1QI5A

Mutant (d294n) maltotetraose-forming exo-amylase in complex with maltotetraose
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHNTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of catalytic residues in alpha-amylases as evidenced by the structures of the product-complexed mutants of a maltotetraose-forming amylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
molecule keywords PROTEIN (EXO-MALTOTETRAOHYDROLASE)
total genus 144
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1999-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qi5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qi5A01
5CLTA 1BYBA 3AYRA 1WPCA 1E5JA 2O9TA 1GOMA 5D9MA 1VEMA 1B9ZA 1MW2A 4A4AA 5CZKA 4JL1A 3T2QA 3VX0A 3SCOA 3WD3A 1LWHA 3VIPA 2X2IA 4IISA 2F7QA 3DHPA 4PTMA 2DT2A 3N13A 3ARVA 3PTMA 3VDCA 1UASA 1E3XA 3WL1A 1N82A 1K6AA 4W7UA 3QOKA 4MJ2A 1E40A 2VQTA 2X0HA 2WHMA 3AS2A 2J79A 5C8BB 3N11A 2FHCA 2D23A 3AIEA 4JAWA 4J27A 1FHLA 2WMFA 1R86A 1GQKA 2DIEA 1W3HA 1E6QM 1UA7A 1BFNA 4KGLA 5A6BD 3L4VA 1CTNA 3ZQ9A 2DH2A 2XUCA 2D2OA 4R5EA 2GUYA 3FAWA 1JFHA 4GINA 2WMGA 2Y5EA 4AZIA 4CKQA 4PMNA 2MANA 5KEZA 1KFWA 3UR8A 1UUQA 1IV8A 1D3CA 1E0VA 1NWUA 2E8YA 5IFPA 3BLBA 4CN4A 1ZJAA 1QW8A 2WLZA 4F9DA 2GJXB 1JYVA 2EPMX 2CBJA 3KEHA 1BSIA 4Y7EA 1HXKA 2GJPA 3U5UA 2WVVB 2O9PA 1R75A 3VGGA 3EDJA 2WSPA 3VIIA 2YFOA 1V0KA 1BYCA 5CLWA 3QR3A 3GNOA 4LYRA 3ALGA 5FL0A 3VVGA 1XGZA 2XN0A 3WF1A 3IK2A 3BUPA 5D9PA 4MPKA 2ZXBA 1OSEA 4LPCA 4RL3A 2ZIDA 4GZIA 2WK2A 3RM4A 4XV0A 3CGTA 1E43A 1QVBA 4OUEA 1V3JA 4RE4A 4ZE4A 1HVXA 4RE2A 1EO5A 3EYPA 3KL0A 3CV5A 3DX0A 1CXEA 4QDMA 5BRPA 3GYCA 3THCA 5IFTA 1EOKA 2CNCA 3WEMA 2CYGA 1GUVA 1BPLB 4TUFA 4PN2A 4QLLA 4F79A 2FHFA 3KZSA 3NDZA 5LA1A 4E8DA 1W9XA 3AMDA 2CESA 4WSJA 1J0KA 4UFKA 3BUQA 1GJUA 3OA5A 1E1FA 1V0NA 5GNYA 1XCXA 1VJSA 4DUVA 2J4GA 2WB5A 4DWSC 1UR2A 1WKYA 4EAMA 3HMCA 2QHAA 3CHFA 3TTSA 4TX8A 3F5LA 1FH8A 1UR1A 1JI1A 2G3MA 2XHYA 4FLRA 2DSZA 3IJ9A 1CZ1A 3WH9A 1UH2A 3RIKA 3AS1A 3H55A 2VVSA 3A47A 3N04A 4AZ7A 5IDIA 1PEZA 3TA9A 3AXIA 4JFUA 4UQ9A 2E9MA 4PMZA 1LL7A 2VNCA 3TOPA 2W5FA 2OSXA 4UQCA 1ISVA 2DPEA 1GORA 3AOFA 3GNRA 2Y8KA 3MMWA 4D6DA 1XV8A 1JF5A 1ISWA 3EJRA 3WD1A 2VCCA 2YJQA 1XRVA 1CNVA 4JFSA 1UWQA 3EDDA 2EPLX 3OLDA 3AJ7A 2V3DA 1QHOA 2PWEA 5A1AA 1PZ2A 1U2YA 1E0WA 3K4AA 2QF8A 4QAWA 1CGUA 5JBDA 5HNNA 1UWUA 1WNOA 3PZOA 3WH7A 3ARUA 4U5KA 1TVNA 1QNRA 3A6OA 1CGYA 3NUKA 4NRRA 3APGA 1MFUA 1NWRA 1BG4A 3AIWA 2WSKA 5GPRA 4MJ4A 1B3WA 1E73M 1H41A 4K68A 3WEZA 5A69A 3VIMA 4FLOA 1R33A 1UD6A 3A22A 2HVMA 3D4ZA 2A3HA 3ZT6A 3ARSA 2F7PA 3II1A 5EMYA 5A8MA 4Z2GA 2YBTA 4GKLA 4CVWA 2XVKA 3MMUA 4M80A 1XH0A 1CGTA 5E1QA 1VEOA 1G5AA 1JI2A 3BLKA 2F1AA 1NP0A 1VFFA 3S2CA 2YFNA 2CBUA 1LJYA 1B2YA 1P6WA 1UKSA 4MNKA 3MSDA 3CZ8A 1FFRA 2DDXA 2XN2A 3PN8A 3L4YA 3WDIA 1R8LA 2E4TA 3ZSSA 2G41A 2VZOA 2BS9A 3PZGA 4WK9A 3VMOA 5KZ6A 2FGLA 3EJQA 1I1WA 4LYPA 3OZOA 2WCSA 2EO7A 3W4RA 1V0MA 3FNDA 2XFYA 2VX5A 1BQCA 4PMYA 3FY1A 4Z2JA 8A3HA 1AQ0A 1NOFA 2YDRA 3RPMA 4HPGA 3DYMA 4FNQA 3BCDA 3MS8A 1KWKA 3AMKA 3WMSA 3VGFA 2DQXA 1Y7VA 4AIOA 2ALWA 3F5KA 3PTKA 3VD3A 1TQVA 2XPKA 1HWWA 4LYQA 1KCLA 2FHBA 3BMWA 3HN3A 2VRKA 2EABA 4P7OA 5I3DA 5I2UA 5FL1A 3OGSA 1LLOA 4CGTA 1DWAM 2VZVA 4MNLA 1U30A 1E6RA 3WDJA 1G01A 1RH9A 2W92A 5ABGA 2VZUA 2FE0A 2GK1B 2PI6A 1QWNA 1HJQA 4PEEA 2G4FA 3T09A 4UCFA 1XSIA 5ABFB 3K46A 2Y8VA 3GH5A 4FMVA 4AY1A 3M07A 2CITA 4D6GA 3BVVA 1W1TA 4PMRA 2O9OA 3UERA 2GJRA 3AQUA 3MANA 2JF7A 1X1NA 1QNOA 1KCKA 1QWUA 1W3KA 2IXVA 4AWEA 1ODUA 3GM8A 2X2JA 3VIGA 2J7DA 1SMAA 1J0JA 1JDDA 3VIKA 3WKZA 2OWCA 3LPGA 1UQYA 4U3AA 2Z1KA 3D4YA 1HXJA 3W6MA 3VGHA 1HN1A 4WJXA 1H3GA 1QI5A 4KRUA 1JG9A 4MADA 1GZJA 3I3EA 3ZR5A 1RP8A 3MV01 3TONA 8CGTA 1CYGA 1MWOA 5CPSA 1CECA 1UKOA 2DT1A 1O6IA 3U57A 3A24A 2XGBA 2G3JA 4DO5A 2W62A 4TVUA 2BV9A 3PHAA 4GZJA 3VDHA 1V3KA 1E56A 5A8PA 2W4XA 1WZAA 3GBEA 1ITCA 1JFXA 1V0LA 2ZOXA 2Y4SA 3PZTA 2JALA 1KXQA 2D20A 3H54A 1EQCA 5A94A 4D71A 3WQ6A 3MKKA 3TTQA 7TAAA 2CERA 3W81A 4FNUA 3AHZA 2XWDA 2DSKA 4U2YA 1L0PA 4GI9A 2AOSA 1XHGA 3VDBA 4B9YA 2OW6A 1J10A 4PSPA 3UETA 5GNZA 3AI0A 2ZUNA 2WCGA 2BY2A 1E4NA 3BC9A 1XYFA 1ZU8A 5DO8A 4N42A 1KQYA 4OZOA 4AD3A 2DGAA 3HU7A 1OGGA 4OOUA 3DDGA 4GQQA 4UQAA 1E3ZA 4YN5A 2C7FA 2TAAA 4P7QA 5BWFA 4TVDA 2ZX7A 1GONA 1OGBA 4H7VA 3AHYA 2JF6A 3GNPA 3PZQA 1DWGM 3VGBA 2UY5A 1UWSA 4NXSA 2XM2A 1KR0A 3WH8A 4HMEA 2A3CA 4BQ2A 1B30A 5FKYA 1UZ1A 4UQDA 3VX1A 4UFHA 1EOMA 1X6NA 1GOQA 3T2PA 4PMVA 3GBDA 3WQ5A 5C71A 2X0YA 4PMDA 3AFBA 1ITXA 1W1VA 3AROA 5I6SA 1DHKA 1WE5A 1ZL1A 4D6EA 4AYSA 1FFQA 2Y24A 1BHGA 3EJPA 4H8UA 2X2HA 4AW7A 4UTFA 4HMCA 3E1F1 3T0AA 1OIFA 2IUZA 4YHEA 5AC4A 3D5HA 1SZNA 2GDUA 2BY0A 1ISXA 2PF0A 2D3LA 5CQ1A 2XN1A 3LRKA 3K8KA 5A8QA 1JNDA 3WBAA 1JZ6A 4OBRA 3N18A 1KWGA 1CXHA 2WNWA 3SCPA 3LXBA 3BAKA 1ODZA 4P7RA 3O6AA 4GI8A 5TD4A 3AZTA 2Y2WA 1WDPA 3DX4A 1JXJA 3W25A 2BHUA 3M7SA 5I77A 4ZFMA 4XB3A 1O7AA 3BUBA 2FH8A 2CETA 3WD4A 3LRLA 2J62A 5EBAA 3W29A 3AXXA 4B3LA 5LA0A 1GQLA 2DT0A 1HT6A 4CVUA 3RJYA 2ZWYA 4N0RA 5A6SA 4D6IA 1E70M 1CENA 3NIYA 2YL9A 2XIIA 1R87A 4MAVA 1UD3A 1K9EA 3G6MA 1BTCA 4ACZB 2XWEA 5BROA 1J0ZA 4AZCA 4UFIA 4P8XA 4Z2KA 1LL4A 1J9YA 1UD8A 2WKLA 2YA1A 2CKSA 3CZGA 4AZ5A 5D9NA 3ARYA 1GVIA 3L4TA 3W37A 3SUSA 1DWFM 4AISA 2WHKA 5BRQA 3SCSA 5BCAA 1UH3A 5I23A 3VUPA 2E40A 2ESCA 3BAJA 2A3BA 3A21A 1EDGA 4HZ8A 2VX7A 3QHNA 5JUVA 4PMQA 2EPOA 3U5YA 1QI3A 4W5UA 1R47A 5LA2A 5D8ZA 3WF4A 1LWJA 2J7GA 2V3GA 1MVYA 3NSXA 4EANA 1TQUA 3WMCA 1UQZA 1WP6A 3ARQA 4DM1A 1Z32X 4HOWA 1BF2A 4AIEA 4AEFA 3VTRA 2NT1A 4LQ1A 4M81A 3WNNA 1KQZA 5DEZA 1JYNA 1HL8A 4JL2A 1GOWA 4NI3A 3EDEA 5I5RA 3BH4A 2DEPA 3CUIA 4W8LA 4CCEA 4CU8A 4UFMA 4WKAA 3D51A 3AIVA 4NZFA 3ARTA 4W93A 2E9BA 3CO4A 5I24A 2YLLA 3WSUA 4M29A 1V02E 1ZBKA 4AMXA 1JDAA 1BGAA 2WAGA 4PMXA 4ML4A 3ZJ6A 3WUEA 4HU8A 3DECA 3L4XA 3I3DA 4W87A 1DP0A 4M24A 1YQ2A 1Q6FA 3WNLA 1W3LA 4GPNA 3SURA 1HKJA 3UR7A 4P8VA 1NOWA 5ECUA 4TOQA 4LX4A 1EGZA 4AD4A 1UWTA 4DO6A 1HJXA 2NT0A 4PTVA 1V08A 3WNKA 4D1IA 1MXGA 4J3VA 2XYLA 1W9DM 2CBVA 4PBGA 2WANA 5ABEA 1NH6A 3EMZA 4NX0A 2YLAA 4KMQA 1JD9A 2DSUA 4F8XA 3WIJA 1WDRA 1PX8A 1XD1A 1EA9C 2WHJA 4W5ZA 3VD5A 3GXFA 4OKDA 3PBGA 4L4PA 2XFFA 1FH7A 4CU7A 3WELA 1C7TA 4U33A 2BFGA 1VBUA 3MU7A 4B9ZA 1D2KA 2GFTA 1M53A 3VD9A 3KLLA 4CD7A 1FHDA 2ZX6A 5DT5A 4HZ6A 2DIJA 4DWSA 2YL8A 5CJ5A 3L4WA 3VSVA 3A23A 3MMDA 3BVUA 1BG9A 2EPNA 1GOOA 3OBAA 4PTWA 1UD2A 1QPKA 4CCDA 1K9TA 1V3LA 3OIHA 1PBGA 4AD0A 1M03A 3VMPA 1BGGA 4EK7A 4C7DA 2J78A 3BXWA 1I1XA 3GXDA 3SCUA 3CZEA 3RJXA 3O2LA 2C8NA 3VD7A 3S5YA 3FW6A 4CD8A 1E72M 3WD0A 1WZLA 3VINA 1TA3A 1Q6CA 1GPFA 2O92A 3N12A 1GCYA 2DH3A 2E0PA 3IANA 2WMJA 2EACA 4J3XA 4B15A 4UZSA 4OIFA 4CD4A 2D1ZA 1H49A 5A6AA 2JEPA 4M1RA 4NF7A 1UWIA 5AYIA 3CC1A 3ZSTA 1QI0A 4D6CA 1IZJA 1SR0A 4OGZA 3I3BA 3PZNA 4KH2A 1E6NA 2Z1SA 1XD0A 3WDHA 3UEQA 4PTXA 3RMEA 4IM4A 3WDQA 1PZ3A 1JXKA 4PUDA 2BVTA 2BNJA 1CGVA 1UA3A 4F9JA 4MB5A 4Z2HA 1ZB5A 3AMCA 3EMCA 4H8HA 2V5CA 4ZENA 5HDRA 2CCRA 2XVLA 3S5ZA 1I75A 4UFJA 5CG0A 3VILA 5CGMA 4ZEPA 1CXFA 2ZXQA 3AZSA 2ZUVA 1PIGA 4P7LA 5M03A 2G3NA 4GQRA 5HBFA 4JFVA 4FF5A 4TXEA 3WUFA 2XIBA 2JE8A 3L4ZA 3M46A 4CN1A 5E9AA 1B1YA 3CHEA 4W86A 2FH6A 4DWSD 1RPKA 4MDPA 4QCEA 5DFAA 1W32A 4AD5A 4MB1A 3PZVA 4ZXOA 1KR1A 3GTNA 4A3HA 4GXPA 1UD4A 3HG2A 3TTOA 2PBGA 3CIVA 4J28A 3VGEA 1FA2A 1JNEA 4HZ7A 2DT3A 3NSMA 4AXNA 1VBRA 3DHUA 2WVVA 3D3AA 3IGUA 3MI6A 1DWIM 3BVTA 2WPGA 3WMBA 3ZT5A 3SCRA 1OD0A 3K1DA 1XYZA 3AHTA 3AHXA 3LRMA 5JBFA 1E6PA 2A3AA 2QMJA 3WQWA 4W89A 4NXKA 3POHA 4PCSA 4U31A 3W53A 5E6ZA 3CLWA 2WBKA 2XM1A 3O9NA 2X09A 2D0GA 3EJUA 4P8WA 3WFLA 1JGIA 3HZ3A 4J3WA 2VI0A 2EADA 4HTYA 1VIWA 2WZIA 2VQUA 2ZX9A 4JFTA 1V6XA 3BVWA 3KLKA 4LGXA 1B3ZA 2VJXA 2OLHA 2J75A 1VEPA 3MO4A 2WMHA 3PTQA 2B31A 2BVYA 1LG2A 3EBVA 2J7EA 3VM5A 3ZOAA 1OBAA 4HPHA 1W1YA 4XZWA 1VFUA 3HG3A 3GZAA 3VDAA 4ZE5A 2QV4A 3N17A 4UOQA 3ZMRA 1HKMA 5E0FA 3KE0A 4QLJA 3QOMA 3T08A 1XCWA 2OWWA 3SUUA 5M5DA 3TV8A 2VC9A 3WY1A 3GDBA 4FK9A 1LL6A 1GW1A 2D24A 3WN6A 3KL5A 1G0CA 1MYRA 1TCMA 3VNYA 4FNSA 2YOCA 4HU0A 3DDFA 3HG5A 1T0OA 1TG7A 3T2OA 4W88A 3ARPA 2BHZA 2BY1A 2X05A 1RP9A 1WAWA 5A3HA 1CXLA 2VO5A 4NRSA 1DTUA 3AMGA 1QBBA 2J7BA 4GI6A 2W61A 4HA1A 3ARRA 3MUIA 1NQ6A 3CUFA 4AYGA 3H53A 1W9VA 4JCMA 2OSWA 1WDQA 1H11A 1XSJA 4BS0A 3OGRA 3WUGA 3NJ3A 4JKKA 3S6TA 1HKIA 1V6UA 3FHQA 4KRTA 2AMGA 2VTFA 2NSXA 3SUWA 2XJ7A 3ZR6A 2IXUA 1BYDA 1HIZA 2WMIA 3EDKA 5E70A 4UFLA 2W67A 4H41A 2YA0A 1AMYA 4GZEA 1BLIA 1K9FA 3SCNA 4W7VA 3CUGA 4IUGA 3GH4A 3VD4A 1OT1A 1H1NA 3EDFA 2QLYA 4BA0A 5IHSA 4H04A 2XVPA 1IZKA 1B0IA 1ISZA 4UR9A 2VT0A 2VCAA 3B9DA 3CZLA 3VGDA 2ZICA 2VCBA 5JBEA 2VRJA 4CUCA 4BF7A 3CHCA 2D3NA 4GO8A 2FDMA 1V02A 1OWQA 4PRWA 4W8BA 1E0XA 3EJSA 4GO9A 1C7SA 3DYPA 4C7FA 5F7UA 3RM9A 5DMYA 2UY4A 2GJXA 5CGTA 1D7FA 3GXPA 1UZ4A 3NSNA 5A8OA 1V3IA 1HX0A 4FNRA 5CSYA 2E8ZA 2UY2A 1SMDA 1Q6DA 4E4PA 4FNTA 1WZKA 5E6YA 1QHZA 1HNYA 4E2OA 1WZMA 3RCNA 3SUVA 3MV11 1GHSA 3NYDA 3MSGA 1XH2A 3VOCA 3WDPP 5BXTA 1ZBCA 5A8NA 1GHRA 1C91A 5D9OA 2ZX8A 2BXZA 1MQQA 3IJ8A 4EKJA 1EDQA 2WMIB 3OB8A 1MQRA 3BSHA 3SCTA 1E9LA 1NARA 2J74A 2PWGA 1JZ3A 9CGTA 2WZEA 1HL9A 2V5DA 4JIEA 5A2CA 1PJ9A 3VO0A 1UR8A 2JIWA 1EO7A 1J11A 1CIUA 3CUJA 3ZJ7A 1Q4NX 4X0NA 2F2HA 1DWJM 4BQ4A 3QGVA 2YIHA 1CDGA 4KWUA 5EFDA 3GXIA 2V3EA 3J7HA 1OT2A 2GDVA 1H0IA 1OD8A 1TQTA 1J12A 2X8RA 4AC1X 5C70A 3MUZ1 1UKPA 1MW3A 1QNPA 3SIMA 1CGXA 3FHAA 4A3YA 2W91A 4H2CA 4OJYA 3M6DA 4F66A 3W0KA 2EBNA 5BYWA 2WC4A 3CZSA 1C93A 3WD2A 3IAPA 1F4AA 3DX3A 3U7BA 1BVNP 1HF6A 1OB0A 5HPCA 1JZ7A 4TX6A 1PAMA 2WMKA 3LPPA 2X1IA 5AC5A 5A2BA 3WY2A 1ESWA 3W26A 1J18A 1M01A 3PZIA 5HOSA 1OIMA 2ZX5A 1VF8A 1CXIA 5CSUA 1G94A 3LXCA 1CBGA 1WO2A 1EHNA 5FD0A 2ZUTA 1O7DC 1AQHA 4DO4A 2VR5A 4MNJA 1EHAA 5DF0A 2PWDA 4C7GA 4QLKA 3ALFA 4NSBA 3UG3A 2AAAA 1F4HA 2J7FA 4CU6A 1JD7A 2WW5A 2J7CA 4XZBA 1NP2A 3TP4A 1AQMA 5DT7A 1EH9A 1CWYA 4HP5A 4IPLA 2GSJA 2WXDM 1V3MA 4WF7A 1A3HA 3VIOA 1W9BM 2XGIA 3AXHA 3WFZA 2YBUA 2D0HA 5I78A 3NCOA 5A95A 3B9EA 4OBSA 2PWHA 3WY4A 1CXKA 4CN6A 1E4MM 4QCFA 3A5VA 2CHOA 2DSVA 2QMKA 2F7OA 4J3SA 1H0GA 3RDKA 1PS3A 1HJSA 1QOXA 1UKQA 2W63A 2EAEA 4M8UA 3F4VA 1WDSA 1KTCA 3EJTA 1R85A 5IHRA 4Q22A 3VIJA 1B31A 1SYTA 5LYRA 4J7RA 3L2MA 2YA2A 3GH7A 1B3XA 3WQVA 1KXVA 1UOKA 2G3IA 3ZIZA 3QHOA 2CXGA 2O9RA 1HKKA 3FAXA 2EQDA 5IXEA 2HISA 3CBWA 2OSYA 3OG2A 2ZUWA 2PB1A 1PX3A 3WL0A 1H09A 3BUIA 3AIRA 3AISA 2GVYA 3CTTA 3VNZA 1GOIA 2IGTA 4E8CA 3HJEA 3WDRA 3BMVA 2WCAA 4BQ3A 1FH9A 2BHYA 1OCQA 2EXOA 4V27A 3MUY1 1US3A 1GNXA 1J0HA 1J01A 1QHPA 1LQ0A 2XFRA 4ATDA 1TQWA 4RE3A 1E15A 4HMDA 5BXSA 1LF1A 3RILA 3WF0A 1MW1A 4W84A 3IAQA 1CLVA 2WZHA 5D4YA 5EFFA 3ARXA 3SCQA 3T0BA 3W27A 3DX2A 1MW0A 1HP5A 1A47A 4J3UA 4ACYA 2J47A 3LX9A 1C8XA 3WH6A 1E55A 1JDCA 3SEPA 1UH4A 2F8QA 2WVUA 2WLYA 3ARZA 3CZJA 2J25A 4R27A 4ACZA 1BAGA 2OYLA 2VX6A 4FLQA 5FOOA 1HP4A 1W3JA 5HPOA 4BZYA 3GXNA 4JKMA 2VMFA 3DX1A 1VENA 1GQJA 4PUEA 4HOXA 4HA3A 4UNIA 3AHVA 1VRXA 1KBBA 1EIBA 3WEOA 4JHZA 3DC0A 3CUHA 4PCTA 5GNXA 4V2XA 4WSKA 4JHOA 4CCCA 3BUDA 2NW0A 4CD6A 3BGAA 3N1AA 4AMWA 2D0FA 2ZE0A 1WB0A 3BSGA 3RM8A 1UYQA 2WWDA 2XVGA 4CD5A 2Q8XA 4D6JA 3VKKA 2YKKA 3IJ7A 1GVYA 3WQ4A 4X9YA 1W9UA 1UR0A 1VFMA 3PZ9A 4W85A 1LG1A 3OGVA 2BY3A 3L4UA 1JAEA 2YL5A 3AIUA 1TA3B 3KL3A 1UWRA 2J77A 4AZCB 2CKRA 1V6VA 1RD6A 1J0IA 2E9LA 1CGWA 2XSAA 1UD5A 4MAZA 1AVAA 2GK1A 1KTBA 2VR4A 1KXHA 5ABHA 1G9HA 2V3FA 3UCQA 3D52A 5CXPA 4J3TA 1BYAA 1EDTA 5A2AA 3CZNA 3POCA 2D22A 1PX4A 3ZO9A 2XSBA 5AYBA 1M04A 4EE9A 3WUBA 1C3FA 1US2A 2F1BA 1X6LA 1B90A 1JAKA 1R7OA 5D8WA 1C8QA 3LPOA 2A3EA 1H5VA 1KXTA 2F18A 4WIWA 1R7AA 1DEDA 4AIUA 1JIBA 4AD2A 4DM2A 3HG4A 5A6JA 1E5NA 4XX6A 1OINA 3ZJ8A 5E09A 1HTYA 1QNQA 1HJUA 1C90A 4YPJA 3BAXA 1S46A 3AIBA 5CPQA 3EMQA 3SCVA 1QNSA 4U5IA 3VSUA 3K8LA 1FP9A 2W66A 3AZRA 3VSTA 4PMOA 2YDSA 4D6FA 1W9PA 2WVSA 1OGSA 1ZBVA 4WKFA 1MXDA 3A4XA 4AD1A 5I79A 3AS3A 1H2JA 1E1EA 4BQ5A 1H4PA 4MTVA 4HOZA 2XVNA 1GJWA 1M7XA 4MB3A 3UG4A 2V38A 3CPUA 1WCGA 5CPTA 1QI4A 2C0HA 1G1YA 4XUYA 3W24A 3A4AA 4TTGA 1W91A 1TE1A 4D72A 1IT0A 1KGWA 1OM0A 3A4WA 2F7RA 2CIPA 2D73A 3WF2A 1UKTA 2UY3A 3QHMA 4TVCA 1NWTA 3WNOA 4UQEA 3N9KA 3LXAA 3JUGA 3ZM8A 2ZUSA 2ZXAA 5E0CA 4BCEA 1TVPA 2XG9A 3AMLA 4H8VA 3VMNA 4LXFA 1NOUA 4P7NA 3ECQA 1EQPA 3B9AA 3N15A 4URIA 1VAHA 4AMCA 1C92A 2VZSA 4AZHA 1JZ8A 1MQPA 3W38A 1W2PA 1E6SM 2VVNA 1NWSA 1JYWA 4UZUA 3BLPX 3WNMA 4OOZA 1CLXA 4IPNB 2WWCA 1XH1A 3CH9A 4JZ5A 2WKGA 4FNPA 1NM9A 2X2YA 2E3ZA 1E71M 5A6BA 3GXTA 3CMJA 1Q6GA 1W1PA 2RGLA 2PC8A 4QFUA 1UR4A 1XC6A 2YL6A 5HXMA 4B16A 3GXMA 3L2LA 1UR9A 2CEQA 3OZPA 4TTUA 1TMQA 1JZ5A 2BVDA 3VIFA 2DSWA 3ZT7A 3A3HA 4P8UA 4L4OA 5ABFA 3K4DA 1GQIA 2CBIA 4HA4A 3WQ8A 1V6WA 3CMGA 4JKLA 1V6YA 2RGMA 2WHLA 3LMYA 3W28A 1ISYA 1UHVA 1TZ7A 4QP0A 5JIPA 3MUAA 3VIHA 2XTKA 3VU2A 4B3KA 3OLIA 2UWFA 3VPLA 3ZJKA 1E4IA 1QI2A 5BXRA 4PSRA 1ZBWA 2EEXA 1TQSA 3DYOA 2PBOA 2YDQA 2WM0A 1E4LA 4ZXLA 2EPKX 7CGTA 4UOJA 1B3YA 4PMUA 4MDOA 4AZGA 1HVQA 3BAYA 3BVXA 2JFEX 2WYSA 5JIWA 4UOZA 3BCFA 4W8AA 4ATWA 4Q7NA 4FLSA 4D1JA 3CHDA 4MNMA 4WKHA 1JYXA 2FGZA 4U3CA 4S3KA 1PPIA 1K9DA 4YHGA 3PZMA 4PYSA 2JIEA 2FYVA 3W6LA 4U2ZA 4W7WA 1XSKA 1W2VA 4DUXA 2J8FA 2OYKA 2WC7A 1B3VA 3OLGA 3VM7A 1PIFA 4UQBA 3PZUA 4WLCA 1R46A 6A3HA 2F61A 1V3HA 1VJZA 3AIQA 1L8NA 2VUYA 1QBAA 4X0VA 1BVZA 5BXPA 1KGXA 3T0DA 3AS0A 3BAWA 1ZS2A 3D50A 2ZUMA 4AZBA 6CGTA 2J7HA 2BXYA 3THDA 2WVTA 3SCWA 1SFSA 3G6LA 1MFVA 1VFOA 1Q6EA 2WC3A 3CZKA 3AICA 3U7VA 2JEQA 3BAIA 3RO8A 5A6KA 1JZ2A 1E6ZA 1ZJBA 2CPUA 2VOTA 3UESA 1FOBA 2OYMA 4V28A 1E6XM 4NZJA 4NZCA 1DWHM 3W82A 5FIPA 1TUXA 2ZUUA 3UG5A 4GIAA 1C8YA 1FP8A 4DUWA 3WBEA 5I0DA 3NDYA 7A3HA 1KBKA 3AYSA 1JZ4A 1QX1A 1CEOA 4M82A 1QW9A 2WBGA 2ZWZA 3FXYA 2EJ1A 1JF6A 3WNPA 3SUTA 4D6HA 2VZTA 2CHNA 2VRQA 1GOKA 3OLEA 1ECEA 4ATLA 3B8SA 2QPSA 4AZ6A 3WF3A 3TTYA 1TFVA 2QPUA 1U33A 1KGUA 6TAAA 1CPUA 4MB4A 5EB8A 4JFWA 1UG6A 3WY3A 3ARWA 3KWXA 5A6LA 5GQBA 5A6MA 3FN9A 4M56A 2G8ZA 4S3JA 3LPFA 2VX4A 2ZXDA 5FCZA 1HJWA 3WENA 1JL8A 1HJVA 4AEEA 1J0YA 1TR1A 1VB9A 5AY7A 2VL4A 5M3WA 2OWXA 3F5JA 3WH5A 1V03A 1EXPA 5M17A 4Z2LA 2OW7A 3K8MA 4DWSB 1YHTA 2VURA 4Z2IA 4JCLA 1KB3A 1R34A 2PWFA 4KGJA 2J8GA
chains in the Genus database with same CATH superfamily
1KBGL 5BU6A 1D6VH 1E5JA 4QITA 4LKXB 5E6RB 1POKA 3OKLB 4Q7DA 3BXNB 5F70A 5GSVA 4HPOL 5KJ4A 3PJUA 4B90A 2FMOA 3CK0H 1MW2A 4OD3H 5IHLB 3VWKD 5E51A 4XMWA 4FZEL 4NAEB 3GI8H 3T2QA 1UB3A 4W9GC 4Z3TA 5C2CA 4HIJA 1PWMA 3DAQA 1XLIA 3QEGL 2YGOA 2JCCE 3DHPA 1XMEB 2DT2A 3RHWK 3LJ3A 3P1VA 4PJ7A 4S2SA 4HUXA 3ZJAA 3ES8A 1PO9A 2X38A 2NY7L 3WL1A 9RUBA 1RBAA 1OWWA 4Z1CA 4OFVA 4Z3EA 4KTEL 4DJDA 2GC4C 5D71H 4EF8A 1VA9A 3WKNA 1N6QL 3QOKA 1ND0A 2FPYA 2WHMA 4HNCA 2UZIH 4N4PA 1F42A 2J1YA 3EWUA 1RZJH 1WAEA 2H6PA 1YPXA 1AO7E 2JJSA 1A3XA 2D23A 5K3VA 2PNDA 1WK0A 3QLLA 4OR1A 4JAWA 1MCQA 1XLEA 1GC1L 3L95B 1AZRA 3JWNE 4J27A 4M3HA 2FEDD 1FHLA 3S6DA 3NCEB 5IB4A 3WK1A 4WI3A 4ZW8A 4NQDD 3OQRA 1DE4B 2XU2A 4C6EA 3LIZH 2BCKA 4FADA 1K72A 1UEMA 1Y0LA 2B39A 1EFXB 1RUKH 3VI4F 4JGDA 4WHTA 1BFNA 1IEIA 1A1MA 2JKJA 3AM8A 2QV2A 3D18A 2NYYD 4KZEH 2C19A 2OMWB 3TN0B 3KS0H 1ZENA 4BFRA 1KM5A 4I13B 1JUEA 2YC1A 1CTNA 3VNDA 4RGMC 1XIFA 1UJ3C 3SHSA 1WAAF 2VEGA 2QGCA 4UBDD 1U8KA 2R8WA 4HNNA 2IGFL 1BGXL 3O9WD 4R5EA 3UGVA 3X12B 3ZE2E 1JFHA 2WMGA 3CC5A 4Y9CA 5DUBA 1M7UA 2Y5EA 3LKQB 4IHOB 1L6YA 1AR1C 4X6CB 4CKQA 2MANA 2QF7A 3PJTA 5KUKA 4Z7NF 4PMNA 1NCBL 3RR4A 5IW6B 1A6UH 1IV8A 2C9QA 2CKBB 3AGWA 1D3CA 1I7TB 2HJLA 2E8YA 2NY2B 4GYFA 2Z7GA 5JIHA 1TUPA 3NQMA 2BSED 4PIRF 4PP1D 3O3DB 1AQDB 5E6ID 2PETA 4KO6A 4LLWA 2PE4A 3WNIA 3BUVA 3L0NA 3ARBA 4H26B 1FCCA 2VEPA 1HSAA 3B6SB 4GFSA 3MNVB 2PTTB 4O1AA 1U8IB 2XGZA 1T83A 3LKRB 3W11C 2NX5B 4LCIH 2IPKB 5AW1B 1G9EA 1JYVA 1DVXA 3FCGA 2WLKA 1P4CA 2Q01A 4RWYL 2CBJA 3KEHA 1BSIA 3SGJA 1TMLA 1M3IA 4Y7EA 3QNZB 1HXKA 5T5FA 3CN4A 1T0MA 2IIJA 2PDHA 2IC2A 1R75A 1A22B 3IM1A 3OAYH 3VH8B 4AV5A 4F7MA 5HMEA 3UPBA 4DLMA 1MI5E 4Q8OA 2WSPA 3VIIA 4TN9A 5JW5A 1V0KA 4XPHH 4WFHE 5LBSL 1A7NH 4L5FE 5C0RL 2QQNL 5D2LB 3B3IB 3QR3A 4IKLA 3BDYL 5HYJE 1HTIA 2ADIA 4QRSA 1TJRA 1SLUA 5FL0A 2A38A 3UZEC 2WZPA 3RRXA 3WF1A 4IRJA 3BUPA 2GBAA 1CZ8H 2QT6A 4MPKA 5IROA 4RL3A 1ZHNA 4GUCA 3RMJA 3S83A 1JPTH 3RM4A 3CXOA 4XVJH 4XC1L 1J1PL 1E43A 3CGTA 3MYJA 3RX9A 5KVEH 1D9KB 3QDGA 3DFHA 3MA9H 1V3JA 4WU5B 1RKRA 4JVUA 2CDFB 1ZTXL 2NX5A 4ZTPL 4M6OL 1AJ2A 1KCZA 4RE2A 3FPXA 2A9CA 3VA8A 1ACYH 1ZRUA 3DX7A 3Q1SH 3S3PA 3SGEH 1LO3L 2P0IA 4O2EB 1X7IA 4HJGB 3TVAA 1L9TA 1FYTA 1C08B 3RDTD 4PJHF 5K9KB 4Y9GA 3TMQA 5AOZA 5BOJA 4IF2A 3NQDA 1N59B 2H41A 1GUVA 5D2LA 4Z8FL 3TSBA 4FCAA 3GK8L 1IEHA 1G6RH 4PRPD 3CFMA 2Q1EA 2XWRA 1OT4A 4HHWA 5EZJA 3FUKA 1XHHA 4V1DD 3SB3A 4BFBD 5AHIA 5IOBA 3IU3A 4G1EB 3RPBA 2YAMA 1EAJA 5DHMC 1USQA 4R5XA 2FO1A 1T3FB 2VLRB 3SDYH 4LOUC 3W87A 1N64H 3BOLA 2N3JA 1GJUA 3OA5A 1CLYL 5CPMA 1TR9A 2X7VA 3U6RA 4MTMA 3DX7B 4HHAB 5GZOD 3GRWA 3I9GH 3C5JB 3NO3A 1H3WM 3MOAH 3LD8C 5LIWX 1NMAL 2AEQH 2WB5A 4DWSC 2C3GA 4LEXH 4XVSL 4R90L 5FW7A 1WKYA 2NR6D 2V2DA 2GBTA 4K94L 3SPVB 3U7WH 2V5BA 3QNFA 2EG7A 3CHFA 5F89B 3TTSA 3GFYA 4PL2A 2OJZL 4TX8A 1KYOK 2BX5A 4PJ8D 1T7LA 1DPMA 3KW8A 3G1FA 4RISH 2IDSA 3DRQA 3DUUA 2G3MA 3QUYB 4KJPD 5GRYA 1BXNA 4JTLA 3FRPB 3SDAB 3SDCC 1H19A 4MJID 3N2JA 4JE0A 1A5SA 3RIKA 3OG3A 4DVBA 5EN2B 1JDEA 3AS1A 2YUVA 2DL9A 4KJWC 1YDOA 1WYIA 2V30A 2ZAHA 3ZHLA 3DBNA 1IC7L 2WZMA 3FEMA 4AZ7A 1MCWM 5ERWA 2ZE3A 4PW4A 3KBEA 1KM0A 1QACA 5E6IA 3P7YA 4M5YH 1ROCA 4G5AA 5KVGL 2BSEA 3O2DH 1VFAB 3N55A 4R96B 5DUML 2R1KA 3TA9A 2D2JA 3NYZA 3RZCA 2NUPB 1S3HA 3LNHA 2AXFB 2LT9A 4DO7A 4FNLH 2QVMA 1O5QA 4NQ1A 3PXHA 4TV3A 1SOXA 1URZA 3JV6B 5FWQA 4K94C 2HJKA 4ODSH 5AAWA 2OOGA 3VG0H 4KCUA 5EC2B 2OSXA 5L9DH 2CM6A 1Y6MR 2VXTH 2XXFA 4JANB 2ACUA 3EYUL 2DPEA 3GNRA 3NNTA 4R2GD 4XD6A 5F7WC 1LEGB 2J2ZA 3MJGX 3WG6A 1FVDB 1I1AA 1MFDL 5LXGL 4ZFOA 4EF9A 3V4PH 3IEBA 3OPZL 4UILL 3IXTA 2QJDA 1BFVH 2YJQA 3CN2A 3MV7D 1R5IB 4J3OD 5B8CB 1IT9L 5DZ9A 2ORBL 4KJQD 5E8PB 5E9DB 4CRPA 1AE6L 3EDDA 3NZHL 1X5GA 1QFOA 2XPZA 2ENQA 2V3DA 3UTTE 4DI9A 1QHOA 5T9CE 2KL6A 3QEUA 4OCXH 2K7PA 4FFZL 5A1AA 4H13C 1U2YA 2FZMA 2FLRT 1E0WA 2IO5A 2Y6SC 1CI5A 4JNZA 2B5IC 2PYEB 4ZMTA 4WRHA 1QW7A 3MJYA 2OMXA 3P77B 1A7OH 4PRAB 4DHLA 3GR8A 2GI7A 3I6TA 3O07A 1JV2A 4UTAL 1I7UB 4QWWD 1KBPA 1WNOA 4W70A 3WH7A 2NUTA 2W1NA 3O4LB 1MUWA 5D1ZD 4ZOEA 2AVGA 2DMKA 4F7CA 5FR3A 3VXME 2ZRWA 1XF4A 3ZWTA 4E6MA 4U5KA 2J6VA 1I8LA 4BUHA 2FX7L 3B9KB 3V0DA 3REQA 3UY7A 3QXTA 2MEJB 3NUKA 3QH3A 5JHAA 3OYZA 4XH2B 2Y1YA 3GUTB 5EUOA 2Q86B 1NWRA 3NZPA 4GNJA 4EIGB 2WSKA 5GPRA 4MJ4A 3N29A 3VWKA 3FSWA 1O6SA 3ISWA 4MIMA 3ETBF 5D1QE 1PDYA 4H6QA 2Z24A 1ZV5A 4YN3A 3CH8A 4FLOA 3SCMA 2A21A 4Q8QA 1UD6A 1RZ8B 4L4TB 1KLUA 4Q0XH 3VXOA 2HVMA 3PHQB 3PP4H 4F9PC 2A3HA 1RZGB 2R2CA 2E27L 3MO7A 3ZT6A 2C1PB 1UJTA 1Z3RA 2P45B 1F3RB 4XPGH 3QQ9D 4BH8A 4H1ZA 3ARSA 3IDMB 3E74A 2DAVA 4DGVL 2HDJA 5EZIL 3LCFA 4LDOB 4HYRA 5C07A 1AH1A 4JDZB 5REQA 5JTWA 2QJHA 1NAMB 4GAJH 3WAJA 1BM3L 3RAJH 4W68A 1KTDB 2E6FA 5GGTL 4RUBA 2CBPA 2IH1B 3B03A 3HOGA 3BLKA 3ET9F 5HHNA 4LVGA 2AGTA 1SQ2N 5MHBA 4JFXA 4B0MB 2UZ9A 3VKCA 2C3HA 2Y72A 2OI9C 4YBLB 1DKWA 4C6LA 3EYQD 1DQTA 1G9MH 3IFNH 4XCYB 2FATH 4KVCL 2X6VA 1HKWA 4TQTA 3N6HA 3FQNB 4UQ2A 4LF1A 2BSTA 5G5IA 2Y7GA 1E9PB 3KLHD 3U82B 1G7PA 3CDGB 4LF3A 1FNGA 1ZLUK 1XX1A 5A2LH 3VKDA 3MSDA 2HEJA 1AD9A 5I71B 4LVAA 2C1PA 1TJ1A 3FT3A 4KNQA 2ADGB 4NYLB 1M65A 3L4YA 1OAZL 3HFTA 2V17H 3VWJB 5GGRA 5EBMA 1B2WL 4FG6D 1MG2C 4HISA 1AG1O 2G41A 4MCNA 3LCHA 2PR4H 2I85A 4YZFF 4WK9A 2EICA 4NILA 4UI2A 3VMOA 2WO2B 3PBYA 4YWGH 5DN1A 2ITDB 1RLDA 3E6HA 3FT4A 2C9AA 2X1OA 1Y18B 3EJQA 4HYTB 3OJMB 3BQUB 1S9YA 1QTWA 1LLAA 1EXUA 4Z0JA 1OAYL 1F6AA 4OFDA 4DBEA 4P06A 4EZJA 4CNOA 3W4RA 3KPSE 4RFEB 1BAWA 3T7VA 3K30A 1J5HA 3TC3A 3LVEA 4OQTL 2VX5A 3ENLA 3FTZA 4PMYA 1AQ0A 3H9HB 5ESVB 3WSQL 4NWTH 5GGVY 1ILSA 1MLCB 1NOFA 3W1XA 2ISFA 3QN3A 3STZA 1J8HA 5C0GA 1ZE3H 1U95B 4IYKA 4X9HA 2VSKB 3SCMC 1AODA 4TPRH 4HPGA 3BJSA 5K4XA 4FNQA 2I7SA 3BCDA 5LKYA 2VKXA 5EOQL 2YD9A 1ZAJA 3O6DA 1UZGA 1M57B 3MS8A 4XZLX 3KJ6H 1TTAA 4AIZA 1MMFA 3QM3A 4M19A 3QEUB 3T8XA 2DQXA 1AP2B 4IRZL 2NUYA 3F5KA 1TQVA 5DHYA 3UH8A 1ACCA 3VXRB 1QDSA 1HWWA 1A7RL 3RA7H 3BMWA 1DR9A 3HN3A 2OK0L 4QQUA 4JO4L 1JEZA 3KBMA 4GGBA 1H61A 2MNJB 4RRPM 2CLOA 2CQVA 2WXNA 1WXYA 4F2ME 1A6PA 5I2UA 4UUJB 1NELA 3OGSA 3H3PH 2F58H 1IF2A 1XF4B 3G5VB 3WLKX 3M17B 4CGTA 3MUUA 4GZ7A 3SSGA 3ZTDC 2VZVA 4PRHA 2R56H 5AVXB 1U30A 2UYLB 4YO0B 3EX1A 3W1LA 4CDGC 2NCMA 3NAAL 4PVNA 4ZD3L 1J4EA 2VZUA 2ZRUA 3DZ1A 3EPNA 2VN5A 4AQLA 1PQZB 3NZRA 2GWNA 4QRUA 5DJAA 1DBMH 3ROOA 4OZHE 1ZHLB 4R7DB 4UB9A 4XO7A 2Z92B 4FXFA 1GKPA 2QCDB 1N18A 1PZUB 1TYJA 3T09A 2G4FA 4UCFA 1XSIA 5ABFB 1SDDA 3EYVB 4QXWA 4RQQA 1TPUA 3V5DA 1AA1B 4EWND 3MGTB 1H8SA 3BPNB 4FMVA 4IOIA 1RALA 1KJMB 3N6QA 1FVCB 4PMRA 3ML9A 2J88L 1E1CB 2GJRA 5AVRB 3AQUA 3PNUA 4K8RL 3MANA 4C6PA 4JY8A 3S37H 3HC3H 3L3OB 4RSYA 2HE8A 1X1NA 1W0MA 3QA3B 3LBOA 4B5UA 1HSBA 3U4EA 1AI1H 1BJ1H 4AK2A 4BDVB 5CD5C 1C9WA 4REQA 5F1IA 2DWDB 3CLFH 1KCKA 2DLGA 1A4LA 2DZUA 3QTGA 4AWEA 1ZK9A 5FDWB 4XBJA 1CR9L 3F05A 5KBMA 1L3WA 1FRGL 3SPHA 3KX6A 4NAFA 1J0JA 1GXEA 1PL3A 2YR1A 1W0VA 3FO0H 2B7PA 2PDBA 2BZNA 3N3MA 2AV1A 2X4RB 2P7TB 1DQMH 2WOYA 2Z1KA 4KQ4H 4U1IA 5CS7A 1TLKA 4OLXL 5ESQA 2I60L 3LKSB 1TMCB 3QO1A 3X3FH 4IPJA 3W6MA 2AK4B 3RU8H 3KPMB 3QZOA 2H2SD 3NCYS 5HYSA 4EEEA 3FDWA 3VCRA 4HPYH 1QI5A 4OJEH 5B1KA 1GZ1A 4LVNB 4KRUA 4E8GA 1IWBA 4HFUH 3CFJA 5I26A 4L0YA 1P48A 2C5DC 3RF9A 5KZCB 3B9OA 2OJPA 4JFZH 5KYWB 1O6IA 3BVNA 4WU7A 3TBSB 1VDGA 3SE4A 1AKJB 1YEFL 1TX0A 2XGBA 3FK4A 5AENA 4FMFA 3X11A 3G3LA 4OZFB 3VDHA 2JIXD 3RY5A 2GVGA 5ESAB 2R23B 1XL4A 5AKVA 4JBSA 3ZU8A 4JHMA 4NI8A 5A8PA 1U3YA 4ZX5A 1Q63A 2IKJA 3BZJA 1EX5A 2W4XA 3GBEA 2HRLA 4PU2A 1W0VB 2VDMH 3UAAA 1TWIA 4N4YB 3VDGA 4KV5E 5DQ9B 1KNOA 4LRNL 3P30L 1IFHL 5IMMB 1XDLA 1ORQA 5CPLA 3OZLA 5FKAA 2GABA 1RIHH 1EO8L 3GMMB 5JMRA 4Q4RA 5A94A 2IVFC 1NDGB 3QDHA 4V11A 1UXSB 2H1LM 3OVQA 1CL7I 1GYLA 2BP8A 1RZJC 4NP7A 4NZDA 2C4FT 4C4KO 3W81A 3W2KA 3LXUX 1K8XA 4RBPK 1NMBL 2XWDA 2CR6A 5INDB 1KCVL 3MLYL 1U8PB 2VLME 3DGDA 1J8HD 3GI9H 4G43A 3U9IA 1TV4A 3W2NA 3ZS4A 5KYYA 3VDBA 3T8XB 5KTEL 1XLHA 1ONEA 4PSPA 3UETA 3Q0HA 3W1ZA 3ZKSD 3KBSA 4P3DA 2ZUNA 3I75B 2L7UA 4O9HL 3QCVL 4F7EB 4G8GD 4Y9BA 5E7FA 2P5WA 1IEXA 3F1QA 1XF5A 4I0PC 5E2UL 1ZU8A 2DWEA 4UDUB 3PPEA 1M2VA 2C26A 2QUVA 1N8IA 1CWVA 3IU3B 4F2TA 5DR5H 3L0KA 3M17A 1AQFA 1GW9A 4DVOA 5T91A 3MNVA 2MPVA 4ECLA 3FIGA 4OLVH 2G2RA 3OAZK 4OOUA 4UCGA 4F91B 1FC1A 3DDGA 3RWHA 4PD4J 3FYYA 1E3ZA 2A74B 3NJJA 3GTIA 5A16A 2TAAA 5JYMA 3HR6A 1GONA 3AHYA 1HHHB 1DBKH 1OCCB 3PZQA 5JOPD 1YE4A 3QMSA 4ZQCA 1L3NA 3F83A 3O8XC 4QLRA 3DGGB 3U6XS 3VGBA 4NXSA 4DFIA 1DWGM 3AQZA 1U83A 1KR0A 2CZ5A 2UY5A 3TJPA 3TVMD 2A3CA 4PJBF 4DGUA 3GTXA 4NN5B 3MUHL 1KW1A 2EO9A 4LP4A 1W72L 4K3JH 4EE2A 3O05A 4P23B 4M7ZC 1R3TA 1S9WA 4UFHA 4AOFA 1JZGA 1AKPA 3BD3A 5IQ7L 4NZTH 1EOMA 1EJXC 3AWFA 3NRQA 2YD8A 5CJQH 3PDDA 4N87A 3T2PA 1OIOA 3L3KA 4K15A 2M26A 4PMVA 4H8WH 4XZHA 3UXKA 5J11B 3GIZL 4HFWB 3HLAB 4GCXA 1TU2A 5FIEA 5EEZA 2JQZA 2PW1B 3QR0A 1LBLA 1W8NA 3PGDA 4NBXB 4AT6A 1ZL1A 4O10A 1J5OH 2EKSB 3GPSA 4YHMH 3Q5OA 1Z9LA 4A2HA 4PBEA 1CFMA 4IBWA 5A2IH 2Z8VC 1QFWI 1BVLA 4YDLC 4LALA 1JZIA 2EEDA 4WKXA 3MLVL 5B4MC 4OZHA 2E1WA 2I16A 4WW1A 5E9DA 1Q85A 4YTRA 1FYTE 4OZHF 1AHWB 4O4YH 3EJPA 4H8UA 3V52H 3TCEA 1BV8A 3MLPA 1M3UA 3RIAK 1LK2B 1SBBA 4YDZA 1DL3A 4GAFB 4WW2F 1FGNL 2EVIA 4KBXA 4XISA 3RX4A 3OVUB 3RPIB 4YHEA 1YUHB 5AC4A 2QDEA 5LZLA 2H45A 1EF2A 1SJMA 3ZKMC 2XY2A 1FH5L 2DBLL 2QVIA 1SXCA 4LDLB 2O61A 2MQGA 2RBLA 2D3LA 1J8SA 3M47A 3MW7A 2EDMA 2XN1A 3L5HA 3DJRA 3QCTH 5ANHA 2AJVH 5D70H 4Z7WB 3SAZA 3E49A 4HSCX 4TUOB 4U0RC 2ADAA 3GE7A 2NX3A 4CNUA 4MMXA 3V5FA 5CCZA 5KJRH 1UZ6F 4U6VH 1JNDA 5F1OB 2OCCB 4FXKA 3KM8A 3N18A 1ZD6A 1TQJA 1KCSH 4HK0A 3WIHH 1NDWA 1O0VA 1TO4A 4GRWB 3MYOA 5IB1A 4GJJA 1HWGB 2CFFA 3RN6A 3LN5B 3V6ZB 5E8PA 2A7RA 2FIKA 1ODZA 2RKXA 4PUNA 3CZFA 4MXVE 4ENEC 1KIQB 4GI8A 3AZTA 4DYKA 4HNOA 2Y2WA 1WDPA 2JI2A 4GP4B 3W25A 1IC5L 4PW3A 3O2VH 4BFIA 4ZFMA 2ICWB 2V5MA 5INCA 1VQTA 1O7AA 3C61A 3SDDB 2C13A 1MFAH 1OGTB 4PZVA 4LL4A 2WBJC 3FF8A 4RPPA 3NO5A 3V36A 4QRBA 4XQ6A 3AABA 1R4XA 3LRLA 4MD5B 5FECB 5I5IA 2IKGA 4A2SA 2KDYA 4DK5A 2APXA 5LA0A 3SD2A 4DEPB 5KS9E 3RNDA 3AJXA 1K4CA 2DN7A 1T20A 1YEIH 1BKSA 1PVHA 3C60B 4BHUA 3VCCA 4F33B 2FT8A 4UMSA 5E6SB 5SX4H 5EEVA 1CENA 3NGBC 1QEXA 3I85A 4I9WD 3SGZA 3O1NA 1G4TA 4DIAA 3F7QA 4OZIB 3J07A 3SKMB 1QOQA 2F53D 1VHCA 2A3LA 1IM9A 3O3BA 2ATMA 3N41B 3OBEA 2Y89A 4WHBA 1I3GH 3KM1A 3OAUH 2YD7A 1MH5B 1YBQB 4X4YB 5KAQF 4XPBL 1NKOA 5MKGA 1EBAA 4ACZB 4WW1B 1J0ZA 1H0DB 4QXVA 3CB8A 2QVTA 3E3QC 4PY8J 4Y1AD 4Z2KA 1J9YA 2I69A 1JVOA 3UTQA 3W88A 2GY5A 4ZB2A 1BXVA 2PCPB 4FFWC 5H37H 3VTTA 4JPQA 4F58H 3IDXL 5FAAA 4GCAA 2KI6A 2QW5A 1MUJB 1QSEE 4OH2A 1FVDA 1I1AB 5D9NA 4ZGYA 1GVIA 5B38A 5BU9A 3SUSA 5C9ZA 5ACZB 2WHKA 4JO2H 4R7NA 1EIXA 2X1TA 3A5FA 2AITA 3CAFA 3Q48A 2NZ1A 1JNNH 2A6IA 3VRJA 4MJHA 4LCCC 2X9YA 4NEHB 4WWKC 4XWOD 3WIIL 3NPWA 1MFBH 5D2LE 3UPCA 3A21A 2OEMA 2I9LA 4HZ8A 2VX7A 1AIFB 2E76C 2EE0A 3MLUL 3QHNA 1Z6JT 4H9UA 4N68A 2QJJA 3URAA 4YXGA 4FOJA 4M8QA 1GGYA 1S7XA 1EP2A 1K5NB 4FG2A 5A43C 5B8CC 2R0KH 4PAZA 1T1ZA 2DDQL 3OJVC 2IPUG 4K8RC 1BBJB 3WF4A 1N12A 1V5JA 5D6CB 2J7GA 2V3GA 4Y5XC 2RUSA 1EJOH 2ZJSL 1II4E 3QUHA 4HAKA 3WXWH 3FBQA 4ODTL 4NB7A 2C79A 3HA1A 2IGLA 2X16A 4JZJA 3ME3A 2E6DA 4FI6A 3FN0L 4HOWA 4HBQA 1TPEA 4YHLH 1JK9B 3VTRA 3OGCB 4ZSOA 2Y7SA 4I2XE 4GH7B 1TTPA 4O52A 1S7QB 3T0CA 1FYHB 4NUGL 5LG6A 3VC6A 2NT1A 4US5A 4Z7QF 1I3RA 2CXKA 5I0VA 4M81A 3QDGD 4BZ2L 1YY9D 4EO5A 3F58L 3IWUA 4RDZA 5F7NC 1BF8A 1JK8B 4CADA 3STBA 1GGBH 4JFED 2CJSA 1OAKH 1GOWA 1GOHA 1MCWW 4C1NA 1RJLA 1E6OH 4HNTA 2EIMB 4IRJD 4YC2B 4CVZA 5CZSA 2I9LB 4M4RA 5C0ND 2EVJA 4QTIL 4JOMA 4UFMA 4NNBA 3W72A 4JFOA 1FLRL 1U2CA 3D51A 3WI9A 2JKIS 3OMIB 4NZFA 1XXFC 5J1SC 3I68A 2K0RA 4GOAA 2E9BA 3S36L 3F3HA 3NEEA 2UV8G 1ZA6A 4GG6A 2YLLA 1EJUC 3WSUA 3B1TA 3MACL 5CZRA 4B7IA 2Q7AA 5BW7C 1INDL 1V02E 4J40A 4AMXA 2XRAH 1A5CA 4AMAA 3W39B 1QTSA 4FFYH 1BQ5A 2E1DA 4JZJB 4YUEL 5D7KE 3S0CA 4PMXA 4OCLC 4ML4A 2VDMB 1S5HB 2DQ6A 4XB8A 5AW0B 3CSBA 3B0PA 5GS1A 2FQFA 3I3DA 5H8MA 2ZZ5A 3NK4A 2A99A 1DP0A 2JCCA 1UPMB 2VXUH 4M24A 2A1WL 1AZZC 1TSIA 1FE8H 3D3VB 3MLXH 4PG2A 3PIQB 3IPWA 3HPFA 3Q6GH 3HF3A 1KC5L 3PDOB 2Y61A 3DROA 2OX1A 3SURA 4Z5RB 1FO0A 2LLNA 3CHOA 3RFRA 1KRCC 4P8VA 3ARGB 1NOWA 3UAEA 2GYIA 5I3HA 2FJFA 4HSQA 2AV1B 2X4RA 4KKLC 4LX4A 4TOQA 5ECUA 3NABH 1ZTXE 4OIIH 4AD4A 3KYMB 1UWTA 2O30A 2GQHA 1QHQA 5FWRA 3FQXB 1MXGA 4J3VA 1LXMA 4DN1A 5E23A 2VFDA 1IGIL 3O41B 4HLZG 5AYQA 4PBGA 3LU2A 3I9PA 2UVFA 3QUZB 3S35L 4QNPE 4I7VA 1CLZH 2CJ3A 3GYRA 4UM9B 4OCWL 4POYA 5ENLA 4H5SA 4B3ZA 2FJHB 1YTEA 4DXKA 2DSUA 1TJXA 2E3VA 4BV1A 2FR4A 1BAFH 1CLOH 1DZ0A 1I8AA 1NDYA 3BLIA 1PX8A 4ATTA 2CBTA 2PLCA 4PTTA 1EA9C 2WHJA 3E8UL 4XZUA 1A6WH 4NQDA 3GXFA 4Y16B 3TC9A 2BODX 5IDZA 5DD0H 3FQRB 2QV5A 2XFFA 1CL7H 1OAUL 5FF2A 2DWXA 1I2NA 3M45A 1JPIA 1XYLA 3NVTA 3UPWA 4OCYL 2ATPA 3IMVA 4MAYB 5IFAL 1PUDA 3BV4A 2I25N 3LD5A 3M0JA 5U4NA 1VBUA 4AV4A 1TJHL 2GJ6A 5E9NA 3WXVL 1T2JA 3TN4A 3KM2A 1BD2D 4FXGA 3HS0C 5I8EA 1LQ2A 1T66D 3UYPB 3OOQA 4JM4H 4ZMGA 3IETB 2NV1A 1FHDA 3THAA 2XA8L 1SJHA 3AG2B 3G6JE 3RTQD 5I1LB 3KXFD 5FC9A 5GJMA 4PRID 4R5VA 4HZ6A 2F9BT 3PWVA 3SO3B 1M6UA 5LIUX 5CAYB 1HI6A 2WP3O 3WJMA 1SVBA 3L4WA 1A3QA 2FO8A 4EDWL 1BJMA 3VSVA 3A23A 1HEZB 1CDUA 5F2FA 4C59B 5L2KD 3SDXA 2WP3T 4PYGA 1K1DA 2EUVA 1R3VA 1MIML 4WFFD 4AKPA 2EPNA 3QUMB 4TUUA 5DI8B 5I1AA 4Z1AA 3KHJA 3DXAD 4PTWA 1UD2A 3T3PE 3UTZB 1QPKA 2DF3A 5E5RB 4JQ3A 4CCDA 4YO0A 3S4SG 4JTKA 1MF2L 1P7KB 1TPXB 3FB5A 4XAWH 3QFJA 2VUOA 4RVBA 4LANA 4IIQC 1YMHA 2AJSL 3UYRL 3ITLA 5G1MA 2CR0A 4QR7A 1PBGA 1WEJH 3BLEA 5TE4L 3N4FA 3UP8A 1TPC1 5K9CA 1R5VB 3KWUA 4GBXB 1MFCH 3B5TA 2HKFH 5ABDE 4IQLA 4JTQA 2EE3A 3B9VA 1QMLA 4FAMA 5AVVB 3EH2A 2R59A 4PGDB 1FWIC 1YEWA 4MJ6B 1UJQA 2NDGA 4HXAH 2OZ8A 2BS8A 3CZEA 1OSPL 1AR1B 2V81A 3ZZ1A 3RJXA 4CNSA 1JN6B 4L4TE 3NDOA 3FW6A 1LRTA 5MHSD 3BWUC 1HUVA 3GEWB 1MCNA 2C7UA 4KMTL 1VGEH 3UMTA 3UJRA 3WD0A 5T3XH 3VINA 3UJTL 5KYYB 1XGQA 1RZ7L 2CIKA 5DHVH 3GSQB 1GPFA 4NPYB 4PLKC 4KBPA 2PR9A 1Q6CA 2O92A 4APQA 1XG3A 1L6XA 2G96A 2VIRA 1G7LA 1EGJH 4KK6C 2WZ6A 4AXWB 4ZBJA 1I1FA 1EBPA 2E0PA 1E2ZA 2EACA 1P5VB 4ZW6A 1G0YR 4LT9A 1OQOA 3PFRA 2BW4A 5DMIL 4HIJB 2MCMA 2PXYD 4OIFA 3MR9B 2VFEA 1S9WB 1WIPA 4RZBA 4ANKA 1TZOA 3FUHA 5AUMA 2D1ZA 5FYKD 2ODIA 2BOFX 4M1RA 1HYSC 3HZKA 1YX1A 4NF7A 1Q1PA 4GRWH 2VXQA 1G4PA 5BNKA 3CC1A 3ZSTA 3QORA 2FD6L 4G7SB 1IBZA 1IILE 4I3RH 2MKWA 3WTSA 4H6EA 4ENLA 1IZJA 2AJUH 2P24A 4KH2A 5DSCA 1SR0A 2C0AA 3PZNA 4HLZH 3LNDA 1GGCH 1KGCE 4FFWD 1KCUH 3DHJA 3O3AB 4N5ED 1M7DB 1QSFE 3HNSL 1IARB 1XD0A 3ORWA 3CSFA 3RUBL 5DUPL 5IBLD 4U1KB 5CSSA 3ABQA 3RMEA 1MRCL 4U7KA 1YYAA 4UNTA 1D5MA 2DV0A 3QAZC 4S2BA 1YEYA 1RK1B 3NZUA 4KITB 4S3GA 2LU7A 3OR6A 3ILQC 2IBGA 3BW2A 1AG6A 4NM4L 4PUDA 4KNTA 2B0SH 3QJUB 2C3VB 1GAFH 4U0QB 1S7TB 1F2QA 1UA3A 5C0AA 3QQDB 4G83A 1TV3A 3DBXA 4GRMA 3AXMA 5CR1A 1UGNA 4YHZL 4GKNB 4Z2HA 3Q9QA 1KFGA 2E6YA 3EMCA 2HTKD 3R1GL 1TJ2A 4WVRA 2Z4GA 3IE4A 3WIFB 4KEMA 3CFEB 4EMZA 1CDJA 1LUCB 4AWSA 3UDWC 3FSAA 3HHSB 3K0YA 2ZSVB 3OL2A 4G9DB 5F7EH 4CNIB 5L4MA 3N44F 4POCA 2DU2A 4L3EA 5E5MA 4LVOC 3FQRA 2ACQA 3NPVA 1XGYH 1N7ML 4JAMB 3V7AG 4CQDA 4F2BA 4Y2DC 4X6DF 4HIHA 1X5XA 4PRHE 4GQ0A 4I77L 4ZEPA 1U21A 3FTWA 3AZSA 1IEWA 4ZZ9A 3TFBA 3H7RA 3N2XA 3MOBH 3P93A 1UZ8B 4X2PA 3SN0A 2YD3A 3QW9A 2YAQA 3SN6N 3DIPA 2XN9B 5D7LD 1TIUA 3D34A 5C6PB 1B0GA 2PPAA 3VNKA 3H21A 2AJYH 4G6FD 4JFVA 4N0UA 4JZNA 4G42A 5GS0H 5CGBA 1ICSA 3WUFA 1OZQA 1BYOA 2WXMA 1QQDB 4NASA 3RRAA 3KYNA 3W1UA 2BSTB 3LN3A 4HZ1A 4TOYL 4ALAC 1M6JA 4M3PA 5CLZA 4ORMA 4XKYB 3WMPA 3B7TA 3TYFB 2YD6A 1RPKA 1DN2A 4QYOB 2WYHA 3MRQB 1SXAA 2DJXA 5AW2B 3WEAA 2PCEA 2OZ4H 1X5JA 2E28A 4ZMQA 3ENEA 4M1GH 3FFCE 1N8FA 3EXTA 4S3EA 1ZPUA 2GTWA 2X42A 2XINA 1KR1A 4Z1YA 4XNUL 4GXPA 3HG2A 2DJSA 3FB5B 3TTOA 1CICB 3UOAB 3ULSA 1G67A 2G9HB 2PBGA 2ZA1A 3H6JA 3CIVA 4JPVL 5LDSA 4LVBA 4UUIA 4ERIA 3M0VA 4AVKA 3ARDB 3DV6B 3LB0A 4BH8B 1LQAA 5LNRA 3NSMA 4LSTH 1RU9H 2PDWA 2QQKL 3ME0B 5ECJE 1VBRA 4P2VA 4WGKA 4L3FA 5GZND 3IGUA 2BLFA 3O4OC 5K39B 3OPSA 1RJYB 3ZE1B 1E0TA 4PA8A 2DQEL 3VFGL 1DWIM 1ZDSA 4AYBA 1MHEB 5I06A 3FT2A 2WPGA 1SJDA 3EX2A 1Q0XH 4HSNA 1H60A 3TJ4A 2Z2AA 4R4BB 4L9LC 5CEYA 1AG0A 5JQHC 3ONBA 5LB1A 4JE4B 4PG2C 1TVDA 1RUSA 4J8RB 4N8VA 4LWWA 5C3TA 1E27A 1I9RH 5LGYA 3FKKA 4XMZA 3MFFA 3QS2A 4X4KA 4N25A 3MBDA 2FGWL 3M0ZA 2QMJA 4DEFA 2JJWA 3EFDH 3MX0B 4D8PA 4W89A 2YYTA 1H5BB 4U31A 5EOCL 5D9SB 3W53A 1E7UA 1KIPA 3W75A 3ARED 1WUFA 2X41A 2GITA 1P9MA 4I8DA 4K3HA 4DVBB 2JCCF 1KJMA 4UYQA 4WWKA 4C47A 4L6OA 4BH7A 1M7JA 1A50A 1IM3D 5GS2D 1SJBA 4UQ3B 4MYWB 1H1YA 3LM3A 4YXKH 1JGIA 4LEFA 3WFLA 1RHFA 1RSCA 2OTPA 3WO4C 3F12B 4Z3IA 1BMZA 1MAML 2QSTA 3ESMA 4V33A 1AY1L 3JW7A 3MRFB 3V0SA 5FF4A 2HSIA 4H1LB 1BKHA 3L12A 2DQIL 2WZIA 3PY9A 2VQUA 1ZZMA 4NQCB 5KN5B 1AQ8A 2D9CA 5K9QI 4XPAL 2WO5A 1KGJA 2FWOA 4PG9B 3L21A 2E7DA 3D6GA 5K93A 1JRHH 3T77A 3TJHC 2OLHA 1EWHA 2JTYA 2WBJD 3BIBX 3NFPA 2J75A 1N0LA 2VXNA 5C6TH 4ZE5A 1JGLL 5AC8A 5E0QA 1K03A 7ODCA 3N0PB 2QZ5A 3RVXD 3PTQA 2WXPA 4I7WA 4FABL 4OV6F 5AD0A 5LQBH 4LVFA 2PXYB 3OJDB 2R1XA 4W9IC 4BH7B 4HPHA 4QDPA 4MAUL 4NUQA 5F6IC 4OLZL 3R0KA 1JSYA 4M9OA 4CILA 2WJFA 5HAOA 4JO5A 2PGEA 3EZ4A 3ECVA 5FCUL 3L3HB 4ODWB 3VDAA 2VC2L 3V1PA 4IEFB 1HKMA 5E7BA 5EU3B 3PDOA 3T3PF 3IFOB 4XCFL 4JX5A 5I1HH 3W7NA 4N9BA 1NWPA 2CM5A 4PJDE 1MCIA 3RL1B 1IL1A 1PG7W 2JELH 3MHGA 3QOMA 5CN1A 1XTLA 2OGYA 3MROB 3QGAC 1CD9B 4X7CC 1YEEL 4TUKH 4ZSOB 4G42B 2Q3RA 3FO2B 5I82A 5M5DA 1LO2H 4WI8A 2QADB 3C2FA 3QKZA 4FK9A 3ZE0E 4Q8VA 7ENLA 3TWBA 4OKVA 1PYWA 4DQWA 4NQVA 3KL5A 3WN6A 3MNZA 3VNYA 1ZSDA 4MM1A 5FK9B 4BE6A 1PYFA 1PG7H 4D8ZA 1A7QL 1QATA 4JFHE 3DDFA 4M8QB 3ABGA 4UMAA 1ZT7B 2J6XA 3DJZA 4AYDC 2BHZA 3ULSB 2OELA 2CNZA 2AI0L 4GO6B 3UTPE 4YDLB 2BY1A 2Y6SD 1RP9A 3OZ9L 2RDTA 3OAYK 3CQJA 3OZMA 5HNRA 1TQCC 3ITVA 4OZ4A 1X5LA 4RIRB 5TBOA 1XIDA 2NW3A 3HB9A 4ETQA 3FJTA 2PPCA 1NTHA 4JTGA 1N68A 2DUXA 3VFRB 1XGDA 2FSEB 4EXKA 2FLBT 1I60A 3OGCA 3M43A 4I6VA 4BSJA 5HGHA 4TV5A 2XH0A 4EQ2A 4QAMB 1IUZA 3DURA 2WYSA 3ARRA 5KBPA 4Y19D 2SEBB 1ZGLB 3MUIA 1NQ6A 3CUFA 4AYGA 3H53A 2PCPA 1W9VA 1H11A 3NIFB 2UZYA 1XF2A 5HHNB 5E6IC 2NWSA 5AYXA 1DVFD 1XF1A 3NJ3A 1NCDL 3FUDA 3S6TA 1YRKA 2K1MA 4X9GA 4F3HA 2GQ8A 1BEYH 1HNFA 1FL3B 1OGPA 3T0EC 43CAB 1D7KA 2F54B 1OTUD 2AMGA 2QHLA 4HF5H 2ARJQ 3SE8H 3CO8A 4GYPA 4XAFA 1PLBA 3SKOB 4NENA 2XKUA 3LMZA 4WTZA 2WTRA 1F4XH 4JN1L 1BYDA 3GHRA 2A0LD 2WIIB 3DIVA 3EDKA 4GT0A 1T1XA 5E70A 3KRUA 4J39A 2W07A 2BDNH 2F5AH 2VR7A 5AVSB 2FVLA 3UIYA 2W67A 3QQ9C 3GRGA 3MRNA 1OB1B 3PWAA 5BW6A 2KDGA 2CHXA 4AEIH 4GSDL 5I30L 5TQ2H 1G6CA 3C0SA 3CUGA 3NOEA 2BNRB 2WQVA 3NCXA 3VD4A 3EXRA 3QIBC 1OT1A 3GT6A 1AD1A 2QLYA 5C0NC 1RZMA 4ZFZB 1PSKL 3ASOB 1NFAA 4IU2B 4OIAA 1S1PA 4LB8A 5F0PB 4P57A 2DMGA 4F1ZA 1I1CA 4FYQA 4KKZA 3PSWA 1L7IH 1JUFA 4JM2B 2XA3A 3RNKB 4DTGL 2VDQL 1ONXA 2V6HA 4PY7A 3PXLA 2ADJB 1CURA 4LF2A 5CC6A 3RLVA 1SNRA 1KBJA 4P99A 4KY2A 4FQCL 4B6ZA 1H50A 1NUNB 5KSBB 4ILSA 1T0MB 2Y7MA 4MHHG 4OD1H 3CZLA 4E9WA 1Q2RA 1NY1A 1NUGA 1DIEA 1R6WA 2QDDA 2VCBA 5FEPA 5JBEA 4CUCA 1E9OA 3ECBA 5H8UA 3UYPA 3DIFA 2XZCH 3KYAA 1WDWA 4U6HA 2FDMA 1ZT4A 3O3EB 4EUPG 2E7CA 4NQQA 1KFBA 1DE4A 2TPSA 4Y4KC 5BWAA 2BDQA 4PB4A 5H8PA 4CLMA 2YK1H 3DYPA 1WV2A 1T83C 3DMMA 4HKJA 3R13A 3W1RA 3U4KA 2GJXA 4KCVA 5FACA 1D7FA 3GXPA 4U1GB 5HI5D 5B3SB 1P0DA 1ZGDA 5B1CA 3BGJA 1V3IA 1XINA 1X7TA 2NXZC 5CSYA 5GGSB 2ON3A 2F53E 1NC2B 3KPNA 4WJKB 2R2HB 1UBSA 4M6ML 4WI7A 4R34A 3GO2A 1HI6B 3RGBA 1V10A 1IE7C 4WFED 4DRSA 2A5UA 2COVD 1GGIH 2VJ0A 1WBXB 1ZANL 3IJYB 3AGVA 1H5YA 2OCZA 4G6ML 4LSQH 2WZTA 1HNYA 4PREA 1NGQL 3RCNA 2XBZA 4NAMA 3MV11 3QHZH 5AEAA 5DJCB 5IOPB 1JCLA 4IRJC 2SEBA 4HCFA 1ZGLA 4PBFA 1NIDA 4IQJA 1X9QA 3M9YA 4QTFA 4OJAA 3VOCA 2XQBL 1Z3GL 5F1SA 4Q8PA 4Y9MA 1A3LL 2FGBA 3OODA 1IM3A 1F3JA 4PV9A 5DS8A 1R5VA 1X5FA 3VXNA 3WL9B 3KP1A 3LM7A 4MMYB 1FL3A 1C91A 1R9YA 3GC2A 5D9OA 2BXZA 3RL2B 3S96B 5F7HA 2FL5A 4Y16A 3BRGC 1PKMA 1MEXH 3JWNG 4MA7L 4X6CE 4AQ1C 5CBAA 5BOFA 4AB4A 1RVFL 4ODBD 3C0QA 1P4IL 4PODA 1MQRA 4L29B 5E0KA 3BSHA 5I2IA 2FZNA 5KBKA 4ZPVA 1OARL 2H8PA 4JFHD 1E9LA 2NQ3A 2PWGA 5C2UB 2Z1XA 4O53A 4U4MA 2BNRA 1JZ3A 2ICWI 1JR1A 3PG9A 1A4KB 3RDJA 3C86A 4PRIE 3T55A 4G1EA 5J4MA 3MUGA 2JQAA 4M61B 1KM2A 1FFPA 1WG3A 5CGYD 5A2CA 3VO0A 4YVPA 3S5OA 1O5KA 4KKLD 3B5GA 1O7SA 4ZUVA 3QH2A 3C75A 2F2HA 5D7HA 4BRVA 2PPDA 4AE0A 1WFTA 2HLEB 1KENH 2I07A 2L7EA 3F7YB 1DANU 3IGAB 3L81A 4LAQL 4ZAKC 5I02A 2YIHA 3QJAA 2WINA 1I1AD 1QRKA 2TRYA 3I6GB 4G2AA 1ZMYA 5HNTA 1GPOH 1DL7L 3HUJA 3UJIH 2J66A 5EFDA 1N4XH 2BX7A 1OT2A 3WAKA 1H0IA 3HA0A 4FFTA 2GDVA 5U7SA 4AC1X 4FKEA 4TSAH 4GSUA 4IGBA 3MUZ1 5C70A 3LQLA 2ATSA 3VG9C 2B1HH 5T3ZH 1JZJA 1UKPA 2VITA 2O5ZH 1OM3L 2PAJA 4KKPA 1ZLVH 4C6BA 2AFNA 3N73A 3RCYA 2FMNA 1RUMH 1FNSL 3ILPA 1EAQA 2AF2A 4FA8A 2GSGA 1CYWA 4F7KA 2X3AA 4H2CA 4Y4KB 4UWQB 5GGUA 5GZNC 1BVWA 2EBNA 4JFDA 4LSUL 5FUCC 5BYWA 5EU5B 3H9SD 4ZUUB 1I8LC 1B4JH 4NJAH 3WD5H 3WD2A 4AHPA 1WUNT 3N85L 5GSRB 2ZRXA 3HGJA 4GRSA 1CFVL 4XHQA 2C15A 4JLRA 1N5AA 1H3PL 1OB0A 5K9JH 4DGIH 1IR1A 4N2YA 3DTDA 1PAMA 4UIOA 1HHIB 1IJ9A 4L18A 1JPDX 2X1IA 5AC5A 3R06B 1BXBA 2A6KB 3ASNB 2R69L 2K78A 4FF7A 1PY9A 2FJGB 3ATDA 1IE5A 3BAEL 4AGOA 3QDJE 1FZMB 3SRDA 2OP4H 2XKNB 3F2LA 4FQ2H 5CHNB 3IGFA 4C6FA 5CEZH 2NW2B 1M01A 1LZOA 1OIMA 1VF8A 5CSUA 2Z91A 4L3ED 3UGXA 2FZBA 2KQNA 2Q2LA 1FGVL 1CBGA 2BJML 1WO2A 2RCSH 3BUYA 4X4MA 5F1NB 4AI7A 3FU3A 1P5UC 1RZQA 2N01B 2CMRL 2J8UA 3BT2H 3MY9A 2EDFA 1N8OE 2Z3FA 4PJ5D 4DO4A 2DQFB 1MVUA 1E3FA 3AU1B 4IU3B 5AW6B 3HW7A 2KT6A 1P6CA 4HDIA 5HVWA 1EHAA 2XKSA 3OMAB 5D1XA 3V4VL 1AD4A 3MXWH 3NTCH 4ICWA 5I1GH 4RXFA 3CFDA 2MNWA 5D6DC 5SWZE 3LEVL 4WTWA 3QT2A 5BZDB 3FV9A 2QGBA 3UG3A 2NY6C 2VMCA 2AAAA 3ILDA 3ZRCC 4FA6A 15C8H 5KINA 2Q10A 4DX3A 2ZG2A 4KTYA 3AU6A 1N7KA 1HHIA 4XZMX 1JD7A 5FKAB 5F9DC 4M7LT 2OVLA 5F9JA 4M7JL 3CB3A 1ZPLA 3L5MA 3DOSB 1OTUC 4UTTC 5DT7A 1EH9A 1AGCB 1MNUL 4NN6B 4NPKA 2KZ1B 3CMFA 3T8QA 4WUUD 2VM8A 1V3MA 3RWIB 3NQ2A 2Z4QA 3WS3B 4K7PY 1ADOA 3LV5A 1DVFC 4V15A 5T5FH 4PWEA 1TPWA 3QPXL 4KK5C 5FHBL 3TXAA 4S0HA 3Q06A 3MSRA 4HNVA 1T5XB 4JKWA 4WHYG 5BPPA 4EIZC 2P52A 5IB2A 5F7YC 4LP8A 3AXHA 3MBEB 4UQ3A 5F0JB 1F1DA 4X0KB 2PXYA 3BO9A 1DXEA 3T1WA 2D0HA 1F6YA 1NDMA 3NCOA 4OUOA 3APFA 4OBSA 5D7JC 3UYOD 5LGXA 2DKMA 3Q44A 4XMLL 2Y5TA 4WTXA 4H1LA 1JMZA 3NEXA 2ZPKL 3L1EA 3J8F7 3WY4A 2GZXA 1CXKA 4QCFA 4I0PD 5GGVH 2EKCA 4DJDC 3MYPA 3K2UL 4M62H 3A5VA 5D8JL 2W81C 4NOBA 4XD4A 3ZHDA 1PD6A 3L5JA 3WFAA 3N43B 2VGBA 2WXLA 4J3SA 3RDKA 1EZUA 4QHPA 1BXAA 1HJSA 4MA1C 4ICMA 2UZXB 3QNXB 1S9VA 4O02L 1QQDA 4AX6A 1UKQA 4X6EA 4KWVA 3GO1L 5K4ZA 1CFNB 3EKLA 5GSRA 3IKKA 3L2NA 4Z7UE 2NSQA 3MVSA 2W63A 3N1MC 5AW9B 3E5BA 5DELA 2EAEA 3EWYA 3LV6A 1Y6NR 4FQJL 1F0LA 5J13B 3A64A 2BH0A 5BRBA 1EEZA 3L5XH 2VW4A 5IW1A 2NY3B 3EHBD 1R85A 4QSFA 3OHXB 1DHPA 2DLTA 2YXMA 1UCBL 2AEPH 2A7NA 1INQA 5BJTB 4DJEC 2ZOTA 1L5GA 2PYEE 3NH7L 3PFUA 4AQEB 2OMTA 5A40E 2CDEA 5CD3B 1B3XA 1UEYA 4M5TA 3WQVA 1UOKA 2MCPH 1TWSA 2G3IA 3CN0A 3W5NA 4C6MA 4C56E 4W9JC 4A67A 3K91A 3QUKB 5JIIA 4NUJA 1FX6A 1R3WA 1Z9AA 3FZUC 2O9RA 3V4BA 4PS4L 5C7ZA 1P4BL 2I5GA 4DP4X 5CJXC 1GY1A 2AV7B 2DI8A 3QSTA 2OSYA 1VFBA 4PJIF 1UFGA 1X7QB 2B14A 2ZUWA 3B9KD 4UIKL 1YDNA 3ES6B 4P3CH 4JTAA 2ID5A 3KPRB 4PRIA 1SDAB 4Z7OF 5XINA 1CW2A 2MTPA 1ADQL 3AISA 1ZVHA 4NN7B 1MREL 3HG0A 1CICA 1DQWA 1GOIA 1JGMA 2B5IB 3DN5A 3BMVA 3G6DH 3QPYA 4FJZA 2WUBH 4BQ3A 4ERGA 4FQPA 3AT9A 3FT4B 3QDJA 5E2JA 3S3CB 3O2WH 4YHYB 2NXHA 2VC5A 3V0TA 3AADB 4PHXA 1N6UA 1XGPA 4KFNA 3ROOB 1GYVA 2RJHA 5BZZA 4V27A 3SR7A 1TZGL 1US3A 3MTXA 1OP5K 1TWZA 3EUDA 3KW7A 2HVJA 5JOFA 5DHYB 1HIMH 4X8CA 2HVBA 1E5UI 1GS7A 4ZOCA 1T1XB 1SUJA 1W37A 1D9KC 4HIIB 2KYIA 3A6CL 5F3HA 3MB9A 4RE3A 3GC4A 4PE8A 2H3NA 3CSPA 3ZTJG 2HH0L 3ZL2A 3M0IA 1A5FH 1CLVA 1YTDA 3KPRE 2NWRA 5EMLA 3NPSB 4HQQH 1I8KA 1MELA 5EIQA 3ESOA 1IWAA 3AG1B 4JQ1A 2R1NA 2XZQL 5D2VA 4FQIL 5G4NA 3HTLX 1KN4L 2MSPA 4JDTH 2HKHL 2YPLE 4O54A 4XNZB 4GG8B 4MAYC 1N70A 3W27A 5ABZA 1F6AB 2FB4L 4XNXL 1MW0A 5J04A 3CFKA 2PGRA 3B56A 1TZ8A 2FT6A 4J3UA 4QF1B 2PRLA 3UJJH 3GNNA 3UVIA 4ADUA 4IWWA 3S3GA 4DAGL 1FWAC 3OW1A 1NDVA 4IKKA 1E55A 3TCXA 3NIFE 4KUZL 5T33L 3KR3H 1SZFA 3ARZA 4OI9A 1DJXA 3CZJA 1M9HA 3PBVA 3D85B 2Y6TE 3U9WA 1TUFA 2MUCA 4KETA 5I3GA 2Q7NA 3VWJA 5HJYA 2WOBA 1B0WA 2VX6A 2HT3C 1R3KA 1JDFA 3TZVD 4BZYA 1SZRA 5IR1B 3DEQA 5KETA 2ENPA 4CW1B 3OXRA 3GDMA 1VENA 5IK3B 2FJKA 4HA3A 1JPSL 4UBPC 1OCNA 3V5HA 4UNIA 4ZMYA 2R1WB 1E9PA 1MLBB 1P6AB 3O3AA 3TLRA 1KBBA 3AHVA 3MVTA 4KQ3L 4IX2A 4LUJA 2W8CA 2YRLA 4QEEA 1CF8H 3KTXA 3S88L 3BUDA 2NW0A 3BGAA 3C56A 3D07A 1ONRA 2D0FA 4KZ0A 3C5SA 4NZ1A 1ZT1A 3UJSA 2DIAA 3TO4A 4QRQA 1V7NL 3P9MB 3BGFB 5DD1H 2IH9A 1ASPA 2GKIA 5GISL 1LM1A 4YQXH 3CV7A 1MDRA 4V2BA 2X89A 4OZGA 3CFJB 3VGAC 4WY0A 2Q8XA 3RFAA 4D6JA 2IS7A 5T1KA 3VKKA 3ZYJA 1MH5A 4ZFOL 1PKQB 4MYAA 1LRNA 1KT2A 2YKKA 1SW3A 1XLAA 4DT2A 5F96L 3C5QA 3U1QA 4JD4A 5GJPA 1CD1B 1WAAE 4PJIB 1VRSA 4ZUWB 1W9UA 2F08A 3IU4H 4L56A 1E42A 3P3UA 3V75A 4HZAA 3W7EA 2J5LB 2IPWA 4YHKH 2F54D 4QG8A 1KG0B 1VFMA 1ZOXA 2OQJA 2Y36H 4YK4C 3WUWA 1LG1A 2BY3A 3GZ3A 4W85A 1FH2A 1FHGA 3FCBA 1JAEA 4ZQNA 3S9YA 2YL5A 5K2ZA 5GGQH 4OBTA 1TA3B 4LU5H 5EU6D 4RZ6A 2A1YA 4YVVA 2H3NB 4AZCB 2PTUA 2HPTA 4UTUA 1NDGA 4IFOA 2WXQA 2BSLA 1DEEA 2Q7YA 3AYTA 1TQBC 1JXFA 4S0TD 4Q58C 2NY6B 5IHUL 1YEHL 4RGNE 2GK1A 2B9AA 1IM3B 2QULA 3BEWB 1T0PB 3CXDH 5DDHA 5EU6A 4OZIF 3APMA 4GACA 3O63A 4ZQMA 3LHAA 4WFGD 1T4KB 4Z95H 3T3ME 1YPZE 3CFKB 4E9QA 3BZ5A 1KO0A 2Z29A 3QZ6A 4NPYA 4NNAA 3N43F 4NZ4A 4IJ3B 1OE2A 5A2AA 2FZDA 4XB7A 5F88B 4O1BA 2X1PA 3POCA 5BOEA 3H7BA 1PX4A 2V5LA 2OL3A 3MDUA 5MEOB 1CBVL 1S5HA 4OJFH 1NIEA 3GMOA 4PV8B 1YEKH 1OP9A 2DEXX 5HINA 1IC1A 1US2A 2XG4B 3NJMA 1B90A 4U1SB 3V8CA 4WOZA 3KXFB 4MD0B 4WKZB 1YC7A 1NCAL 3OA3A 3LPOA 1TB3A 1H5VA 5ID1B 1ZCRA 4RGOL 3VXUE 1G9NH 2N7BA 5KVFE 3N9GH 1R7AA 3ZE2F 3V6FA 1I9JH 1QRQA 1K4GA 4Y4HC 1QKZL 5EWIH 1DEDA 2YKLH 3SQOL 1OABA 3MLRL 4DM2A 3L65A 2PLMA 5H2ZA 2HSAA 1JWMB 1KNOB 3EJCA 4M48L 5DYOA 1E5NA 1EL3A 2INZA 2R51A 4JFFA 5EO0B 5L4JA 4XX6A 5C7XL 1JFQH 4ENZA 4I87A 3ZKND 3U4EB 4BDVA 1ZQ5A 4HIXL 1PDKB 5IHZA 3CJPA 2VC6A 2ESVB 1FWGC 5AHLA 4KS0A 1ERNA 2R94A 3OKEB 4AEHL 2DQHH 5DJ2A 3FBKA 3TZVA 3EH5B 4KI5E 5D2WA 1VERA 2P88A 5HDQL 5HTSA 5JXAL 2Q8AL 1PCXA 5IJCC 2HWGA 1TZAA 5CPQA 4IDLA 2K8QA 2RIKA 4Q74A 5AOKA 4NNPH 4WWKB 2V5JA 3WK3A 2W0LA 3QZWA 1QU4A 1QNSA 4FCHA 3NQGA 3QWRD 4BWLA 1NUDA 3HZVA 3PABB 3Q2DA 3LGDA 4Q9RL 4L80A 2P5ED 3AZRA 1FO0B 3N14A 3GZKA 1AXTH 4YX2L 1Q9LB 3OQ3B 3GYEA 3EFFB 4WTQA 4D6FA 4HS8H 2Q3XA 2QR0A 4YDJA 4WV1A 3VFMA 4HQVA 1OGSA 4IG2B 2MKLC 3T2NH 3TX4A 5KJ7E 2HRPL 3FUNA 1GRWA 1PU0A 5IBXA 3R06A 2YX0A 5H94B 3GMPA 4Q7IA 2VLJA 4V1YA 3L48A 1E1EA 1VHPA 3EYFB 4AC4A 1HHGA 4MTVA 1DQXA 1TF4A 4HOZA 4JDVB 1EZLA 4HKBA 1X38A 3PR2A 1T96A 2PWUA 4P5RA 5HVHB 5CBEB 1NIAA 1M7XA 2X4TA 2X3CA 4O5LH 5D4JA 3X17A 3WS3A