1QI5A

Mutant (d294n) maltotetraose-forming exo-amylase in complex with maltotetraose
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
418
structure length
418
Chain Sequence
b'DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHNTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (EXO-MALTOTETRAOHYDROLASE)
publication title Roles of catalytic residues in alpha-amylases as evidenced by the structures of the product-complexed mutants of a maltotetraose-forming amylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
total genus 144
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1999-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qi5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qi5A01
4ZXOA 4HZ8A 2YL6A 4AZ6A 4W7WA 5IHSA 3ZO9A 4D6EA 1E0WA 3CHEA 2D24A 1CXKA 4PUEA 4GO8A 2WYSA 4LGXA 4D1IA 2GSJA 1H2JA 5CGMA 1UQYA 3WD1A 5ABFA 4W88A 3OA5A 3W24A 2NT1A 2CPUA 3PZTA 5FCZA 2IGTA 2VCCA 2E9LA 5FL0A 2JIWA 2XFFA 5FL1A 3ALGA 1RH9A 4OOZA 3PZVA 3WQ6A 4TTUA 2Y4SA 2AAAA 1TG7A 1UA7A 1PAMA 5CQ1A 1CDGA 2WVTA 3EJQA 5DF0A 1HJSA 4PSRA 1JZ2A 1QHPA 2GUYA 3VGEA 3ZQ9A 1UQZA 2X05A 5A8PA 5HBFA 1L0PA 5D8WA 1JYVA 2FHCA 4C7DA 1Q6DA 2DQXA 2YBTA 3MSGA 2V3FA 4QLKA 3PZIA 3N12A 5FKYA 2G3MA 1J0IA 4J3WA 3W26A 3II1A 1R85A 2X0HA 2VRQA 3T2PA 2VMFA 3NYDA 4M81A 3DX2A 1CLXA 3BXWA 3APGA 1MW2A 2E3ZA 2A3CA 5BYWA 3WN6A 1E73M 3D51A 1UZ4A 4YPJA 3LXCA 4RE2A 3A21A 3GXIA 1NP0A 2VJXA 4HOXA 3DX3A 4PTXA 1H49A 1FA2A 3ZJ6A 6TAAA 3AROA 3WD4A 3SCVA 1ISXA 3WIJA 5I23A 2XVPA 2GJPA 3MKKA 1NH6A 1OT2A 2ALWA 3VDAA 3PZNA 3EJTA 1TFVA 3SCSA 2BFGA 2BY0A 1ISZA 2WMJA 4F79A 4CN4A 3WDPP 3BCFA 1W9BM 3ARWA 4HPHA 4NRRA 3QGVA 3WQVA 3VD4A 2JALA 2ZUUA 1V08A 4W93A 4PMNA 2FH8A 1J0YA 4OGZA 2VX5A 5CSYA 1KXHA 1HX0A 5CGTA 3T08A 3IAPA 1ZBCA 1KTBA 3HJEA 1V3LA 3NSMA 1LL6A 2VCBA 1BQCA 4LPCA 3SCOA 1RP8A 3DX4A 3TP4A 2ZUVA 3WY2A 4NXSA 3WDHA 1KGXA 1DWAM 4WF7A 1LL4A 2D0HA 4P7RA 1DWIM 1LWJA 3LRKA 1V3KA 3T0BA 3KLKA 4D6CA 2AOSA 1V3JA 2WANA 2CESA 4H04A 1FHLA 4D6JA 1KWKA 4ML4A 1CLVA 2B31A 3PN8A 3NJ3A 1PZ2A 1VENA 2J7BA 4TUFA 4J3TA 2OSXA 5F7UA 3WD2A 1V3HA 4UFIA 4DM1A 1QI4A 7CGTA 4TXEA 4H41A 2NT0A 4HMEA 4W89A 3VSTA 1HF6A 4ATLA 1JI2A 4JFTA 2XVLA 4DWSC 4D1JA 2GK1B 2ZXBA 3WDQA 1I1WA 3T0DA 5EBAA 2XJ7A 3MANA 2WMFA 1H11A 2O9OA 2ZX5A 6CGTA 1LWHA 2WMGA 4ZFMA 1DWJM 3PZOA 2V5DA 4FF5A 3A5VA 1E3ZA 1E6PA 5ABEA 5E0CA 1UWSA 4UZUA 1RP9A 3S2CA 1CXHA 1UKSA 1TQUA 3OLIA 1OGGA 3AJ7A 3HG3A 1XSKA 3BVXA 3CZJA 5M3WA 2A3BA 3NSNA 3ZSSA 1E40A 1V03A 3S5ZA 1V02E 3K8KA 2QV4A 1H0GA 3ZT5A 2G3NA 4GXPA 4WKFA 3BAYA 2VVSA 3WMSA 3W6MA 4GI9A 2V3GA 4KWUA 3A3HA 1CXEA 4LYRA 4M56A 4KGJA 3ARRA 1G94A 2DH3A 1QNRA 3VD3A 1TR1A 2EPNA 1TQSA 2GK1A 3EBVA 3W28A 4AMCA 2QMJA 4AWEA 1K9TA 3EDEA 4CU7A 3VNZA 5HOSA 3RIKA 4E8DA 3L4VA 4W5ZA 4OKDA 3ARZA 1V3IA 1BPLB 2WKGA 2JFEX 3BUIA 4J3VA 2VQTA 3AS1A 4HA4A 2Z1SA 1JF5A 4FNRA 3DX1A 1P6WA 2YFOA 1CPUA 3WNPA 4HU8A 4GZJA 3WNOA 2GDVA 1W9UA 2J7DA 3VU2A 1OWQA 1E70M 3ECQA 1HIZA 2GFTA 2JE8A 3WH5A 2WMKA 4AYGA 2W5FA 4YHEA 1CGWA 4R27A 5ECUA 1BGAA 4LYPA 3MS8A 5BRPA 3SEPA 2CBIA 2AMGA 1UD6A 2DIEA 1WDQA 3CGTA 4GKLA 1BFNA 2J25A 5EFDA 4Z2LA 1DWHM 3FXYA 4JFSA 4U33A 1EXPA 1ZBWA 2OLHA 2BS9A 3A4AA 2PWGA 5E6ZA 2FDMA 3L4YA 1VEOA 1CIUA 4WJXA 3KL0A 1EDGA 2XN1A 2CERA 3VDHA 1FP9A 3GH4A 2G3IA 1UR1A 4FNUA 1W9DM 4QP0A 1VFUA 1QNOA 2A3AA 4AZBA 5A6MA 1UD5A 3GNOA 4W85A 5BROA 3AYRA 2W4XA 2O9PA 4N0RA 3HG5A 2WC4A 2F7QA 3WF4A 5A95A 3N11A 3L2MA 3L4ZA 2RGMA 2GJRA 3KLLA 2YA0A 2CCRA 2YKKA 1Q6EA 4FK9A 4DWSB 2EAEA 3WY3A 1V0LA 1HL8A 1JZ6A 4AZHA 4H8VA 1UWUA 3TA9A 3GXPA 1GNXA 1JDCA 3AIVA 2YL9A 1J0HA 1PX3A 1HVXA 3BAIA 3VIPA 3VMOA 1Q6GA 2W62A 2OYMA 5I0DA 4A3HA 3SUTA 1VBUA 5TD4A 2UWFA 2WHJA 5I77A 1UH4A 3EJRA 2ZXQA 1GOIA 1R7OA 3N1AA 1GW1A 4DUXA 1QI0A 2XFRA 4MNMA 1VB9A 2C7FA 3OZPA 2CETA 3EJPA 1OB0A 4ACYA 4GQRA 4J3SA 1AVAA 3A4WA 2D20A 2QPUA 2MANA 4BQ4A 3WUFA 4NZCA 3I3EA 4DWSA 1OGSA 1OD8A 2J7EA 3FNDA 4XZBA 3K8LA 4E2OA 5C8BB 5BXRA 4YN5A 4AXNA 4UQDA 3TTQA 3ARVA 3PHAA 3ZR6A 2J7CA 1UWQA 1U33A 1BVZA 3GXFA 1E56A 1E9LA 1HJWA 3WQ4A 1E6XM 5D9MA 1GOKA 1ZU8A 2O92A 2BY2A 2FHFA 2YA2A 3T0AA 1WDRA 1UD3A 1ZS2A 4Z2GA 2ZOXA 1J0JA 3G6LA 2YDRA 3DYPA 5A6BA 1W3HA 2ZICA 3BVVA 4CGTA 1F4HA 3DHUA 4IM4A 2OWCA 3U5UA 1XSJA 3A4XA 1NOUA 5IHRA 2BXZA 3GNRA 1SR0A 4AIOA 4TX6A 2CXGA 1J01A 2WLZA 3LXBA 2X2JA 4FLQA 4DUVA 3W25A 3WEMA 4B3KA 2IXUA 3WD0A 1TA3A 5I79A 3W82A 5A1AA 2EEXA 3MO4A 4WKHA 2JF6A 2YL5A 5AY7A 3BCDA 2XGIA 3TONA 5GNZA 2FHBA 1H4PA 3WSUA 4CN1A 3N15A 4S3JA 2XVNA 2YLAA 4B9ZA 1SZNA 2PB1A 1MYRA 5DEZA 1CENA 4FLSA 2XGBA 1ODZA 5LA0A 1ZJAA 5DMYA 4OOUA 1LQ0A 5E09A 4YHGA 1EO5A 4P8XA 3K8MA 1UYQA 2ZIDA 3VGGA 2EXOA 3F5LA 3WH8A 1UWIA 1E1FA 3UR7A 1J0KA 3N13A 3CZSA 1KXVA 4JL1A 1QI3A 2W92A 1K6AA 3QOKA 3D5HA 1TVPA 1G1YA 3VIKA 1ISYA 4W8AA 3RM9A 2W63A 1E55A 1EOMA 2G4FA 4RE4A 1R33A 4DO6A 4M29A 1XRVA 4MB4A 4F66A 1HKKA 1QHOA 4H8UA 4K68A 4P7OA 2WCSA 1KQYA 1UOKA 1MW1A 4EKJA 4RL3A 3FY1A 1KR0A 2DT1A 2CIPA 5D9PA 4IPNB 3O2LA 1BG9A 2VR4A 4U5IA 2XUCA 1HJXA 3CUJA 2TAAA 1EHAA 5ABGA 1BVNP 1W1VA 2A3HA 3AXIA 1JZ8A 4UQEA 3BLBA 1B3YA 4PMXA 1CWYA 2ZX9A 3VPLA 5I2UA 3CBWA 3RJXA 3RILA 4M24A 3W4RA 1Q6FA 4UCFA 4UFMA 1H1NA 3DECA 4PTVA 2EPMX 5A6AA 5GNYA 1JYNA 4AZGA 5D4YA 1WO2A 2VURA 1R8LA 4PMUA 2PWEA 1GHSA 3ZSTA 3KZSA 1DTUA 2CHOA 4KH2A 3F4VA 3AISA 3WEOA 4D6FA 3VX1A 4LXFA 1UASA 2WKLA 3BUPA 1W3LA 2GJXB 5BRQA 4AZ7A 1E6QM 1V0NA 2X09A 4NXKA 1JYXA 1BTCA 1JZ5A 3ZMRA 1W9XA 3NCOA 5D9NA 3WQ5A 4UFLA 1JD7A 1PBGA 2J47A 5DT7A 4D6DA 5DT5A 4NRSA 3B9AA 3IGUA 3MUAA 1T0OA 1UKTA 3AS0A 4UQAA 3GH7A 2J79A 3VIMA 3LPOA 2F1BA 3UG4A 3WNNA 1XV8A 3SCNA 1V6VA 1IZJA 1GJWA 3ZJ8A 1MQQA 1C8QA 2EJ1A 1E71M 5A8NA 2DGAA 3IANA 2DIJA 3D50A 2XSBA 3BAJA 5E1QA 5FOOA 2WPGA 2V5CA 1B31A 1CGYA 4MNKA 1M53A 3W0KA 1QWUA 4U31A 2GJXA 4GZIA 2ZUNA 1X6LA 1E6RA 1NOWA 4JAWA 3F5JA 2FGZA 1WE5A 3BSGA 1WNOA 3CC1A 5FD0A 3AMCA 2OWWA 3VTRA 1EH9A 1UZ1A 8A3HA 4H8HA 3QHOA 4DWSD 1HP4A 2EO7A 4AYSA 3ARTA 1VF8A 5E9AA 3WNMA 1WKYA 3CUFA 2DT2A 3BUBA 1HT6A 2E9BA 4ATDA 1R7AA 5A8QA 2FYVA 5BXTA 2CITA 1C93A 1KGUA 3I3DA 4GO9A 2VRJA 3N04A 4TVDA 4HA3A 3NDZA 1JF6A 1OSEA 1QNSA 2Y2WA 1AMYA 1GORA 1PPIA 3MV01 1UR0A 1GOQA 1JNDA 1W3KA 1R75A 4HZ7A 3OLGA 4AEFA 5A6BD 3CUIA 2J8GA 2WSPA 4J28A 5A2AA 3VIGA 1QWNA 1ZJBA 1WDSA 3EMQA 2WWDA 1S46A 4KMQA 1LF1A 3AFBA 2XTKA 1QVBA 3PTKA 2Q8XA 4AIEA 4JL2A 1FH9A 3AIWA 1MQPA 2J77A 1CGTA 3LXAA 1KFWA 1W2PA 3SCUA 4JIEA 2EPKX 2IUZA 1V3MA 2F2HA 4JFUA 1CXFA 2ZUTA 3J7HA 4P7NA 2VNCA 7A3HA 2D0FA 2O9TA 2BHUA 2PWFA 2EQDA 2XIBA 1JDDA 3NDYA 1B0IA 1QI5A 4JHOA 2UY3A 4XV0A 1B2YA 4CCDA 4V27A 1SMAA 4C7GA 3BVWA 1HTYA 3PTMA 4UTFA 1OCQA 4QCEA 3E1F1 1ISWA 1QW9A 2F7PA 1J18A 3PZUA 4B3LA 4AD1A 2DEPA 3K46A 1WZAA 5EMYA 2WHLA 3RCNA 2WB5A 2VX4A 3AQUA 3OGVA 2D0GA 2PBGA 4UQ9A 4S3KA 1CTNA 2CHNA 1JGIA 4MJ2A 5HPCA 2RGLA 1E0XA 4D72A 2Y8KA 3RPMA 3AHXA 3HMCA 3BAWA 3CO4A 3WH9A 4X9YA 3ARSA 3H53A 4HMCA 1EGZA 1NM9A 3VIJA 3A6OA 4QLJA 5A8MA 2WMHA 1ESWA 3UCQA 4TTGA 1JD9A 1C7TA 5I6SA 3GM8A 4CD8A 1V0MA 4MB3A 1E43A 1GZJA 2DSWA 3AIUA 1GUVA 4GI6A 1D3CA 4J3UA 1W32A 1C92A 3CZEA 2VO5A 4P7QA 4PUDA 2DT0A 3MMWA 1JXJA 3SUVA 2DSZA 3N18A 5JIWA 1XH2A 2XN2A 1B9ZA 1PIGA 4XUYA 5M17A 1XH0A 2G41A 1FFRA 3OG2A 4CU8A 4UNIA 3PTQA 4AD0A 2WZEA 2NSXA 3THDA 1YHTA 3UETA 1BYCA 4W7VA 4IUGA 5KZ6A 2J7GA 1BLIA 5DFAA 1G5AA 1KXTA 4UFKA 2BHYA 2E9MA 1R86A 1ITXA 1OIMA 3DC0A 4CUCA 1HNYA 1NWRA 2C0HA 3WQWA 3N9KA 2X8RA 4M8UA 2OWXA 4NF7A 1A47A 2WMIB 3WF0A 3VMNA 6A3HA 4KRTA 1B30A 1R47A 3SCWA 2CKSA 2W61A 5BXSA 3WNLA 3UG3A 2E40A 3VD5A 1W91A 5BWFA 1GVYA 1H3GA 3VD9A 3OB8A 4AZIA 1UKOA 1WZKA 1LLOA 1QNQA 3K4AA 2W91A 4J27A 3WD3A 4Q22A 1CEOA 3SCPA 4EK7A 4L4PA 5HXMA 2OW6A 1BYDA 1J9YA 1GCYA 3MV11 3ZJ7A 4CU6A 3CPUA 1E72M 2J78A 2D23A 2F7RA 3LPGA 4MPKA 4UZSA 1R87A 2EPLX 3WUBA 2WC7A 4NI3A 4WK9A 2JEQA 4QDMA 3SIMA 2VZUA 3CTTA 2XG9A 1V6WA 1DHKA 4GINA 2WVVB 2PC8A 3D52A 1W1TA 3KWXA 3L4UA 1VFMA 2WMIA 2E0PA 5LYRA 4AIUA 3AS2A 1G01A 1Y7VA 1M04A 4FNPA 3NIYA 1I1XA 1C90A 2DDXA 4OBRA 1Q4NX 2PI6A 1AQHA 2F7OA 3U7VA 3AHZA 3AIRA 1VEMA 2A3EA 1V6UA 1HN1A 1KR1A 3WMCA 1NP2A 2BVTA 3BUDA 1WPCA 2JEPA 3WF1A 4MJ4A 2CYGA 3U7BA 3HG4A 4PMRA 3BVTA 3POCA 1EOKA 1HWWA 2WWCA 4M80A 5BXPA 1XH1A 2BY3A 4UOQA 4NX0A 3AYSA 4NZFA 1FOBA 1QI2A 3FN9A 2X1IA 4KGLA 4JFWA 1Q6CA 1CBGA 2D2OA 2QLYA 2W66A 1JDAA 3CUHA 4V2XA 4OBSA 4UOZA 3RO8A 4CKQA 2EABA 2ZUSA 5HDRA 3MSDA 1RD6A 2WVVA 5JBEA 3PBGA 2FGLA 5ABHA 4FLOA 3BSHA 4MDOA 2ZXAA 3OLEA 1OBAA 2WCGA 5A69A 4JCLA 5JBFA 4H2CA 2EBNA 3MUZ1 4F9DA 2V3EA 2XN0A 3A47A 3UG5A 2YLLA 3RJYA 4MNLA 4AZCB 2XSAA 2WW5A 1JZ4A 3OZOA 2X2IA 1J10A 2WZIA 2VX7A 2QPSA 3BAXA 5C71A 4AD5A 3FAWA 3LPFA 1UR2A 1X6NA 3WY1A 2VT0A 4W8BA 2YFNA 4EAMA 3ZT7A 1FP8A 3BVUA 1GQIA 3AIQA 2ZXDA 3VNYA 3ALFA 4QCFA 2VUYA 1KGWA 4GI8A 3D3AA 4CD5A 2WZHA 2VOTA 1V02A 2WC3A 1B3ZA 1UD8A 4GPNA 1XYFA 3CV5A 1HVQA 4PMVA 3BC9A 3B9EA 3S5YA 2QF8A 1XCXA 5AYBA 2G3JA 2YA1A 5A6LA 2J8FA 4BQ3A 1E4LA 1W9PA 4AMWA 1US3A 3FW6A 5HPOA 1B3VA 1A3HA 1QX1A 3DX0A 3AXXA 3T09A 3CZLA 2E4TA 3IAQA 1R34A 4BA0A 2DPEA 1J12A 2D3NA 4TOQA 4AZCA 1JAKA 1JAEA 4CD6A 3SCRA 2J7FA 1EA9C 2X2YA 4H7VA 2OYKA 1QHZA 2DT3A 2GDUA 2WVUA 2X2HA 2PBOA 4QAWA 3BLPX 3KL3A 4Y7EA 4WSKA 4C7FA 4U2YA 3CZGA 4DUWA 2UY4A 1KTCA 1E4MM 2O9RA 4HOZA 4ZEPA 5CXPA 5A6JA 3SCTA 4ACZB 1E3XA 1QBAA 3W29A 3VKKA 3VGFA 5E0FA 4P7LA 4PMQA 2D1ZA 4GZEA 4W7UA 4Z2KA 4D71A 5EFFA 5LA2A 1UH3A 2PF0A 1TVNA 2BVYA 2CBJA 4W8LA 4JFVA 3PZMA 5JBDA 4W84A 1CGXA 4AISA 1Z32X 2WXDM 1LL7A 1UR8A 1VAHA 5I5RA 3JUGA 4AD4A 2XYLA 4HPGA 3VVGA 3B8SA 3QHNA 2XHYA 4M82A 1US2A 1W1YA 3IJ9A 4PMZA 3AMKA 4WKAA 1IZKA 3WH7A 4ZE5A 2BV9A 1OINA 2ZUWA 3TTSA 3VIIA 2VZOA 1PEZA 3GXDA 4PCSA 2WK2A 4OJYA 3L4TA 3AHTA 4FLRA 1XGZA 3SURA 1SYTA 2CBVA 1UWRA 1H5VA 4ZENA 4W5UA 2XWDA 1C8YA 3NUKA 1KCLA 1IV8A 3QR3A 1HP5A 2ZX6A 1H0IA 3SCQA 1ISVA 4JZ5A 5A8OA 3IJ7A 2J62A 4ATWA 1BHGA 4BQ5A 4D6HA 1DWGM 2UY2A 3ZR5A 5GQBA 1N82A 3OGRA 3VDCA 4PTWA 1XD0A 4Q7NA 5A2BA 3EMCA 3BMVA 5CPSA 4BS0A 3U57A 5D9OA 4PMYA 4X0NA 3AMDA 3VX0A 5CLTA 5HNNA 3VIHA 3BH4A 4DO4A 3EJSA 1GQKA 2ZX7A 4XZWA 1RPKA 3GBDA 4CCCA 3RM8A 3W53A 2C8NA 1CNVA 1C8XA 5IDIA 3WF2A 1JNEA 3AMLA 1GOOA 1TCMA 3F5KA 1ECEA 1PX8A 1E6ZA 1BAGA 4V28A 3LX9A 3ZOAA 2ZWYA 2ZWZA 3WDRA 3LRLA 3AIBA 3UR8A 3ARYA 2ZE0A 3WENA 1KXQA 2D22A 2EPOA 2VZSA 1ODUA 2FH6A 4W86A 1E4NA 4LX4A 5I24A 2YL8A 2Y8VA 5A94A 3WELA 1KBBA 3CZNA 1UUQA 3DYMA 5DO8A 1LG1A 3AZTA 3ZT6A 3THCA 4FNTA 3M46A 4U2ZA 2VL4A 3I3BA 2VTFA 5E6YA 2ESCA 1ZB5A 3VIFA 2D73A 1C91A 3SUSA 1WDPA 3GXTA 2DH2A 3CIVA 3S6TA 4TX8A 5FIPA 4JCMA 3AOFA 1NWSA 4BCEA 2EACA 3RMEA 1C7SA 3CLWA 3DHPA 3EDDA 1VBRA 3GZAA 3KEHA 1E5JA 3W81A 1F4AA 1M01A 1J11A 3T2QA 4QLLA 1JI1A 1NWTA 2V3DA 3CHFA 3MI6A 1GVIA 1E1EA 3GXMA 2XWEA 2PWDA 3AZRA 1UH2A 3HZ3A 2WBKA 4BF7A 4MB1A 3RM4A 1DEDA 3EDKA 5A3HA 1MQRA 3AZSA 1XHGA 2BHZA 2HISA 1OIFA 2F18A 3VILA 1LJYA 3GBEA 4F9JA 3WEZA 3MMUA 4JHZA 1KCKA 1VFOA 3IJ8A 1EQCA 1U30A 1EQPA 3HU7A 5IFTA 1ZBVA 1GPFA 2E8YA 3WDJA 1UD2A 2FE0A 3O6AA 1XCWA 4MDPA 3TV8A 1TMQA 4DO5A 3WY4A 1G0CA 1HJQA 3AS3A 1K9DA 3UERA 1HL9A 1EIBA 1NARA 1E6SM 4E4PA 3WFLA 3AICA 4R5EA 1M03A 9CGTA 2V38A 1WZLA 2VZTA 3POHA 3WMBA 2XIIA 4PBGA 4P8VA 2DSVA 1E5NA 5D8ZA 1ZBKA 2VC9A 1X1NA 1H41A 2WVSA 4GQQA 5JUVA 3H54A 4PN2A 3DDFA 1GJUA 1DP0A 1WAWA 3MU7A 3VSUA 3BLKA 3MUIA 4QFUA 1VJSA 5CLWA 3W37A 4TVUA 3AIEA 3GYCA 4J7RA 4OZOA 5CPTA 1H09A 2YJQA 2E8ZA 1W3JA 3WFZA 3B9DA 1K9EA 3VDBA 2D3LA 3N17A 3NSXA 1ZL1A 5IXEA 2VCAA 1QOXA 1BYBA 1HJUA 2WHMA 2YDSA 2J4GA 1AQMA 1D7FA 3EYPA 3SUWA 1UHVA 4AY1A 4BZYA 3WBEA 3CUGA 4ZE4A 1PIFA 4P8WA 4FMVA 3WUEA 4NSBA 3LMYA 4URIA 2YBUA 2YOCA 2XVKA 4WSJA 4CCEA 4JKMA 1KBKA 1PS3A 3VSVA 3WDIA 3CZ8A 5CZKA 4AMXA 1FH8A 1UR4A 1L8NA 5C70A 4MB5A 3OBAA 1BG4A 4UFJA 3WQ8A 1W2VA 1QNPA 1UG6A 3WL1A 2YDQA 1E4IA 1CGVA 4GIAA 1KB3A 1NWUA 5CSUA 1VJZA 2WSKA 4OUEA 3T2OA 1CXLA 4N42A 4Z2HA 3K4DA 3VGHA 4HA1A 2F8QA 2UY5A 5JIPA 4WIWA 3A23A 2VI0A 5GNXA 1JZ7A 3VO0A 5A2CA 4JKKA 3ARXA 3ZIZA 4CD7A 3G6MA 1KQZA 3CHCA 1GHRA 1HKMA 1YQ2A 3HN3A 3AHVA 1GOWA 3L4XA 2WCAA 1JZ3A 4AZ5A 2BY1A 1TQVA 2VX6A 3TOPA 1VIWA 1J0ZA 5GPRA 2JF7A 4UQCA 5KEZA 3OLDA 4JKLA 1OM0A 5M03A 2Y24A 3A24A 3SUUA 1MVYA 4M1RA 1FFQA 1EDTA 5EB8A 4AD3A 3KE0A 4A3YA 3VUPA 1DWFM 2Y5EA 1C3FA 4U5KA 2J75A 3PZ9A 1O7DC 3KL5A 3OIHA 4LQ1A 1JFHA 3RDKA 1M7XA 4B15A 1MFUA 3BMWA 4D6GA 3L2LA 2WBGA 1JL8A 1FH7A 4IISA 4AW7A 1ITCA 3WF3A 3BAKA 2Z1KA 3CMGA 1WP6A 4CVWA 3VM5A 2OSYA 4B16A 3AXHA 1B3WA 1UD4A 1HKJA 3AHYA 4F8XA 2BXYA 1BYAA 3W6LA 1CGUA 1EDQA 1WB0A 2CNCA 2J74A 1XSIA 1PJ9A 3K1DA 4W87A 2WNWA 3GXNA 5AC4A 1UKPA 1G9HA 3WBAA 5CPQA 3BUQA 2OSWA 5AYIA 3UEQA 2QMKA 3GTNA 4UQBA 1B90A 5BCAA 1B1YA 1AQ0A 1QPKA 4HU0A 3FHQA 3VGBA 2GVYA 1MW0A 1UA3A 2XM1A 1R46A 4HTYA 1MW3A 4A4AA 3EDJA 5I78A 1B3XA 5LA1A 4U3AA 3WKZA 3H55A 1SFSA 1TE1A 4AD2A 3M7SA 4MTVA 1MXDA 1GQLA 4EANA 1GONA 4IPLA 4AEEA 4HP5A 1VFFA 4Z2JA 5A6KA 1HXJA 5CG0A 3GH5A 4D6IA 2YIHA 2XFYA 3VD7A 2VQUA 1BGGA 3MMDA 2CBUA 3D4ZA 1CECA 1JYWA 4EE9A 4CVUA 1TA3B 1K9FA 1O7AA 1XD1A 3VM7A 3ARPA 2VVNA 4AC1X 4HZ6A 1WZMA 3GNPA 3ZM8A 1OT1A 1VRXA 3MUY1 1GQJA 5I3DA 3ZJKA 2G8ZA 3U5YA 2QHAA 2HVMA 2F1AA 4J3XA 1W1PA 4LYQA 1UWTA 3EMZA 3EDFA 3AI0A 2DSUA 4MAVA 3WL0A 3VINA 1V6XA 3PZGA 4RE3A 5A6SA 3DYOA 3WH6A 4MADA 1HKIA 1U2YA 3LRMA 1WCGA 2ZX8A 3OGSA 4ZXLA 1SMDA 2PWHA 3CHDA 3PZQA 4PTMA 4TVCA 5AC5A 3O9NA 1PZ3A 3VGDA 1XYZA 3HG2A 2WLYA 1JIBA 4PYSA 2J7HA 2IXVA 3WNKA 4KRUA 4PRWA 4PCTA 4CD4A 3QOMA 1FHDA 2WAGA 3D4YA 1JXKA 8CGTA 2WM0A 4MNJA 4Z2IA 4B9YA 2W67A 4DM2A 1I75A 1E0VA 3CH9A 1MXGA 1D2KA 1NOFA 1W9VA 5E70A 1O6IA 3M07A 4XX6A 5M5DA 2OW7A 3QHMA 1VEPA 3WUGA 1MWOA 1EO7A 1E15A 2XPKA 3EJUA 3L4WA 4MAZA 4OIFA 3UESA 3A22A 1NQ6A 3IK2A 2OYLA 3GDBA 1UKQA 4E8CA 2EADA 1V0KA 3BGAA 2BNJA 2XM2A 2CKRA 4X0VA 2ZUMA 1CZ1A 3AMGA 1XC6A 3TTYA 1EHNA 3TTOA 1E6NA 1OGBA 2JIEA 4P8UA 3W27A 1LG2A 1CXIA 1KWGA 2CEQA 3ARQA 1TUXA 3VOCA 3W38A 4PMOA 3CMJA 4NZJA 4PSPA 1V6YA 4ACZA 3VIOA 5ABFB 1GOMA 2NW0A 2X0YA 1BF2A 2VZVA 2DSKA 2BVDA 1JFXA 4PMDA 5IFPA 5CJ5A 1QW8A 4L4OA 4UOJA 4FNQA 4U3CA 1PX4A 4BQ2A 2F61A 4XB3A 3FHAA 4HOWA 1TZ7A 4WLCA 2XVGA 3LPPA 7TAAA 4UFHA 3DDGA 4CN6A 1QBBA 1IT0A 1HXKA 1MFVA 2VR5A 3FAXA 3M6DA 2VRKA 3CZKA 2WHKA 4PEEA 4FNSA 1BSIA 1TQTA 1HJVA 4UR9A 1CYGA 3ARUA 1TQWA 1UR9A 1JG9A 1OD0A 4HMDA 3VMPA
chains in the Genus database with same CATH superfamily
1E0WA 3N6YA 1O12A 4WQ6A 4J8RB 4MJ5A 1X44A 4A6YA 2OM5A 3VOGA 2FMNA 3T4CA 1QSEE 3OA5A 4BJHA 4JRYD 3W6YA 4OTXH 4OLVH 1FWSA 5LNGA 2JIWA 1RH9A 2AEWA 4Z95L 3RMJA 3APMA 5HUOA 3FCSB 4XC1L 3KLQA 3NSJA 3UYPB 3VG0H 3DUUA 5I1LA 3FUNA 1HJSA 5GGTL 3QCVL 4PSRA 4AWUA 3H42H 4D8ZA 4DN3L 2ITFA 5AVXB 5D2NB 1I8LC 1BBDH 4FYQA 5HBFA 3MJYA 2ZG3A 4Z7VA 2XETA 2YBTA 5C7ZA 2I60H 4DLFA 1EGMA 4X8XA 5D7JD 4M81A 5HHVH 2QSCL 2FO4B 3TNOA 4JOMA 3PGDA 3D51A 4RCAA 4UR7A 1TEYA 1UZ4A 3FB7A 2R1KA 4O0ZA 3GIQA 4GAAA 4DW2L 3R7MA 3ZVIA 4XVSH 4HZ1A 2DM3A 2K1MA 2N7BA 4AU0A 4NP4H 5KOMC 1G7UA 3SDCC 1TFVA 1EA0A 2BFGA 3F4NA 3PJLA 1BZ9A 3NPVA 2H6PA 4QS6A 3PQYB 4ZX5A 4ZFFB 2ICEA 1CGSL 3SYOA 4PMNA 3C5XA 1XWVA 3BVNA 4N2FA 3QJZA 1FYTB 2H0PA 1HX0A 3K4WA 2X2UA 4QOKE 1S38A 5HGDA 4K0OA 3DRTB 1DWIM 3S5LG 1ZEAL 4OZHB 1UT2A 1KN4H 4HETA 2AL2B 4D6JA 4H20L 4ODHH 5K9KA 2OSXA 3OKEB 3USBA 2CLLA 3H2CA 2PWVA 3VI4B 3QUYA 5BJTA 2BERA 4LOVA 1BIHA 3VXTA 6CGTA 5LCVH 2WMGA 4JEQA 3GD6A 5EUOF 3G5YB 5E0CA 2GW5A 1UWSA 2CK0H 3SKMA 4HWEH 1VCBC 3WLIA 4HB7A 1YMYA 1N3NA 2FJFB 2XFGB 4QHKI 3Q01A 1Z5YD 2QV4A 4GXPA 3NIDE 2O7SA 1JN6A 4UT6L 3HNSH 1TQJA 4KKBD 3ROLA 1K4HA 1N55A 3VD3A 1EC7A 5KZDA 3O6CA 1X5YA 1VS1A 1FCQA 5IM7A 4X5LA 4M3PA 4EI5A 2FWSA 3NTCH 3T1WA 3KVDD 2B59A 5TDOA 1CF1A 4X7CC 3OXRB 3PWJA 1YX1A 3ZHKA 2PDXA 2EDRA 5ITFA 5AC6A 1P0SE 4YNYB 3NL2A 3MCOA 1WQ5A 5A43C 1ZWIA 3G5VA 2MCMA 1A3XA 1YEDA 2BSTA 4GKLA 1E9PB 5PCYA 1SFHA 5DURD 4WOQA 1HYRC 5C0GA 1TQCC 3MRFB 4REQB 4WRLA 4Q8OA 3VRLF 3BJLA 4I90A 1VEOA 4F7TB 1CIUA 3RHWF 2IBZY 3KL0A 2QSQA 2P44B 1Z9SB 2P8LB 2B5IB 2PCXA 5HYSB 3UACA 5GJSL 3T1FB 2CHZA 2W9DH 5H8DA 2O9PA 1D9KD 2AQNA 4DT2A 2YKKA 3F12B 1MJ8L 5EIIA 3V9FA 2EG8A 2PGRA 4L2YA 4LLAA 3WY3A 2I7GA 1HL8A 4A2HA 2A74C 1Q72H 3O11B 3GXPA 1JRHI 1CURA 3KWSA 2LVEA 4ZFZB 5JIKA 2YL9A 2CIIA 3VIPA 2NVDA 2N56A 5DCCA 3X3GL 4A3HA 3ZE2E 4NDMA 2QCCA 2PR4H 5AYYA 4GXUN 1XPYA 2SEBB 5IZ7A 4U05A 4Q8BA 4LSRL 1AQKL 2QPUA 1BZEA 3DX5A 5EIQA 3ZX1A 3K8LA 2DVTA 3V8CA 1E9LA 1UR3M 1E6XM 5FA3B 3MUJA 2WO2B 4N2NA 4HIXH 3T0AA 3NQ2A 3W2DH 4GMEA 2IV9A 4F57H 3QIBC 3PBVA 5JIDA 2C3XA 1F4HA 1FNSH 1YY8A 2YAMA 3KGTA 2OLSA 2CXGA 4YLCA 1W2KT 4FQPA 3VXNA 2ZG2A 2X2JA 4BFBD 4OM0H 2PYEE 3CIAA 4IRSC 3FO1A 5A1AA 3ARDD 1FBAA 3D39B 4N8VB 4F8PA 2YKLL 4AIZB 3KHQA 2ZCKH 2P7TA 4XZ9A 4ZXBD 1OD9A 3RJQB 5DEZA 2CFFA 4HSNA 2QHRH 3GHTA 3BG9A 5DMYA 3L9YA 4RBPH 4YVVA 3U7WL 3R43A 4FFVC 4GCXA 1WXJA 1TVPA 2E9WA 1OX4B 2Q02A 2JNZA 3K5RA 4Q7DA 1LOLA 4EUPA 3ZL1A 2HTLD 5D4HA 1KDIA 2R7EB 1XRVA 4PA8A 2CRYA 2NVCA 2X12A 4LCIH 4B9GA 2HT4C 2R14A 3ALXA 5D9PA 5IIEA 3NEEA 3NAAL 5DMMA 4WJKB 1J8HA 1HJXA 4GRLD 4IFOA 1XO8A 5GISL 4ZMTA 5D1QB 4DETA 3G1VA 1KYOJ 1TZAA 4MAUH 4IFKB 4CL7A 4U7KA 2Y07L 4LNRA 5AYZA 3W4RA 1O68A 1ZSHA 3DECA 4N0UB 4ZUUB 1ES0A 3AG2B 4W6XB 2YQGA 1H0DB 3U46A 1JOIA 4PUMA 4X22A 2CHOA 3K0YA 3F4VA 2RB8A 1UASA 3CHQA 3A9IA 3HC4L 3BUPA 3IFPA 1Z9AA 4YFLI 3WSQL 4AZ7A 3NCFB 5XIMA 1X5JA 5D7KE 2GTWB 4AQEA 3SD2A 5I19L 3C8FA 6PCYA 5AYUL 4NRSA 4JW3A 3TVMC 4J8RA 2MQCA 3EUUA 1UKTA 1MRFL 4GMSH 4B91A 4ZW7A 1FCBA 4NUQA 1TCRA 4HAFA 2ITEA 1ZLEA 15C8H 4XO3A 1Z9OA 2WY3B 3FOMA 2BNQD 4ABWA 5BV7H 3FCSA 3VXUD 1AHWB 2FLRT 1QWUA 1UENA 4PJDB 5CZTA 1MIMH 4LP4A 5D2VA 3MZNA 2WLLB 4PMFA 2ZCHH 5LGXA 1JCXA 5DMGC 4TUUA 4ATDA 2NR6A 1LWIA 3LCWA 3M7WA 1F13A 4TVDA 5D6CB 5AHFA 4PJ7F 3TJXA 5B22A 1KO0A 1JNDA 2NXIA 1BFVL 1ZT1A 2Z35A 3VFNA 1ZJBA 2X4OB 2R51A 4N2HA 3DO3A 2OT0A 2XTKA 2IAAC 4XG1A 3FH8A 3CB8A 4TLUA 4LW7A 3RVTC 3LERA 2O9TA 1TQXA 5G4WA 4PL1A 1IB5A 5T1MA 3US9A 2NDGA 3KRBA 1WISA 4HD5A 1LE5B 1MEIA 3WU1A 4ELMF 4LH8A 5EMYA 5D7LA 1PFOA 1RVFH 1G4PA 3K30A 1XT5A 2AV1A 1IT7A 4XMWA 2RGLA 5L9FA 2FJHB 4IGBB 3RVWD 2AL2A 1AD0B 3VFGL 1MI3A 4QS5A 4NKOB 3BTNA 1ZA6A 3KLHC 3OAZK 4I9MA 1SSDA 1GRWA 3EPMA 1XIIA 2JK2A 4B0MB 3JTSA 4DXXA 1GUVA 4C91A 2H5UA 1Y0EA 4G6AC 2J44A 3FU0A 2F68X 2GGIA 1PGRB 3VA6A 2PP3A 3BPOC 3G5YA 3ANUA 4S1SL 1II4E 2R69L 2FJFA 1WX0A 2BZNA 3E6FA 3NSCA 4GG8B 3CVIH 1EFXA 3O8XD 2E9MA 3MJ9H 3VZZA 3FUMA 4AHPA 4J3OG 2NY0C 4MDIA 4Z7OE 4X8JB 4XX1E 1FL3B 4WEVX 5KVEE 1Q9LB 4HIJB 5DD3L 4KFPA 1XH3A 1NLBH 3NQFA 2TSYA 1BEYL 4PGDB 7XIMA 3FFSA 3HG1D 4F7PB 3QDJD 1INEL 4KJYB 4P49A 1LLOA 5IVXB 2QDDA 4DAGL 8FABB 4XCEB 3QDAA 2DIKA 3CH1B 3ARGC 2D23A 2WC7A 5F1NA 1COBA 1P7QA 1EIXA 4IK6A 4S1QL 4BEUA 3C87A 2BVWA 2D8KA 4OCRH 1VFMA 4GW4A 5BMWA 4REQA 3ILPA 4BFOA 3NIYA 1GGYA 1C90A 3OG6B 3TH2T 3PJNA 4RX0A 5DVNA 3S37H 3NAVA 3ZLQC 5MKGB 1X5LA 4DP7X 1B54A 1GGOA 1NLDL 1ZAJA 2OMTA 1EBGA 3GFYA 1VKXA 1EHXA 3CUHA 3SDOA 3MUGA 4BBWA 5EZJA 1RD6A 4PVLA 4JFQB 2Y72A 4ODSH 5IHBA 1OQOA 3CK5A 4C59B 1DQML 3O4LB 3IGSA 2Q2EB 3OQ8A 5C0BB 1HUVA 1E6JH 6FABH 2XSAA 4GGBA 3NO3A 1HZHH 3LI1A 3LPFA 1X6NA 2H0JA 3WY1A 4N28A 3LLDA 2JKIS 2IH1B 4RAHA 5EV7A 1JHLL 2XUWA 3MGTA 4YXHL 4UWMA 4J12A 4NM4L 3UDWC 4A8IA 1KCSL 2PDJA 3HI5L 2QUVA 2J9XA 4Y96A 4NRYB 3O6KH 2Q10A 5AB3A 3HVNA 1A4BA 4F8OA 2V5JA 2X4SA 4PH6A 1A2YA 1QVOB 1JAEA 4KZCA 2OMAA 1YN7A 3EWYA 3DERA 2UY4A 5GS1B 1E4MM 3RUGB 2WQAA 2WJZA 4QNEA 5E5MA 1EC8A 5ESQB 2GJNA 2LLGA 4PMQA 4NYLA 4D3CL 3VVVA 2BSSB 4HNNA 3ZDZB 1MLCA 3CCHB 4MYWB 4JAMA 3RPIB 1I1AC 3SYPA 1Z32X 3EGDA 1LL7A 1NUGA 4OM1H 2OZTA 3VAEA 5L2KB 3B8SA 4GACA 4J40A 1E9IA 3QSRA 1IZKA 2J27A 3WBXA 3U9UA 2Q8BL 4C57C 1RV8A 2NY5L 3M88A 5DO2D 2J5LB 2XWDA 2CZEA 5FXCH 4QGYA 3QQ4A 4Y2DC 4JM0A 5DVPA 3DNKA 4PRID 5A6TC 3W2MA 4KKQA 2Z6JA 1LRTA 3VI2A 2A2IA 5FYKU 4Z7NB 1KB5A 4R6UA 1CNVA 1UA6H 4E9SA 2OO6A 4XOBA 3GBNL 1KBGL 5EHFA 2ILLA 4OZHF 1O9VA 1YPFA 4WNSA 3SFWA 4UTMA 5CHNB 3MX0B 4XD3A 3LNGA 5IROD 4O4YH 4ZUUA 4RW3A 4G70B 1FPTL 2DRUA 4X7EC 3W11D 2CLOA 4KVNL 4NJAL 4ODVH 2HTMA 4XH2A 3VI4F 3RJOA 1ZB5A 3E5BA 3VIFA 2Y9RT 3L67A 2Z2AA 2D73A 3AU0A 1KGCE 2BJML 1EL3A 3S6TA 2GTWA 5JIIA 4BRVA 4TSAL 4JQIH 2XT1B 3EDDA 3W81A 1JGVL 2EVGA 3MLUL 3PUDA 1ZGLM 3E6HA 1MJJB 2ROYA 4JO3L 3HC0A 1E1EA 5I1DA 4KVPA 3CEPA 3QNZB 1B6DA 2V67A 3BWSA 3IGAB 1A9BB 2POZA 3CU2A 2ZVRA 1AGCB 4LZKA 4ZTOH 4JHZA 4IJCA 4LVAA 3GO1H 3S3CB 4J1OA 4J1UB 2LTQB 3PPCA 4MDPA 3TV8A 3L1OH 4OB5L 2BWIA 4KFMA 4NN7B 4LEQA 2XKUA 3DSNA 3PREA 2A6DB 3QUMA 2UZXA 4G6KH 5BS0D 3BG3A 3PB0A 2VAAA 2P47B 3TA3A 1WAAA 1E4XL 5B39A 4IK7A 1QFPA 3WK2A 3IFOA 2BVUA 3WFBH 3GBML 3F01A 3S3BB 2L7UA 1KFEA 2NV1A 4EI6B 1FWXA 3SRHA 4B95C 3W37A 4XXCA 3UPAA 5CPTA 3LMJL 5EO9B 3V1PA 5J13C 2J4WL 4NNXA 4R7NA 3GSWA 5GJTH 3QK0A 1BYBA 4YO0A 2DQCL 2IMNA 1NDMB 1FYHB 3CHXA 3TCXA 1BXUA 5JLZA 2O7QA 1USZA 3K4ZA 3WJWA 4URIA 2QVNA 4DKEH 4FOKA 1IARB 1MCKA 4PV8B 4JNZA 1AH3A 4E41B 4ZW5A 4UTTC 3OBAA 5HHOE 3WQ8A 3GI8L 2HJFB 4ONFH 3GSOB 3IDYB 3C6LD 4ADGA 3QXBA 4BFGA 2AK1H 1T66D 1EZWA 3FQYA 1BQHA 4JKKA 2VEMA 4RX4D 1RJYA 1GHRA 4P9HH 3LHYA 3K2GA 3K1KC 1M4KA 4P8QA 1U8OA 3V6FB 1OM9A 2WTRA 2KPNA 2F5BH 3LIZL 5DUPH 4OQTH 1PZ5A 3BRGC 3EO9L 3HUJE 3A24A 3SUUA 3AREB 5T3ZH 1RLBA 4LMQE 4PJHB 4U1GC 1UWEH 4U5KA 4DI9A 2HFEB 3HZVA 1RXOB 4IISA 2YQ3A 1S3KL 1MHEA 5IESL 4IS6B 1WP6A 4LL4A 2ZYFA 3P0GB 4CVWA 2OSYA 3PAVA 3AW5A 2AEQL 4F7PA 2MCG1 2C9VA 1CGUA 2BCKA 1TTCA 1ICSA 4OCSL 2CAKA 2VXQA 1QD0A 1AZ2A 4KJQD 5XIAA 8FABA 4XCEA 2QADD 4O02B 4L23A 4MA1C 5A5WA 1NCTA 2QEZA 1MCPL 3EXTA 3APYA 1R46A 1E0UA 4HTYA 3D05A 4KKRA 3H0TB 4L4VE 5DX7A 5L6YL 3MHFA 3MLTB 4P5UA 3KYNA 4JY5L 1MXDA 3BGMB 3N43B 1KIRB 1U3YA 1XM3A 3SKOB 3KYKL 2HJPA 3NM3A 2EH8L 4PB9L 3NZSA 2DWYA 4YQXH 2WQWA 3MRJA 4JLRB 4AC1X 1KJMB 3EF4A 4EN3D 2EG6A 3K72A 2EDFA 3Q6GH 3SO5A 4JFQA 3KZ8A 1OF0A 4BZ1L 4TPRL 1GZHC 5A6SA 4JHMA 4FZ8H 2GWGA 1RMFH 1V8HA 5AKTA 3UAJC 3MRRB 2XPZA 4KIRA 3TM6A 3CHDA 3IUDA 3I6GA 3ATBA 1QXLA 1JIBA 3LMZA 1UEYA 3GTXA 3E8VA 1S9VB 1INQB 1JHTB 1I75A 3SZ6A 2H3BA 1YDPA 2PMQA 4JANA 3M44A 4DJMA 1FRBA 4OKVB 3LBMA 3M07A 5AW6B 4IIQC 2Q3OA 4ZS7L 4YWGH 3C6CA 2XPKA 2HMID 4WKXA 1GTHA 4L2LA 3NJIA 2YUVA 4JFXA 4KC3B 5H91A 3VSQA 1E6NA 1KN2L 1JZJA 4P8UA 3MCKA 2H3NB 5GS1A 5JQ9A 2X0VA 1YCSA 1UUSA 4KMTH 4RGNB 5BRZE 3VIOA 3QJUB 5IW3A 2VLJB 1DVSA 1TKWB 4PMDA 4PJDF 1B4JH 4PRHB 2ZZ7A 4BQ2A 3I6RA 2XVGA 7TAAA 1SQ7A 3LN9A 3UZEA 5ALBH 2WSRA 1PL9A 1BSIA 1RLCL 3NPSC 3S6DA 3KCJA 3BWAA 4Y5YB 1OAXH 4P9MH 1LLAA 1UXWB 4W81A 4PW9A 5D38A 2Q20A 1CK0L 1D5ZA 4IOFD 1YLBB 5DS8A 3GHSA 2DJMA 4O2EB 4CSTA 3ALGA 1RJPA 4AAJA 2M26A 4EZJA 3PZVA 2IGLA 4PRTA 4AVKA 3IK4A 4JQXC 1BDYA 5HVHB 1X7TA 4DPRA 3WIHL 4WIQA 4LFHD 3Q43A 4ORZC 1R2SA 1UQZA 1J7VR 4A2SA 3ICJA 3M0VA 2JKNA 3AY4C 1S7UB 3W26A 1JV5A 3THML 5DVKA 5EZIL 2FIKA 4C6MA 3Q8BA 3GMLA 4PRPD 1H61A 4RE2A 2C1PA 4WUKH 4NNYA 4E8GA 2KX9A 3UU0A 1FCGA 1I7TA 1V10A 4LVBA 2ITCB 1G4EA 4JFFE 1XIEA 2XNAA 3KDMA 2FX9L 3GNMH 2NSMA 4LS1A 4IYKA 3QYSA 4UQ3A 2Y7LA 2JIXD 3QH2A 1J48A 2F54B 3OVGA 2VDLB 4MJIB 3FRPB 4NO2A 3F7VA 1OADA 2CO7A 3DX4A 1Q45A 2C1GA 1PTAA 3SBQA 3B3IA 3E80A 3W83A 3LNMA 4AYFA 4QNWA 3NIGE 4C6BA 1WICA 3IGAA 2NY4C 3IKCA 3IS0X 4JY4A 1A7NL 2BNRA 1AKJA 2IVFC 2P5EE 2FEJA 1MDTA 2VGBA 3VYLA 3DG6A 2NT0A 4HMEA 3OF6D 2QPDB 5IVXF 3BWUF 1MDRA 4YR6B 1F3TA 2XQYG 1IHIA 2C19A 2V5DA 5ABEA 1TJIH 1Z5HA 1TQUA 2BGQA 2P5WA 4XP9H 4ZT1A 1O1HA 2HXAA 3MOAH 3SPVA 3L17A 2HWZH 1HIMH 4MVBD 3BAYA 1RJZA 1E5AA 4LLUB 4K3JL 1CTMA 4M4PA 3A3HA 5B7FA 1CLOL 4XMXA 1IILE 4CU7A 4IT1A 2VDNL 4BY3A 4MJJA 2FUQA 3RCYA 1JDEA 4QRAA 1OCCB 4DKFL 1T96A 3R89A 1OWQA 1HIZA 4RNFA 3FYEB 5LVEA 4N5ED 3UJJH 2JE8A 4G9FA 1LMKA 5E24E 4V1XA 3T07A 4JFDB 2P24B 5BRPA 2DVUA 2ACUA 1Q0YL 2ED9A 1BFNA 1N0LA 5EFDA 1G6VK 1P4BH 2VERN 1EXPA 3BEVB 1U21A 3GSOA 2OLHA 2BS9A 3WK0A 3SRKA 3URNA 4WENB 2Z7ZA 4M5PA 3HHSA 5GGQL 2WNXA 4HISA 2HB0A 5DJAA 1OF2A 5BROA 4ZJ9A 3CFBA 3HG5A 4TNWK 4IHOB 2Y36L 2J66A 3TLLA 3FTUA 1JF1B 1IAKA 3CFQA 4KFZC 3NA9H 2AQ3A 5B7MA 4DWSB 3TYGH 1X38A 4XVUC 1WGVA 2WN3A 1DCEA 1XYCA 3QDME 5JOFB 1JDCA 4CMHB 4DVOA 3RUGF 5ID1A 1BM7A 3D18B 4LCYA 5I0DA 4NN6B 3O3RA 4QXIA 3GIZL 1VBUA 2UWFA 3ZDZF 2DZWA 4I87A 3N1AA 1G7MB 5MEQB 5E9NA 1ZLSH 2MHAA 5FA5A 1ZANH 3WJJC 4EBQH 1WAUA 4AGMA 2CR6A 5CO1A 3WKQA 2Z4QB 4NBYB 1CD8A 4O02A 1U33A 4B7IA 2O92A 1NBZA 4Z0JA 4ZO6A 4KKNA 3URBA 5E6IB 4LSTH 3BGMA 3SI9A 3QJRB 5TK2A 2BXZA 4FQXC 4KETA 2W1NA 4Q8QA 4IGNA 5FHBL 3L3IB 5EZPA 5DZNA 3FXGA 3EOBB 5D37A 2IXUA 4PODA 4IRZA 4UNVA 4PUBH 3U8GA 4JR9H 4WKHA 3AITA 2D03H 5DQ9B 4Z7NF 3PJTA 4Q7BA 2YZ8A 1JNNH 2VDNB 3TONA 1H4PA 3HNTL 2YLAA 3LTYA 2PB1A 3E0FA 4QXWA 2AK4E 1JR1A 1TG8A 5HULA 3SOTA 1EAJA 3G7TA 5CEXB 5EU7E 1ZLDA 5FYKD 4NLHA 3H7BB 5IFJA 5A7EA 3D3FA 5FGBC 3LZ5A 2FKPA 3RM9A 3MCLH 4OFKA 1R33A 1LP9E 2X38A 4JGDA 3FSVA 1IXNA 3WIIL 2J9YA 3U25A 2WXNA 1BG9A 2YHGA 2XUCA 2BMKB 3I6KA 4QUOA 2V5TA 3ABQA 3FFDA 4M9PA 1IC1A 4A39A 3DK0A 2BIPA 1MZYA 3E2HC 4PJXA 2VW7A 2AEOA 4M24A 3OKMB 1T7YA 5JHLL 1G6RL 3OPZH 1CD9B 4GKSB 1DTUA 3VH8B 2JJSA 5E1GA 3S8WA 1X5XA 4Y5YA 1TJRA 3D6GA 3BLFA 1NCAL 1A5NC 2EE2A 5LO7A 5KW9L 4WZHA 5KVMC 2JQXA 1IZJA 2VLKD 4K7PY 3CWNA 4G1EB 1ZD6A 5B80A 5D5MA 4P59H 3GYRA 1PDZA 1DE5A 4K9EH 1WNOA 5F7DB 1NAL1 2ZWSA 5LZLA 3ARTA 4LUIA 1GA2A 4WGXA 3ITCA 1S7UA 2E9BA 1OSPH 1Z48A 2Z7YA 3QW9A 2VJ8A 3MR9B 2HRPL 4GAGH 2Y2WA 2C1OB 3MV01 4JTJA 3WK1A 1HHHB 4WEUD 5J11C 1LF1A 3ATZA 1MRQA 4JL2A 4ZUTB 5MF5A 1ILSA 1CXFA 4N0CD 2D0FA 2BHUA 1ZY9A 2PWFA 3ARBC 2VC6A 1JDDA 1FBIH 4PJEE 1GTFA 1SEQH 1VP5A 3FCUB 3B05A 4DHLA 5C09E 1A5BA 4PRRA 4Y4KB 1HTYA 1SGKA 2DQHL 3W0WD 1R9FA 4KW2A 2BP8B 4MJIA 2WTOA 3H2NA 1EYWA 4FALA 3CQJA 4GUPA 3CJPA 4XP4H 2P10A 1UM4L 4PJHF 4MRCA 1YEIH 1E4KA 1BXCA 4TRPH 4ZS6C 2ZKHH 4WI4A 5CZVH 3V4PH 3SPCA 4DX3A 4WWKA 2XU2A 4PS4H 3Q1SL 2FB4H 3KBEA 4YVPA 2MPAL 2ZOTA 1RL1A 1G6RB 5BQDA 3TZVC 4XAWH 1TJMA 3AU6A 4WEMB 3IVSA 3ULUD 4E42B 3CIXA 1T0NB 4V1DD 2DQJH 4LSSH 4B9PA 2EG7A 3MBEC 4LSVH 3UABA 2DW5A 4A67A 3N18A 4JZNB 3OAZH 1PIGA 4LEOB 3KMDA 4AD0A 1D7CA 2R24A 4F15B 2PTYA 5DFAA 4P57A 3N43F 1AMXA 1ITXA 2Z7UA 1CI1A 1NWRA 1ADSA 5HJGA 1OF8A 2R29L 3IM1A 4ICXA 3LD8C 5DJXB 2PW2A 1B30A 2ZOKB 4WHYH 3V5KA 3LZNA 1JRCA 5C7HA 3QO1B 1LRNA 2X1WL 4FIQA 5ESVA 3WQEA 4J27A 4Q22A 5E8NA 1A0DA 3DH7A 1GCYA 3ZJ7A 2HNEA 4ERGA 5KANG 3QDGD 2P24A 4NQDE 2XISA 2Z26A 1GYLA 3IEBA 2BFVL 1BMGA 2XG4B 4RAUB 5C08B 1Z42A 1KR1A 2DZXA 1Z69A 3WF1A 3QXWA 1ECYA 2ZOLB 1JNHA 3OG3A 4PG9B 1OPOA 2APTA 4DUOA 5EUOA 4IJ3B 2DTML 4V2XA 4NUPA 4NQUA 1NEUA 4TNVK 4W9FC 1MHHA 5IR1B 2E68A 4WUUE 3TYFA 4FLOA 1A3ZA 2Y25A 1UWYA 4ORGA 4MDOA 4HS6B 5A69A 1E6OH 3FU8A 4G6MH 3VFPA 3TBYA 4MMXA 5C07B 3RZCB 3D18A 1OB1B 4RFNB 4NZ4A 5CIPB 1FA4A 3KCLA 4W6YB 4AZCB 2WW5A 3FC8A 2VX7A 1QSFD 3MOBH 1A8ZA 1G7MA 2FATL 3OHXB 1E0TA 1Z5LA 3HN8A 2ATAA 4GI8A 1KPUA 4KKCC 3PVFA 1IXOA 5C0RH 2P1FA 2COQA 3ECVA 2J88L 3EBAA 2PCEA 1E4LA 1N7ML 1M9WA 1W9PA 2H9AB 1RU9L 3FW6A 4JHVA 1B3VA 3VD1A 3DX0A 3EWCA 4XCYA 5DLMH 5FGCE 1J12A 4I9AA 4LVEA 2D3NA 4CD6A 5JXED 1I9IH 3UTSD 1IT9L 3QC3A 1QHZA 1KUMA 1C16A 4DUWA 3QZ6A 1KTCA 2HKHH 3QM3A 4JPIB 3UXLA 4KTDH 1FIGH 1YEGL 4P7LA 1O75A 5D7IB 1FWJC 3FU9A 3V6OC 3QXAB 4ANUA 4Z2KA 1ZVNA 5ISZB 2V69A 2K70A 1GCFA 1K03A 3OXSB 5I9QC 1GHFH 4Y6GA 4AD4A 2EHHA 1RURH 3GT6A 3NGBC 3R1GH 2H1PH 1NIEA 5CEXA 3NK3A 4PCSA 3DI3B 2WK2A 3VXQB 4Z7UB 3E02A 1HE7A 3EFDH 3MRIA 3W2LA 3DOPA 3H7BA 3H9SE 1VZIA 2FZBA 1IV8A 1ZLPA 4UTBA 4PYHA 1NC2A 4R26L 3EB3A 1BHGA 1EDHA 4G59C 3IUHA 3DWTA 5T3XH 2Y5TA 2PTTB 3W9EB 4Q8NA 3FTYA 2FMOA 5EOCJ 4CQ9A 3SQRA 4PMYA 1YMHA 1UP3A 5IJDC 2PXYA 4I1RA 3RR1A 5EDXA 3C8DA 2C8NA 2VC2L 3M1BB 4RISH 3A6CH 4Q4MA 2VITA 4FHJA 1ECEA 5H4YA 4GSXA 3N6JA 2IANA 4TMPA 4JDYA 4JM2C 5JW4Q 3C5QA 1U93A 1S3HA 4UBDC 3FLUA 2IOIA 3ZT6A 4GKSA 4MXWL 3Q2WA 1G1OA 2FL5B 4AVJA 1ZAHA 4RUBA 4WO0A 4YDNA 4OD3L 4IBQA 4NKIH 3GI9L 1JUFA 3CIVA 3C86A 4YDKH 1A5LC 3RMEA 3DHPA 1MVUB 3CFMA 4PFMA 4IIGA 3Q2NA 1JI1A 4NC1E 3LS9A 3DHFA 1F6YA 3IDGB 3HZ3A 2WBKA 4G1EA 4EE2A 1VCAA 5A3HA 3DV4B 3C12A 1IEAA 4P9HC 1U8HB 1P4LB 1GGIH 1POJA 1VYRA 2HISA 3VILA 3VCLA 3PB2A 1EAPA 1MWAA 1VFOA 1ZBVA 4JFED 4OJFL 5ECVA 3BT0A 3WDJA 5KSBE 1BD2B 4HOMA 5HI3D 3NG3A 2GQ8A 4PUWA 2PODA 3BW9B 3R25A 1WBZA 4DO5A 5I6LA 3KYOA 4Y8AA 1R3IL 3HC2A 3MLRH 1JZGA 5EZOH 5FKAB 2VXUL 3EA3A 4E4PA 4XWGH 4AUJA 5DJYA 1A3RL 2IH3B 5JTWA 2VC5A 1HHHA 4DQOL 2ARWA 1Q38A 4YHOH 4HQQL 1GJUA 5HSFA 3AALA 5J5DA 2V82A 4NN5C 3AIEA 3NJVA 2QBWA 1KA9F 3H4FA 5AQ0A 1TTIA 1W3JA 4NO3A 4A3QA 5DQPA 1JZFA 1R0AH 3N17A 3P9LB 1HJUA 3RY6C 4QTFA 4Y4KA 1P5UB 1UHVA 2E6QA 4WXYA 5E0QA 2ISVA 1KFCA 2WXGA 4HWBL 3DZ1A 2ESVA 1GTEA 5ACMA 4MD5B 4OH2A 5IWLC 5K39A 3VSVA 2VC2B 3FQRB 5DJ0B 1QR4A 1UR4A 4L8DA 1LDCA 4YDZA 3N6HA 2ACSA 4UFJA 1MFDL 1W2VA 1RD5A 3D0VB 3H4XA 1NWUA 5CSUA 2JXMB 3CFDB 4GO6B 5C6MA 3H9HA 2YSSB 5DK3A 1ONQA 2OMVB 2E7HA 3UGUA 4IDJL 1W3NA 2GUOB 3NJFA 1YQ2A 2QKIB 3SJVB 1MCBA 4WNJA 5IB2A 4JRXD 5T1KA 2GK0B 4J5VA 4PJ7A 5C7VA 1J5DA 4AZ5A 4QKXB 3AGVA 2WLHA 3FU5A 2Y24A 5IBUG 4U1MA 5CINL 3TKFA 1XR8A 1FWWA 1YYLH 3ONCA 3BYTA 3P4LA 4ZW8A 1XYBA 4F33A 7FABH 4QROA 4W4OA 1SDYA 1I3RB 3QV9A 2G50A 3FJTA 1YYCA 1PG7W 1KYDA 5CCKH 4ELMA 2VN7A 3L5XL 2A2QT 2ZSWB 1B90A 1B1YA 1JPSH 3FHQA 5E2TH 4P0DA 2BINA 4JX4A 1OM3H 4A4AA 1H7PA 1WCBB 1SFSA 2WUBH 2PP0A 3PJSB 3S5OA 5E2JA 5KSVB 4K3EL 1GONA 4HP5A 1MRCL 4N6EA 4YSQA 1AZ1A 4HUMB 3LS4H 2BX7A 2CBUA 1PHWA 3QC5X 3Q8FA 3OGOE 3ILDA 4L9LA 4C83A 4PG9A 1MIEH 5JORB 3NEXA 3KWTA 1L0YA 4K5NA 5IR1A 2XZ9A 4P2RD 3AI0A 3QW4B 3BJSA 4XOEA 5FYJL 5AW5B 1KFJA 4MZYA 1EXHA 3PGCB 3GKZA 3RZCA 3WLKX 4PTMA 3KPPA 5CIPA 1Z66A 1I0BA 4HPJA 3STLB 1OAKL 3MJ7A 3MU3A 3WJYA 2WB1A 4EXAA 5DZ9A 5I8CA 4R85A 2WXHA 5ACZB 2XKSA 3N85L 4MA8L 5LXGL 1JXKA 2Z28A 1L6GA 2LW3A 4Z2IA 3DAQA 3T4WA 1Q1JH 4DO7A 1MXGA 3IGFA 4FOJA 1O5XA 4XD6A 5E70A 4WV1C 3U4BL 3PR2A 3VJ6A 3VQ1C 3QJTB 4B2DA 4KUZH 3GWJA 1DR9A 3DO7A 5J12C 3PP3K 5DQJA 2EP6A 1TTGA 3VNKA 3VI3E 3QHFL 3I6LD 3TTOA 4ICMA 2DYSB 4UB0L 1JBJA 3BH9B 2J20A 4HA0A 3VK5A 1TUXA 5J3HD 2QGCA 1AO7D 4A2MA 2MRYA 4PU2A 5AWNL 3US1A 5AKVA 3QXAA 1YNQA 4ZTEA 3JYCA 2OFQA 3UW6A 4RNRA 3WLPA 4C56E 4NO0B 3FAXA 4P3CH 4BXVA 3TOYA 1QRNB 3GHPA 1HJVA 5F44A 2DLHA 4B96A 3ITXA 4HZ8A 4JYEA 4JPWH 4GHRA 3VE7A 4ZW6A 3JV4B 2QQQA 5HVWA 1XGQB 2ZZ4A 3ZY7A 3E38A 3P2BA 4GO8A 4P2YA 1Q7QA 5F0JB 1MUCA 3LN4B 4LGSB 4H9VA 3WD1A 5D1XE 3VXQA 3A4JA 1W8OA 4RNHA 4WI5A 2E9LA 5IGXH 2N01B 2YXGA 1XL4A 3EBHA 3NN8B 1BQSA 1ZV5A 4Z3FA 4HAKA 1U3HA 2GC4C 2UUDK 3V4VL 3GTFA 5DCBA 3TCLA 2YRZA 1TZ9A 4NUGH 4FXGB 2O6PA 1LNUB 4AHOA 3RWFA 5HGBA 3V4BA 3SKJH 2BB0A 2FQIA 2HROA 2YD0A 3MA9L 4K3DL 3SDDD 3F58L 3DI0A 3IIVA 3NYDA 5B1JC 5F2IA 3B9KB 2E6PA 4F40A 3SQSA 3CJJA 4HHGA 5TPWH 3TURA 3HE7C 3KXFD 4YPJA 3UYPA 1NC4D 3MLYH 6TAAA 2VENA 3C2RA 4NY2A 4AQ1B 5D2NA 1SZFA 1OT2A 4WY7H 2VWEC 3EJTA 3I85A 4GEIA 2FL5A 4F79A 2AVGA 2I5YL 4G2AA 3HPXA 5L8LB 4DBSA 2ZXEB 5IF0B 4LIQE 2L7EA 2FO4A 3VC6A 2X4RB 1YDVA 4GYPC 1LEKB 1P6CA 4JFHE 1LL6A 4UIKH 4QEEA 3QUXB 1NIUA 3RTQC 1V3KA 2AOSA 4HSCX 3VZXA 1QPXA 3ABSA 3PQYA 3QISA 4ZFFA 3UTTE 1NGXB 5EY5A 1S1PA 4IOIB 4N2GA 4XXWA 4R4ND 4WUIA 1BF5A 1FYTA 4W89A 4P2CG 4NC0B 1BA9A 4L9XA 4D1JA 1VDGA 3FTZA 2N1TE 3CV7A 1KRAC 3DRTA 4ODUB 5FKAA 2AQVA 4IMKC 4OZHA 2IH3A 3FCBA 3P67A 4OT1L 3W6MA 3OKEA 2PLCA 2Y1YA 4GH1A 2CGRH 3ARRA 5FEBA 2IV8A 3VI4A 4R7VA 5AVWB 2WOQA 4XO9A 5HOSA 3V4VB 1XLDA 3KVPA 2H1LM 2CNYA 2RAMA 1OHZA 5E9DE 2YFOA 2DDQH 3QZNA 1W9UA 5TF0A 3AUWB 3X1GA 1WCQA 3KPOB 2WIIB 3WKML 2IWKA 5IHLB 3BKYL 4PWJA 1IEBB 4AYGA 2K78A 4MD5A 1BGAA 5DRWB 5FJOA 3HMXH 1JMXA 5F8QC 2OEKA 3D0VA 5MP6H 4GFIA 2JXMA 1X4YA 7REQB 1FE8L 3FS2A 4Q9RH 2APFA 5GGTA 3H8NA 5HWMA 3OXRA 2HH0L 3S34H 3HQOA 4Z7AA 2CBQA 4YNYA 3SJVA 4GBUA 3BV4A 3MZ2A 4ALAL 3P3YA 3H7RA 4NOBA 2GK0A 2WUCL 1H50A 1E9PA 2DLIA 5C9XA 4FA6A 3MRFA 1UWUA 5DRNB 4LANA 1XGUB 4LCCC 3H2FA 4HJ0C 4F7TA 4HPOL 1Z9SA 2P8LA 5HYSA 5D7IF 3T1FA 2ED8A 3ASNB 3V6ZB 1B2WH 1UCBH 1GW1A 2D2GA 1TB3A 3O3AB 4FQQB 3EADA 1OB0A 4OF5A 4EZLA 4FXFA 3F12A 3GRWH 3JQOB 2IADB 4R84A 4KWOA 4QXGL 4IKIA 4Q9CA 2H9GB 2ZSWA 3O11A 4ZFZA 3G04B 4KNSA 1J5SA 4IMLB 4KU1A 1GOKA 4XKYB 5EWIL 4NI8A 3H3KA 3RIAF 5KVDL 1ZS2A 1J0JA 4Z7UF 1NSNH 2YDRA 5KSVA 2SEBA 4PW3A 4QHKJ 5FKPB 1O7VA 1T7ZA 2DZBA 2H4EA 2PDWA 2GC7C 2WLZA 4MGGA 4N2BA 1N0XL 5ENWB 1FVEB 3TXVA 1ID2A 2MPVA 4XBPB 3QUYD 5FA3A 1LO3L 5JORA 1UM6H 5FECB 3BCDA 4R3UA 3I50H 3UXIA 4S0SD 1WDAA 2VABB 3NZHH 3BDKA 1YEJH 1OCNA 1R6WA 4R4FL 4DK3A 3RXZA 2GYSA 1ZJAA 2CLHA 2VLLB 4C4KT 4DIAA 1UYQA 4MM1A 4UT6A 5JXQA 3STLA 4LC6A 2EIDA 2APBA 1UWFA 1BVNT 2W92A 3OKYA 3PWGA 3D5HA 2B3RA 3D39A 4N8VA 4XD5A 4C6QA 5JPNB 5E6SB 1ZT7B 1E55A 4AIZA 3IPEA 4LVFA 3KPQB 4FZEH 4G2DA 4RGMB 5AB2A 2RDTA 4KQ0A 4L56A 1PZDA 4EKJA 2CE6A 1EEYB 3GEWB 5DT1H 3MXWH 4EIVA 1OTUC 2VR4A 1FX6A 2TAAA 2EIKB 5JNYB 4H3DA 2YCJA 3IV8A 3BH9A 1MUJB 1OX4A 1JGEB 2H26B 5GJPA 5GRJH 2R7EA 4PTVA 1HKFA 4M5TA 4XN2A 5G5DB 1GHSA 5D2XA 4XN5A 3LOTA 5HDWA 1DDHB 3M17B 1U8NB 5I1JH 1U4EA 4I77H 3SECA 4X98B 1JYXA 4B4HA 1RBOB 5D1QA 4A05A 5FF0A 4KRPD 3VW3H 2W59A 5M95B 4IFKA 5JHAA 3GE7A 4LKXB 2HE8A 4E9TA 1T0OA 4F7EB 3O45B 4P3DB 3WHE0 2XV2A 4N0UA 5IQMA 3LPOA 3UG4A 1FSKC 1SBSH 4BIKA 1H0DA 3P4MB 4E2DA 3RIFK 1GW9A 2WMPB 1YEFL 3L3OB 5IB4B 1N2RB 3EX1A 3DGBA 1TPWA 5CEZE 4MWFB 3FGCB 3EYSH 4ODTL 2DT2A 5A8QA 2B1OA 1Y65A 2AGKA 1OSEA 3O6FB 1AMYA 2GL5A 3QWOB 2JKTM 2HRGA 4IFRA 4HMNA 1MEXH 3O7UA 2BXVA 1UUMA 3VWJB 4DGVH 4MG4A 1A6TB 1AHWA 3EMQA 3TT1L 4PJDA 3G6AB 3BV7A 4Y5XC 1E2ZA 1A5MC 1CGTA 1U36A 4JIEA 3JZEA 4LEXH 5CSGA 2X7LB 5IHZB 3WMPA 2WLLA 1VADB 3EYUH 5FUCE 4LBAA 4AC2A 5D6CA 4WK4B 4N4PA 3T8QA 4HEPG 2GLKA 1ISWA 1YADA 4LSQL 3OEXA 5C0FB 3TT3H 1OOAA 1OSYA 2X4OA 3UBPC 1F2JA 1Q65A 4WTZA 3N2MA 3PG9A 3TWCL 5J8OA 2YRBA 2I5GA 1FIEA 5BOZG 5T8IA 4HAGA 2BVPB 3H53A 1NGXA 5EO0B 3EF7A 8RUCA 2CLIA 4U0RC 3EA1A 1KF9B 1A7OL 3ID7A 1LE5A 4KWVA 2WQVA 2F5AL 3U2EA 3AIUA 5GS2D 1D3CA 4J3UA 2LU3A 3L0NA 4OF3A 2MMXA 4RZBA 2DWXA 3FT0A 1XH0A 2FJHA 4IGBA 4LLDB 1AD0A 1T2QL 4KIEA 4NKOA 3HV9A 3QPXH 1SOKA 4W9EC 3O05A 2KYIA 3DBSA 5ETUB 5LXEA 4I9WD 4CNTA 3C09B 4DIXA 3U9PH 2X8RA 3I9IA 3OPUA 5KUKA 2EGZA 2W94A 3L6FB 3RAJH 4JPQA 1MCJA 4KX8A 5IREA 4POCA 4RDZA 5BXSA 4KV5E 1NTDA 1Q8MA 1RQHA 4BDVB 3SE4C 1XCTB 3W2JA 1CICB 3ULVD 5CILH 3NABH 5DVOA 2YEZB 2W91A 3CLFL 1WBHA 1GGBH 4DYKA 1XGYL 3KPOA 2OW6A 4L1BA 5HR7A 4GG8A 1T7LA 3P77B 3KOFA 3HN5A 4ELKB 3LPGA 3PL6B 3V0DA 1JJKA 1XLLA 5DFTA 3UP1A 4NI3A 2R9HC 5DRWA 4ZMLA 2R56H 4GOSA 4X8JA 4L3CB 1FL3A 3L4UA 2X6CA 1UCWA 1DANU 1Q9LA 3QQ1A 4HIJA 1PIIA 4TM9A 3TO2B 1WIPA 1FL5B 4PGDA 2B9AA 1E9QB 2PCQA 7REQA 1EJ8A 4KJYA 1VEMA 3L8QA 3C2OA 5IVXA 1S9YB 1RIVH 4XCCH 3E12A 5FW6A 3F64A 1HWWA 4UOQA 5FFLA 1IM3B 3AYSA 3CH1A 3VD2A 2G3ZA 1S78D 2NR6D 2ZRXA 2A9CA 3PCYA 4OIIL 5JBEA 3FYYA 3MHGA 4F4RA 3H4HA 1T83A 3B40A 1E30A 5IVZB 4XPGH 1CF8L 2IAMB 3TCSA 3D06A 4HVXA 1GAFH 5MKGA 3D25B 5F3BB 3V6ZA 1RAKA 1UB3A 1NDGB 4BFAA 4XWUA 3O3AA 5LIUX 3T0WA 2W27A 4YZFE 1T89A 4KY2A 3V5HB 1EHLH 4J6RH 3SRFA 1OP3H 3QWRA 1XYFA 1IIGA 3CV5A 5IQNA 1ZTXL 3RX5A 5A6LA 3O4LA 2Y7QB 4AMWA 3NACL 1QQDB 4JMNA 5D7LD 4GNJA 5C0BA 4YUEH 2ATKB 2DPEA 4XKYA 2G97A 1ZLWK 1F4XH 4FO4A 3LQMA 2X2HA 5PTDA 4CJ0A 3BLDA 2B0SL 5IBTL 2JKEA 2IH1A 2XTJE 4Y19B 2CR0A 4BUQA 4LF3B 3SBWA 2I9EA 1GJPA 3KJ4C 1J9CT 4NRYA 5G4HC 4K1WA 1CGXA 4ZI8A 2A7NA 3BKCH 2IPUK 4W9KC 4OV6F 1QVOA 4IQEA 5ADPL 2LOEA 2EYSB 3G22A 4WKAA 1GKOA 1D8CA 2R69A 2HPTA 3ISWA 4WFGE 5G4EA 4AJYV 3QFJB 3RUGA 4N6FA 3D0CA 3B9NA 5ESQA 2AGJH 5CSRA 1EFXD 1W6TA 3QRGH 1XGZA 2IQAB 2BSSA 2I9LB 3CCHA 4ZO8A 1H5VA 4PMEA 3RPIA 2HYMA 3RWDB 2A4ZA 4JDTH 2J62A 5HR6A 4A2FA 4MNGE 4NX5A 4ADTA 4Y2WA 3I02B 3ZR5A 3QIUB 4OZIB 5L2KA 2WLJA 4Q8WA 4Q7NA 1SW7A 3VX0A 5CLTA 4WKZB 4LPXA 3I2CH 4DO4A 5CJ8A 5F7EL 4XZWA 4PB0H 5CZSA 1TFPA 2ZC1A 3L5AA 3KBJA 5E8OB 1P7QD 4NAEB 3ZL4L 3ATFA 1VPOH 4ZQMA 1A3QA 2ZWZA 2X6UA 4P4KC 2FH6A 3Q13A 1E8XA 4K8RD 4G7FA 3FQWB 2ANUA 4HJIA 5JHDE 1UUQA 4TUJB 1HZYA 3IJQA 4KRMB 3LHVA 4BK9A 1DDHA 1KBVA 1UGKA 1DZ0A 3ZYZA 4U2ZA 4KJPD 3CAWA 2PRHA 4AWJC 4E9WA 4TX8A 4RFOL 3AOFA 3CYJA 3DKLA 2V2DA 3GS0A 5CHNA 1AH1A 4QLLA 3MX0A 4F7EA 4EMZA 2V3DA 4OSUL 1T03L 4XP1L 4PWGA 3OWRA 1W56A 3OVQA 2NW3B 3DSFL 3P4MA 1AH4A 1S2EA 5CBJA 1IC7L 2YMTA 3O07A 3TR9A 4A29A 5EGRA 5T33L 4ZUWB 4PP1C 3QY6A 4OLYH 1NMAL 3MV8B 3RWJB 3HCVB 2B1HL 1XCWA 1KDJA 3W7HA 1KTDB 3MNZB 1AZBA 1LYXA 1MJJA 4K3HA 2DQFB 4A8LA 1PD6A 3RZWA 4B6ZA 3QNZA 3SN1A 5IMKB 3QWOA 2J6EH 1A9BA 4F3FB 4PBGA 1AGCA 1A6TA 2EC8A 3GM0A 3TS8A 2EH7L 5EBWB 5CN2A 1F58H 4J1UA 5ICXB 4OZOA 4QRUB 5C3LD 1QATA 5K4XA 3O1NA 4MYAA 2CUMA 1VADA 4N2IA 2D7TH 2EO9A 2A6DA 3NSXA 4CEXC 2P5PA 4XNXH 5C5YA 2J4GA 3EYPA 1WWAX 2BIMA 3WBEA 5C0FA 4DXKA 3IJHB 1IYXA 4BFEA 3B2VL 2DLGA 4EI6A 4CCEA 2VCOA 4JKMA 3LBOA 4EVZA 2R2BB 3U6XS 4AMXA 3GHBL 5EO9A 1NFDE 2Z31B 3JTBA 2YDQA 4JIRA 2BVPA 1RUMH 4UZGA 3UJRA 4N42A 2YD5A 1N18A 1NDMA 3SY0B 2F8QA 5DK0B 5DK2B 3BFOA 3MMEB 1B9BA 4GRMB 5L4JA 3ILQC 5LG6A 4N87A 5FSEC 5D96C 3FA5A 2E76C 3REWB 4WY0B 4PV8A 4E41A 1P69B 5CCGE 4XHJC 5D72L 2HJFA 4XPBH 3TH3T 2P4AB 3W75A 3QZPA 3H26A 3GZPA 5EMUA 3MRKB 1O7DC 1WBJA 2YCEA 1QO2A 2OSLB 1LDSA 3FUJA 4DN1A 1X8CA 4KH9A 1NMBL 3NJJA 3HAEH 2UZIL 3BKMH 3VAVA 1PTZA 4LVDA 5HI5C 4D9LH 1WB0A 1IC5H 3V6FA 1N4XH 4LL1A 2YEZA 1SOQA 4PJBB 3O9WB 3B04A 3AREA 4MSWB 1X7FA 2XM1A 4PJHA 1EHKB 2G9HB 2HFEA 2QJIA 2QQ6A 1XL9A 1ZRQA 3EXSA 2N3JA 5LBSL 2ZONA 4IS6A 1BJ8A 5HATA 4MDRA 2EKJA 1F2QA 3K7UA 4W4QA 4N24A 3GH5A 1BGGA 2AQPA 1QOPA 2NZ9C 3MMDA 2OMXB 4FQJH 4LDLB 3GSRB 3D4ZA 3OR7B 1X9LA 1WRFA 1H19A 3DHMA 1NFPA 3H0TA 3N0AA 3UJTH 3MLTA 3EGXB 3VXGA 4DZ8B 3TA3D 4PC8A 5MENE 1OALA 4H19A 3WH6A 1KIRA 4PL2A 3PUOA 3SKOA 1BF6A 4LAOA 3CL8A 4QNPE 4TVCA 2X7WA 2VD8A 3QEZA 2G0WA 1KLUB 1HCYA 4PCTA 3ABZA 2QKSA 4JLRA 1KJMA 3QZOA 3S83A 1DQLH 4JN1H 3V5HA 3CH9A 4OGAC 4XPFH 5HHPB 3VD0A 2O6CA 1O6IA 4PGBB 2VL5B 3UTPD 1MWOA 3ZKXB 3VVWA 5BV7C 2Y7QA 2XN9B 3MRRA 4KROD 1QQDA 1TZOA 2HVJB 1ILUA 4KCTA 3FTSA 2J73A 3JZYA 3BFWA 3LB6C 2O4EA 3NJKA 1S9VA 4PW4A 4M0XA 1INQA 1JHTA 2YCLB 3JXAA 3CMJA 1V6YA 1UJ3C 2LVCA 4OLXH 1G4MA 1HINL 3PP3H 4OKVA 3VFVB 3RDTC 3R12A 2PP8A 4XCNB 1F7BA 3WJXA 3PWIA 3ARFC 2R2EB 3RLVA 4XBEH 2QCLA 1GIGH 1ZHLB 3GMNB 5T5NG 1CYGA 3P2VA 1C29A 4TTDC 1B4KA 3LIZA 2H3NA 2D24A 2ZZ3A 1CDBA 3ZR4A 4D1IA 1DFBL 4FKKA 4G7VL 2VLJA 1TKWA 3C3NA 4PRHA 3NCJL 2I9LA 2IW0A 5FL1A 1K2DB 2HS8A 5D4IA 4OZFG 3RWDA 3CE1A 3AO0A 1PAMA 3I02A 2OX5B 2R0WL 3EW3B 3QIUA 4LUSB 1UXWA 4NKMB 4WKZA 4JQ4A 1S5HB 2FHCA 2CJSA 2UUDH 2R39A 2J1XA 1LM8V 1BFSA 3T2PA 4O2EA 1AUSL 3APGA 3O0RH 4U1IB 3T8LA 4OLWL 2QT3A 4Z18A 2A3CA 4LNYA 1HYSD 5D7HA 5LBVA 5T5FL 2C7UB 3GSXB 2Z4TA 4G1MB 4PTXA 1H49A 1MPAL 5AAWA 5HYIA 4TUJA 2ALWA 5LWYL 4X80L 4NFCA 2A7RA 1WC7B 4BKSC 1GPOH 4XKMA 4AITA 3C5ZC 4M19A 1BIIB 5IEHB 4H9MA 1ZNNA 3UGXA 2YUZA 3HPJB 2AKRB 4Q4RA 1RJQA 1BAWA 1IBGL 3KCWA 4BZ1A 2CBOA 1KTBA 4DBUA 3L9EA 2DQDH 1V3LA 5J9PB 1TRDA 3RG1C 4FZIA 2ZFAA 2QPXA 1ZPUA 5HTSA 2ITCA 4RZCB 3WS3B 3LZLA 1O6TA 3O6LL 1YVLA 1KLFB 4OLEA 4LCSA 3WD2A 4UFIA 1FC1A 7CGTA 2F54A 4N3TA 2Y89A 1TMHA 2GK1B 1JCLA 2HN7B 3FRPA 2NWSA 1TVLA 1OCWL 4HJTA 2V81A 3BDYL 2WXRA 2WJFA 3TC6A 1E6PA 5C2BL 2OK0L 1RP9A 4HJJL 1UKSA 1QFWL 2G4GA 1FCVA 5DVLA 4OGXL 1WS7A 3ENEA 2N0MA 1AS8A 3ZPDA 2Q3ZA 1YZZA 3QRBA 1LWRA 2B15A 5ICXA 1V7MH 4QRUA 5GJNA 4YMPA 3NURA 4YR6A 1RJRA 1QPOA 2JFEX 2VQTA 3FMGL 3SDCB 1A6UL 4FP1A 3FB6B 1TDQA 5MI0C 2CDEB 1N68A 4LLUA 4GH3A 2CU9A 4R27A 4S3DA 2Y0FA 4LAUA 3NJMA 5JOPD 5KBNC 2GQHA 4IG2B 1U4FA 3VXMB 2FDMA 1XIGA 4UTKA 4PTTB 5AFDA 2XHNA 2R6OA 4XNUH 1H3PH 1I85C 4TVPD 3WIHA 1RSYA 4ZOAA 2G3IA 4OW6A 1Z0NA 1SXSA 3GNOA 4W85A 4GRMA 1RZQA 1UUOA 3REWA 4JFDA 1GKEA 4OU3A 3E0VA 4XPHH 2VP8A 4ZBJA 4QDGA 4B3VA 4QRPB 1OK8A 4JDZB 2E7DA 3VFMB 1GEQA 2OZ0A 3BEVA 2BMBA 1RIHL 2GABA 4X6CE 2CHWA 4Y9CA 5DC2A 1FORL 1HVXA 1TWIA 4A68A 3X3FL 3UPCA 4WDUA 5FCUL 1O5PA 3SUTA 3T7VA 1IIHA 1XFPA 5IMMB 5B38G 1ITUA 2APVA 4IHOA 4PLKD 4EPBC 3PRZA 1JF1A 4BQ4A 2VXTL 2MWCA 4HPYH 4DWSA 3F5WB 5DXWA 5JOFA 1OFDA 3KHJA 1QSVA 1OP3K 4K7YA 1INDL 2G9HA 4XX5A 1FGVL 5KJRL 5MEQA 3A6BL 2P28B 2OWCA 1CR9L 1MVFA 2BNRD 1AKJD 4FJZA 4Y16C 3GNRA 5KVEH 4OZIF 5G2NA 1TQCB 2IDSA 3Q48A 1BGXH 3W25A 3OR7A 2Z4QA 3IN0A 4UUJB 2BZ7A 4FDWA 1ICQA 3BOVA 3G3DA 2EEXA 2YL5A 3G3LA 4JXCA 3KDOA 3BN9D 1G7QB 2DQUL 5E6IA 4FG2A 4DZ8A 1B88A 3CBJB 4L6HA 2X16A 2P5WD 2O56A 4FL4C 2PEVA 4EO5A 4IMFA 3L3IA 2NXZD 3ME0B 3ZXWA 3EOBA 1MCRA 3UR7A 1KXVA 4HNOA 3UGRA 3QOKA 2Z34A 3HPZA 5DQ9A 3FNKA 2NY6C 5AOMA 5LNWA 1P4UA 1EF3A 3M1OA 1E90A 5HHPA 4CQBA 3W39B 2P50A 1TPH1 25C8L 4GMTL 1VERA 4RL3A 3WKNA 3SR7A 2LFEA 3K6DA 3HOJA 2ZF9A 1LO0H 3CUJA 3FFCB 4LLMB 4G9FD 3S2AA 4BXSV 4M8RA 1QZNA 2HKFH 2BDNH 3NNTA 1UZ6F 1UB6B 4J2MA 4DPCX 4TLKA 1A7RH 2IOMA 4YAQB 1Y18B 4E0CA 5GNYA 3QIBB 5D4YA 3RX7A 5JO5B 5HGAB 3BCJA 2Z8SA 2R2EA 3GR8A 5EC1B 3VX1A 1I8AA 4IKNA 4F9LC 4PAZA 2BMKA 4FQ2H 1ZE3H 2ZPKL 1V0NA 3X13B 3WKYA 1CE6B 1S4IA 4IRSB 3W7QA 4A2RA 2ZA2A 1OTSC 4I2XE 3MA7B 1IAMA 3BE1H 3OKMA 4NJIA 2EIMB 3QSKB 1S39A 3VQMA 3N2CA 1HQRB 2IG2L 2HRWA 3CAKA 2G60H 4Y4FC 1LEIB 4F5CA 3VH8A 2NXGA 4PJ5E 1J96A 3W0KA 3NL3A 2OX5A 4YHZH 2FBJH 2YWZA 5F7KC 5FV1L 1MMFA 1AP2B 1EH9A 5FO7B 3BDBA 2PO6B 3AM8C 4JRYE 4LTSA 1WKYA 2Y3NA 4HVBA 2OULB 4HT3A 3MACH 3S35H 4A7QA 3UP8A 4CC4C 1WZ1L 4A6GA 3TX9A 1DBJH 1JF6A 1QNSA 2WWKO 3DJRA 2L0DA 3IN2A 4HZ7A 4X4KA 3FSTA 2WSPA 4