1QI5A

Mutant (d294n) maltotetraose-forming exo-amylase in complex with maltotetraose
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
418
structure length
418
Chain Sequence
DQAGKSPNAVRYHGGDEIILQGFHWNVVREAPNDWYNILRQQAATIAADGFSAIWMPVPWRDFSSWSDGSKSGGGEGYFWHDFNKNGRYGSDAQLRQAASALGGAGVKVLYDVVPNHMNRGYPDKEINLPAGQGFWRNDCADPGNYPNDCDDGDRFIGGDADLNTGHPQVYGMFRDEFTNLRSQYGAGGFRFDFVRGYAPERVNSWMTDSADNSFCVGELWKGPSEYPNWDWRNTASWQQIIKDWSDRAKCPVFDFALKERMQNGSIADWKHGLNGNPDPRWREVAVTFVDNHNTGYSPGQNGGQHHWALQDGLIRQAYAYILTSPGTPVVYWDHMYDWGYGDFIRQLIQVRRAAGVRADSAISFHSGYSGLVATVSGSQQTLVVALNSDLGNPGQVASGSFSEAVNASNGQVRVWRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of catalytic residues in alpha-amylases as evidenced by the structures of the product-complexed mutants of a maltotetraose-forming amylase.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Hydrolase
molecule keywords PROTEIN (EXO-MALTOTETRAOHYDROLASE)
total genus 144
structure length 418
sequence length 418
ec nomenclature ec 3.2.1.60: Glucan 1,4-alpha-maltotetraohydrolase.
pdb deposition date 1999-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09081 DUF1921 Domain of unknown function (DUF1921)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1qi5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1qi5A01
2RGLA 1SZNA 4AD2A 2VX4A 1W3KA 3N11A 1EIBA 3MV01 1ZU8A 2A3BA 2O9PA 1NM9A 4U31A 2OSYA 1D7FA 4UFIA 2OWCA 5A94A 3F5JA 2PI6A 4XB3A 2JFEX 3DX1A 3QOKA 4PTXA 1X6LA 1J0YA 5A2CA 2Y5EA 4MB1A 1XHGA 2EEXA 3VX0A 3BVUA 5A8PA 2Z1KA 2E4TA 3WDIA 1SMAA 3WQ4A 2WNWA 4WK9A 2MANA 4CD4A 1E3ZA 2BVYA 3F5KA 4PMZA 2NW0A 2YKKA 2XJ7A 4U3AA 4W89A 1VEPA 1Q6FA 3MU7A 4B9ZA 2Z1SA 4PSRA 5CPTA 3D50A 5GNZA 1HJUA 5ABFB 2EPOA 4AMXA 3CUHA 3VGFA 4UQCA 1V0MA 1QI5A 4CN6A 3A5VA 1UKTA 1T0OA 3L4VA 1GQKA 2C8NA 5EB8A 4W88A 4P7NA 3QHMA 4H8VA 5CG0A 1C7SA 3U7BA 4YHGA 1TZ7A 1JIBA 3WMBA 2ZICA 2JALA 3BXWA 1JZ8A 3ARTA 1G1YA 3VILA 2DSVA 3U5YA 5CPQA 3VVGA 1HNYA 4FNTA 5I0DA 4M1RA 1BPLB 4FNRA 2PBGA 3CHDA 4DWSD 5BXTA 4CD6A 2CPUA 1ZB5A 4BCEA 1MXDA 2WMIA 3DECA 3FNDA 1D3CA 1EDQA 3CTTA 3M07A 1NWUA 3SUWA 3MMWA 1FH7A 5A8NA 1SFSA 2G41A 2XM2A 1J12A 4GZIA 1E6NA 1JFHA 4P8XA 3NUKA 2VQTA 2F61A 3S2CA 4OOZA 3U57A 2WMIB 1PIGA 5FKYA 4IPLA 4TUFA 4LYRA 2EPNA 4ATDA 4X0NA 1GOWA 1L0PA 3AZRA 3LRLA 2YBUA 3S5ZA 1E40A 2GJRA 5I77A 2WM0A 1QNPA 1W1PA 3VIJA 1UR8A 2D23A 3PZVA 1H0GA 1XSIA 4FNSA 4WKAA 1ZBCA 4KH2A 3AMLA 1GVIA 6A3HA 3G6MA 4V28A 4GQQA 2Q8XA 5ABGA 3W53A 2JF7A 5A8QA 1LLOA 1IZJA 5A6KA 1TE1A 3RDKA 1E15A 3B9EA 2CYGA 2XYLA 3LPOA 3MS8A 4MNLA 1XCXA 1NOUA 4F9DA 1BYCA 1JYVA 1UZ4A 3AMGA 1JZ6A 3CZGA 3WBAA 4CN4A 2YLAA 1J10A 3OIHA 2DDXA 2OWXA 1NQ6A 1JF5A 4L4PA 4DUXA 3VOCA 1CNVA 4LXFA 3CMGA 4WKFA 4M80A 1NWTA 3SEPA 3THCA 4FLRA 3MUY1 2IXUA 1C90A 1GHSA 1FHDA 3TV8A 1KXTA 3FW6A 1V0KA 1HVQA 1QX1A 1MW2A 1C92A 4B3LA 4OBRA 4UZSA 1FOBA 1IZKA 2TAAA 3E1F1 3W0KA 1CIUA 1DHKA 5HXMA 3BGAA 4PBGA 3DYMA 4PMRA 2PWGA 4NRRA 3GNOA 4ATLA 3THDA 1E6ZA 1QI0A 1XH2A 4MNMA 3CC1A 3WH9A 1W9PA 2VL4A 3PTKA 3TTSA 1B3WA 1QHOA 1MYRA 3RILA 1XGZA 5FL0A 1UA3A 5D9NA 3W81A 2GDVA 4AMWA 1HP5A 5CSYA 5HBFA 1WZMA 3MANA 1ITCA 4Z2LA 2J79A 1TQWA 3SCSA 3L2MA 1WNOA 3ARZA 1E4NA 4CCEA 3VIKA 2WHKA 1OM0A 2XG9A 4PUDA 3WFLA 1TR1A 1FH8A 2WHLA 2F18A 2YDSA 3ZSSA 1XYZA 1EO7A 3ZM8A 1AQ0A 2OLHA 1KXHA 1W9XA 2GK1B 1BLIA 1E0WA 3MV11 4HU8A 1OIFA 3EJRA 2XTKA 1E9LA 3D4ZA 2BS9A 1J18A 2VZUA 1KXVA 1VRXA 4UQEA 1BGAA 3W38A 3OBAA 4PMDA 2DH2A 3AMCA 1TVPA 1VIWA 4D72A 1HKIA 1E6RA 5A6BD 4Z2GA 1WCGA 5C71A 4U2ZA 4YPJA 4WF7A 1NOFA 1ZJBA 1UD4A 1V0NA 1BF2A 3BLBA 3VKKA 3PTQA 2WVTA 4S3JA 3LRMA 2G8ZA 3ZR6A 4W7UA 1UWSA 5A6JA 5E6ZA 3AICA 3ZJ7A 3NDYA 3O2LA 3MUZ1 3DYPA 3GM8A 3EJSA 4WSKA 2QLYA 1QWNA 2JF6A 5I79A 2IXVA 5GQBA 2VCBA 3AYSA 3B9DA 2E8ZA 3AHZA 3W6LA 3T0BA 4D71A 1QVBA 4C7DA 1NARA 1NP0A 3PBGA 3HG4A 3A4XA 3GZAA 4R5EA 3WSUA 4N42A 1J0KA 5DF0A 5F7UA 1W9VA 2W4XA 1H11A 1I1XA 3WEZA 4AD1A 4OOUA 2YDRA 3WDPP 5DFAA 4HZ8A 2J74A 4WIWA 1CXFA 1BSIA 5D8ZA 1W2VA 3N9KA 3MO4A 4PMNA 4JKMA 2CCRA 4CU6A 2VCCA 4PMXA 1KB3A 4B15A 1BQCA 5A2AA 3ZQ9A 4IM4A 3UR7A 2ZUVA 3CIVA 3LXCA 3GH7A 3PTMA 3ARXA 3SCRA 1QOXA 5M5DA 1WZLA 2J25A 3W6MA 2QF8A 7A3HA 4HOWA 4CKQA 1CENA 1PX4A 5BYWA 3QGVA 4JFVA 1VEOA 1O6IA 1IT0A 2WHMA 2ZUUA 5GNXA 4Y7EA 2Y24A 1Y7VA 3A22A 1CXLA 3PZMA 5M17A 1WZAA 2CITA 3UCQA 2PBOA 1ITXA 4LYQA 7CGTA 3EDKA 3KL5A 1JFXA 4UFJA 4JL2A 2F7OA 2D22A 4U5KA 3BC9A 4FNPA 3VNYA 7TAAA 3FXYA 1VJSA 1FFQA 1GQLA 2YFNA 4QFUA 1QNQA 1H1NA 1CDGA 1KGXA 2E9MA 2J7GA 1RPKA 4R27A 1B3XA 3HU7A 3WY2A 3DHUA 2D24A 3TTYA 3IJ8A 3WQ8A 4DUVA 2V5CA 2EAEA 1BVZA 1WZKA 5A2BA 4KMQA 2FGLA 2FH8A 3VD7A 3MMDA 3GXTA 3SCNA 1PX8A 1CXKA 1KCLA 1C8YA 1KWGA 1NWSA 2FHFA 4JHOA 1U2YA 1B3YA 4IISA 3S6TA 3WNPA 4XZWA 4D6HA 4AISA 1E56A 2J77A 1WAWA 3CO4A 3L4YA 2QPUA 3BMWA 2V3DA 3CZKA 2GJPA 5E70A 1X6NA 2YL9A 4DM1A 1W1VA 1HL8A 2X0YA 1HJQA 1K6AA 3DDFA 1E71M 4PMYA 5AYBA 3WD0A 1M01A 1XD1A 4P8UA 3SURA 1WDRA 2CBIA 4JKKA 3DX2A 1M04A 4IUGA 5ABHA 4HP5A 4UZUA 5IHRA 3BUQA 5EMYA 4DWSA 1VBRA 4MADA 5A95A 5CPSA 3HN3A 1JI2A 1QW9A 2V38A 4D6GA 1J11A 1CGYA 1DTUA 1JZ3A 2FDMA 3UETA 1MW3A 1J0JA 4GIAA 1DEDA 2YA2A 5A3HA 1XCWA 4W86A 3WH5A 3AIQA 4H8UA 4AEEA 3VDCA 1NWRA 4RE4A 2WZIA 1C3FA 1MXGA 2ZXBA 1JD7A 2ZXQA 2F1BA 2YL8A 1CPUA 1K9DA 2BHZA 1JZ4A 3BUIA 4MB5A 4TTGA 3VM7A 4GQRA 2DIEA 1QNSA 1HKKA 3EYPA 4P8WA 1HIZA 3DX0A 1QW8A 2FHCA 1HVXA 2CHOA 1H49A 3AFBA 3VDHA 4AW7A 2WKLA 1EOMA 3PZQA 1XRVA 3QHNA 5D9MA 3HJEA 3WENA 3U5UA 3WUEA 2UY2A 2X2JA 4HMCA 1CEOA 3LPFA 4IPNB 3RO8A 2EBNA 3CZNA 3WF2A 4NRSA 2O9TA 1GONA 1WDQA 2BFGA 3HZ3A 4CGTA 4QLJA 2OYLA 1UYQA 4FK9A 1R46A 3T0DA 5M3WA 2VX7A 4QP0A 4DM2A 4M82A 2O9RA 1GVYA 1PEZA 4GO9A 3VDBA 1R87A 3AS2A 3GBDA 5A6SA 8CGTA 1GPFA 4PN2A 4LPCA 1FP8A 4L4OA 2Y2WA 3DC0A 1E72M 1QI3A 4UFHA 1XSJA 1H4PA 1AQHA 1CYGA 5AY7A 2YL6A 3PZIA 4D1JA 2ZX8A 2VC9A 2ZUMA 1UH2A 1JNDA 1CGXA 5HPOA 2OWWA 3ZT6A 3GH4A 3EDJA 1UWRA 4BQ5A 1E6SM 3J7HA 4Z2KA 3WUBA 1HWWA 4DWSC 2RGMA 2B31A 5E09A 1ISYA 3W28A 4A3HA 4V2XA 2DSKA 3HMCA 3POHA 3WF1A 1HF6A 1OGGA 5DT5A 1GOMA 1KWKA 2E0PA 1X1NA 3CHEA 1SR0A 3TTQA 4CD7A 5A69A 1K9TA 3WDJA 2WSPA 2CNCA 3L4TA 3WD2A 3VTRA 3VSUA 1QBBA 1J0IA 3QHOA 4MJ4A 2EJ1A 1V6VA 3LPPA 4J27A 3VMPA 2JIEA 1QNRA 4TX8A 5ABFA 3LX9A 3AIWA 1R8LA 3VSVA 4EE9A 1UQYA 3AIEA 3W4RA 1C93A 1JYNA 4WJXA 2W92A 2VTFA 2XN1A 4JFUA 1B90A 4HPGA 1QBAA 2DT2A 4KRUA 1BG4A 1CBGA 3RIKA 1JZ7A 4OUEA 4KGJA 4A4AA 3RJXA 3D4YA 1WDPA 2VT0A 4PEEA 1MW1A 4YN5A 4EKJA 1CTNA 5A8OA 2WPGA 3LXAA 2JIWA 3AXHA 5CZKA 5CSUA 1GORA 1M03A 2C7FA 4JFSA 1BVNP 2BNJA 3CH9A 4W7WA 1CZ1A 3N13A 1TQSA 1LQ0A 4PTVA 4AMCA 1ESWA 3OZPA 4D6DA 2UY4A 3BLKA 1EXPA 3CLWA 3IANA 1FH9A 4OBSA 4ZE5A 6TAAA 1RP9A 5A6BA 3SUSA 3ZMRA 4U33A 4B3KA 5AC4A 4HZ6A 3WDQA 4JHZA 2BY0A 4TOQA 3WMCA 5HPCA 1A3HA 4RL3A 4DO6A 5JBDA 5DMYA 3WH6A 1TQUA 1GNXA 2X0HA 1VJZA 5BRPA 1TG7A 1V6YA 4D6JA 4NF7A 3W82A 2A3EA 3CZEA 3CUFA 4PTMA 5EFDA 3WY3A 1L8NA 3WD3A 2J4GA 4AIEA 4H7VA 4HA1A 2FGZA 2F7PA 2BV9A 4JL1A 3OGVA 3SCUA 4AZ5A 1UQZA 3BLPX 3DDGA 4HMEA 3GBEA 4PMQA 3GNRA 3WDRA 1EGZA 4HZ7A 2VO5A 2WMGA 2A3HA 1B2YA 1HXKA 1IV8A 4X9YA 3VGDA 2ZXDA 4J3TA 3ZT7A 3GYCA 3K46A 4CU8A 2CBUA 3GH5A 1TVNA 1E5NA 2WCGA 2OW6A 2XM1A 5EFFA 3ZIZA 3A24A 1VF8A 1OT1A 2FE0A 2UY5A 2XVNA 5AYIA 5A6AA 3AROA 1V3IA 3MKKA 1GCYA 2XN2A 4W7VA 1MQQA 3AIBA 3OA5A 1LL4A 1LF1A 4GZJA 4OZOA 2VX5A 1CGTA 2CERA 1E3XA 1JL8A 3GXDA 1JYXA 2JE8A 3VD4A 5IXEA 1M53A 2BY2A 1B31A 2WLZA 3D5HA 1OD0A 4E2OA 3ZJ6A 1UKPA 4GI9A 1QHZA 4MDPA 2FHBA 1H0IA 3AQUA 2EO7A 5CGMA 1V3KA 3FAXA 2WMKA 4OIFA 4BF7A 3N17A 1Q4NX 2BXZA 4W84A 3K8LA 1GW1A 3KWXA 4ZENA 1G5AA 2WB5A 2CBVA 2V3EA 1CLXA 1W3JA 1HXJA 2E40A 4ACZA 4UQDA 5FD0A 4TVCA 1UUQA 4JZ5A 4N0RA 3WIJA 4AZHA 3AHXA 1HKMA 3CGTA 4RE3A 4UCFA 4BQ2A 4J3UA 3T2QA 1YHTA 1GHRA 3RMEA 2V5DA 3PZTA 4MJ2A 5ABEA 1W32A 1E1FA 4EK7A 2F7QA 2OSWA 3H55A 3MUAA 4W8LA 4UNIA 1R7OA 1W91A 2ZIDA 2YA1A 2DT1A 1OBAA 1W1YA 2YLLA 1TCMA 4FLQA 1FA2A 2WLYA 4LQ1A 3D51A 3GXIA 2F8QA 4P8VA 2WAGA 1PZ3A 1MFVA 3N12A 1BYDA 3BSHA 1R75A 1AVAA 1XYFA 3NDZA 4GXPA 1ISWA 5EBAA 4CCDA 1H41A 3PZNA 2VQUA 3WD4A 1BAGA 2J7EA 3WY1A 3ZT5A 1UH4A 4QDMA 3AOFA 4PMVA 4AZGA 5CGTA 5HDRA 3TONA 3W24A 2EABA 1RH9A 3L2LA 1UD3A 1B1YA 2XIBA 3H54A 3EMCA 3VO0A 3EJPA 5FL1A 3BSGA 4UFKA 3PN8A 3II1A 5BROA 3LMYA 1UD2A 1W3LA 3K4DA 4EAMA 1AMYA 1KXQA 1J0ZA 5AC5A 3UG4A 2O92A 1QWUA 3NJ3A 3NSXA 2WANA 3ARVA 3WD1A 4W5ZA 2VNCA 2JEPA 4B9YA 2EPKX 2ZWZA 2X05A 1OGSA 3WQWA 4D6IA 5IFPA 3AS1A 1UWIA 2J47A 4XX6A 1CGWA 4TTUA 3FY1A 9CGTA 1MQRA 4E4PA 1B3ZA 3BH4A 2CETA 2HISA 1ZS2A 4ZXOA 1FHLA 2WBKA 2XPKA 3OB8A 3GNPA 4KGLA 1DWFM 3BUBA 1MFUA 5CQ1A 1R7AA 3ZO9A 1LWHA 1LWJA 1E6QM 4PMUA 6CGTA 3BUDA 3VDAA 4AZCB 3ARQA 2J7FA 2XFYA 4QCFA 2CKSA 2V3FA 2DT0A 4ATWA 1V6XA 1W3HA 5I5RA 3WNNA 3BAKA 4ZFMA 4ZE4A 3S5YA 2V3GA 3L4ZA 4GKLA 2W66A 1JAKA 2W61A 5IHSA 1G9HA 2C0HA 4Q7NA 2CEQA 2E9BA 1W1TA 3VMNA 1KBKA 1TFVA 4BA0A 5E6YA 5I6SA 3AIRA 3TP4A 1E43A 3VM5A 3KL3A 3VINA 3N18A 4AIOA 3ZOAA 5JBEA 3EJUA 5D9OA 4C7GA 1JDCA 3CZ8A 1ZBKA 2EXOA 2PWFA 2PB1A 1UH3A 2GVYA 2WC4A 4M81A 4MTVA 2YFOA 1M7XA 4M8UA 3ZJ8A 4JIEA 1C91A 2DEPA 4AD0A 3N1AA 2WYSA 3PZGA 4W93A 4UQBA 1J01A 5D4YA 3ARPA 2WC7A 3VSTA 2WVUA 3GXMA 1QI2A 3VPLA 1K9EA 2WZHA 2DSUA 3VIIA 3IJ9A 2E3ZA 4GO8A 4JCLA 1HX0A 2BY3A 2J8GA 1W9DM 3JUGA 2WBGA 2QMKA 4J3SA 4JFWA 1R85A 3UR8A 4UFLA 1JXJA 2DH3A 3N15A 3SIMA 1B9ZA 1QNOA 3AHTA 1EOKA 3FHQA 3IAPA 2DT3A 2G3IA 4J7RA 1KFWA 1UD6A 3N04A 3CHCA 3B8SA 4ZXLA 4OJYA 3WNOA 1GOOA 2W91A 4F8XA 4AZCA 3VD9A 3BVWA 4MDOA 1JI1A 2YL5A 2ZUTA 1V3HA 4BQ4A 1UR9A 1GUVA 1UKQA 5E1QA 2QMJA 1XC6A 2VZTA 3KE0A 4CU7A 1WP6A 1E73M 5IDIA 5DT7A 1VAHA 4UFMA 2J75A 4HA3A 2VMFA 3SCOA 1RP8A 1UA7A 1LL6A 1CWYA 1H3GA 3BMVA 4W5UA 3DX4A 2A3AA 2XGBA 4UOZA 4NZJA 1UR2A 3GDBA 3KEHA 2WSKA 4H04A 4UTFA 2J7HA 3A21A 5BXSA 4CUCA 2Y8VA 1B30A 4HTYA 4MB3A 2OSXA 3WL0A 4XZBA 4PSPA 4AZBA 1E6XM 2CIPA 3BAIA 1OT2A 2WWCA 2GDUA 3SCQA 5KZ6A 1GJWA 5KEZA 2XFFA 4AD5A 1NH6A 5LA1A 2YIHA 5DO8A 1WB0A 1O7DC 1P6WA 3BVXA 1VEMA 3G6LA 2NT0A 4GINA 4NXKA 4MAZA 2AMGA 3WNMA 2YA0A 3TOPA 5A8MA 2FH6A 3UEQA 2G3NA 4U5IA 3RM9A 1TUXA 3VNZA 3CUGA 1JAEA 1DWAM 1UZ1A 1QI4A 3EMZA 4M24A 5C8BB 1MW0A 4PUEA 1LG2A 2D20A 5A1AA 1US3A 5BCAA 1D2KA 2VX6A 5JIPA 4XV0A 2XN0A 2J62A 3D3AA 5CXPA 4MAVA 1E4LA 1JDDA 2VUYA 1EDGA 1LJYA 3CV5A 1KTBA 2QV4A 5FIPA 2XWDA 1UWUA 1ODUA 3VGHA 1F4AA 3HG5A 3IK2A 2D3NA 4AZ6A 5CJ5A 1NOWA 2EACA 3ZR5A 1CXEA 3BVTA 2GUYA 3OLDA 3EMQA 4FNUA 3OZOA 3MMUA 3ARRA 2EPLX 1NP2A 3OGRA 4NZCA 2EADA 3UG3A 1E0VA 4DWSB 3AISA 1XH1A 2WMJA 3SCPA 1OB0A 1GOIA 4QLLA 4DO4A 2G3MA 3VX1A 3O9NA 3M7SA 3ALGA 1EO5A 2DIJA 3TA9A 3EJQA 2XUCA 3M6DA 4TXEA 4URIA 1C7TA 3GTNA 2ZX5A 4A3YA 1VFMA 3ARUA 3VGGA 2WCSA 3AS3A 5I78A 2WC3A 2UWFA 3VIGA 5I23A 4AD3A 1JF6A 4FLSA 1E1EA 1BYBA 4EANA 5CLTA 4PMOA 2E9LA 3IGUA 2PC8A 2Y4SA 4NXSA 5GPRA 1EHNA 2GJXA 3RPMA 3KLLA 4D6FA 4BS0A 1HTYA 5E0FA 1BTCA 1I1WA 1UR1A 4FLOA 1V3MA 4Z2IA 5LA2A 4P7OA 5M03A 1A47A 2VURA 4NZFA 3NSMA 3K1DA 3ARSA 4Q22A 4E8DA 1Z32X 4LX4A 4U3CA 4MNKA 1V0LA 1OD8A 2NT1A 2F1AA 1DWJM 3A3HA 3QR3A 4NX0A 3VUPA 1WE5A 2X1IA 3IJ7A 2J78A 3CHFA 1JXKA 1E6PA 1OSEA 3DHPA 3ZJKA 4UOQA 3VIPA 1ECEA 3VIHA 4J3VA 3BCFA 3ECQA 1OINA 1EDTA 1J9YA 4JCMA 1EA9C 2D0FA 2VZSA 3SCTA 3VGBA 4AEFA 3CZLA 1DWGM 4C7FA 4PRWA 4FNQA 3WFZA 4OGZA 1ISZA 3O6AA 1XV8A 1HJWA 1HL9A 1PJ9A 4AZIA 3APGA 5GNYA 1UWTA 4DUWA 5HOSA 2PWEA 3NYDA 2PWHA 1O7AA 3W27A 1UHVA 2A3CA 2J7BA 1KBBA 2VRKA 1Q6GA 2AAAA 4JKLA 3SCWA 4DO5A 1EH9A 3AMKA 5JBFA 1EQPA 2ESCA 3T2PA 1V3LA 1PIFA 5TD4A 3AXXA 4AD4A 5BXRA 2J8FA 1B0IA 3WF0A 3AZTA 1U30A 4LGXA 3BAYA 5E9AA 4AXNA 3OLIA 3MSGA 1JD9A 2XSBA 3K4AA 1J0HA 2X2IA 4P7QA 4CD5A 1DP0A 4QAWA 4WSJA 3SUVA 1UG6A 1YQ2A 1WKYA 1BHGA 2BY1A 4F66A 3ZSTA 2WMHA 1PPIA 2NSXA 3VGEA 3F5LA 3NSNA 4J3WA 1PBGA 1UKOA 2GK1A 8A3HA 1CXHA 1BYAA 3A23A 4H41A 2OYKA 3UESA 2VVSA 2XIIA 3L4UA 1VB9A 4NSBA 1UD5A 1KQYA 5FCZA 2PWDA 1VENA 3WEOA 1V6WA 4H2CA 2W63A 3WMSA 2WZEA 4Z2HA 1R86A 1BG9A 4F9JA 3PZOA 4P7LA 5FOOA 4QLKA 3AIVA 1KR1A 3RM8A 3U7VA 4PCTA 1V6UA 3NCOA 3SCVA 3LRKA 1PS3A 2W62A 4AWEA 4JAWA 3WF3A 2BHUA 3BAXA 4X0VA 2G3JA 5JIWA 3EDDA 2X2HA 2VRJA 4K68A 1G01A 2ZWYA 1JDAA 2WK2A 1TQVA 4D6EA 2OYMA 2PF0A 2UY3A 4E8CA 4Z2JA 3L4XA 2VVNA 1E70M 1EHAA 2D3LA 1XH0A 4AIUA 5D9PA 5I3DA 2VR5A 2ZUNA 3VIFA 3WQ6A 1MWOA 5E0CA 3K8KA 4HOXA 3WY4A 1C8QA 3GXNA 1N82A 1US2A 4TVUA 4GZEA 4PYSA 1V03A 3CZSA 2VR4A 2HVMA 1E0XA 3CMJA 3CUIA 3T0AA 1V3JA 2X2YA 2IUZA 3T09A 1PX3A 1PZ2A 4D1IA 4BQ3A 3L4WA 2VOTA 5DEZA 2X09A 4UQ9A 2F7RA 2DSZA 3OLEA 1DWIM 3A4WA 1E55A 5CLWA 4RE2A 3BAJA 1C8XA 1TQTA 3POCA 4AC1X 2ZX9A 3AI0A 4TX6A 2VI0A 1LG1A 2DQXA 2BVDA 2F2HA 2VZVA 1CLVA 1S46A 5I24A 1W9BM 2D1ZA 2WMFA 1MVYA 3CBWA 1R47A 2CESA 1WDSA 4J28A 2XGIA 1UR4A 1V02A 1ZL1A 1JYWA 3RCNA 4CD8A 1F4HA 1XSKA 1GOKA 3VMOA 1OCQA 3WUGA 1KGUA 2BHYA 3VD3A 3CPUA 1G94A 2QHAA 4W85A 1OIMA 4UR9A 1V02E 2J7CA 2WWDA 1R33A 4GI8A 3MSDA 4B16A 1ZBWA 4UOJA 1Q6DA 4CN1A 3SUUA 1JZ5A 5C70A 4GI6A 2GSJA 4PTWA 3WDHA 1UASA 3AJ7A 4NI3A 3M46A 1QHPA 2YDQA 3I3BA 3AHVA 1FP9A 2YOCA 1FFRA 3AS0A 1SYTA 3BUPA 4AZ7A 3WL1A 1V08A 4FMVA 4D6CA 3RJYA 4M29A 2ZX6A 4CVWA 1UR0A 2AOSA 3EDEA 1TA3A 4FF5A 2XVPA 1TA3B 2FYVA 3EBVA 1H5VA 5BRQA 3F4VA 5LYRA 1VFOA 4BZYA 1KCKA 1XD0A 3FN9A 3NIYA 2CKRA 4HA4A 4ML4A 4J3XA 3WELA 3ALFA 1TMQA 3WQ5A 1GOQA 2J7DA 3B9AA 1I75A 3QOMA 4WLCA 1GQJA 3W37A 3FHAA 3WUFA 1UKSA 3FAWA 4TVDA 3VIOA 1HJXA 4HU0A 3EDFA 4W8BA 3TTOA 3AMDA 4M56A 2VZOA 3CUJA 1G0CA 1E4IA 4AYGA 3I3EA 4PCSA 2IGTA 3VIMA 1KR0A 1E5JA 3KL0A 4HOZA 1HN1A 3LXBA 3CZJA 2ZOXA 2D0GA 1UOKA 3WBEA 3H53A 5BWFA 4UQAA 1CGUA 4KRTA 2D0HA 2BVTA 2ZUSA 3UG5A 2CBJA 1BGGA 3W25A 4QCEA 2JEQA 4H8HA 5BXPA 3WQVA 3WN6A 2WVSA 3KZSA 3AXIA 4JFTA 3PZ9A 3GXPA 2W67A 2YJQA 2XVKA 2O9OA 3PZUA 1U33A 2D73A 1B3VA 4HMDA 4LYPA 4HPHA 3RM4A 3HG2A 4MPKA 2W5FA 2VCAA 4OKDA 2X8RA 2XVGA 3GXFA 2D2OA 4V27A 1EQCA 3A4AA 4CVUA 3AHYA 1Q6EA 4ZEPA 4YHEA 3DX3A 1VBUA 3IAQA 3OG2A 3BAWA 3MI6A 4U2YA 1AQMA 3BVVA 1OGBA 4CCCA 2WKGA 1BFNA 5A6LA 2ZE0A 1PAMA 5IFTA 1KGWA 2ALWA 2BXYA 3A47A 1GQIA 5LA0A 4W87A 3AZSA 1GZJA 1ZBVA 1W9UA 2CXGA 3VU2A 1HJSA 3VD5A 3BCDA 3OGSA 1JG9A 2XHYA 3OLGA 2G4FA 1JNEA 2ZX7A 2GJXB 1JZ2A 2WXDM 4W8AA 5JUVA 4ACYA 3SUTA 1ISVA 2Y8KA 4XUYA 1H09A 3EJTA 3WNKA 1Q6CA 2YBTA 2XWEA 1SMDA 1R34A 2VJXA 1CGVA 5I2UA 1VFUA 4P7RA 1ODZA 3W26A 2WCAA 2ZXAA 1QPKA 1GJUA 1JGIA 2GFTA 3WH8A 2WW5A 3HG3A 1H2JA 3WH7A 2XVLA 5A6MA 1WO2A 1RD6A 5HNNA 5ECUA 1ZJAA 2ZUWA 3WF4A 3ARYA 2WVVB 3KLKA 2EPMX 4WKHA 1UD8A 1DWHM 1LL7A 2DGAA 3LPGA 2DPEA 2DSWA 1E4MM 1HP4A 2WVVA 3AIUA 4AYSA 3AYRA 2E8YA 2OW7A 3UERA 3K8MA 1VFFA 3D52A 4ACZB 2XSAA 3PHAA 4MNJA 3A6OA 2CHNA 3WKZA 4S3KA 2QPSA 4AY1A 2WHJA 1WPCA 3T08A 1HJVA 3MUIA 1KQZA 1CECA 1MQPA 3DYOA 4KWUA 4F79A 1K9FA 1HKJA 5D8WA 4GPNA 1KTCA 3WNLA 1CXIA 3ARWA 2VRQA 3I3DA 1UWQA 1HT6A 2EQDA 3WEMA 1OWQA 3W29A 1W2PA 4MB4A 2XFRA 3T2OA 1ISXA
chains in the Genus database with same CATH superfamily
2HFEA 1E50A 2V17L 3MJYA 1A3RH 1SYVA 1XTLA 4HT1L 1W3KA 3M0IA 3RWIA 3RPTA 4ZFGL 5FI8A 5C0RH 4UTTC 3TO4B 4ALAC 1BMZA 1HHJB 4JE4B 3U2SB 4W87A 4F48A 5C7XL 3SY0A 2SODB 4B90A 2OSYA 2V8LA 5FO9B 5D5ME 3DAQA 1TYGA 3MRPB 2DY3A 4MZ3A 4ODWB 5KSBB 4UFIA 3DETC 2CK0H 3H4FA 4U6VH 3U6WA 1AR2A 4HQQL 3A4FA 3Q6FA 1VZGA 4XB3A 3Q2CA 4Y2OA 5H4YA 1OZUA 2DU2A 2IDFA 5IBUG 4LLWA 3SQMA 5C07A 4M7SA 1P1ZA 2OCCB 4BK8A 2J27A 1IAKA 3L5AA 4PTXA 3S1GA 3NRFA 1L2UA 4NFDA 4LKXB 4ZNCD 2WJZA 4KQNA 1DQMH 2V69A 5I18H 1ZLVH 4A8IA 3C09C 4XX5A 1T21A 1XHGA 5M95B 3FTGB 1FWJC 1VP5A 1KB5H 1T2QL 3TIEB 1DVFD 5A8PA 4NZTH 1A2YB 3QZOA 2Z1KA 5KJRH 2ATSA 3BW3A 5CAHA 1L9TA 3WKPA 4DW2H 5BO0D 4LHUA 1R38A 4M7JH 1A1MB 5ESQB 4E9VA 1THAA 3QIUC 2E4TA 1X7TA 2ROYA 2MPAH 1U8JA 5U7SA 2PCFB 4QCIA 4S1DD 3RU8X 5E5MB 2VDKL 1SMAA 3ULAB 1SUHA 2WNWA 1U93B 3D2UB 1E5BA 1ED3A 2BVYA 1NAL1 3SN1A 3NFPB 2NW0A 2R0WH 3WIIH 4K1GA 2PGWA 2R4RH 3HUJA 4JVPA 4NQDA 2JQZA 4GUOA 3GTFA 4W89A 4F24A 5EBUA 5IB2A 4JRXB 1Q6FA 4ES9A 1CFNA 2BVPB 1OCWL 4MAYA 3MA9L 3BEWA 1ZTXE 1KACB 4B5TA 2GBVA 3QLDA 1JNLH 5CPTA 3D50A 3GMMB 1S7XA 2EPOA 1A3RL 1U8OA 4UQCA 4TMCA 1A5BA 4KKAC 4CN6A 3ONBA 1J8HE 4PRAB 1T0OA 2FTYA 3UZVA 4P2RA 3QMSA 2CLEA 3EXJA 3F4NA 4QKXB 1EVTC 1MMFA 3D0VA 3FOLB 3QHMA 2CJSA 1KB9J 5CU5A 3DFQA 1CUOA 4H8VA 2EDJA 4JHUA 3ME3A 5CG0A 5BS0D 1C7SA 4KJWD 1N8ZA 3O7UA 2PCPA 4G8AC 2WLLA 5D2LB 4YHNA 1OC6A 3IGLA 2AEWA 1P7TB 4IKKA 2JALA 5F7KC 3ITXA 4MQTB 3WMBA 4FP8H 3JWNE 3T0WA 3BKYL 3OHXB 1KNOA 2VJ0A 1Q9WA 5E2JA 4Q8OA 5GISH 3MLTB 2ROXA 5BZXA 1SLUA 3RPIA 1MJJA 5JTWA 1MI5D 2EKCA 3Q3GB 3VILA 3WBXA 1B6UA 2K6ZA 4NZUH 4ODTL 2WXLA 5T8IA 4JQXA 3U6XS 1QYGL 3VVGA 1HNYA 3IYLW 4KHXH 1WEJL 2PA6A 5EU6B 4QRRD 3QJZA 3VTAA 4WUIA 3K5RA 4HUNB 4NB7A 5SV3A 2A9NH 5IESL 2Z93A 1NPUA 4QOKA 4G82A 3OVRA 4S10A 4MNGA 1A4JB 3QH2A 4TNWF 4HN8A 2WMIA 1FBIH 4QD2E 1UM4L 4JDZB 3FNDA 4IMAA 5GGRY 2CLVB 4FADA 3M07A 1FGVL 2DM4A 5D1ZI 4J1UB 1X7SA 4KH9A 4AIZB 1FXPA 3MMWA 2FB4L 3QJHB 3QO1B 4LDLB 2Q86A 3WIIL 5E08H 3WK2A 1FFNB 4KQ3L 3ZE0F 2CNZA 4UM8B 4DPAX 1VRDA 1UT9A 4HCRH 2EE6A 3C6LD 1E6NA 3DX7B 3B8TA 3ZLFA 3HPJA 3BZ4A 3HV9A 4OH2A 4QTHB 4DCQA 5A16A 1VPXA 4GYKA 3H56A 4ZFFA 2P5NA 5C0EA 4OVXA 3LZ5A 3W76A 1HHIB 3S96B 5FKYA 4ATTA 4TUFA 3CEUA 2AK4A 4ATDA 3V52L 5AFAA 5ITBH 1E51A 2Z00A 5CZTA 2OS7A 3APMA 5KAQG 1DQIA 1KN2L 5H91A 2LV4A 2WM0A 4MQ7A 2YBVA 2P26A 3OJ2C 3TC6A 2EC9U 4KZ0A 5FO8A 3RO6A 1Y0LA 2W0LA 1XDJA 4N90D 1TTRA 4XE0A 1KDJA 5I16B 1EZWA 1MRCL 1TV2A 1GW9A 2YXXA 3Q94A 1DQQB 4XN4A 4OFVA 1A5CA 2OT1A 3GNXA 3VWJA 3R25A 5D2TA 5AZEL 4UANA 1LOQA 4IPPA 2G0KA 4UTWC 3BG5A 3KWWB 2WNZA 1DN0B 2Q8XA 1MFEL 2FNBA 1I7TA 3CZFA 2G2PA 1ZANH 4GT7A 4PREB 5TK4A 2UVEA 4NS0A 1F2QA 1HO4A 1L6GA 3QYSA 1G69A 2ZYRA 3WJZA 5CPLA 5KTEL 1GGBH 2GY5A 1TE1A 2J2ZA 1E15A 1F4YH 3T0EB 3P2DA 2R24A 5IJBC 2RHEA 4GFIA 3QNYB 4JX6A 3NSFA 4XHQA 1QEWA 4LK4A 4MNLA 2MOVA 3OX8A 1UXSA 3CFCL 3IJSA 4NJAL 5DJDB 4NQSB 4F57L 3CL7A 5CGQA 1BQHA 2NNCA 4KFOA 2GJ6A 1UZ4A 1TFHA 1UM4H 1AG6A 4PRPE 3AMGA 1GGYA 4XXCA 1WS8A 1A8JH 1PY0A 4LCYA 4CN4A 4TO8A 3Q1SH 4G9FD 4FX6M 1WV7T 3SE8L 3W9DB 1MI5A 5HDWA 1T7VA 2DVXA 3OIHA 4O1EA 4XP6H 2DDXA 3N50A 3GIPA 4JTDA 4EI5B 2Y61A 1MCEA 1DXEA 3QQWA 1AMXA 3CMGA 4MYPA 4LPXA 1RIHH 4PJAE 3HS9A 2ITCB 2NR6A 3TYAA 3OJDA 1NU5A 1FL5A 1U58A 2ED9A 4FLRA 4CSZA 5B38G 3K1GA 5HYFA 3KBPA 4OIIL 1FL5B 3QORC 4YEFA 1IM9D 4FA7B 4IHOB 1AH1A 1H3UA 1WA0X 2Z4QA 3BO9A 4DAGH 4KNTA 4ZMAT 1XIBA 2YEQA 2D2CC 1IIGA 2AQVA 3IFPA 1MW2A 3GSWA 5FKAB 5HYJA 3A13A 5JOEA 5LB1A 4NYYA 4R7JA 4PY7A 4JMXA 5BVJB 3I75A 2AJSH 3LCYA 3BO8A 4PRTA 2TAAA 3MRNB 2FECI 3C6SB 4ONOA 3DYMA 4PMRA 1NMBL 4WWID 3GMNA 1O5XA 3W9EB 7ENLA 2B0SL 2WJ7A 4PYHA 4IW4C 4BRJA 3DSFH 4LCWB 3ZTCC 1A6AB 3L5WA 4G2AA 3NG3A 1NC4D 1UXSB 2WJDA 4C6PA 1WFJA 3IKCB 3ZN6A 1QI0A 1R3WA 1OGTA 1XINA 3PPSA 1IGFL 5KZCB 1AKPA 2VL4A 4NHUB 4W9IC 2PLCA 3TTSA 3F2BA 1QHOA 1MYRA 2PP7A 1XGZA 2J2ZB 4WO0A 1TNNA 3KWSA 5IRPA 3HE6D 5C07E 4ZTOH 1DHPA 2Z25A 3FQNB 5JZ7C 3CUPA 1WZMA 1A5MC 4Z3TA 5MHSD 2XG4B 1WCBA 3KH4A 4OCWH 1E65A 4B41A 1RZPA 3MLRH 1EEPA 2DJXA 3T40A 4PBDA 3UCRA 2DW6A 4Z2LA 5I09A 2VLKB 5B1CA 3QUYD 4PCNA 3SCSA 3L2MA 2UY6A 4NQVB 4HVBA 4IIQA 5EO0A 3QRFM 2JKSA 3P02A 4KKQA 1W1IE 2XV3A 3SE4C 2J88A 3EWBX 2WHKA 4PJFE 3OV6A 2Y1HA 4HK7A 5CSRA 4LW7A 1T04A 4LAZA 1LQ2A 3OAYH 1XVSA 3PFRA 4PGDB 5ILTL 3UOAB 1FH8A 4RV3A 4ASTA 3SPGA 3ITTA 3KPSD 1FZOB 3FDKA 3W7CA 4NUGL 3FRUA 5IK3B 1FAIL 4Q0XL 4AK2A 4ZFOB 2G4GA 3DX6B 4S1RH 4IQLA 1AQ0A 1G6VK 5FA5A 5ICZB 1S7WA 3HRZC 3KXFA 1BWMA 5FJTA 1I3GL 1W9XA 1KJVB 1L9RA 1ADWA 1KC5H 4Q8WA 2UY7B 3JWOC 2XA8H 2XFGB 3CVHH 4G8GA 2Y22A 4ORGB 4X6BA 2GK1B 2GCYB 3GYEA 3RZCD 1MIEL 4YSDA 1N7MH 5AWNH 4ZW8A 1OIFA 4GQBA 1I7RB 3TZNA 3EJRA 2NY2D 4EAEA 1BMWA 2XTKA 3PBMA 3IDIA 4H25A 3W0WB 3QXDA 5F9JA 1OXYA 2BS9A 2GTQA 3N40F 4W9DC 2VZUA 1XZWA 3SGKC 5K9JH 4UQEA 2G60H 3W38A 4ZMGA 1LMIA 3OBAA 4MXVE 4Y5VB 2ZBTA 5FEZA 1NCDH 2DH2A 4LOEA 3F58L 1VIWA 1KLFB 1LRQA 3W7RA 2FZDA 4HGWA 4D72A 3ULUL 3QV7A 4S1FA 2HKFL 3VE0A 5J1SC 4LAJH 3MCLH 4J40A 2DQIH 3WI9A 1QG3A 3PWIA 1A6ZA 4YPJA 5IKCA 5K1NA 3N44B 4PH6A 4HNTA 1CDYA 1ZJBA 3M44A 1OZTG 1UD4A 4DIAA 5I71B 1V0NA 1E9ZB 2WTRB 5E9XA 5I03A 1D9KB 1AXSB 3ELQA 4HIHA 2C3WA 3C5ZB 2E5EA 4DP2X 1SJAA 1VCFA 2REQA 1XGDA 5KSBF 1Z3GH 4FI6A 4EF3A 4FZEH 5AW9B 2MCPL 3H0TB 3W39A 2G8ZA 1SEBB 3ABGA 3SCMD 2AL2A 2V2CA 5DFVC 5MENE 4FFZA 1BZ8A 5A6JA 3M7WA 1DBMH 5FHBH 3AICA 3ZJ7A 3NDYA 3O2LA 4KS0A 4M93C 1QEXA 3QCVH 5C08E 3MUZ1 2BZ7A 3N06B 3DYPA 5ESVB 3THAA 2YLHA 5D1ZD 2WP3T 3QZLA 4PJDB 2FATH 2OCFD 3QA3B 3EJSA 3RUGF 1T7LA 1CX9A 4XN5A 4WRHA 2JF6A 1FVCB 3NJLA 4Z7QB 2EYTB 4R4BB 2ZZ5A 2XIOA 3RWJB 1ZE3C 4IK7A 3G3MA 5C0DB 4I9JA 3RP1A 4L2LA 5FYKE 1KC5L 2VCBA 4B9GA 3AYSA 4QXGH 3WQGA 5EEXA 5CP3H 4X4YA 5FB8B 1GZPA 4RMBA 4QSFA 3AHZA 2ICEA 2J4WL 4ODSH 2JKTM 3GSRB 2F54D 2H6PB 4Y4FC 3T0BA 1QVBA 2GJLA 4HBKA 4D71A 4XKYB 3PL6A 4C7DA 4Z7NB 3FCSA 1PZSA 3DV6A 5CF3A 3P2BA 4PS4H 5LNDA 1NARA 3N9RA 1M71A 4Z0SA 3REVA 3PBGA 2JCCA 2X87A 3HG4A 4E41B 4FQ1H 2DAVA 4A04A 1KIRA 1ZLSH 1ERNA 3OKDB 4KXAA 2MNRA 2OEMA 4LBUA 3GBNL 2AQSA 1WVZA 4PLJD 3ARED 4JO3L 4IKLA 1AFVH 4O0ZA 1E30A 1HHGB 5DF0A 4N42A 3FTGA 4HC1A 4WGHA 4C6FA 5F7UA 1W9VA 3GRWH 1BVLB 4AD1A 1P9MC 1EC9A 1G7JB 3MWAA 2C9RA 4JHWH 3FJ6A 3M5ZA 2X1SA 3WDPP 2I07A 2WLIB 1IXQA 3LCIA 1TKKA 3GR4A 1BSIA 4WQOA 4JICA 4RZ4A 4P5SA 1W2VA 3OKLA 4R96B 1BVKA 5AVUB 3VU1A 3HKZA 1ZT4B 2WZAA 5FKPA 1AHWC 1KEGL 1G7JA 2FEDD 2MKLC 4FKHA 4MMXB 2C91A 2VCCA 3KW7A 5T3ZL 1DLFL 4O1FA 4DHGA 1XR9B 3W5MA 1RUKL 4U4IA 5JDSA 4KRPC 1P7BA 3MXVL 4U7MA 1YEGL 3FUJA 5I5JA 3ARXA 4JO5A 4S38A 6PTDA 2VMCA 1I1FA 4JFQA 3OKDA 3FH8A 4LGRB 2J25A 4Y1AD 2D7PA 7A3HA 2HQAA 3P2TA 5BYWA 3H6OA 2GUOB 4I2XE 3UF9A 1O6IA 4KEZA 2DYRB 4GXVH 5B7YA 1XCQA 5JH1A 5IFJB 2A4CA 2PYEB 3HZYA 1I9RH 4HFWA 4PJ5D 2LHAA 4RWHA 2NYYD 2C9XA 5IB4A 2ZOUA 5JW4R 2Z92A 2NYZA 1DKWA 3L95A 3ZHFA 1A7QL 1CXLA 1MHHB 2ZXEB 3MCKB 3H8AA 1WZAA 5FEXA 3ZWTA 4HIBA 3PIQA 5D7LA 3O45B 5GJSH 1XBDA 4LYQA 4EMZA 2AGJL 5EO1A 1VBJA 3M5XA 1IGJA 4O5LH 4RFNC 5AOIA 1IIHA 3C2YA 4W9JC 7CGTA 3DG3A 1YSOA 2AW2A 1Z7JA 5CZVH 3OKOA 4Q56A 5E9DE 3N2BA 1M6OB 3PNWA 5JQ6H 3NPSB 4GP4B 4UQ2A 1CD0A 1KN2H 4YVNA 1TVHA 2PUQT 4GAGH 3ZX1A 1XUZA 2BWDA 2VLKD 1SJEB 1EJ7L 1TV4A 4L37B 2F54E 5BW6A 1RZJH 1R3IL 2QVFB 3VCRA 1KA9F 4LE8A 5CC5A 4RX4A 2E7LA 4JOMA 4M5PA 4FHKA 5I0VA 1OABA 3B8VA 1ZALA 4AKQA 2VL5A 5I6OA 3JWNC 3KCOA 3GMQA 2UWEF 4WR3A 4Y16D 1H1NA 3FU9A 1S5HA 3QUZA 3BT2L 4I9WD 5JIMA 4OLYL 1JJKA 2OODA 2FZ9A 3TA3C 4F3FB 2F9BT 4AXKA 4W4QA 1DBJH 3WYRA 1W0WA 4GAAA 4JPWH 3H1ZA 2A5UA 2DI9A 2BX7A 5EV7A 1V54B 1CG9B 2BVOB 3HU7A 5LWYH 3MV9D 1TJIL 3C5JB 4BD4A 3F7JA 2B1HH 4KZDH 4OGXL 4IDJL 1X4XA 2KZ1B 3W86A 4EACA 5CCKH 1IT8A 3QGAC 4BWTA 4HBCH 1BVZA 3GZKA 3MMEA 1WBYA 4WHYH 3SJVB 4L56A 4GKZA 4PB9L 3C3UA 4QJ1A 3BVDB 1KN4L 4AMAA 2OMZB 1ZLUK 5EEZA 1K4DB 4RBPH 4LEXL 4TULH 4GVFA 2OQJA 3ZVHB 5FCUH 3VRLF 3MHGA 4OZHB 2Z0BA 4U6TA 1WFTA 2QPFA 1NICA 5D4QA 4AVJA 5LXVA 5KSAD 1M6UA 4Y1AE 1ADOA 2DJUA 1UT2A 3MFFA 3W7MA 4IISA 1D7CA 1GW0A 3B1UA 4A7VA 3CQJA 4F2TA 3QDJE 3PPFA 3C87A 3LNFA 3L67A 3BW9A 3QEQD 3AT9A 4LSPL 5EUOE 4D6HA 2B1OA 3ASWA 1X7FA 1MG3C 5FM5O 2AV1A 2FO8A 2IOOA 5SWSA 1Z89A 3B06A 3L4YA 4G6MH 1W37A 3QF0A 3BMWA 2UX7A 2WXFA 3L1EA 3WCYA 3VVWA 1IWPA 3QZNA 4W9GC 5AW2B 1YAZA 3PY9A 3V5DA 3WKNA 2X0YA 4C6JA 1HJQA 4YXLL 1RBOB 5ALBH 5F89B 4APQB 1YNKH 3H4XA 1IAOB 4RZCB 3HR6A 4IOIA 2W65B 5FGBC 1L9SA 2VFEA 5AYBA 1FAKT 1F6FB 3F7VA 4K73A 5E9DD 1YYCA 2IOIA 4OHQA 4MVBC 3SURA 4Y0GA 5IMMA 5F0PB 2EEFA 3DUSA 1DEEB 3HNTH 5D8JL 4ZXBA 5K59F 5L88H 3WU1A 4XBMA 1KJ2A 5J4MA 1G6CA 2G9KA 3VQ1C 4HP5A 3UJTH 2ED7A 3LDBB 3WFEL 4AQEB 3WTUA 2PABA 5EMYA 4Z7UF 1ZV5A 1PKLA 4O1BA 4AVOA 2PD9A 4NHUA 5HQEA 4C91A 3FQXB 4DAGL 3HN3A 4S23A 1OGAA 2CFFA 5L4IA 3H4WA 2QGDA 1NY1A 1FG9C 1WUZA 3MNWB 3QQDB 4WWOA 1Z3NA 4NAJA 3LZLA 3O11A 4WCYL 4HISA 5CN3A 1TTFA 3BP4B 4UQ3B 4KCVA 1AIFA 4M5YL 2APSA 3W00A 1WV2A 1KELL 1AQ8A 4AUYA 4F7KA 1OWRM 2K7PA 3ARDA 1T6VN 2ZCKH 3T4WA 1OLLA 2FDMA 3L0KA 5D2NB 1UWAA 3R89A 3SR7A 4ZPVA 2GKIA 4OM0H 3E6FB 3QQNA 2AQPA 5MERA 4YQXH 1GG1A 3KXQA 4NQXB 5DDHB 5HYJB 3CU2A 3HLAB 3KXFE 4B4HA 3ZVIA 3VDCA 2VWEC 1H51A 1PW3A 4R8WH 2FJFB 3G2GA 4IMGA 2XV6B 1UYWH 1FV1B 5JXEC 1C3FA 1H1YA 3HI1B 4OD3L 4WI7A 4XWGL 3VI3F 5DMKB 5DD6A 3QKZA 4L23A 5I8OH 2HZGA 3VFGH 2YD5A 3SHSA 3V4PB 2X16A 3T6WA 3C0SA 3WLHA 3LIUA 4F0RA 2QJDA 3B2UC 3UP1A 1K9DA 2GWGA 1OP9A 2ICWB 4PRNB 4U6YB 4NNXB 3FBKA 4MA7H 3L1OL 3RVVD 2DIEA 1QNSA 1XYLA 3FQ1A 5CILL 1HIZA 3VI2A 3K91A 1E42A 2V6AA 4BYHA 1D6VH 5FYJL 5DWUL 3A5FA 5AVWB 5IBLD 1HVXA 5B21A 3S37H 3MUCA 2GK0B 3MI2A 4I4WB 2QSQA 2H8ZA 1EFZA 4NAEA 4OZGF 2JJUA 2BP0A 3IXAA 4GKNA 5CR8A 3M0VA 3VDHA 3JT2A 3ZHDA 2NUTB 1YNLH 4YNYA 2HMCA 1T1XA 4HK0A 1D5XA 5IFAH 4AYBA 3QJXA 5LJYH 2KZKA 5LNVA 2EXSA 3MLWL 4Q0XH 1F02I 3RDTA 4A3QA 2WJEA 1QCWA 2DYPB 2IV8A 4ONGL 1YC7A 4LIQH 5LN8A 2DQUH 4QRUB 1YJDL 4E2VA 5IV2A 5JQHC 3RFZA 1OD7A 1FWFC 1OD9A 3IUHA 3R12A 4L6OA 1BFTA 3L81A 6REQA 3VXNA 4DQWA 2NQDA 1WDQA 1QSVA 1KPRB 3KLQA 2Z1XA 4HYVA 3HZ3A 4OCNC 5B1AB 4HJFA 5I1HH 4QYOA 5I07A 1PKQA 1DQQA 2OYLA 1CE6B 5E2TL 1UYQA 2RKXA 2J6EA 5DJ8B 4D9QD 3M0HA 4WJEA 2NX5D 2BM3A 3P9LA 1K85A 4QP0A 5I74B 4M82A 3HR5B 4XAKE 3ZTNH 2O9RA 1UACH 4E9SA 1KM4A 5EU5A 3AVEA 3MRGA 3BHBB 4A35A 3VDBA 1R87A 3PQYB 5DVOA 4PRID 4A29A 3F04A 4LAOA 5FA3A 1CZ8L 1M7IB 3UEZA 3MBWA 3FS2A 4ALDA 2WQXA 1ID5I 1GPFA 4IBLT 4PN2A 3E0LA 3GRIA 1KYAA 4EOWL 1N68A 5A16B 4DCQB 1FP8A 1W8SA 5HK4A 4QCEA 1XIGA 2FGWL 3I6LE 1QSEA 1WUNT 3QZBA 3KPLB 4HV8B 1XSJA 3UTQA 4Z7VA 2E3VA 1Z66A 1AQHA 3PSWA 4CVZB 2AJSL 2XFXA 2XFWA 2YL6A 2YAPA 1DJQA 2X4SB 4QDGA 3T0VA 4D1JA 2JIXD 3UC2A 4FSAA 1W1B1 3M7OA 4G5ZH 1PG7H 2B59A 3BGMB 3CXDH 4IS6A 2VC9A 2ZUMA 2CDGA 3BZ5A 3P69A 1NOAA 4DF0A 4HKBA 4FQ1L 1BAFL 1CGXA 2M83A 3M8OL 3O6KL 2JWYA 2XUWA 4QO1A 4UYQA 4X5RA 3S48A 3ZT6A 4DOHE 3EDJA 4Z0JA 1MCFA 4GC3A 1TO5A 1E6SM 4XZIA 4XHJC 4DK3A 4DWSC 2B31A 1UCBH 3OG4B 3KG5A 3W28A 2WXMA 3DPBA 3UPAA 3WO4B 4F91B 5DD1L 4POCA 3GJFK 4QXGL 4Q8UA 1DQDL 4L8CA 1HF6A 1OGGA 4UWMA 4LLUA 3CQQA 3AWGA 3P4MA 4N2HA 4IBTA 1P0EA 2H32B 2ZAHA 5INCB 4RUBA 2Z6FA 2OXHA 4QOKE 3LLFA 5CZSA 5LCVA 3CV7A 4J39A 3ZL1A 3N42B 1ECQA 2RB8A 4FYQA 3BE7A 5A69A 3TFCA 2XBDA 3DHFA 4OUUB 5F2FA 3HMXA 5J8LA 3L4TA 5KSUB 4GIEA 3VSUA 4EPEC 4WEEA 4P59H 1XXDC 3LEVH 4H1LB 3W11D 2XZQH 1MRAA 5TDNA 1RA5A 3GRWL 4PUNA 3LPPA 3MODL 1PD1A 1RZ7L 3S3BB 3I7QA 3DTDA 4TYUA 3VMPA 3IMUA 1S7XB 5I1EL 3REQB 4BHYA 3H4HA 3OJVC 2CLRA 1T40A 2NX5E 5DMGD 1R8LA 3D4CA 1VSCA 4EE9A 2E59A 3R6IA 4AB4A 4I0PD 4C6LA 4XPAL 1UQYA 3W4RA 1JYNA 1P7QD 1UFGA 2JB6B 3LVTA 3SPJA 1AW2A 2QCCA 3QCUL 2W92A 1JTOA 3G5YB 2Y9RT 1HINH 2NNRA 1UPMB 4GMEA 4FXGA 2RDXA 5EBMA 4RDZA 1XGQB 2Z3FA 2VTFA 5BMFL 3S88H 4JFUA 2VC6A 1B90A 4HPGA 1QBAA 2VUNA 4YUEL 2Z31A 3RCYA 3VYOA 3E74A 2EDBA 4QHMA 1DSYA 1MCQA 1CR9H 4XNBA 2CA3A 4L4TB 1CBGA 3I6LD 3P4OB 1LYXA 1SZGA 4XBEL 4JFZH 4OUEA 4IBQA 4N5EC 3FMGL 4KVCL 4Y7MA 1K4GA 2AJ3B 2BW4A 1GHFL 2EXYC 4A4AA 1IC0A 4ELKA 1WIPA 1YEJH 3K2IA 4JZNA 4HK6A 1NC2B 1JCMP 1UXMA 1U3HD 1EPXA 2WMPB 1U41A 2VT0A 4PGCB 2WO2B 1LP9F 4UFJA 1BOYA 2XQYG 1C29A 1KM0A 3GC4A 4KAQH 1S2AA 4RMVA 4EKJA 1CTNA 3F84A 3OW1A 1JK8A 4YN5A 2DQIL 5A8OA 1PLGH 4QHLB 5HHQB 1H0DB 1T89A 1B3JA 3RUGE 3VFVA 3D0LA 3B9KA 3QNZA 2Q10A 1U1HA 4QR6A 3GHSA 3WH8A 2FQDA 5DEFB 3IIPA 1P6AB 5GRUH 2R2BB 4HYWA 4IKNA 1Q94B 3RR1A 3GSOB 4HEMA 2VDPH 1M03A 5AB3A 3OZ9L 6ENLA 1KIUB 1X5ZA 4N1EA 2BNJA 3NQ6A 3TBSB 3IJHB 2HTKD 3HGJA 1CZ1A 3WLSA 4HUMB 5GJTL 3N13A 3F05A 3M0YA 1XXFC 3N1PC 5TQ0L 1ESWA 2IVFC 4ELMF 4D6DA 1M3IA 1NPJA 3K2KA 1NTDA 3A67L 2YN5A 2Z1VA 3IUIA 3VWJC 5F2GA 4F37K 3LCWA 1DVSA 2BP8A 3CLWA 3IV3A 2J1KA 3KBFA 3VI4F 2BMKA 5KVFL 3BZEB 1EPVA 1ONWA 4BY3A 2J47A 5HGBA 2Z34A 4N8VA 3I6KB 6TAAA 1XW8A 3TR2A 1OCRB 3DUUA 5A6BA 4O15A 2B08A 5AW0B 1RLDA 5J04A 5K4ZA 2YQGA 3TO2B 3ZLQC 5J6GB 1K4CA 5EEUA 2P5WB 1M3UA 4WNQA 4TOQA 4RR4A 2GEQA 4ABUA 2CKNA 2J56A 4P05A 5ELIA 1IAIM 1N8WA 2YPLB 3T9WA 4DO6A 1QK2A 3D05A 1T5XB 1TQUA 4Y5YA 3VXSE 1F18A 4K36A 3LDBC 3WN5B 3WH6A 5BRPA 1V6YA 4I0PA 3APYA 4D6JA 7TIMA 2BGQA 3CVHA 3QJFB 2OI9C 4PN6A 5FUCE 3TEUA 5LBVA 5J6HA 4O10A 3LKRB 2DLEA 2DTML 3V0TA 4PJ9D 3WLOA 4WEVX 3SDXE 4PW3A 5DVMA 1FL6A 1ZSDA 4Y2DD 1KGIA 2A0LD 4Z7VF 1IVTA 4AGQA 4AIEA 3WD3A 4CMMB 4H7VA 2FGZA 4P2OB 3U9IA 4K2SA 5AD0B 4QHKJ 3RLUA 4JL1A 2B0MA 4LNYA 3HZVB 4F7CB 1QBLL 1HDMB 1UQZA 2EG6A 4N9BA 4HMEA 4HPYH 1ME8A 3O3RA 4KRMB 4X2UA 4PMQA 1SVDA 3U4KA 2LE9A 4F9LC 2PPAA 2FWUA 1A9BB 3EFOA 5BW7C 3INPA 5H8PA 1RUMH 5L8KB 4X9YA 3SB3A 3VGDA 3GG1A 3S2LA 1X5HA 2E7DA 2Y36H 2ZXDA 3WD5H 1A4MA 4CU8A 4LLAA 3ARGA 4QTFA 4DW2L 1VF5C 3HFMH 1E5NA 1VKXA 3TCLB 4IYKA 3SQBA 3EJYC 1PVNA 2DQHH 3ZIZA 2XM1A 4YLBA 2CR3A 1CI1A 2HG5A 1OQFA 3M1OA 2FE0A 5A6AA 1DCEA 2XVNA 4EP8C 1NAML 5F3BB 4MWAD 4BXSV 1A6WL 3NJIA 1BX2A 5ENWB 3QPKA 1D3GA 4F2BA 3LZOA 1GCYA 2XN2A 4J8RA 4ICMA 2ZCLH 4L6DA 4GMSH 4LASH 1SDDB 1ET8A 1A02N 3OA5A 2LAAA 2WWMC 1QWKA 4DKEL 1LF1A 4GZJA 4OZOA 4RQQB 3RK8A 5IQ9A 1JYXA 1MCIA 1WS7A 3AXKA 5IVOA 2INFA 1GZHA 3RKDC 4DI8A 5J56B 3QI9B 3K71B 4XAWL 4FYSA 1R3QA 4U1SB 3D5HA 1L7IL 1OD0A 4E2OA 5G1MA 1D2PA 1HXYB 5GSVA 4JTRA 3KAAA 2HLFC 1PCXA 3BH8B 1QZNA 4IIEA 1AW1A 3LM3A 4RV8A 1AO7D 1JN6A 2EO7A 5CGMA 1V3KA 3H9YA 3R18A 4WKZB 4C4KT 2WMKA 4JTCA 2ZONA 5H1WA 4PQXA 4A7QA 4BF7A 3N17A 1BRLA 2VWTA 5FF3A 4E2DA 3GUWA 4WW1B 1HKLL 4S3EA 2BVUA 1BECA 5B7MA 1E6JL 2A1WL 2FBOJ 4ZENA 3EFDH 3DJRA 5FO7B 1HSAB 1OTTD 1CLXA 1D5MB 4ZDHB 1W3JA 3L1FA 4XAPA 4JUSA 1V10A 2AKRA 4UQDA 5DYOA 3RRAA 5FD0A 1MIML 3QUXC 3UBXB 1E9OB 4HKXA 5I8CB 1AJ2A 5TE4L 1TSHA 4B0MB 5LCVL 2O6CA 1XIWA 2CKBB 4N0RA 4ADGA 1UUQA 3B3DA 3KPTA 2PLKA 2H9AA 2WWNA 4RAVB 3B3BA 3MI3A 1KB9K 1FCBA 1JULA 1T0MB 4HSCX 3T2QA 4JPGA 1J8HB 5AOJA 2R1PA 2OZ3A 2E77A 2DMGA 2VDMH 4WV1C 5DA0B 2IQDA 4KESA 3W73A 2CXKA 5JPNB 4ZMNA 3V6BR 1E1FA 1SQ7A 1H6FA 4NASA 4TSBL 2BOCB 5DJ6A 2DP3A 2GJ6E 3DX9A 4IU2A 5D7LD 1HNGA 1F45A 3GLAA 3MUAA 4N9EA 3KPSE 5EF3A 3ETTA 5T9BG 5PTDA 5DK0A 3ZU8A 4NRYA 3QPZA 4YSSA 4I77H 1KTDA 2BSCA 3TO4D 3NRPA 2DT1A 3V4PL 3XISA 5ITFB 2G5WA 7FABL 4KZEH 4FLQA 1FA2A 3GTXA 1IFGA 5B7FA 5BVPH 2IQ9H 3D51A 2R0ZL 1A21A 3GXIA 1W72A 3MLVL 3NGBB 3QI9C 1S5IL 4M1CD 4NO0D 2Y7FA 2EIEA 3B8IA 3T71A 2YSSB 4PJAA 3BWWA 1E5AA 3K6NA 4RGNC 4BK4A 1HZKA 1E0OB 3NEEA 3N41B 1CLKA 3BK0A 2FSEA 4L4JA 4PUWA 4NYUA 1XYFA 3GIVA 1EC8A 4Y4FA 4UINL 1ISWA 5EBAA 3PANA 2NY5H 3UDWC 4PUBH 3MLUL 5FWQA 4Z42C 1YEKL 2B1AH 4GXMA 3GRGA 1GCFA 1BAGA 1U3YA 3WY1A 3SGDI 4EVNA 3NZ8B 5GGUB 3ZT5A 5EZLA 3TVMB 2EG8A 3V7MA 4NI6A 3LH9A 2FYYB 1FFTB 5KG9A 1TEFA 1WC7A 5DHMC 2D03L 2EABA 4CJ0A 4C83A 1RH9A 2EKSB 3L2LA 3GY1A 4O2EB 1RJYA 4L4VB 4DWHA 3T1GA 3EMCA 4P07A 4W9LC 2W5PA 2H8PA 2R1YA 3EJPA 1M7UA 2YEZA 2V7NA 1A3XA 3PNUA 1A5AA 1U91A 5DUJA 1DXIA 1IEWA 1W3LA 4WW2B 1LO4L 1RKRA 3EWWA 1BX2B 5ENWA 1K4HA 1JZJA 1LLAA 1N7ML 5EN3A 5AWNL 5F3BA 3WOVA 4ONVA 4LVNC 4WW2C 1BQUA 3CHRA 2NXGA 5HVHB 1OWWA 5C08D 1XPYA 3NJ3A 4G5ZL 4CNUA 3CQHA 3GTIA 4HNCA 4FHJA 1NL0L 2YAQA 2WANA 3D3VD 4UBDC 5HI3C 1RXLA 2KLRA 4JPIB 4XCFH 1Z69A 2OTWB 1VYRA 2VGBA 2VNCA 4DXKA 4JRFA 3RLGA 2QNEA 2Z7WA 1A1OB 4KJPC 4M7TA 2OMBA 4BK9A 4JG1H 4N2BA 2X05A 4KZEL 5AC8A 3NFNB 1OGSA 1ZCOA 4O02B 5CJXC 1S7QA 3QDGD 3AS1A 1RZ7H 3HURA 4PJ9A 1CGWA 4W9TA 4QY8A 1EJOH 4HWEL 4KNUA 4UUJB 5F7DA 9CGTA 1O0VA 1A3ZA 1B3ZA 3BH4A 3VI3A 2E6AA 1ZS2A 1GZHC 1FDLL 2XPGB 3BZFA 4GW1A 5GS0L 2VN3A 4IBUA 2VXQH 2BH0A 3V6OC 2WIIB 3SDAA 3TV3L 1EYEA 1FHLA 3CFBA 2VERN 3LB6C 3P0XA 2P3EA 2D2JA 2XYBA 4NVTA 2P80A 1DWFM 1UMYA 4HJJH 5I76A 4ZQNA 4RJEA 3NK4A 1R7AA 4BZ2H 3VNIA 1IKOP 1LWHA 5AOUA 2R4RL 1E6QM 2IBZX 4YS4A 1AXIB 1X9LA 4UDUA 2DZAA 2WLHA 3QCVL 1N5YL 1VZHA 3ZQWA 1U3ZA 4Y89A 2V9TA 4TQHA 3QW9A 3I4EA 4AZCB 3IVTA 4LVEA 4QRQA 2P5WA 4G5AA 4M5ZH 4LNCA 2CKSA 3KXFD 2L7QA 4FTDA 4U7KA 5DJAA 4FZEL 4O8RA 5GJMA 2YAOA 4LIQL 3DUUB 1V6XA 3UIYA 4B9KC 5I5RA 3BAKA 2FLBT 4ZE4A 3S5YA 5FHBL 1LO4H 2Z7YA 4FL4C 2WBJC 2AV7A 4GKLA 5T1KB 1JAKA 2H0EA 2W61A 4ZT1A 1JP5A 3M86A 3O6FD 1YMHB 4Y9PA 5IHSA 2QQNL 2C0HA 4J4PA 4AHPA 4KEUA 2ZOLB 1FRBA 2CEQA 1U8PB 1KTJA 1PZCA 1XCTB 1IQDA 4FQIH 1WUFA 4FQQB 3VMNA 2E9JA 2DWDB 4YCPA 4ZQPA 2YZRA 2PW2A 1FUYA 4KK8D 1XLFA 5E95B 4HCHA 1YEIL 3N18A 1TENA 3ANUA 3CFEB 2CUMA 1FQ0A 3GDRA 1PFOA 4KVNH 4YAQB 5CLZA 3B9KB 3QJTB 3QNZB 1XF1A 2D2HA 2QS8A 2B2XL 4AGOA 2GK2A 3D3VE 1SXNA 3HC2A 4G59C 3DFTA 2OMTA 3O6MH 3V0WH 3FRPA 1ZBKA 4MMZA 4W9HC 3UJEA 3QFGA 2YQ3A 3O4OC 4M81A 3ES6B 2E6JA 3EOBA 4LKCA 5D7IB 4KKAD 4DN3L 4ZMWA 4O14A 2NNFA 4FO4A 2ZOWA 1SPDA 2GY7B 1C5DB 3IUDA 3KR3L 5I1IL 1M6JA 1ZLPA 4L5ZA 5D6DA 5K3VA 3C6EA 2V5SA 5AUMA 1PO9A 4LMQI 5TGBA 2NX5A 1DBBL 1DBAL 1QFWH 3LY6A 1CE1L 3PG2A 3PZGA 1NIAA 1E9QA 3I7SA 1UZ6F 3U1PA 2QGCA 3PBWA 2EIKB 1HQ4A 1NCCH 2X4PA 5F88A 1XGQA 2ZUYA 4B7LA 4ANXA 2PTXA 3QTGA 2VLJE 1NMCB 2C26A 2WC7A 5DJZA 4WENB 2HRHA 2V0TA 3LLXA 2HPTA 4O16A 4RLDA 4GFXA 2GTWA 3OKMA 2O55A 5G2WA 3WBWA 1BZ9B 3X11B 1VADB 1LE5B 1QI2A 1T2QH 4XP4H 1KJ3L 1U5VA 1DVTA 3KZ8A 3H7RA 1A7QH 4TKWA 1K9EA 4R3UA 4ERIA 3BGFB 2F08A 3RZWA 3ZYZA 3W74A 2LVEA 2YPKB 3F7RA 4PRIE 4LHUG 1O6SA 4G8GE 2E3ZA 3DI2B 1RSCA 3VFTA 3EO1B 3MRRB 2X1UA 1QBLH 4GO8A 3SDDC 5FECB 1QU4A 4AQ8A 2AK4D 1HX0A 1KFAH 2BY3A 3CFEA 3NH7H 4IJRA 2C1OB 4CQ9A 3RWEB 4X60A 3G1HA 3SKUD 4Z7UE 4FXSA 3JUGA 1IAII 1RCOB 2WBGA 2QMKA 3S34L 1ZANL 3UABA 4ONHB 5IVXA 2VLRE 1ITQA 1R85A 1KM5A 3CYVA 3PY2A 4MJHA 1JXJA 1TR9A 3LNPA 2DWYA 3LEVL 1OAZH 4JREC 4MQSB 3TZVA 1J88A 4YR6A 2PXYC 5EGRA 4ODHH 5EU4A 1FXQA 2OU4A 4ZTEA 2GFBA 1OF2B 3N15A 5E2UL 4P9HC 4RAHA 2DUZA 2R8SH 1PL3A 2PPDA 9XIAA 5GZND 3VA8A 3UZQA 3FHQA 3FRPG 3GHUA 2DT3A 3QDJD 1I9IH 5HJXA 1F00I 4LC8A 3AUVA 3QEQE 2BRQA 2CG9X 5I3KA 3Q13A 4B95C 1KLYA 3WL9B 4IP7A 4HIXL 3B8SA 2FDSA 4HZLA 4OJYA 2Z2AA 1RV8A 2R91A 3K0YA 3RVWD 1OTSC 5BU6A 1N10A 5DVPA 3AG2B 4L3EE 5HNTA 4AZCA 3QAZB 2P5EA 3F3HA 3GTVA 4HKJB 4JRXE 3VXSB 4A8RA 2PMZA 1WTGT 1T20B 4OFQA 4QOKD 5ES4B 1TXKA 4NO3B 2AK1L 2MPVA 1GUVA 4BQ4A 2E9WA 4ELDA 1FVDB 3OPZL 5AAWA 1F73A 2QMJA 4IQHA 1NDMB 1F11B 4JUTA 4JFPA 4CU7A 4NZUL 4O1AA 3H6AA 2HFFB 3B2PA 1NDYA 4OIIH 2POZA 3APNA 1XWYA 4Z3EA 3LAFA 1E73M 3G1SA 2H26A 5ETUA 1GH7A 1AGBB 2WXNA 3K7UA 3G04B 5J1AB 2J75A 3OIXA 4HA3A 1F6LL 1JVLA 1JWSA 2IAMD 4LNRB 4D3CL 4HLZG 5BRZA 4DP6X 3TMQA 1OFPA 2OMWA 5CKSA 2A3AA 1ADQH 4Y9GA 2V2WB 3HUJE 4NQDE 3ROOB 3GDBA 4FEMA 4NM4L 2WSKA 5GZOA 5KJ7E 12E8H 1XIHA 2POTA 3DGRA 4IFKA 4PCFA 5DLMH 5T33L 4GPVA 1TPB1 1BQLL 1LEKB 4MB3A 2GSIA 5D7KD 4S1QH 4RKAA 4XWUA 3WQDA 4LO9A 4XPBH 4LARL 4GNVA 4DJFC 3P8IA 4GYJA 2OTWA 3QRBA 2OLSA 3W1LA 3CSPA 2CIPA 3FPYA 4M6VA 8XIMA 2PO6D 3DXAD 4JR9H 4ODHL 2NUYA 1A7OL 4WDTA 5KS9F 1OT2A 4Y6GA 4XXDB 2NWSA 2H2PC 5KZ6A 2Q02A 4Z3FA 1MZYA 4HUXB 2HUEA 1QFUL 2OZTA 4N6QA 3TC3A 3WV0A 3V52H 2BIIA 1NH6A 2JK5A 3QJOA 2ZE3A 3UTSD 4IRJC 2WZPD 5DSCB 2PTZA 4PWKA 1I3UA 1DSWA 1SYSB 1U8HB 2DD8L 4YL4A 4PB0H 2B7OA 3JRKA 4XZHA 2Q8AL 5F1NB 1VEMA 3BVXA 1E27A 5JMRA 3DO7A 2P10A 1Y65A 5SWZB 3LNMA 5IWLA 2R1LA 5D7JA 5CZXD 4DZBA 2QJNA 1RJYB 4YOKA 3FUFA 2D8KA 3I6GA 2AMGA 1FDYA 2EKSA 2O5YL 4U6XA 1B0GB 2BVWA 1ZHNA 4HXBH 4P49A 4J5VA 5A8MA 3F7YA 3HJ0A 1H7XA 1VD6A 3P11H 3WSQH 1B4JH 3EBHA 3MNZB 1B9BA 3IXAB 5D4IA 5F7MC 1T03H 1GJPA 4J1OA 2C4FU 4BFBD 3U48A 1JPMA 1K8ZA 4BI7A 3AXLA 4PJFA 3GBMH 5TTRA 1JAEA 2NX3A 4IIGA 1A3LL 2C19A 2VMJA 5DJ2A 1XX1A 2QAPA 1S7SA 1P5UC 4JEJA 4YHKL 5MEOB 1WWAX 3DUHA 3WTYA 3AYTA 4OM0L 5A1AA 3FH5A 5BCAA 1US3A 2D20A 4PUBL 2A7BA 4CILA 4JJ5A 5JIPA 2NZLA 5DRNA 5ADPL 5DGQA 5DC9B 2PTWA 5AYXA 3DG7A 1I3GH 1TU2A 2IWKA 4P57B 5CXPA 4HGXA 4P2VA 2JKWA 1R0AH 1YE4A 4K8RC 3G1DA 1R5WB 2QTEA 4APXB 5EU7E 4H9UA 3IXTA 3HE6C 5DMKA 2LVCA 3CV5A 1G4RA 3B5HA 3V7AG 3B43A 5T33H 5JZ7D 3M0XA 1B2WH 3CVBA 3IEAA 4GJIA 3GPEA 2RJGA 1TVDA 4M6OH 1KCBA 4ODXA 2DORA 4OKVA 3V0VA 1E0UA 4L1LA 3U7WH 1KTDB 5DJXA 3SBPA 1IGWA 2D69A 4PJXB 1LO0L 4B60A 1WAUA 4C55A 3ME0B 2HEJA 4IU2B 4A68A 1IBGH 1B4KA 2AMUA 2BOFX 3WH5A 4V1YA 1YEKH 2B1AL 3W7IA 3VXSD 5D7KE 1XF4A 1KMGA 3BVTA 2FZNA 2GUYA 4OT7A 3KPSB 2PR4H 3N9GH 3OLDA 5BZAA 4FNUA 2ZCLL 2OZ8A 3QAQA 3ERXA 2A2QT 4I3RH 3QPEA 4YO0A 3T6XA 5AYZA 1QOQA 4DF9A 2P53A 3LTPA 4WJG3 3MACL 2EPLX 3M1BB 2QJIA 3GRBA 4RESB 2CKBA 4C4KO 2FWLB 1U8KB 3GHPA 5BS0E 5EWIH 1LO2L 3TPKA 3OGRA 4DEPC 1E0VA 5D05A 1IB5A 2NPLX 4GH1A 1ITBB 3Q2NA 4LSPH 5FX3A 2SEBA 4ZXBB 1MCWW 2EDNA 4R5TA 5IMLA 4R2GB 2F2KA 3EXSA 1TCRB 4LCIL 3VX1A 4F20A 4X6CE 1CICD 3F7VB 3LOWA 3ARDD 3GBML 3HF3A 4PBEA 2NY2C 2W65A 4RGNE 4Y2DA 2PEVA 3ALGA 1NGYA 4A67A 1EO5A 2DIJA 4B9FA 1BRLB 2Z1BA 4H9VA 3B8YA 4EXPX 1KGYE 1IQWL 2YQ2A 4TSCL 4WKZA 3QMRA 1YPZA 4NSKA 5C7VA 1NAKH 1P1MA 4QRRE 4NIRA 3R11A 1JGMA 2ZX5A 3LNDA 4JRYA 3ARUA 3SM0A 4HN4A 3S35X 1GVRA 3QNXB 2WCSA 3AS3A 5J7CC 1H5YA 3I6EA 5HDBE 4LVDA 1GIGH 3UTTB 2IEPA 1N6QH 2WC3A 2UWFA 2WUCL 5DUMH 2HX7A 4HU4A 3VIGA 1A4AA 2FJUB 2M8XA 1JZGA 3HNSL 4NRXB 3TBWB 5I23A 3BKML 3LS5L 4Y1AB 5E0QA 1A7NL 4MD5B 5KJ4A 2WO4A 3MJ9H 3RRQA 1E1EA 4XNDA 1ZTMA 4XNUH 3CX2A 3VNKA 2FFIA 3HAEB 5EZJB 1E4JA 2V2TA 5BZWB 3MBEA 5TQ2H 5IJKA 3VH8B 4OZHA 1CLYH 1E28A 2QTVA 2GJXA 4NHVA 3RPMA 4E9WA 5D9SA 3QFWA 3TSMA 2J9ZA 3N25A 3SCMC 1I31A 5AW3B 3WYZA 4D6FA 4OGAD 1SBSH 1HTYA 1PTZA 2BJML 5E0FA 2BSSB 3V1HA 4MDJA 3VE9A 1I1WA 1GYAA 1UR1A 2HG5B 2VXTL 4LQFL 1V3MA 2H6OA 3E2HB 4GAJL 3FYIB 5D7SL 5AN7A 3TIMA 1A47A 2PTVA 3C5JA 4TVPH 1TIUA 4YQXL 3W9ZA 4CW1A 4GIPD 1AO7E 2B7NA 1XLGA 3M8OH 3O6KH 2X0SA 3AYVA 3GQYA 4E8DA 3ZIYA 3BWSA 1YPZF 2IGLA 2OMYB 2OTUB 4J8QA 4U3CA 3ZDYF 1KEGH 4MNKA 3U0HA 1UYWL 2C9UA 4H0IA 3KS6A 2H1XA 3ZL2A 2A6JA 4TV6A 3APFA 1UOZA 1MJ8L 5E4EC 4ELMA 4O8AA 2ZOKB 1JWUB 1CURA 3A3HA 4P46A 4WXYA 4Y4FD 2TYSA 1H1ZA 1WE5A 2YPVH 3FB7A 3BP7B 3GSVA 1MLCA 5EC1B 3LXUX 1JXKA 1EB3A 3CHFA 1YLBB 1OSEA 2A74C 2AJVL 3DHPA 4ZB2A 5AOZA 2O26U 1KIPB 5HHME 4UOQA 5IBUB 3QISA 3US0A 3EWYA 4IG2A 1G6RA 2ICWJ 2AXGA 1I6NA 4IP4A 1IE5A 1HILA 4RFOH 4IMLA 4QSHA 1KTRL 4AHOA 4MD0A 1U5JA 3MRHB 2NNXA 2GITB 2OMXB 5CEYA 1EA9C 1HAWA 4TUKL 3FJ4A 1PQZB 3MJ7A 3WEAA 3GB7B 2R2EB 3MOAH 1YY8A 2IGFH 4P46C 3NCXA 1ML1A 1T8QA 4HCRA 4XKMA 2Z4TA 1SY6L 3ETSA 3CZLA 3VG9B 2LQRA 1JZFA 5AAMA 4Z77B 3O45A 4O5LL 1ZHKB 4PV8A 4FAAB 3MYZA 3LQZA 5L7XH 3ULUF 1GJIA 3LH2H 3BJ91 4JX0A 3EX3A 2R0LH 3H2NA 4GA8A 4AZIA 4J3OD 3W2MA 2AJXH 2FEDC 1N55A 5DZJA 4YLQT 1UWTA 4DUWA 4GBUA 3TAKA 2ZOOA 2K0RA 4YWGL 4EZKA 4HNVA 1KBBA 2VRKA 2FATL 3CFDB 4KX9A 1U95A 4DO5A 2FKPA 1G6RB 1W5NA 1MDRA 5AL0A 1KIPA 1AH3A 4YGVB 1E0TA 1EQPA 1E6OH 1TTUA 3WTWA 4ODUA 5K7JA 1PIFA 1XFPA 4QAMB 5CEXA 3WLKX 5TD4A 2A1YA 1OE1A 3M41A 4EVZA 1MFCH 1HIML 2IH1B 3H7LA 3WF0A 2XN9A 4TM9A 5KW9H 1U30A 4R96A 1JPGA 2BOEX 3QFJD 3CL6A 4A6YH 1DZ0A 3BQUC 2PDFA 2YCKX 4OLEA 2H47C 2XSBA 2QSTA 1I1YB 5DEGA 5EIIG 1J0HA 2X40A 2X2IA 4G80A 4P7QA 1CDBA 1AZRA 4TLKA 3NQBA 1OYCA 1BVLA 4M9PA 4M6QA 1I7UB 5F1SA 1YQ2A 3GPSA 4Z5RA 5E56A 4AQ1A 1WKYA 4E9RA 4PY8J 4JZNB 4C6OA 2QLVB 2CZVA 3ZSTA 2WMHA 2NSXA 3F5LA 3D39B 3EYSL 4QDWA 2EXWC 1MQKH 4Q4SA 4ZX5A 3CSYB 4AUJA 1PLGL 4HHAB 1V05A 3DV4A 1G0DA 1EFXD 5LVEA 2GL5A 3FA5A 2Z31B 3LRHA 3GSNL 5DZPA 5HHMD 3T0XA 1EUNA 4K9EL 2NVCA 4O52A 3GSRA 4UV7L 4FXGB 2J6EL 1MJ7H 4K71C 3X13A 5K9OB 2P0IA 4D8ZA 4ZZ9A 2XIIA 5H94B 5IHWA 2FJHA 2Z8SA 4NSBA 1QKZL 1HZHH 4HTBA 2H1PL 4NRXA 3TBWA 1T8XA 1CCWB 3A9BA 1B6DA 3SGZA 1M9WA 4XBPA 4H2CA 2W63A 1RMFL 4YX2L 4A2LA 5DJCB 4PBFA 3PDGA 3PABA 3PPEA 4S2SB 2MHAB 3UPCA 1GAFL 4PR4A 4LOUC 3PZOA 4ZXBD 3R8BB 2DFAA 4PR5B 1DCLA 1JNLL 2AP2A 5AZEH 1LBLA 2JQXA 5IREA 3AIVA 2C13A 1VCAA 4YTTA 4G83A 1MAKA 4PCTA 2PKDA 4CBZA 1NGYB 3LRKA 3BV4A 4XAFA 5LAXA 1NKGA 5IB3A 3WF3A 4H3DA 1QRKA 4L8DB 3VZXA 3W70A 2R23B 3BAXA 1WAAA 3T65B 1AXSA 2QDWA 2SEBB 4HIHB 2GABA 5GJSL 1IEIA 2WTRA 3W83A 5JIWA 5KYNA 1FY6A 2X2HA 3W2DL 1BBJA 1HHKA 2VAJA 5JNYB 4LLUB 1WBXA 3QEGH 5EU6E 1IWAA 4D0BA 2WK2A 3OXRA 4ZB5A 3D2TA 2OYMA 4PW4A 2UY3A 4YVXA 4X5XB 1OADA 3D30A 4YSRA 4OTXH 5KBPA 1MKFA 4LWWA 4AIUA 2LU3A 4XPBL 4IEFB 1W2KT 1E8WA 2X5PA 1C9WA 2O5YH 3IMTA 1NKOA 4F15C 3F6JA 3LMZA 3X14A 4JO4L 1OEPA 3S9ZA 1LCOA 3WZ0E 5H6HA 5DA4A 1CDCA 5C3LD 4PJXA 3GSNH 1RFDL 5G5IA 1TJ2A 4ICCX 3VIFA 1MWOA 4C54A 5A2KH 5E0CA 3K8KA 3L7EB 3NJHA 3O41A 3J27A 4WO4D 1CDUA 1MHPL 2GCYA 1SXCA 2OGJA 3U4AA 3A12A 3G1RA 2UZPA 4LEXH 4TULL 4X6BB 1C8QA 4WGVB 5DR5H 1AD4A 2GSMB 2JTDA 1TTQA 4KKXA 3TWBA 1WEJH 1R5WA 2N1TE 2VLME 3EGSA 2PF8A 2QGYA 1B88A 4OCXL 3A4DA 3NQ2A 4GZEA 4JQVA 4F0LA 4HCLA 1V03A 1NCJA 2B1HL 3PHOA 5IK3A 4KZDL 3ULSA 2VR4A 4PWJA 2HVMA 5CILH 1FZOA 5I15L 4HNOA 1Z5LB 1ZSHA 4OLZL 1ZRUA 4XCCH 4JO1L 4M7ZC 3TN4A 4P5TA 2J73A 3FBQA 3JYCA 4I5UA 1NFKA 2VDPL 1DVFA 3IACA 5I1LB 3OZ9H 4D1IA 5F96L 4P4KC 3EF7A 4BQ3A 2IH8A 2X1WL 4IRZA 3EBIA 3MJ9A 1TZHA 4POYA 3S8HA 4MHBA 2V7HA 3IJYA 1CB2A 2X09A 4UQ9A 3NABL 1NCBL 3NZUA 3NPSC 5EO0B 2DSZA 4GRLB 4IJTA 2CHWA 1F4WH 4Q14A 4ZMOA 3LOTA 2FT6A 5TFSH 3A6CH 1DQLL 4WJKB 2PCEA 2FR4A 3TROA 5TE7H 1W6TA 4LU0A 4DZBB 1DFXA 1PIIA 3CUPB 4GRWE 1TQTA 1ACCA 3BKCH 3POCA 2PW1A 4MAUL 4Z7UA 2NV9A 5J5DA 4OCRH 2P8MA 3FS9A 5JA9A 3V6FA 4D2JA 4TX6A 1NCUA 1PYFA 1WWWX 2ACRA 4WHDA 2PW1B 3ES7A 4NIYE 4Y8EA 2X88A 3AM8C 3TJ4A 1KTKE 4JS7A 5GIRA 4Z17A 3WQ5A 4TOYL 3C60B 3GG7A 4FZ8H 1KFJA 4QRPA 4G1KA 5FJRA 5EU6D 5D96C 1KM6A 1P84J 3RGVA 2D1ZA 3LYEA 2CO4A 3FQRB 1FWBC 1OCOB 1TTJA 4QIUA 5F0MB 1K1DA 1XGTA 4FABL 1G6RH 2XWRA 1R47A 3CXFA 1BF5A 2F7IA 3ANVA 1WDSA 4J28A 3WFEH 3LEYH 5KVEH 2ZYHA 3FXIC 3H2QA 3ORJA 3HC0B 3AUOA 4Y5VC 5C2CA 5CUSH 5DZAA 5FYJU 5HHNA 3MACH 3W1RA 5BRZB 2Z4QB 1FWXA 1XZ0A 4L5FE 1YN7B 3TTEA 5DZVA 2JQMA 3CFJB 1TV3A 1W72H 3B6SB 3OF6A 2FX7L 1RIHL 2Z6JA 4NRZB 4Z18A 4S1SH 4KTYA 4CNNA 3MA7B 3VFSA 2QHAA 2ISVA 1KM3A 2B4CH 7REQA 3SDCA 3MKCA 1X3DA 4B16A 1URLA 2VDOL 2VLMD 1ZBWA 2FVKA 2A6KA 4CN1A 2ORBH 1Q6DA 2YPLE 3SUUA 1JZ5A 4GI6A 2H9GA 3SSJA 1FNSL 2JFCA 3WDHA 4LUJA 3MUGB 1UASA 5GJPA 2WZ0A 4JRXD 3KDNA 3QIWB 4NI3A 4H88H 4OZ4B 3W7LA 4LCYB 3WUZA 3BQ5A 4CNTA 1HG3A 5TE7L 2KS0A 2Y6SD 3VXMB 1Y6MR 1IC4H 5GGVH 1ESOA