1QIBA

Crystal structure of gelatinase a catalytic domain
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
161
structure length
161
Chain Sequence
RKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWSLGKGVGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 72 kDa type IV collagenase
publication title X-ray structure of gelatinase A catalytic domain complexed with a hydroxamate inhibitor
pubmed rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 37
structure length 161
sequence length 161
ec nomenclature ec 3.4.24.24: Gelatinase A.
pdb deposition date 1999-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1qibA00
3LIKA 1UMTA 3WV1A 1HY7A 4DV8A 4JP4A 1PWPA 3RTTA 1XFYA 4GUYA 2SRTA 1QICA 4ON1A 1UTZA 1ZVXA 3DNGA 3KHIA 1JIWP 1HOVA 2K2GA 2E3XA 1GE7A 2OW2A 1GE5A 1RMZA 3NX7A 1KUHA 3L0VA 1MMBA 3Q2GA 1XUCA 1UMSA 3LJGA 3LEAA 1AKLA 4H76A 1DMTA 5I43A 1SRPA 2RJPA 1JAQA 3EDIA 3HB2P 3ELMA 5CXAA 3LJZA 1Y0VA 1JANA 3MA2A 1L6JA 1O0TA 1JH1A 4WKIA 1JKYA 2Y6CA 2WO8A 4IUWA 2JNPA 1G12A 2N8RA 1G4KA 3I7GA 1R55A 1BUDA 1IAAA 1G49A 4G0DA 1O0QA 3P24A 2MZHA 1PWUA 3DPEA 1D8MA 4WZVA 2AYKA 1BUVM 2OZRA 2Y6DA 1BKCE 5I12A 1RM8A 2X7MA 2DW1A 3EDZA 1ZXCA 2JIHA 2DDYA 1K7QA 2JT6A 4GQLA 2WOAA 2J83A 4PKVA 2OXUA 4WK7A 4XM7A 1XFVA 1BZSA 1I73A 2V4BA 2OVZA 2X3CA 3LQBA 4A3WA 1WNIA 4L6TA 2KRJA 2JT5A 1JJ9A 1OM7A 4H3XA 1QJIA 1ZS0A 2L0RA 4DF9A 2X3BA 1D7XA 5D3CA 456CA 1CGFA 2FV9A 2RJQA 5I3MA 1A86A 2JSDA 5BOTA 3LIRA 1KAPP 2POJA 2DW0A 4A7BA 1QIAA 2W13A 4ZR5A 1H71P 4H49A 3F17A 3P1VA 4JIJA 1A85A 3ZUKA 1OS9A 3HYGA 1IABA 1SU3A 3EWJA 1IAEA 4HMAA 3V96B 3ZVSA 1Y93A 3HDAP 1MMQA 4IJOA 1MMRA 5I0LA 2CKIA 4XM6A 1I1IP 1C8TA 1OM6A 1OO9A 3KMEA 3EDHA 1JK3A 3HDBA 3B92A 966CA 3N2VA 2OXWA 3KEJA 3LGPA 1B8YA 1UEAA 1G9KA 1B3DA 1SLMA 2D1NA 2ERQA 2CLTA 1XFWA 1JAPA 3G42A 1SMPA 1BSWA 1JAOA 4Q1LA 4L63A 3G5CA 5H8XA 3LE9A 1KUFA 3KECA 2OXZA 1MMPA 1S4BP 1KUKA 2OW9A 2W12A 3Q2HA 3AYKA 1J7NA 4H30A 4GF1A 1XFXA 5BOYA 1PWVA 2OW1A 830CA 1ND1A 3HBUP 4PKRA 3ZXHA 1PWQA 1OM8A 1YCMA 2TCLA 3AYUA 1CAQA 2YIGA 4CTHA 1KUGA 4JQGA 5I4OA 3AIGA 1FLSA 1GKDA 3KEKA 4FXQA 4GWMA 1IADA 3F1AA 3B8ZA 1GXDA 4WKEA 3TT4A 1R1IA 2MZEA 5BPAA 1HFCA 2I47A 3CKIA 3DPFA 1BQQM 4FVLA 4AIGA 4DD8A 3K7NA 3EHXA 4DPEA 1Y8JA 4PKTA 1CK7A 3USNA 3F16A 2DW2A 4GWNA 4EFSA 1FM1A 4H1QA 5B5OA 3DSLA 1XUDA 2HU6A 2FV5A 3F18A 3DL1A 1USNA 4L19A 3KMCA 3TS4A 4XM8A 2O36A 5LABA 4H82A 1BM6A 4IN9A 3WV2A 2W15A 2OVXA 3N2UA 4JA1A 3GBOA 4I03A 2DDFA 2MLRA 2W14A 3HY7A 1XURA 4GR3A 4QKZA 1ROSA 3LKAA 1UTTA 3U1RA 1R54A 5CUHA 4H2EA 3KWVC 1BKCI 2PJTA 4GR8A 3LUMA 2OI0A 1KBCA 4WF6A 5D1UA 2Z2DA 1CXVA 4AXQA 3SHIA 3DWBA 1R1JA 4AYKA 3VI1A 1CGEA 2J0TA 1SLNA 4G9LA 1CIZA 1CGLA 1KUIA 1G05A 3HBVP 2D1OA 3EHYA 1JIZA 2USNA 3KRYA 1AF0A 3EDGA 1K7GA 2A8HA 3LJTA 1SATA 4PKUA 4XBHA 4PKWA 1BIWA 3O2XA 5D1TA 2YB9A 1IAGA 3BA0A 4J4MA 3LILA 1EAKA 3UVCA 1EB6A 1GO7P 1CQRA 1GO8P 2AIGP 3TSKA 3TVCA 3K7LA 2OW0A 1BKCA 1OMJA 3LK8A 1YQYA 3OHLA 4ILWD 2WO9A 1IACA 5L7FA 4AUOA 3OHOA 4FXYP 1R1HA 4GR0A 4XCTA 3I7IA 1C7KA 1HFSA 1ZXVA 1XFUA 5L79A 3LQ0A 2E2DA 1D8FA 1YOUA 1ZP5A 2QPJA 1ASTA 3WV3A 2ERPA 2XS3A 1DTHA 1C3IA 2MLSA 3F19A 2X3AA 1PWWA 1FBLA 4H84A 1ATLA 3HY9A 3LUNA 3LMCA 4HX3A 5CZMA 1OS2A 2K9CA 1ZTQA 1QUAA 1MNCA 3L0TA 5D7WA 1D5JA 5D2BA 2MZIA 1Q3AA 2EROA 1GKCA 1EUBA 1QIBA 1Z3JA 2OY2A 5I2ZA 1K7IA 4I35A 4R3VA 1BQOA 5B5PA 2O3EA 3VTGA 5JMYA 1XFZA 3B2ZA 1AYKA 1YP1A 1QJJA 1GE6A 4PKQA 2W0DA 2XS4A 5D1SA 3F15A 1HTDA 3O64A 1I76A 3RTSA 4JPAA 4PKSA 4FU4A 1HV5A 3E8RA 2OY4A
chains in the Genus database with same CATH superfamily
3LIKA 1UMTA 3WV1A 1HY7A 4DV8A 4JP4A 1PWPA 3RTTA 1XFYA 4GUYA 2SRTA 1QICA 4ON1A 1UTZA 1ZVXA 3DNGA 3KHIA 1JIWP 1HOVA 2K2GA 2E3XA 1GE7A 2OW2A 1GE5A 1RMZA 3NX7A 1KUHA 3L0VA 1MMBA 3Q2GA 1XUCA 3DTKA 1UMSA 3LJGA 3LEAA 1AKLA 4H76A 1DMTA 5I43A 1SRPA 2RJPA 1JAQA 3EDIA 3HB2P 3ELMA 5CXAA 3LJZA 1Y0VA 1JANA 3MA2A 1L6JA 1O0TA 1JH1A 4WKIA 1JKYA 2Y6CA 2WO8A 4IUWA 2JNPA 1G12A 2N8RA 1G4KA 3I7GA 1OZ9A 1R55A 1BUDA 1IAAA 1G49A 4G0DA 1O0QA 3P24A 2MZHA 1PWUA 3DPEA 1D8MA 4WZVA 2AYKA 1BUVM 2OZRA 3DTIA 2Y6DA 1BKCE 5I12A 1RM8A 2X7MA 2DW1A 3EDZA 1ZXCA 2JIHA 2DDYA 1K7QA 2JT6A 4GQLA 2WOAA 2J83A 4PKVA 2OXUA 4WK7A 4XM7A 1XFVA 1BZSA 1I73A 2V4BA 2OVZA 2X3CA 3LQBA 4A3WA 1WNIA 4L6TA 2KRJA 2JT5A 1JJ9A 1OM7A 4H3XA 1QJIA 1ZS0A 2L0RA 4DF9A 2X3BA 1D7XA 5D3CA 456CA 1CGFA 2FV9A 2RJQA 5I3MA 1A86A 2JSDA 5BOTA 3LIRA 1KAPP 2POJA 2DW0A 4A7BA 1QIAA 2W13A 4ZR5A 1H71P 4H49A 3F17A 3P1VA 4JIJA 1A85A 3ZUKA 1OS9A 3HYGA 1IABA 1SU3A 3EWJA 1IAEA 4HMAA 3V96B 3ZVSA 1Y93A 3HDAP 1MMQA 4IJOA 1MMRA 5I0LA 2CKIA 4XM6A 1I1IP 1C8TA 1OM6A 1OO9A 1XM5A 3KMEA 3EDHA 1JK3A 3HDBA 3B92A 966CA 3N2VA 2OXWA 3KEJA 3LGPA 1B8YA 1UEAA 1G9KA 1B3DA 1SLMA 2D1NA 2ERQA 2CLTA 1XFWA 1JAPA 3G42A 1SMPA 1BSWA 1JAOA 4Q1LA 4L63A 3G5CA 5H8XA 3LE9A 1KUFA 3KECA 2OXZA 1MMPA 1S4BP 1KUKA 2OW9A 2W12A 3Q2HA 3AYKA 1J7NA 4H30A 4GF1A 1XFXA 5BOYA 1PWVA 2OW1A 830CA 1ND1A 3HBUP 4PKRA 3ZXHA 1PWQA 1OM8A 1YCMA 2TCLA 3AYUA 1CAQA 2YIGA 4CTHA 1KUGA 4JQGA 5I4OA 3AIGA 1FLSA 1GKDA 3KEKA 4FXQA 4GWMA 1XAXA 1IADA 3F1AA 3B8ZA 1GXDA 4WKEA 3TT4A 1R1IA 2MZEA 5BPAA 1HFCA 2I47A 3CKIA 3DPFA 1BQQM 4FVLA 4AIGA 4DD8A 3K7NA 3EHXA 4DPEA 1Y8JA 4PKTA 1CK7A 1TVIA 3USNA 3F16A 2DW2A 4GWNA 4EFSA 1FM1A 4H1QA 5B5OA 3DSLA 1XUDA 2HU6A 2FV5A 3F18A 3DL1A 1USNA 4L19A 3KMCA 3TS4A 4XM8A 2O36A 5LABA 4H82A 1BM6A 4IN9A 3WV2A 2W15A 2OVXA 3N2UA 4JA1A 3GBOA 4I03A 2DDFA 2MLRA 2W14A 3HY7A 1XURA 4GR3A 4QKZA 1ROSA 3LKAA 1UTTA 3U1RA 1R54A 5CUHA 4H2EA 3KWVC 1BKCI 2PJTA 4GR8A 3LUMA 2OI0A 1KBCA 4WF6A 5D1UA 2Z2DA 1CXVA 4AXQA 3SHIA 3DWBA 1R1JA 4AYKA 3VI1A 1CGEA 2J0TA 1SLNA 4G9LA 1CIZA 1CGLA 1KUIA 1G05A 3HBVP 2D1OA 3EHYA 1JIZA 2USNA 3KRYA 1AF0A 3EDGA 1K7GA 2A8HA 3LJTA 1SATA 4PKUA 4XBHA 4PKWA 1BIWA 3O2XA 5D1TA 2YB9A 1IAGA 3BA0A 4J4MA 3LILA 1EAKA 3UVCA 1EB6A 1GO7P 1CQRA 1GO8P 2AIGP 3TSKA 3TVCA 3K7LA 2OW0A 1BKCA 1OMJA 3LK8A 1YQYA 3OHLA 4ILWD 2WO9A 1IACA 5L7FA 4AUOA 3OHOA 4FXYP 1R1HA 4GR0A 2YUFA 4XCTA 3I7IA 1C7KA 1HFSA 1ZXVA 1XFUA 5L79A 3LQ0A 2E2DA 1D8FA 1YOUA 1ZP5A 2QPJA 1ASTA 3WV3A 2ERPA 2XS3A 1DTHA 1C3IA 2MLSA 3F19A 2X3AA 1PWWA 1FBLA 4H84A 1ATLA 3HY9A 3LUNA 3LMCA 4HX3A 5CZMA 1OS2A 2K9CA 1ZTQA 1QUAA 1MNCA 3L0TA 5D7WA 1D5JA 4L7AA 5D2BA 2MZIA 1Q3AA 2EROA 1GKCA 1EUBA 1QIBA 1Z3JA 2OY2A 5I2ZA 1K7IA 4I35A 4R3VA 1BQOA 5B5PA 2O3EA 3VTGA 5JMYA 1XFZA 3B2ZA 3DTEA 1AYKA 1YP1A 1QJJA 1GE6A 4PKQA 2W0DA 2XS4A 5D1SA 3F15A 1HTDA 3O64A 1I76A 3RTSA 4JPAA 4PKSA 4FU4A 1HV5A 3E8RA 2OY4A
chains in the Genus database with same CATH topology
3LIKA 1UMTA 3WV1A 1HY7A 4DV8A 4JP4A 1PWPA 3RTTA 1XFYA 4GUYA 2SRTA 1QICA 4ON1A 1UTZA 1ZVXA 3DNGA 3KHIA 1JIWP 1HOVA 2K2GA 2E3XA 1GE7A 2OW2A 1GE5A 1RMZA 3NX7A 1KUHA 3L0VA 1MMBA 3Q2GA 1XUCA 3DTKA 1UMSA 3LJGA 3LEAA 1AKLA 4H76A 1DMTA 5I43A 1SRPA 2RJPA 1JAQA 3EDIA 3HB2P 3ELMA 5CXAA 3LJZA 1Y0VA 1JANA 3MA2A 1L6JA 1O0TA 1JH1A 4WKIA 1JKYA 2Y6CA 2WO8A 4IUWA 2JNPA 1G12A 2N8RA 1G4KA 3I7GA 1R55A 1BUDA 1IAAA 1G49A 4G0DA 1O0QA 3P24A 2MZHA 1PWUA 3DPEA 1D8MA 4WZVA 2AYKA 1BUVM 2OZRA 3DTIA 2Y6DA 1BKCE 5I12A 1RM8A 2X7MA 2DW1A 3EDZA 1ZXCA 2JIHA 2DDYA 1K7QA 2JT6A 4GQLA 2WOAA 2J83A 4PKVA 2OXUA 4WK7A 4XM7A 1XFVA 1BZSA 1I73A 2V4BA 2OVZA 2X3CA 3LQBA 4A3WA 1WNIA 4L6TA 2KRJA 2JT5A 1JJ9A 1OM7A 4H3XA 1QJIA 1ZS0A 2L0RA 4DF9A 2X3BA 1D7XA 5D3CA 456CA 1CGFA 2FV9A 2RJQA 5I3MA 1A86A 2JSDA 5BOTA 3LIRA 1KAPP 2POJA 2DW0A 4A7BA 1QIAA 2W13A 4ZR5A 1H71P 4H49A 3F17A 3P1VA 4JIJA 1A85A 3ZUKA 1OS9A 3HYGA 1IABA 1SU3A 3EWJA 1IAEA 4HMAA 3V96B 3ZVSA 1Y93A 3HDAP 1MMQA 4IJOA 1MMRA 5I0LA 2CKIA 4XM6A 1I1IP 1C8TA 1OM6A 1OO9A 3KMEA 3EDHA 1JK3A 3HDBA 3B92A 966CA 3N2VA 2OXWA 3KEJA 3LGPA 1B8YA 1UEAA 1G9KA 1B3DA 1SLMA 2D1NA 2ERQA 2CLTA 1XFWA 1JAPA 3G42A 1SMPA 1BSWA 1JAOA 4Q1LA 4L63A 3G5CA 5H8XA 3LE9A 1KUFA 3KECA 2OXZA 1MMPA 1S4BP 1KUKA 2OW9A 2W12A 3Q2HA 3AYKA 1J7NA 4H30A 4GF1A 1XFXA 5BOYA 1PWVA 2OW1A 830CA 1ND1A 3HBUP 4PKRA 3ZXHA 1PWQA 1OM8A 1YCMA 2TCLA 3AYUA 1CAQA 2YIGA 4CTHA 1KUGA 4JQGA 5I4OA 3AIGA 1FLSA 1GKDA 3KEKA 4FXQA 4GWMA 1IADA 3F1AA 3B8ZA 1GXDA 4WKEA 3TT4A 1R1IA 2MZEA 5BPAA 1HFCA 2I47A 3CKIA 3DPFA 1BQQM 4FVLA 4AIGA 4DD8A 3K7NA 3EHXA 4DPEA 1Y8JA 4PKTA 1CK7A 3USNA 3F16A 2DW2A 4GWNA 4EFSA 1FM1A 4H1QA 5B5OA 3DSLA 1XUDA 2HU6A 2FV5A 3F18A 3DL1A 1USNA 4L19A 3KMCA 3TS4A 4XM8A 2O36A 5LABA 4H82A 1BM6A 4IN9A 3WV2A 2W15A 2OVXA 3N2UA 4JA1A 3GBOA 4I03A 2DDFA 2MLRA 2W14A 3HY7A 1XURA 4GR3A 4QKZA 1ROSA 3LKAA 1UTTA 3U1RA 1R54A 5CUHA 4H2EA 3KWVC 1BKCI 2PJTA 4GR8A 3LUMA 2OI0A 1KBCA 4WF6A 5D1UA 2Z2DA 1CXVA 4AXQA 3SHIA 3DWBA 1R1JA 4AYKA 3VI1A 1CGEA 2J0TA 1SLNA 4G9LA 1CIZA 1CGLA 1KUIA 1G05A 3HBVP 2D1OA 3EHYA 1JIZA 2USNA 3KRYA 1AF0A 3EDGA 1K7GA 2A8HA 3LJTA 1SATA 4PKUA 4XBHA 4PKWA 1BIWA 3O2XA 5D1TA 2YB9A 1IAGA 3BA0A 4J4MA 3LILA 1EAKA 3UVCA 1EB6A 1GO7P 1CQRA 1GO8P 2AIGP 3TSKA 3TVCA 3K7LA 2OW0A 1BKCA 1OMJA 3LK8A 1YQYA 3OHLA 4ILWD 2WO9A 1IACA 5L7FA 4AUOA 3OHOA 4FXYP 1R1HA 4GR0A 2YUFA 4XCTA 3I7IA 1C7KA 1HFSA 1ZXVA 1XFUA 5L79A 3LQ0A 2E2DA 1D8FA 1YOUA 1ZP5A 2QPJA 1ASTA 3WV3A 2ERPA 2XS3A 1DTHA 1C3IA 2MLSA 3F19A 2X3AA 1PWWA 1FBLA 4H84A 1ATLA 3HY9A 3LUNA 3LMCA 4HX3A 5CZMA 1OS2A 2K9CA 1ZTQA 1QUAA 1MNCA 3L0TA 5D7WA 1D5JA 4L7AA 5D2BA 2MZIA 1Q3AA 2EROA 1GKCA 1EUBA 1QIBA 1Z3JA 2OY2A 5I2ZA 1K7IA 4I35A 4R3VA 1BQOA 5B5PA 2O3EA 3VTGA 5JMYA 1XFZA 3B2ZA 3DTEA 1AYKA 1YP1A 1QJJA 1GE6A 4PKQA 2W0DA 2XS4A 5D1SA 3F15A 1HTDA 3O64A 1I76A 3RTSA 4JPAA 4PKSA 4FU4A 1HV5A 3E8RA 2OY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LIK A;  1UMT A;  3WV1 A;  1HY7 A;  4DV8 A;  4JP4 A;  1PWP A;  3RTT A;  1XFY A;  4GUY A;  2SRT A;  1QIC A;  4ON1 A;  1UTZ A;  1ZVX A;  3DNG A;  3KHI A;  1JIW P;  1HOV A;  2K2G A;  2E3X A;  1GE7 A;  2OW2 A;  1GE5 A;  1RMZ A;  3NX7 A;  1KUH A;  3L0V A;  1MMB A;  3Q2G A;  1XUC A;  1UMS A;  3LJG A;  3LEA A;  1AKL A;  4H76 A;  1DMT A;  5I43 A;  1SRP A;  2RJP A;  1JAQ A;  3EDI A;  3HB2 P;  3ELM A;  5CXA A;  3LJZ A;  1Y0V A;  1JAN A;  3MA2 A;  1L6J A;  1O0T A;  1JH1 A;  4WKI A;  1JKY A;  2Y6C A;  2WO8 A;  4IUW A;  2JNP A;  1G12 A;  2N8R A;  1G4K A;  3I7G A;  1R55 A;  1BUD A;  1IAA A;  1G49 A;  4G0D A;  1O0Q A;  3P24 A;  2MZH A;  1PWU A;  3DPE A;  1D8M A;  4WZV A;  2AYK A;  1BUV M;  2OZR A;  2Y6D A;  1BKC E;  5I12 A;  1RM8 A;  2X7M A;  2DW1 A;  3EDZ A;  1ZXC A;  2JIH A;  2DDY A;  1K7Q A;  2JT6 A;  4GQL A;  2WOA A;  2J83 A;  4PKV A;  2OXU A;  4WK7 A;  4XM7 A;  1XFV A;  1BZS A;  1I73 A;  2V4B A;  2OVZ A;  2X3C A;  3LQB A;  4A3W A;  1WNI A;  4L6T A;  2KRJ A;  2JT5 A;  1JJ9 A;  1OM7 A;  4H3X A;  1QJI A;  1ZS0 A;  2L0R A;  4DF9 A;  2X3B A;  1D7X A;  5D3C A;  456C A;  1CGF A;  2FV9 A;  2RJQ A;  5I3M A;  1A86 A;  2JSD A;  5BOT A;  3LIR A;  1KAP P;  2POJ A;  2DW0 A;  4A7B A;  1QIA A;  2W13 A;  4ZR5 A;  1H71 P;  4H49 A;  3F17 A;  3P1V A;  4JIJ A;  1A85 A;  3ZUK A;  1OS9 A;  3HYG A;  1IAB A;  1SU3 A;  3EWJ A;  1IAE A;  4HMA A;  3V96 B;  3ZVS A;  1Y93 A;  3HDA P;  1MMQ A;  4IJO A;  1MMR A;  5I0L A;  2CKI A;  4XM6 A;  1I1I P;  1C8T A;  1OM6 A;  1OO9 A;  3KME A;  3EDH A;  1JK3 A;  3HDB A;  3B92 A;  966C A;  3N2V A;  2OXW A;  3KEJ A;  3LGP A;  1B8Y A;  1UEA A;  1G9K A;  1B3D A;  1SLM A;  2D1N A;  2ERQ A;  2CLT A;  1XFW A;  1JAP A;  3G42 A;  1SMP A;  1BSW A;  1JAO A;  4Q1L A;  4L63 A;  3G5C A;  5H8X A;  3LE9 A;  1KUF A;  3KEC A;  2OXZ A;  1MMP A;  1S4B P;  1KUK A;  2OW9 A;  2W12 A;  3Q2H A;  3AYK A;  1J7N A;  4H30 A;  4GF1 A;  1XFX A;  5BOY A;  1PWV A;  2OW1 A;  830C A;  1ND1 A;  3HBU P;  4PKR A;  3ZXH A;  1PWQ A;  1OM8 A;  1YCM A;  2TCL A;  3AYU A;  1CAQ A;  2YIG A;  4CTH A;  1KUG A;  4JQG A;  5I4O A;  3AIG A;  1FLS A;  1GKD A;  3KEK A;  4FXQ A;  4GWM A;  1IAD A;  3F1A A;  3B8Z A;  1GXD A;  4WKE A;  3TT4 A;  1R1I A;  2MZE A;  5BPA A;  1HFC A;  2I47 A;  3CKI A;  3DPF A;  1BQQ M;  4FVL A;  4AIG A;  4DD8 A;  3K7N A;  3EHX A;  4DPE A;  1Y8J A;  4PKT A;  1CK7 A;  3USN A;  3F16 A;  2DW2 A;  4GWN A;  4EFS A;  1FM1 A;  4H1Q A;  5B5O A;  3DSL A;  1XUD A;  2HU6 A;  2FV5 A;  3F18 A;  3DL1 A;  1USN A;  4L19 A;  3KMC A;  3TS4 A;  4XM8 A;  2O36 A;  5LAB A;  4H82 A;  1BM6 A;  4IN9 A;  3WV2 A;  2W15 A;  2OVX A;  3N2U A;  4JA1 A;  3GBO A;  4I03 A;  2DDF A;  2MLR A;  2W14 A;  3HY7 A;  1XUR A;  4GR3 A;  4QKZ A;  1ROS A;  3LKA A;  1UTT A;  3U1R A;  1R54 A;  5CUH A;  4H2E A;  3KWV C;  1BKC I;  2PJT A;  4GR8 A;  3LUM A;  2OI0 A;  1KBC A;  4WF6 A;  5D1U A;  2Z2D A;  1CXV A;  4AXQ A;  3SHI A;  3DWB A;  1R1J A;  4AYK A;  3VI1 A;  1CGE A;  2J0T A;  1SLN A;  4G9L A;  1CIZ A;  1CGL A;  1KUI A;  1G05 A;  3HBV P;  2D1O A;  3EHY A;  1JIZ A;  2USN A;  3KRY A;  1AF0 A;  3EDG A;  1K7G A;  2A8H A;  3LJT A;  1SAT A;  4PKU A;  4XBH A;  4PKW A;  1BIW A;  3O2X A;  5D1T A;  2YB9 A;  1IAG A;  3BA0 A;  4J4M A;  3LIL A;  1EAK A;  3UVC A;  1EB6 A;  1GO7 P;  1CQR A;  1GO8 P;  2AIG P;  3TSK A;  3TVC A;  3K7L A;  2OW0 A;  1BKC A;  1OMJ A;  3LK8 A;  1YQY A;  3OHL A;  4ILW D;  2WO9 A;  1IAC A;  5L7F A;  4AUO A;  3OHO A;  4FXY P;  1R1H A;  4GR0 A;  4XCT A;  3I7I A;  1C7K A;  1HFS A;  1ZXV A;  1XFU A;  5L79 A;  3LQ0 A;  2E2D A;  1D8F A;  1YOU A;  1ZP5 A;  2QPJ A;  1AST A;  3WV3 A;  2ERP A;  2XS3 A;  1DTH A;  1C3I A;  2MLS A;  3F19 A;  2X3A A;  1PWW A;  1FBL A;  4H84 A;  1ATL A;  3HY9 A;  3LUN A;  3LMC A;  4HX3 A;  5CZM A;  1OS2 A;  2K9C A;  1ZTQ A;  1QUA A;  1MNC A;  3L0T A;  5D7W A;  1D5J A;  5D2B A;  2MZI A;  1Q3A A;  2ERO A;  1GKC A;  1EUB A;  1QIB A;  1Z3J A;  2OY2 A;  5I2Z A;  1K7I A;  4I35 A;  4R3V A;  1BQO A;  5B5P A;  2O3E A;  3VTG A;  5JMY A;  1XFZ A;  3B2Z A;  1AYK A;  1YP1 A;  1QJJ A;  1GE6 A;  4PKQ A;  2W0D A;  2XS4 A;  5D1S A;  3F15 A;  1HTD A;  3O64 A;  1I76 A;  3RTS A;  4JPA A;  4PKS A;  4FU4 A;  1HV5 A;  3E8R A;  2OY4 A; 
#chains in the Genus database with same CATH topology
 3LIK A;  1UMT A;  3WV1 A;  1HY7 A;  4DV8 A;  4JP4 A;  1PWP A;  3RTT A;  1XFY A;  4GUY A;  2SRT A;  1QIC A;  4ON1 A;  1UTZ A;  1ZVX A;  3DNG A;  3KHI A;  1JIW P;  1HOV A;  2K2G A;  2E3X A;  1GE7 A;  2OW2 A;  1GE5 A;  1RMZ A;  3NX7 A;  1KUH A;  3L0V A;  1MMB A;  3Q2G A;  1XUC A;  3DTK A;  1UMS A;  3LJG A;  3LEA A;  1AKL A;  4H76 A;  1DMT A;  5I43 A;  1SRP A;  2RJP A;  1JAQ A;  3EDI A;  3HB2 P;  3ELM A;  5CXA A;  3LJZ A;  1Y0V A;  1JAN A;  3MA2 A;  1L6J A;  1O0T A;  1JH1 A;  4WKI A;  1JKY A;  2Y6C A;  2WO8 A;  4IUW A;  2JNP A;  1G12 A;  2N8R A;  1G4K A;  3I7G A;  1OZ9 A;  1R55 A;  1BUD A;  1IAA A;  1G49 A;  4G0D A;  1O0Q A;  3P24 A;  2MZH A;  1PWU A;  3DPE A;  1D8M A;  4WZV A;  2AYK A;  1BUV M;  2OZR A;  3DTI A;  2Y6D A;  1BKC E;  5I12 A;  1RM8 A;  2X7M A;  2DW1 A;  3EDZ A;  1ZXC A;  2JIH A;  2DDY A;  1K7Q A;  2JT6 A;  4GQL A;  2WOA A;  2J83 A;  4PKV A;  2OXU A;  4WK7 A;  4XM7 A;  1XFV A;  1BZS A;  1I73 A;  2V4B A;  2OVZ A;  2X3C A;  3LQB A;  4A3W A;  1WNI A;  4L6T A;  2KRJ A;  2JT5 A;  1JJ9 A;  1OM7 A;  4H3X A;  1QJI A;  1ZS0 A;  2L0R A;  4DF9 A;  2X3B A;  1D7X A;  5D3C A;  456C A;  1CGF A;  2FV9 A;  2RJQ A;  5I3M A;  1A86 A;  2JSD A;  5BOT A;  3LIR A;  1KAP P;  2POJ A;  2DW0 A;  4A7B A;  1QIA A;  2W13 A;  4ZR5 A;  1H71 P;  4H49 A;  3F17 A;  3P1V A;  4JIJ A;  1A85 A;  3ZUK A;  1OS9 A;  3HYG A;  1IAB A;  1SU3 A;  3EWJ A;  1IAE A;  4HMA A;  3V96 B;  3ZVS A;  1Y93 A;  3HDA P;  1MMQ A;  4IJO A;  1MMR A;  5I0L A;  2CKI A;  4XM6 A;  1I1I P;  1C8T A;  1OM6 A;  1OO9 A;  1XM5 A;  3KME A;  3EDH A;  1JK3 A;  3HDB A;  3B92 A;  966C A;  3N2V A;  2OXW A;  3KEJ A;  3LGP A;  1B8Y A;  1UEA A;  1G9K A;  1B3D A;  1SLM A;  2D1N A;  2ERQ A;  2CLT A;  1XFW A;  1JAP A;  3G42 A;  1SMP A;  1BSW A;  1JAO A;  4Q1L A;  4L63 A;  3G5C A;  5H8X A;  3LE9 A;  1KUF A;  3KEC A;  2OXZ A;  1MMP A;  1S4B P;  1KUK A;  2OW9 A;  2W12 A;  3Q2H A;  3AYK A;  1J7N A;  4H30 A;  4GF1 A;  1XFX A;  5BOY A;  1PWV A;  2OW1 A;  830C A;  1ND1 A;  3HBU P;  4PKR A;  3ZXH A;  1PWQ A;  1OM8 A;  1YCM A;  2TCL A;  3AYU A;  1CAQ A;  2YIG A;  4CTH A;  1KUG A;  4JQG A;  5I4O A;  3AIG A;  1FLS A;  1GKD A;  3KEK A;  4FXQ A;  4GWM A;  1XAX A;  1IAD A;  3F1A A;  3B8Z A;  1GXD A;  4WKE A;  3TT4 A;  1R1I A;  2MZE A;  5BPA A;  1HFC A;  2I47 A;  3CKI A;  3DPF A;  1BQQ M;  4FVL A;  4AIG A;  4DD8 A;  3K7N A;  3EHX A;  4DPE A;  1Y8J A;  4PKT A;  1CK7 A;  1TVI A;  3USN A;  3F16 A;  2DW2 A;  4GWN A;  4EFS A;  1FM1 A;  4H1Q A;  5B5O A;  3DSL A;  1XUD A;  2HU6 A;  2FV5 A;  3F18 A;  3DL1 A;  1USN A;  4L19 A;  3KMC A;  3TS4 A;  4XM8 A;  2O36 A;  5LAB A;  4H82 A;  1BM6 A;  4IN9 A;  3WV2 A;  2W15 A;  2OVX A;  3N2U A;  4JA1 A;  3GBO A;  4I03 A;  2DDF A;  2MLR A;  2W14 A;  3HY7 A;  1XUR A;  4GR3 A;  4QKZ A;  1ROS A;  3LKA A;  1UTT A;  3U1R A;  1R54 A;  5CUH A;  4H2E A;  3KWV C;  1BKC I;  2PJT A;  4GR8 A;  3LUM A;  2OI0 A;  1KBC A;  4WF6 A;  5D1U A;  2Z2D A;  1CXV A;  4AXQ A;  3SHI A;  3DWB A;  1R1J A;  4AYK A;  3VI1 A;  1CGE A;  2J0T A;  1SLN A;  4G9L A;  1CIZ A;  1CGL A;  1KUI A;  1G05 A;  3HBV P;  2D1O A;  3EHY A;  1JIZ A;  2USN A;  3KRY A;  1AF0 A;  3EDG A;  1K7G A;  2A8H A;  3LJT A;  1SAT A;  4PKU A;  4XBH A;  4PKW A;  1BIW A;  3O2X A;  5D1T A;  2YB9 A;  1IAG A;  3BA0 A;  4J4M A;  3LIL A;  1EAK A;  3UVC A;  1EB6 A;  1GO7 P;  1CQR A;  1GO8 P;  2AIG P;  3TSK A;  3TVC A;  3K7L A;  2OW0 A;  1BKC A;  1OMJ A;  3LK8 A;  1YQY A;  3OHL A;  4ILW D;  2WO9 A;  1IAC A;  5L7F A;  4AUO A;  3OHO A;  4FXY P;  1R1H A;  4GR0 A;  2YUF A;  4XCT A;  3I7I A;  1C7K A;  1HFS A;  1ZXV A;  1XFU A;  5L79 A;  3LQ0 A;  2E2D A;  1D8F A;  1YOU A;  1ZP5 A;  2QPJ A;  1AST A;  3WV3 A;  2ERP A;  2XS3 A;  1DTH A;  1C3I A;  2MLS A;  3F19 A;  2X3A A;  1PWW A;  1FBL A;  4H84 A;  1ATL A;  3HY9 A;  3LUN A;  3LMC A;  4HX3 A;  5CZM A;  1OS2 A;  2K9C A;  1ZTQ A;  1QUA A;  1MNC A;  3L0T A;  5D7W A;  1D5J A;  4L7A A;  5D2B A;  2MZI A;  1Q3A A;  2ERO A;  1GKC A;  1EUB A;  1QIB A;  1Z3J A;  2OY2 A;  5I2Z A;  1K7I A;  4I35 A;  4R3V A;  1BQO A;  5B5P A;  2O3E A;  3VTG A;  5JMY A;  1XFZ A;  3B2Z A;  3DTE A;  1AYK A;  1YP1 A;  1QJJ A;  1GE6 A;  4PKQ A;  2W0D A;  2XS4 A;  5D1S A;  3F15 A;  1HTD A;  3O64 A;  1I76 A;  3RTS A;  4JPA A;  4PKS A;  4FU4 A;  1HV5 A;  3E8R A;  2OY4 A; 
#chains in the Genus database with same CATH homology
 3LIK A;  1UMT A;  3WV1 A;  1HY7 A;  4DV8 A;  4JP4 A;  1PWP A;  3RTT A;  1XFY A;  4GUY A;  2SRT A;  1QIC A;  4ON1 A;  1UTZ A;  1ZVX A;  3DNG A;  3KHI A;  1JIW P;  1HOV A;  2K2G A;  2E3X A;  1GE7 A;  2OW2 A;  1GE5 A;  1RMZ A;  3NX7 A;  1KUH A;  3L0V A;  1MMB A;  3Q2G A;  1XUC A;  3DTK A;  1UMS A;  3LJG A;  3LEA A;  1AKL A;  4H76 A;  1DMT A;  5I43 A;  1SRP A;  2RJP A;  1JAQ A;  3EDI A;  3HB2 P;  3ELM A;  5CXA A;  3LJZ A;  1Y0V A;  1JAN A;  3MA2 A;  1L6J A;  1O0T A;  1JH1 A;  4WKI A;  1JKY A;  2Y6C A;  2WO8 A;  4IUW A;  2JNP A;  1G12 A;  2N8R A;  1G4K A;  3I7G A;  1R55 A;  1BUD A;  1IAA A;  1G49 A;  4G0D A;  1O0Q A;  3P24 A;  2MZH A;  1PWU A;  3DPE A;  1D8M A;  4WZV A;  2AYK A;  1BUV M;  2OZR A;  3DTI A;  2Y6D A;  1BKC E;  5I12 A;  1RM8 A;  2X7M A;  2DW1 A;  3EDZ A;  1ZXC A;  2JIH A;  2DDY A;  1K7Q A;  2JT6 A;  4GQL A;  2WOA A;  2J83 A;  4PKV A;  2OXU A;  4WK7 A;  4XM7 A;  1XFV A;  1BZS A;  1I73 A;  2V4B A;  2OVZ A;  2X3C A;  3LQB A;  4A3W A;  1WNI A;  4L6T A;  2KRJ A;  2JT5 A;  1JJ9 A;  1OM7 A;  4H3X A;  1QJI A;  1ZS0 A;  2L0R A;  4DF9 A;  2X3B A;  1D7X A;  5D3C A;  456C A;  1CGF A;  2FV9 A;  2RJQ A;  5I3M A;  1A86 A;  2JSD A;  5BOT A;  3LIR A;  1KAP P;  2POJ A;  2DW0 A;  4A7B A;  1QIA A;  2W13 A;  4ZR5 A;  1H71 P;  4H49 A;  3F17 A;  3P1V A;  4JIJ A;  1A85 A;  3ZUK A;  1OS9 A;  3HYG A;  1IAB A;  1SU3 A;  3EWJ A;  1IAE A;  4HMA A;  3V96 B;  3ZVS A;  1Y93 A;  3HDA P;  1MMQ A;  4IJO A;  1MMR A;  5I0L A;  2CKI A;  4XM6 A;  1I1I P;  1C8T A;  1OM6 A;  1OO9 A;  3KME A;  3EDH A;  1JK3 A;  3HDB A;  3B92 A;  966C A;  3N2V A;  2OXW A;  3KEJ A;  3LGP A;  1B8Y A;  1UEA A;  1G9K A;  1B3D A;  1SLM A;  2D1N A;  2ERQ A;  2CLT A;  1XFW A;  1JAP A;  3G42 A;  1SMP A;  1BSW A;  1JAO A;  4Q1L A;  4L63 A;  3G5C A;  5H8X A;  3LE9 A;  1KUF A;  3KEC A;  2OXZ A;  1MMP A;  1S4B P;  1KUK A;  2OW9 A;  2W12 A;  3Q2H A;  3AYK A;  1J7N A;  4H30 A;  4GF1 A;  1XFX A;  5BOY A;  1PWV A;  2OW1 A;  830C A;  1ND1 A;  3HBU P;  4PKR A;  3ZXH A;  1PWQ A;  1OM8 A;  1YCM A;  2TCL A;  3AYU A;  1CAQ A;  2YIG A;  4CTH A;  1KUG A;  4JQG A;  5I4O A;  3AIG A;  1FLS A;  1GKD A;  3KEK A;  4FXQ A;  4GWM A;  1IAD A;  3F1A A;  3B8Z A;  1GXD A;  4WKE A;  3TT4 A;  1R1I A;  2MZE A;  5BPA A;  1HFC A;  2I47 A;  3CKI A;  3DPF A;  1BQQ M;  4FVL A;  4AIG A;  4DD8 A;  3K7N A;  3EHX A;  4DPE A;  1Y8J A;  4PKT A;  1CK7 A;  3USN A;  3F16 A;  2DW2 A;  4GWN A;  4EFS A;  1FM1 A;  4H1Q A;  5B5O A;  3DSL A;  1XUD A;  2HU6 A;  2FV5 A;  3F18 A;  3DL1 A;  1USN A;  4L19 A;  3KMC A;  3TS4 A;  4XM8 A;  2O36 A;  5LAB A;  4H82 A;  1BM6 A;  4IN9 A;  3WV2 A;  2W15 A;  2OVX A;  3N2U A;  4JA1 A;  3GBO A;  4I03 A;  2DDF A;  2MLR A;  2W14 A;  3HY7 A;  1XUR A;  4GR3 A;  4QKZ A;  1ROS A;  3LKA A;  1UTT A;  3U1R A;  1R54 A;  5CUH A;  4H2E A;  3KWV C;  1BKC I;  2PJT A;  4GR8 A;  3LUM A;  2OI0 A;  1KBC A;  4WF6 A;  5D1U A;  2Z2D A;  1CXV A;  4AXQ A;  3SHI A;  3DWB A;  1R1J A;  4AYK A;  3VI1 A;  1CGE A;  2J0T A;  1SLN A;  4G9L A;  1CIZ A;  1CGL A;  1KUI A;  1G05 A;  3HBV P;  2D1O A;  3EHY A;  1JIZ A;  2USN A;  3KRY A;  1AF0 A;  3EDG A;  1K7G A;  2A8H A;  3LJT A;  1SAT A;  4PKU A;  4XBH A;  4PKW A;  1BIW A;  3O2X A;  5D1T A;  2YB9 A;  1IAG A;  3BA0 A;  4J4M A;  3LIL A;  1EAK A;  3UVC A;  1EB6 A;  1GO7 P;  1CQR A;  1GO8 P;  2AIG P;  3TSK A;  3TVC A;  3K7L A;  2OW0 A;  1BKC A;  1OMJ A;  3LK8 A;  1YQY A;  3OHL A;  4ILW D;  2WO9 A;  1IAC A;  5L7F A;  4AUO A;  3OHO A;  4FXY P;  1R1H A;  4GR0 A;  2YUF A;  4XCT A;  3I7I A;  1C7K A;  1HFS A;  1ZXV A;  1XFU A;  5L79 A;  3LQ0 A;  2E2D A;  1D8F A;  1YOU A;  1ZP5 A;  2QPJ A;  1AST A;  3WV3 A;  2ERP A;  2XS3 A;  1DTH A;  1C3I A;  2MLS A;  3F19 A;  2X3A A;  1PWW A;  1FBL A;  4H84 A;  1ATL A;  3HY9 A;  3LUN A;  3LMC A;  4HX3 A;  5CZM A;  1OS2 A;  2K9C A;  1ZTQ A;  1QUA A;  1MNC A;  3L0T A;  5D7W A;  1D5J A;  4L7A A;  5D2B A;  2MZI A;  1Q3A A;  2ERO A;  1GKC A;  1EUB A;  1QIB A;  1Z3J A;  2OY2 A;  5I2Z A;  1K7I A;  4I35 A;  4R3V A;  1BQO A;  5B5P A;  2O3E A;  3VTG A;  5JMY A;  1XFZ A;  3B2Z A;  3DTE A;  1AYK A;  1YP1 A;  1QJJ A;  1GE6 A;  4PKQ A;  2W0D A;  2XS4 A;  5D1S A;  3F15 A;  1HTD A;  3O64 A;  1I76 A;  3RTS A;  4JPA A;  4PKS A;  4FU4 A;  1HV5 A;  3E8R A;  2OY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...