1QIRA

Aspartate aminotransferase from escherichia coli, c191y mutation, with bound maleate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGYCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title The Role of Residues Outside the Active Site in Catalysis: Structural Basis for Function of C191 Mutants of E. Coli Aspartate Aminotransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminotransferase
total genus 126
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1qirA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1qirA01
1B9HA 1D7UA 5M46A 1VEFA 2EH6A 1C9CA 1RV4A 4GE7A 5HHYA 1PMOA 3OKSA 1AHYA 3B1DA 1TATA 2FYFA 2CB1A 4J5UA 4L0OA 1N2TA 4WXFA 4Y0DA 2D61A 2W7IA 1QZ9A 1PFFA 2CH1A 2QA3A 1WYUB 1MGVA 1DJ9A 1GC0A 4Q6RA 1EJIA 2F8JA 3MAUA 3D6KA 4WYDA 5M49A 2Z20A 5EAAA 3ZZJA 5E3KA 1B9IA 1SF2A 4R5ZA 3FVSA 4ZM4A 1X2AA 4MY5A 1GD9A 5I92A 4LC3A 2QMAA 2FN6A 4JF0A 3HMUA 1JS3A 3FTBA 2C81A 3PD6B 1B5PA 3EI9A 2VMSA 4GEBA 3K40A 4LNLA 3WGBA 1CQ7A 2ZYJA 2VMYA 3ECDA 4A0GA 4EB5A 4MQRA 2W8VA 3EIBA 3JWBA 4XJOA 2R5CB 4W1VA 2BI5A 2CJDA 3RBFA 2AEVA 3DRDA 1JG8A 1OHYA 1PG8A 2W7DA 2Z9WA 4UQVA 4XJPA 2W8UA 2Z1YA 2HUUA 4GRXA 2YHKA 1MDZA 3FQ7A 5J8QA 4GDYA 3M5UA 2ZY3A 3PJ0A 1CQ6A 4A6TA 1G7WA 4RJYA 1ASMA 4NOGA 1CS1A 2HOYA 3MEBA 3P6KA 3Q8NA 1ASNA 4JEWA 2VGZA 2VIBA 4UHMA 2CFBA 3KGWA 4UOYA 4ZWMA 3AEJA 1RVUA 1AMRA 3EIAA 3II0A 1O62A 4W1XA 2AY2A 4WXBA 2V1PA 4DQ6A 2EGYA 3G7QA 3COGA 2HUFA 1KL2A 2HOXA 4OMAA 1XI9A 2BIAA 3A9ZA 3F0HA 4WYEA 1O61A 1GC4A 4PVFA 4IX8A 5FT6A 2BWNA 1ARGA 1ZOBA 1JS6A 1KMKA 4ATQA 4XQ2A 1OATA 1ARTA 3KKIA 2VMXA 1D2FA 1LW5A 1SFFA 4LW2A 4F5MA 2Q7WA 1I29A 2W7HA 2YKYA 2Z61A 4RM1A 1BJOA 1ZODA 4JE5A 4I8AA 1ARSA 1WYTA 3ACZA 2FNIA 4XJMA 3G0TA 4IYOB 1AJRA 2WKAA 2OKKA 2BI9A 3N0LA 3PDBA 1LKCA 2D7ZA 2R2NA 4RJ0A 3WGCA 2FNUA 1AIAA 2CJHA 1M0PA 1CQ8A 1B5OA 1ECXA 3VP6A 3VAXA 3NTJA 2EPJA 3MADA 3NYTA 1WKHA 1CZEA 4AZJA 1BS0A 1YJZA 2QB3A 3BCBA 1YOOA 1M0NA 2VMUA 2ZY2A 2JJHA 3MC6C 5DJ9A 3W1IA 4A72A 3FD0A 2Z67A 2ZJGA 3NDNA 3B46A 3VK2A 3W1HA 2JISA 5G09A 2ORDA 1FG3A 5LH9A 3CQ4A 2W7JA 4RLGA 5M4BA 1CL2A 1WYVA 4JEVA 3NUBA 3GZCA 1AKBA 4R5FA 1T3IA 3MAFA 4WYCA 1M0QA 4ADBA 1ASCA 4TV7A 2CANA 1CL1A 2WK7A 3JWAA 3ZRRA 3BWNC 3WKSA 2EZ1A 2CSTA 3LWSA 2BYLA 1Z3ZA 2AY6A 3F9TA 3IHJA 3ZRPA 1ELQA 1KMJA 1AHEA 2YKUA 1AMQA 3DU4A 3GZDA 4E1OA 4F4EA 1AAWA 1RVYA 3EI5A 2VI8A 1UU1A 3WKRA 2R0TA 3FFRA 1J04A 1G4XA 2X5DA 1IX7A 2VMPA 1V72A 2YRIA 4O6ZA 3UE8A 4F5LA 1YJSA 1XEYA 3RCHA 2AY9A 2CTZA 2VMQA 1JF9A 4KYOA 4ZASA 1AIBA 5EQCA 5G0AA 4ATPA 4FFCA 3TFTA 3JTXA 3PPLA 5E4ZA 1FG7A 2OGEA 1BQDA 1TOGA 3N75A 3QM2A 1O4SA 3AOVA 2FM1A 1ASDA 4EU1A 4ZSWA 2YCPA 2X3LA 1I43A 3CBFA 3ISLA 3LV2A 1MDOA 2E7UA 2ZP7A 5M4DA 2BIEA 1N31A 5DJ1A 5FT5A 4LNMA 2VI9A 3HT4A 1AY8A 3RI6A 4ZWVA 1E5FA 3A8UX 4MSOA 2O0RA 4BMKA 4OC9A 1ASEA 1W3UA 4B9BA 4Y0HA 1DFOA 4BA5A 4CVQA 1OHVA 3UAKA 4OT8A 4CBSA 5EIGA 2EO5A 2HOZA 3BS8A 4H51A 4OBVA 4WYAA 2VGVA 3KGXA 4OYTA 1YIYA 3NU7A 4ZAHA 3QPGA 4TN4A 3WCNA 2C0RA 4DBCA 3EZ1A 3TATA 2W7EA 3EI7A 3L8AA 3I4JA 3R4TA 9AATA 1GBNA 3DXWA 5EUNA 4J8LA 2HUIA 4A00A 4A0HA 3QGUA 2GSAA 5K8BA 1UKJA 4JEYA 3TFUA 1MDXA 4GE4A 1YIZA 1SVVA 4QGRA 4F5GA 1LC5A 2W7MA 2PB2A 1M32A 5JAYA 1WSTA 1SZUA 2BHXA 2Z9VA 1E5EA 1GDEA 1QJ5A 3BCAA 4EFFA 1ZC9A 3EI6A 4OCAA 3WCOA 3ELPA 3H14A 1M4NA 2AATA 2BI3A 4WP0A 2E54A 2DGKA 3VOMA 2Z1ZA 4K2MA 3DZZA 2AY1A 4LW4A 2GB3A 1AJSA 2VMRA 3AEPA 1AHFA 4ADCA 2GMUA 4P3MA 5AX8A 4XAUA 2AY4A 4JE5D 4WB0A 2AY3A 4IXZA 1AX4A 3RBLA 2QLRA 3GJUA 3PAAA 1IX6A 2Z9XA 3E2FA 3TCMA 1GC3A 3LVMA 4UHOA 2Z9UA 4K2IA 1EG5A 1TPLA 3AV7A 3AATA 3NRAA 1FC4A 4MQPA 1GEYA 2RFVA 1AKAA 3I5TA 3PGYA 3FQ8A 2DKBA 2OQXA 3FRKA 3PA9A 4E77A 1CJ0A 1V2DA 1G7XA 4FL0A 4IY7A 4WBTA 1X28A 1AY5A 4A0RA 4E3QA 1W7MA 3IF2A 1ELUA 1B8GA 3AEMA 2NMPA 2WK8A 3OP7A 4RITA 1IJIA 1LC8A 1VJOA 3A9YA 3B1CA 3NNKA 2W8JA 4R8DA 2HP2A 4F5FA 1Y4IA 1AICA 5EFSA 2BWPA 2BI2A 2ZY4A 1UU0A 3BCXA 4M2JA 2BKWA 3LVKA 1BJOB 4RIZA 2W7KA 1WYTB 1S07A 2YKVA 4U1TA 1ASFA 1DGEA 1DJEA 3CQ5A 4ITXA 3B1EA 2VGWA 2YCTA 3DR4A 3KE3A 3RQ1A 5HDMA 3PDBB 3USFA 3ASAA 2HZPA 1ORDA 1TOEA 3E2ZA 1C7GA 5HXXA 4TMRA 4ZDLA 3WZFA 3A2BA 4F5IA 3EZSA 3ZRQA 4Q75A 3T32A 2CH2A 1GCKA 1OXOA 3PIUA 2D64A 2QB2A 4OBUA 1J32A 3BWNA 4JEXA 5DX5A 3WX9A 1D7SA 2ZSMA 3EI8A 1DTYA 2DGLA 3L44A 4HVKA 4ZLVA 2GMSA 3GETA 3WLXA 3JU7A 3K7YA 1MLYA 1AY4A 3BC8A 3FZ6A 2D7YA 3FKDA 3NYSA 1GEWA 5BJ4A 1TARA 1AMAA 2JGTA 1MLZA 4PFFA 3BV0A 3I16A 3JW9A 3NX3A 4ADDA 1C0NA 1ASBA 2OATA 4BA4A 1S08A 3CAIA 4WXGA 3MAFB 4N0WA 1RV3A 3ATHA 1U08A 4W8IA 5C6UA 1TOIA 4WYGA 1I48A 3FVUA 5F8VA 1N8PA 2V0YA 4MQQA 5G2QA 3GZDC 1W23A 1ARHA 1KKPA 2PB0A 3FZ7A 1DGDA 3JZLA 4JF1A 1BT4A 2VMNA 3EUCA 3A9XA 1WYUA 3VK4A 1AMSA 4BHDA 3VK3A 5FT8A 3AENB 2D63A 2W7LA 4IXOA 2E7JA 4AO4A 3RCHB 3GBXA 1W7LA 5G2PA 1M0OA 3BWOA 4RAEA 4E3RA 3E2YA 4XK1A 1KKJA 5IWQA 4W91A 2W7FA 4MKJA 4XJLA 1W7NA 1YJYA 3DYDA 1B4XA 1QIRA 2D66A 3FZ8A 3PD6A 4F5KA 2YOBA 1BJ4A 1ASGA 3HDOA 2YKXA 2G6WA 4A6RA 1I41A 3E6GA 1Z7DA 3LG0A 4WYFA 3ASBA 1BJNA 3FCRA 2O1BA 2R5CA 3DXVA 1DKAA 3DC1A 4DGTA 2BIGA 3NUIA 1AAMA 3GWPA 4MKKA 2VIAA 1IAXA 5F9SA 5LHAA 2JJGA 1IBJA 3LVJA 5G4IA 3TQXA 4ISYA 4BQ0A 4F5HA 4ZDPA 1AKCA 1MAQA 3NYUA 2W8TA 5EIGB 4WD2A 1VP4A 2BI1A 2OGAA 2VLHA 4EB7A 3BN1A 2VMZA 4CXRA 1WKGA 2X8UA 4W5KA 1X0MA 4B98A 1H0CA 2VGSA 2ZUKA 2CY8A 2HP1A 1LC7A 1TASA 4XEWA 5FT4A 3FDDA 3K28A 3GSBA 4AH3A 4CXQA 3QBOA 2VMVA 3DODA 2QBTA 2R5EA 1H1CA 1M7YA 2ZSLA 5D5SA 1V2FA 1D7RA 1MAPA 4WLJA 4EMYA 1C7OA 1SZSA 1TOKA 3HBXA 4AZKA 2BWOA 3HL2A 7AATA 4ZSYA 3QN6A 5G4JA 4OTLA 2W8WA 4GE9A 4GSAA 2XBNA 3AEJC 4IXSA 1IAYA 2C7TA 2DGMA 2VLFA 5E5IA 1KL1A 1LK9A 1OXPA 1CZCA 5DB5A 4IYOA 1P3WA 3FVXA 5D95A 1AHXA 3FDBA 4IW7A 2VGTA 1AJSB 2WK9A 1S0AA 2AY7A 3FFHA 3AOWA 2HORA 3G8MA 1GEXA 1SPAA 1BKGA 4W1WA 2JG2A 3WY7A 4PIWA 2W7GA 5BJ3A 1C7NA 1PMMA 2O7CA 3LVLB 2CJGA 4U2HA 4A0FA 4ADEA 2GQNA 3B8XA 4WB0B 3E77A 3LY1A 1ASLA 1ARIA 2D5YA 3W1JA 3MC6A 4Q76A 2VGUA 3N5MA 2AY8A 3F6TA 4K2BA 4KXKA 8AATA 1EQBA 1V2EA 5EUDA 2XH1A 4Y0IA 4RKCA 4ZM3A 3FSLA 3P1TA 4PFNA 1D7VA 2FQ6A 3AEMC 4A6UA 1BW0A 3UWCA 2DR1A 2DOUA 4M2KA 4UHNA 1S06A 3ELEA 2EZ2A 4N0BA 3GR9A 3PDXA 3CQ6A 1ASAA 1QJ3A 3FQAA 3MBBA 3NU8A 1C4KA 1YNUA 2JJEA 3AELA 2AY5A 2YCNA 4MGRA 4HF8A 3H7FA 3QI6A 3AEOA 1BJWA 4M2MA 2BYJA 4WLHA 1LW4A 2ZY5A 1G4VA 1QISA 1UU2A 4R2NA 4CBRA 1BQAA 4AO9A 3MKJA 1DJUA 1WYVB 5EUEA 1OHWA 3BB8A 3E2ZB 4JEZA 2D65A 4AOAA 3HVYA 2PO3A 2TPLA 4KAMA 2E7IA 2YRRA 1LS3A 3E9KA 2VMWA 1IVRA 2OKJA 1M6SA 1X29A 2ZC0A 3QHXA 5TF5A 3R9AA 2DKJA 3RUYA 2VMTA 1IUGA 1GC2A 1S09A 4LNJA 1TOJA 1YAAA 5EAVA 4ZDOA 3HQTA 3AENA 3HLMA 2C44A 4ITGA 2VYCA 2VMOA 1AHGA 1O69A 2X5FA 3ZZKA 4F5JA 3DR7A 2CINA 4RKDA 4Q31A 1QGNA 1IX8A 1QITA 1SZKA 2AEUA 2JJFA 4P7YA
chains in the Genus database with same CATH superfamily
1B9HA 1D7UA 5M46A 1VEFA 2EH6A 1C9CA 1RV4A 4GE7A 5HHYA 1PMOA 3OKSA 1AHYA 3B1DA 1TATA 2FYFA 2CB1A 4J5UA 4L0OA 1N2TA 4WXFA 4Y0DA 2D61A 2W7IA 1QZ9A 1PFFA 2CH1A 2QA3A 1WYUB 1MGVA 1DJ9A 1GC0A 4Q6RA 1EJIA 2F8JA 3MAUA 3D6KA 4WYDA 5M49A 2Z20A 5EAAA 3ZZJA 5E3KA 1B9IA 1SF2A 4R5ZA 3FVSA 4ZM4A 1X2AA 4MY5A 1GD9A 5I92A 4LC3A 2QMAA 2FN6A 4JF0A 3HMUA 1JS3A 3FTBA 2C81A 3PD6B 1B5PA 3EI9A 2VMSA 4GEBA 3K40A 4LNLA 3WGBA 1CQ7A 2ZYJA 2VMYA 3ECDA 4A0GA 4EB5A 4MQRA 2W8VA 3EIBA 3JWBA 4XJOA 2R5CB 4W1VA 2BI5A 2CJDA 3RBFA 2AEVA 3DRDA 1KAFA 1JG8A 1OHYA 1PG8A 2W7DA 2Z9WA 4UQVA 4XJPA 2W8UA 2Z1YA 2HUUA 4GRXA 2YHKA 1MDZA 3FQ7A 5J8QA 4GDYA 3M5UA 2ZY3A 3PJ0A 1CQ6A 4A6TA 1G7WA 4RJYA 1ASMA 4NOGA 1CS1A 2HOYA 3MEBA 3P6KA 3Q8NA 1ASNA 4JEWA 2VGZA 2VIBA 4UHMA 2CFBA 3KGWA 4UOYA 4ZWMA 3AEJA 1RVUA 1AMRA 3EIAA 3II0A 1O62A 4W1XA 2AY2A 4WXBA 2V1PA 4DQ6A 2EGYA 3G7QA 3COGA 2HUFA 1KL2A 2HOXA 4OMAA 1XI9A 2BIAA 3A9ZA 3F0HA 4WYEA 1O61A 1GC4A 4PVFA 4IX8A 5FT6A 2BWNA 1ARGA 1ZOBA 1JS6A 1KMKA 4ATQA 4XQ2A 1OATA 1ARTA 3KKIA 2VMXA 2A1VA 1D2FA 1LW5A 1SFFA 4LW2A 4F5MA 2Q7WA 1I29A 2W7HA 2YKYA 2Z61A 4RM1A 1BJOA 1ZODA 4JE5A 4I8AA 1ARSA 1WYTA 3ACZA 2FNIA 4XJMA 3G0TA 4IYOB 1AJRA 2WKAA 2OKKA 2BI9A 3N0LA 3PDBA 1LKCA 2D7ZA 2R2NA 4RJ0A 3WGCA 2FNUA 1AIAA 2CJHA 1M0PA 1CQ8A 1B5OA 1ECXA 3VP6A 3VAXA 3NTJA 2EPJA 3MADA 3NYTA 1WKHA 1CZEA 4AZJA 1BS0A 1YJZA 2QB3A 3BCBA 1YOOA 1M0NA 2VMUA 2ZY2A 2JJHA 3MC6C 5DJ9A 3W1IA 4A72A 3FD0A 2Z67A 2ZJGA 3NDNA 3B46A 3VK2A 3W1HA 2JISA 5G09A 2ORDA 1FG3A 5LH9A 3CQ4A 2W7JA 4RLGA 5M4BA 1CL2A 1WYVA 4JEVA 3NUBA 3GZCA 1AKBA 4R5FA 1T3IA 3MAFA 4WYCA 1M0QA 4ADBA 1ASCA 4TV7A 2CANA 1CL1A 2WK7A 3JWAA 3ZRRA 3BWNC 3WKSA 2EZ1A 2CSTA 3LWSA 2BYLA 1Z3ZA 2AY6A 3F9TA 3IHJA 3ZRPA 1ELQA 1KMJA 1AHEA 2YKUA 1AMQA 3DU4A 3GZDA 4E1OA 4F4EA 1AAWA 1RVYA 3EI5A 2VI8A 1UU1A 3WKRA 2R0TA 3FFRA 1J04A 1G4XA 2X5DA 1IX7A 2VMPA 1V72A 2YRIA 4O6ZA 3UE8A 4F5LA 1YJSA 1XEYA 3RCHA 2AY9A 2CTZA 2VMQA 1JF9A 4KYOA 4ZASA 1AIBA 5EQCA 5G0AA 4ATPA 4FFCA 3TFTA 3JTXA 3PPLA 5E4ZA 1FG7A 2OGEA 1BQDA 1TOGA 3N75A 4K05A 3QM2A 1O4SA 3AOVA 2FM1A 1ASDA 4EU1A 4ZSWA 2YCPA 2X3LA 1I43A 3CBFA 3ISLA 3LV2A 1MDOA 2E7UA 2ZP7A 5M4DA 2BIEA 3N4RA 1N31A 5DJ1A 5FT5A 4LNMA 2VI9A 3HT4A 1AY8A 3RI6A 4ZWVA 1E5FA 3A8UX 4MSOA 2O0RA 4BMKA 4OC9A 1ASEA 1W3UA 4B9BA 4Y0HA 1DFOA 4BA5A 4CVQA 1OHVA 3UAKA 4OT8A 4CBSA 5EIGA 2EO5A 2HOZA 3BS8A 4H51A 4OBVA 4WYAA 2VGVA 3KGXA 4OYTA 1YIYA 3NU7A 4ZAHA 3QPGA 4TN4A 3WCNA 2C0RA 4DBCA 3EZ1A 3TATA 2W7EA 3EI7A 3L8AA 3I4JA 3R4TA 9AATA 5KTBA 1GBNA 3DXWA 5EUNA 4J8LA 2HUIA 4A00A 4A0HA 3QGUA 2GSAA 5K8BA 1UKJA 4JEYA 3TFUA 1MDXA 4GE4A 1YIZA 1SVVA 4QGRA 4F5GA 1LC5A 2W7MA 2PB2A 1M32A 5JAYA 1WSTA 1SZUA 2BHXA 2Z9VA 1E5EA 1GDEA 1QJ5A 3BCAA 4EFFA 1ZC9A 3EI6A 4OCAA 3WCOA 3ELPA 3H14A 1M4NA 2AATA 2BI3A 4WP0A 2E54A 2DGKA 3VOMA 2Z1ZA 4K2MA 3DZZA 2AY1A 4LW4A 2GB3A 1AJSA 2VMRA 3AEPA 1AHFA 4ADCA 2GMUA 4P3MA 5AX8A 4XAUA 2AY4A 4JE5D 4WB0A 2AY3A 4IXZA 1AX4A 3RBLA 2QLRA 3GJUA 3PAAA 1IX6A 2Z9XA 3E2FA 3TCMA 1GC3A 3LVMA 4UHOA 2Z9UA 4K2IA 1EG5A 1TPLA 3AV7A 3AATA 3NRAA 1FC4A 4MQPA 1GEYA 2RFVA 1AKAA 3I5TA 3PGYA 3FQ8A 2DKBA 2OQXA 3FRKA 3PA9A 4E77A 1CJ0A 1V2DA 1G7XA 4FL0A 4IY7A 4WBTA 1X28A 1AY5A 4A0RA 4E3QA 1W7MA 3IF2A 1ELUA 1B8GA 3AEMA 2NMPA 2WK8A 3OP7A 4RITA 1IJIA 1LC8A 1VJOA 3A9YA 3B1CA 3NNKA 2W8JA 4R8DA 2HP2A 4F5FA 1Y4IA 1AICA 5EFSA 2BWPA 2BI2A 2ZY4A 1UU0A 3BCXA 4M2JA 2BKWA 3LVKA 1BJOB 4RIZA 2W7KA 1WYTB 1S07A 2YKVA 4U1TA 1ASFA 1DGEA 3N4SA 1DJEA 3CQ5A 4ITXA 3B1EA 2VGWA 2YCTA 3DR4A 3KE3A 3RQ1A 5HDMA 3PDBB 3USFA 3ASAA 2HZPA 1ORDA 1TOEA 3E2ZA 1C7GA 5HXXA 4TMRA 4ZDLA 3WZFA 3A2BA 4F5IA 3EZSA 3ZRQA 4Q75A 3T32A 2CH2A 1GCKA 1OXOA 3PIUA 2D64A 2QB2A 4OBUA 1J32A 3BWNA 4JEXA 5DX5A 3WX9A 1D7SA 2ZSMA 3EI8A 1DTYA 2DGLA 3L44A 4HVKA 4ZLVA 2GMSA 3GETA 3WLXA 3JU7A 3K7YA 1MLYA 1AY4A 3BC8A 3FZ6A 2D7YA 3FKDA 3NYSA 1GEWA 5BJ4A 1TARA 1AMAA 2JGTA 1MLZA 4PFFA 3BV0A 3I16A 3JW9A 3NX3A 2G7JA 4ADDA 1C0NA 1ASBA 2OATA 4BA4A 1S08A 3CAIA 4WXGA 3MAFB 4N0WA 1RV3A 3ATHA 1U08A 4W8IA 5C6UA 1TOIA 4WYGA 1I48A 3FVUA 5F8VA 1N8PA 2V0YA 4MQQA 5G2QA 3GZDC 1W23A 1ARHA 1KKPA 2PB0A 3FZ7A 1DGDA 3JZLA 4JF1A 1BT4A 2VMNA 3EUCA 3N4XA 3A9XA 1WYUA 3VK4A 1AMSA 4BHDA 3VK3A 5FT8A 3AENB 2D63A 2W7LA 4IXOA 2E7JA 4AO4A 3RCHB 3GBXA 1W7LA 5G2PA 1M0OA 3BWOA 4RAEA 4E3RA 3E2YA 4XK1A 1KKJA 5IWQA 4W91A 2W7FA 4MKJA 4XJLA 1W7NA 1YJYA 3DYDA 1B4XA 1QIRA 2D66A 3FZ8A 3PD6A 4F5KA 2YOBA 1BJ4A 1ASGA 3HDOA 2YKXA 2G6WA 4A6RA 1I41A 3E6GA 1Z7DA 3LG0A 4WYFA 3ASBA 1BJNA 3FCRA 2O1BA 2R5CA 3DXVA 1DKAA 3DC1A 4DGTA 2BIGA 3NUIA 1AAMA 3GWPA 4MKKA 2VIAA 1IAXA 5F9SA 5LHAA 2JJGA 1IBJA 3LVJA 5G4IA 3TQXA 4ISYA 4BQ0A 4F5HA 4ZDPA 1AKCA 1MAQA 3NYUA 2W8TA 5EIGB 4WD2A 1VP4A 2BI1A 2OGAA 2QSRA 2WB6A 2VLHA 4EB7A 3BN1A 2VMZA 4CXRA 1WKGA 2X8UA 4W5KA 1X0MA 4B98A 1H0CA 2VGSA 2ZUKA 2CY8A 2HP1A 1LC7A 1TASA 4XEWA 5FT4A 3FDDA 3K28A 3GSBA 4AH3A 4CXQA 3QBOA 2VMVA 3DODA 2QBTA 2R5EA 1H1CA 1M7YA 2ZSLA 5D5SA 1V2FA 1D7RA 1MAPA 4WLJA 4EMYA 1C7OA 1SZSA 1TOKA 3HBXA 4AZKA 2BWOA 3HL2A 7AATA 4ZSYA 3QN6A 5G4JA 4OTLA 2W8WA 4GE9A 4GSAA 2XBNA 3AEJC 4IXSA 1IAYA 2C7TA 2DGMA 2VLFA 5E5IA 1KL1A 1LK9A 3H9XA 1OXPA 1CZCA 5DB5A 4IYOA 1P3WA 3FVXA 5D95A 1AHXA 3FDBA 4IW7A 2VGTA 1AJSB 2WK9A 1S0AA 2AY7A 3FFHA 3AOWA 2HORA 3G8MA 1GEXA 1SPAA 1BKGA 4W1WA 2JG2A 3WY7A 4PIWA 2W7GA 5BJ3A 1C7NA 1PMMA 2O7CA 3LVLB 2CJGA 4U2HA 4A0FA 4ADEA 2GQNA 3B8XA 4WB0B 3E77A 3LY1A 1ASLA 1ARIA 2D5YA 3W1JA 3MC6A 4Q76A 2VGUA 3N5MA 2AY8A 3F6TA 4K2BA 4KXKA 8AATA 1EQBA 1V2EA 5EUDA 2XH1A 4Y0IA 2FKIA 4RKCA 4ZM3A 3FSLA 3P1TA 4PFNA 1D7VA 2FQ6A 3AEMC 4A6UA 1BW0A 3UWCA 2DR1A 2DOUA 4M2KA 4UHNA 1S06A 3ELEA 2EZ2A 4N0BA 3GR9A 3PDXA 3CQ6A 1ASAA 1QJ3A 3FQAA 3MBBA 3NU8A 1C4KA 1YNUA 2JJEA 3AELA 2AY5A 2YCNA 4MGRA 4HF8A 3H7FA 3QI6A 3AEOA 1BJWA 4M2MA 2BYJA 4WLHA 1LW4A 2ZY5A 2EYQA 1G4VA 1QISA 1UU2A 4R2NA 4CBRA 1BQAA 4AO9A 3MKJA 1DJUA 1WYVB 5EUEA 1OHWA 3BB8A 3E2ZB 4JEZA 2D65A 4AOAA 3HVYA 2PO3A 2TPLA 4KAMA 2E7IA 2YRRA 1LS3A 3E9KA 2VMWA 1IVRA 2OKJA 1M6SA 1X29A 2ZC0A 3QHXA 5TF5A 3R9AA 2DKJA 3RUYA 2VMTA 1IUGA 1GC2A 1S09A 4LNJA 1TOJA 1YAAA 5EAVA 4ZDOA 3N7NA 3HQTA 3AENA 3HLMA 2C44A 4ITGA 2VYCA 2VMOA 1AHGA 1O69A 2X5FA 3ZZKA 4F5JA 3DR7A 4H63Q 2CINA 4RKDA 2KFPA 4Q31A 1QGNA 1IX8A 1QITA 1SZKA 2AEUA 2JJFA 4P7YA
chains in the Genus database with same CATH topology
1B9HA 1D7UA 5M46A 1VEFA 2EH6A 1C9CA 1RV4A 4GE7A 5HHYA 1PMOA 3OKSA 1AHYA 3B1DA 1TATA 2FYFA 2CB1A 4J5UA 4L0OA 1N2TA 4WXFA 4Y0DA 2D61A 2W7IA 1QZ9A 1PFFA 2CH1A 2QA3A 1WYUB 1MGVA 1DJ9A 1GC0A 4Q6RA 1EJIA 2F8JA 3MAUA 3D6KA 4WYDA 5M49A 2Z20A 5EAAA 3ZZJA 5E3KA 1B9IA 1SF2A 4R5ZA 3FVSA 4ZM4A 1X2AA 4MY5A 1GD9A 5I92A 4LC3A 2QMAA 2FN6A 4JF0A 3HMUA 1JS3A 3FTBA 2C81A 3PD6B 1B5PA 3EI9A 2VMSA 4GEBA 3K40A 4LNLA 3WGBA 1CQ7A 2ZYJA 2VMYA 3ECDA 4A0GA 4EB5A 4MQRA 2W8VA 3EIBA 3JWBA 4XJOA 2R5CB 4W1VA 2BI5A 2CJDA 3RBFA 2AEVA 3DRDA 1JG8A 1OHYA 1PG8A 2W7DA 2Z9WA 4UQVA 4XJPA 2W8UA 2Z1YA 2HUUA 4GRXA 2YHKA 1MDZA 3FQ7A 5J8QA 4GDYA 3M5UA 2ZY3A 3PJ0A 1CQ6A 4A6TA 1G7WA 4RJYA 1ASMA 4NOGA 1CS1A 2HOYA 3MEBA 3P6KA 3Q8NA 1ASNA 4JEWA 2VGZA 2VIBA 4UHMA 2CFBA 3KGWA 4UOYA 4ZWMA 3AEJA 1RVUA 1AMRA 3EIAA 3II0A 1O62A 4W1XA 2AY2A 4WXBA 2V1PA 4DQ6A 2EGYA 3G7QA 3COGA 2HUFA 1KL2A 2HOXA 4OMAA 1XI9A 2BIAA 3A9ZA 3F0HA 4WYEA 1O61A 1GC4A 4PVFA 4IX8A 5FT6A 2BWNA 1ARGA 1ZOBA 1JS6A 1KMKA 4ATQA 4XQ2A 1OATA 1ARTA 3KKIA 2VMXA 2A1VA 1D2FA 1LW5A 1SFFA 4LW2A 4F5MA 2Q7WA 1I29A 2W7HA 2YKYA 2Z61A 4RM1A 1BJOA 1ZODA 4JE5A 4I8AA 1ARSA 1WYTA 3ACZA 2FNIA 4XJMA 3G0TA 4IYOB 1AJRA 2WKAA 2OKKA 2BI9A 3N0LA 3PDBA 1LKCA 2D7ZA 2R2NA 4RJ0A 3WGCA 2FNUA 1AIAA 2CJHA 1M0PA 1CQ8A 1B5OA 1ECXA 3VP6A 3VAXA 3NTJA 2EPJA 3MADA 3NYTA 1WKHA 1CZEA 4AZJA 1BS0A 1YJZA 2QB3A 3BCBA 1YOOA 1M0NA 2VMUA 2ZY2A 2JJHA 3MC6C 5DJ9A 3W1IA 4A72A 3FD0A 2Z67A 2ZJGA 3NDNA 3B46A 3VK2A 3W1HA 2JISA 5G09A 2ORDA 1FG3A 5LH9A 3CQ4A 2W7JA 4RLGA 5M4BA 1CL2A 1WYVA 4JEVA 3NUBA 3GZCA 1AKBA 4R5FA 1T3IA 3MAFA 4WYCA 1M0QA 4ADBA 1ASCA 4TV7A 2CANA 1CL1A 2WK7A 3JWAA 3ZRRA 3BWNC 3WKSA 2EZ1A 2CSTA 3LWSA 2BYLA 1Z3ZA 2AY6A 3F9TA 3IHJA 3ZRPA 1ELQA 1KMJA 1AHEA 2YKUA 1AMQA 3DU4A 3GZDA 4E1OA 4F4EA 1AAWA 1RVYA 3EI5A 2VI8A 1UU1A 3WKRA 2R0TA 3FFRA 1J04A 1G4XA 2X5DA 1IX7A 2VMPA 1V72A 2YRIA 4O6ZA 3UE8A 4F5LA 1YJSA 1XEYA 3RCHA 2AY9A 2CTZA 2VMQA 1JF9A 4KYOA 4ZASA 1AIBA 5EQCA 5G0AA 4ATPA 4FFCA 3TFTA 3JTXA 3PPLA 5E4ZA 1FG7A 2OGEA 1BQDA 1TOGA 3N75A 4K05A 3QM2A 1O4SA 3AOVA 2FM1A 1ASDA 4EU1A 4ZSWA 2YCPA 2X3LA 1I43A 3CBFA 3ISLA 3LV2A 1MDOA 2E7UA 2ZP7A 5M4DA 2BIEA 3N4RA 1N31A 5DJ1A 5FT5A 4LNMA 2VI9A 3HT4A 1AY8A 3RI6A 4ZWVA 1E5FA 3A8UX 4MSOA 2O0RA 4BMKA 4OC9A 1ASEA 1W3UA 4B9BA 4Y0HA 1DFOA 4BA5A 4CVQA 1OHVA 3UAKA 4OT8A 4CBSA 5EIGA 2EO5A 2HOZA 3BS8A 4H51A 4OBVA 4WYAA 2VGVA 3KGXA 4OYTA 1YIYA 3NU7A 4ZAHA 3QPGA 4TN4A 3WCNA 2C0RA 4DBCA 3EZ1A 3TATA 2W7EA 3EI7A 3L8AA 3I4JA 3R4TA 9AATA 5KTBA 1GBNA 3DXWA 5EUNA 4J8LA 2HUIA 4A00A 4A0HA 3QGUA 2GSAA 5K8BA 1UKJA 4JEYA 3TFUA 1MDXA 4GE4A 1YIZA 1SVVA 4QGRA 4F5GA 1LC5A 2W7MA 2PB2A 1M32A 5JAYA 1WSTA 1SZUA 2BHXA 2Z9VA 1E5EA 1GDEA 1QJ5A 3BCAA 4EFFA 1ZC9A 3EI6A 4OCAA 3WCOA 3ELPA 3H14A 1M4NA 2AATA 2BI3A 4WP0A 2E54A 2DGKA 3VOMA 2Z1ZA 4K2MA 3DZZA 2AY1A 4LW4A 2GB3A 1AJSA 2VMRA 3AEPA 1AHFA 4ADCA 2GMUA 4P3MA 5AX8A 4XAUA 2AY4A 4JE5D 4WB0A 2AY3A 4IXZA 1AX4A 3RBLA 2QLRA 3GJUA 3PAAA 1IX6A 2Z9XA 3E2FA 3TCMA 1GC3A 3LVMA 4UHOA 2Z9UA 4K2IA 1EG5A 1TPLA 3AV7A 3AATA 3NRAA 1FC4A 4MQPA 1GEYA 2RFVA 1AKAA 3I5TA 3PGYA 3FQ8A 2DKBA 2OQXA 3FRKA 3PA9A 4E77A 1CJ0A 1V2DA 1G7XA 4FL0A 4IY7A 4WBTA 1X28A 1AY5A 4A0RA 4E3QA 1W7MA 3IF2A 1ELUA 1B8GA 3AEMA 2NMPA 2WK8A 3OP7A 4RITA 1IJIA 1LC8A 1VJOA 3A9YA 3B1CA 3NNKA 2W8JA 4R8DA 2HP2A 4F5FA 1Y4IA 1AICA 5EFSA 2BWPA 2BI2A 2ZY4A 1UU0A 3BCXA 4M2JA 2BKWA 3LVKA 1BJOB 4RIZA 2W7KA 1WYTB 1S07A 2YKVA 4U1TA 1ASFA 1DGEA 3N4SA 1DJEA 3CQ5A 4ITXA 3B1EA 2VGWA 2YCTA 3DR4A 3KE3A 3RQ1A 5HDMA 3PDBB 3USFA 3ASAA 2HZPA 1ORDA 1TOEA 3E2ZA 1C7GA 5HXXA 4TMRA 4ZDLA 3WZFA 3A2BA 4F5IA 3EZSA 3ZRQA 4Q75A 3T32A 2CH2A 1GCKA 1OXOA 3PIUA 2D64A 2QB2A 4OBUA 1J32A 3BWNA 4JEXA 5DX5A 3WX9A 1D7SA 2ZSMA 3EI8A 1DTYA 2DGLA 3L44A 4HVKA 4ZLVA 2GMSA 3GETA 3WLXA 3JU7A 3K7YA 1MLYA 1AY4A 3BC8A 3FZ6A 2D7YA 3FKDA 3NYSA 1GEWA 5BJ4A 1TARA 1AMAA 2JGTA 1MLZA 4PFFA 3BV0A 3I16A 3JW9A 3NX3A 2G7JA 4ADDA 1C0NA 1ASBA 2OATA 4BA4A 1S08A 3CAIA 4WXGA 3MAFB 4N0WA 1RV3A 3ATHA 1U08A 4W8IA 5C6UA 1TOIA 4WYGA 1I48A 3FVUA 5F8VA 1N8PA 2V0YA 4MQQA 5G2QA 3GZDC 1W23A 1ARHA 1KKPA 2PB0A 3FZ7A 1DGDA 3JZLA 4JF1A 1BT4A 2VMNA 3EUCA 3N4XA 3A9XA 1WYUA 3VK4A 1AMSA 4BHDA 3VK3A 5FT8A 3AENB 2D63A 2W7LA 4IXOA 2E7JA 4AO4A 3RCHB 3GBXA 1W7LA 5G2PA 1M0OA 3BWOA 4RAEA 4E3RA 3E2YA 4XK1A 1KKJA 5IWQA 4W91A 2W7FA 4MKJA 4XJLA 1W7NA 1YJYA 3DYDA 1B4XA 1QIRA 2D66A 3FZ8A 3PD6A 4F5KA 2YOBA 1BJ4A 1ASGA 3HDOA 2YKXA 2G6WA 4A6RA 1I41A 3E6GA 1Z7DA 3LG0A 4WYFA 3ASBA 1BJNA 3FCRA 2O1BA 2R5CA 3DXVA 1DKAA 3DC1A 4DGTA 2BIGA 3NUIA 1AAMA 3GWPA 4MKKA 2VIAA 1IAXA 5F9SA 5LHAA 2JJGA 1IBJA 3LVJA 5G4IA 3TQXA 4ISYA 4BQ0A 4F5HA 4ZDPA 1AKCA 1MAQA 3NYUA 2W8TA 5EIGB 4WD2A 1VP4A 2BI1A 2OGAA 2QSRA 2WB6A 2VLHA 4EB7A 3BN1A 2VMZA 4CXRA 1WKGA 2X8UA 4W5KA 1X0MA 4B98A 1H0CA 2VGSA 2ZUKA 2CY8A 2HP1A 1LC7A 1TASA 4XEWA 5FT4A 3FDDA 3K28A 3GSBA 4AH3A 4CXQA 3QBOA 2VMVA 3DODA 2QBTA 2R5EA 1H1CA 1M7YA 2ZSLA 5D5SA 1V2FA 1D7RA 1MAPA 4WLJA 4EMYA 1C7OA 1SZSA 1TOKA 3HBXA 4AZKA 2BWOA 3HL2A 7AATA 4ZSYA 3QN6A 5G4JA 4OTLA 2W8WA 4GE9A 4GSAA 2XBNA 3AEJC 4IXSA 1IAYA 2C7TA 2DGMA 2VLFA 5E5IA 1KL1A 1LK9A 3H9XA 1OXPA 1CZCA 5DB5A 4IYOA 1P3WA 3FVXA 5D95A 1AHXA 3FDBA 4IW7A 2VGTA 1AJSB 2WK9A 1S0AA 2AY7A 3FFHA 3AOWA 2HORA 3G8MA 1GEXA 1SPAA 1BKGA 4W1WA 2JG2A 3WY7A 4PIWA 2W7GA 5BJ3A 1C7NA 1PMMA 2O7CA 3LVLB 2CJGA 4U2HA 4A0FA 4ADEA 2GQNA 3B8XA 4WB0B 3E77A 3LY1A 1ASLA 1ARIA 2D5YA 3W1JA 3MC6A 4Q76A 2VGUA 3N5MA 2AY8A 3F6TA 4K2BA 4KXKA 8AATA 1EQBA 1V2EA 5EUDA 2XH1A 4Y0IA 2FKIA 4RKCA 4ZM3A 3FSLA 3P1TA 4PFNA 1D7VA 2FQ6A 3AEMC 4A6UA 1BW0A 3UWCA 2DR1A 2DOUA 4M2KA 4UHNA 1S06A 3ELEA 2EZ2A 4N0BA 3GR9A 3PDXA 3CQ6A 1ASAA 1QJ3A 3FQAA 3MBBA 3NU8A 1C4KA 1YNUA 2JJEA 3AELA 2AY5A 2YCNA 4MGRA 4HF8A 3H7FA 3QI6A 3AEOA 1BJWA 4M2MA 2BYJA 4WLHA 1LW4A 2ZY5A 2EYQA 1G4VA 1QISA 1UU2A 4R2NA 4CBRA 1BQAA 4AO9A 3MKJA 1DJUA 1WYVB 5EUEA 1OHWA 3BB8A 3E2ZB 4JEZA 2D65A 4AOAA 3HVYA 2PO3A 2TPLA 4KAMA 2E7IA 2YRRA 1LS3A 3E9KA 2VMWA 1IVRA 2OKJA 1M6SA 1X29A 2ZC0A 3QHXA 5TF5A 3R9AA 2DKJA 3RUYA 2VMTA 1IUGA 1GC2A 1S09A 4LNJA 1TOJA 1YAAA 5EAVA 4ZDOA 3N7NA 3HQTA 3AENA 3HLMA 2C44A 4ITGA 2VYCA 2VMOA 1AHGA 1O69A 2X5FA 3ZZKA 4F5JA 3DR7A 4H63Q 2CINA 4RKDA 2KFPA 4Q31A 1QGNA 1IX8A 1QITA 1SZKA 2AEUA 2JJFA 4P7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9H A;  1D7U A;  5M46 A;  1VEF A;  2EH6 A;  1C9C A;  1RV4 A;  4GE7 A;  5HHY A;  1PMO A;  3OKS A;  1AHY A;  3B1D A;  1TAT A;  2FYF A;  2CB1 A;  4J5U A;  4L0O A;  1N2T A;  4WXF A;  4Y0D A;  2D61 A;  2W7I A;  1QZ9 A;  1PFF A;  2CH1 A;  2QA3 A;  1WYU B;  1MGV A;  1DJ9 A;  1GC0 A;  4Q6R A;  1EJI A;  2F8J A;  3MAU A;  3D6K A;  4WYD A;  5M49 A;  2Z20 A;  5EAA A;  3ZZJ A;  5E3K A;  1B9I A;  1SF2 A;  4R5Z A;  3FVS A;  4ZM4 A;  1X2A A;  4MY5 A;  1GD9 A;  5I92 A;  4LC3 A;  2QMA A;  2FN6 A;  4JF0 A;  3HMU A;  1JS3 A;  3FTB A;  2C81 A;  3PD6 B;  1B5P A;  3EI9 A;  2VMS A;  4GEB A;  3K40 A;  4LNL A;  3WGB A;  1CQ7 A;  2ZYJ A;  2VMY A;  3ECD A;  4A0G A;  4EB5 A;  4MQR A;  2W8V A;  3EIB A;  3JWB A;  4XJO A;  2R5C B;  4W1V A;  2BI5 A;  2CJD A;  3RBF A;  2AEV A;  3DRD A;  1JG8 A;  1OHY A;  1PG8 A;  2W7D A;  2Z9W A;  4UQV A;  4XJP A;  2W8U A;  2Z1Y A;  2HUU A;  4GRX A;  2YHK A;  1MDZ A;  3FQ7 A;  5J8Q A;  4GDY A;  3M5U A;  2ZY3 A;  3PJ0 A;  1CQ6 A;  4A6T A;  1G7W A;  4RJY A;  1ASM A;  4NOG A;  1CS1 A;  2HOY A;  3MEB A;  3P6K A;  3Q8N A;  1ASN A;  4JEW A;  2VGZ A;  2VIB A;  4UHM A;  2CFB A;  3KGW A;  4UOY A;  4ZWM A;  3AEJ A;  1RVU A;  1AMR A;  3EIA A;  3II0 A;  1O62 A;  4W1X A;  2AY2 A;  4WXB A;  2V1P A;  4DQ6 A;  2EGY A;  3G7Q A;  3COG A;  2HUF A;  1KL2 A;  2HOX A;  4OMA A;  1XI9 A;  2BIA A;  3A9Z A;  3F0H A;  4WYE A;  1O61 A;  1GC4 A;  4PVF A;  4IX8 A;  5FT6 A;  2BWN A;  1ARG A;  1ZOB A;  1JS6 A;  1KMK A;  4ATQ A;  4XQ2 A;  1OAT A;  1ART A;  3KKI A;  2VMX A;  1D2F A;  1LW5 A;  1SFF A;  4LW2 A;  4F5M A;  2Q7W A;  1I29 A;  2W7H A;  2YKY A;  2Z61 A;  4RM1 A;  1BJO A;  1ZOD A;  4JE5 A;  4I8A A;  1ARS A;  1WYT A;  3ACZ A;  2FNI A;  4XJM A;  3G0T A;  4IYO B;  1AJR A;  2WKA A;  2OKK A;  2BI9 A;  3N0L A;  3PDB A;  1LKC A;  2D7Z A;  2R2N A;  4RJ0 A;  3WGC A;  2FNU A;  1AIA A;  2CJH A;  1M0P A;  1CQ8 A;  1B5O A;  1ECX A;  3VP6 A;  3VAX A;  3NTJ A;  2EPJ A;  3MAD A;  3NYT A;  1WKH A;  1CZE A;  4AZJ A;  1BS0 A;  1YJZ A;  2QB3 A;  3BCB A;  1YOO A;  1M0N A;  2VMU A;  2ZY2 A;  2JJH A;  3MC6 C;  5DJ9 A;  3W1I A;  4A72 A;  3FD0 A;  2Z67 A;  2ZJG A;  3NDN A;  3B46 A;  3VK2 A;  3W1H A;  2JIS A;  5G09 A;  2ORD A;  1FG3 A;  5LH9 A;  3CQ4 A;  2W7J A;  4RLG A;  5M4B A;  1CL2 A;  1WYV A;  4JEV A;  3NUB A;  3GZC A;  1AKB A;  4R5F A;  1T3I A;  3MAF A;  4WYC A;  1M0Q A;  4ADB A;  1ASC A;  4TV7 A;  2CAN A;  1CL1 A;  2WK7 A;  3JWA A;  3ZRR A;  3BWN C;  3WKS A;  2EZ1 A;  2CST A;  3LWS A;  2BYL A;  1Z3Z A;  2AY6 A;  3F9T A;  3IHJ A;  3ZRP A;  1ELQ A;  1KMJ A;  1AHE A;  2YKU A;  1AMQ A;  3DU4 A;  3GZD A;  4E1O A;  4F4E A;  1AAW A;  1RVY A;  3EI5 A;  2VI8 A;  1UU1 A;  3WKR A;  2R0T A;  3FFR A;  1J04 A;  1G4X A;  2X5D A;  1IX7 A;  2VMP A;  1V72 A;  2YRI A;  4O6Z A;  3UE8 A;  4F5L A;  1YJS A;  1XEY A;  3RCH A;  2AY9 A;  2CTZ A;  2VMQ A;  1JF9 A;  4KYO A;  4ZAS A;  1AIB A;  5EQC A;  5G0A A;  4ATP A;  4FFC A;  3TFT A;  3JTX A;  3PPL A;  5E4Z A;  1FG7 A;  2OGE A;  1BQD A;  1TOG A;  3N75 A;  3QM2 A;  1O4S A;  3AOV A;  2FM1 A;  1ASD A;  4EU1 A;  4ZSW A;  2YCP A;  2X3L A;  1I43 A;  3CBF A;  3ISL A;  3LV2 A;  1MDO A;  2E7U A;  2ZP7 A;  5M4D A;  2BIE A;  1N31 A;  5DJ1 A;  5FT5 A;  4LNM A;  2VI9 A;  3HT4 A;  1AY8 A;  3RI6 A;  4ZWV A;  1E5F A;  3A8U X;  4MSO A;  2O0R A;  4BMK A;  4OC9 A;  1ASE A;  1W3U A;  4B9B A;  4Y0H A;  1DFO A;  4BA5 A;  4CVQ A;  1OHV A;  3UAK A;  4OT8 A;  4CBS A;  5EIG A;  2EO5 A;  2HOZ A;  3BS8 A;  4H51 A;  4OBV A;  4WYA A;  2VGV A;  3KGX A;  4OYT A;  1YIY A;  3NU7 A;  4ZAH A;  3QPG A;  4TN4 A;  3WCN A;  2C0R A;  4DBC A;  3EZ1 A;  3TAT A;  2W7E A;  3EI7 A;  3L8A A;  3I4J A;  3R4T A;  9AAT A;  1GBN A;  3DXW A;  5EUN A;  4J8L A;  2HUI A;  4A00 A;  4A0H A;  3QGU A;  2GSA A;  5K8B A;  1UKJ A;  4JEY A;  3TFU A;  1MDX A;  4GE4 A;  1YIZ A;  1SVV A;  4QGR A;  4F5G A;  1LC5 A;  2W7M A;  2PB2 A;  1M32 A;  5JAY A;  1WST A;  1SZU A;  2BHX A;  2Z9V A;  1E5E A;  1GDE A;  1QJ5 A;  3BCA A;  4EFF A;  1ZC9 A;  3EI6 A;  4OCA A;  3WCO A;  3ELP A;  3H14 A;  1M4N A;  2AAT A;  2BI3 A;  4WP0 A;  2E54 A;  2DGK A;  3VOM A;  2Z1Z A;  4K2M A;  3DZZ A;  2AY1 A;  4LW4 A;  2GB3 A;  1AJS A;  2VMR A;  3AEP A;  1AHF A;  4ADC A;  2GMU A;  4P3M A;  5AX8 A;  4XAU A;  2AY4 A;  4JE5 D;  4WB0 A;  2AY3 A;  4IXZ A;  1AX4 A;  3RBL A;  2QLR A;  3GJU A;  3PAA A;  1IX6 A;  2Z9X A;  3E2F A;  3TCM A;  1GC3 A;  3LVM A;  4UHO A;  2Z9U A;  4K2I A;  1EG5 A;  1TPL A;  3AV7 A;  3AAT A;  3NRA A;  1FC4 A;  4MQP A;  1GEY A;  2RFV A;  1AKA A;  3I5T A;  3PGY A;  3FQ8 A;  2DKB A;  2OQX A;  3FRK A;  3PA9 A;  4E77 A;  1CJ0 A;  1V2D A;  1G7X A;  4FL0 A;  4IY7 A;  4WBT A;  1X28 A;  1AY5 A;  4A0R A;  4E3Q A;  1W7M A;  3IF2 A;  1ELU A;  1B8G A;  3AEM A;  2NMP A;  2WK8 A;  3OP7 A;  4RIT A;  1IJI A;  1LC8 A;  1VJO A;  3A9Y A;  3B1C A;  3NNK A;  2W8J A;  4R8D A;  2HP2 A;  4F5F A;  1Y4I A;  1AIC A;  5EFS A;  2BWP A;  2BI2 A;  2ZY4 A;  1UU0 A;  3BCX A;  4M2J A;  2BKW A;  3LVK A;  1BJO B;  4RIZ A;  2W7K A;  1WYT B;  1S07 A;  2YKV A;  4U1T A;  1ASF A;  1DGE A;  1DJE A;  3CQ5 A;  4ITX A;  3B1E A;  2VGW A;  2YCT A;  3DR4 A;  3KE3 A;  3RQ1 A;  5HDM A;  3PDB B;  3USF A;  3ASA A;  2HZP A;  1ORD A;  1TOE A;  3E2Z A;  1C7G A;  5HXX A;  4TMR A;  4ZDL A;  3WZF A;  3A2B A;  4F5I A;  3EZS A;  3ZRQ A;  4Q75 A;  3T32 A;  2CH2 A;  1GCK A;  1OXO A;  3PIU A;  2D64 A;  2QB2 A;  4OBU A;  1J32 A;  3BWN A;  4JEX A;  5DX5 A;  3WX9 A;  1D7S A;  2ZSM A;  3EI8 A;  1DTY A;  2DGL A;  3L44 A;  4HVK A;  4ZLV A;  2GMS A;  3GET A;  3WLX A;  3JU7 A;  3K7Y A;  1MLY A;  1AY4 A;  3BC8 A;  3FZ6 A;  2D7Y A;  3FKD A;  3NYS A;  1GEW A;  5BJ4 A;  1TAR A;  1AMA A;  2JGT A;  1MLZ A;  4PFF A;  3BV0 A;  3I16 A;  3JW9 A;  3NX3 A;  4ADD A;  1C0N A;  1ASB A;  2OAT A;  4BA4 A;  1S08 A;  3CAI A;  4WXG A;  3MAF B;  4N0W A;  1RV3 A;  3ATH A;  1U08 A;  4W8I A;  5C6U A;  1TOI A;  4WYG A;  1I48 A;  3FVU A;  5F8V A;  1N8P A;  2V0Y A;  4MQQ A;  5G2Q A;  3GZD C;  1W23 A;  1ARH A;  1KKP A;  2PB0 A;  3FZ7 A;  1DGD A;  3JZL A;  4JF1 A;  1BT4 A;  2VMN A;  3EUC A;  3A9X A;  1WYU A;  3VK4 A;  1AMS A;  4BHD A;  3VK3 A;  5FT8 A;  3AEN B;  2D63 A;  2W7L A;  4IXO A;  2E7J A;  4AO4 A;  3RCH B;  3GBX A;  1W7L A;  5G2P A;  1M0O A;  3BWO A;  4RAE A;  4E3R A;  3E2Y A;  4XK1 A;  1KKJ A;  5IWQ A;  4W91 A;  2W7F A;  4MKJ A;  4XJL A;  1W7N A;  1YJY A;  3DYD A;  1B4X A;  1QIR A;  2D66 A;  3FZ8 A;  3PD6 A;  4F5K A;  2YOB A;  1BJ4 A;  1ASG A;  3HDO A;  2YKX A;  2G6W A;  4A6R A;  1I41 A;  3E6G A;  1Z7D A;  3LG0 A;  4WYF A;  3ASB A;  1BJN A;  3FCR A;  2O1B A;  2R5C A;  3DXV A;  1DKA A;  3DC1 A;  4DGT A;  2BIG A;  3NUI A;  1AAM A;  3GWP A;  4MKK A;  2VIA A;  1IAX A;  5F9S A;  5LHA A;  2JJG A;  1IBJ A;  3LVJ A;  5G4I A;  3TQX A;  4ISY A;  4BQ0 A;  4F5H A;  4ZDP A;  1AKC A;  1MAQ A;  3NYU A;  2W8T A;  5EIG B;  4WD2 A;  1VP4 A;  2BI1 A;  2OGA A;  2VLH A;  4EB7 A;  3BN1 A;  2VMZ A;  4CXR A;  1WKG A;  2X8U A;  4W5K A;  1X0M A;  4B98 A;  1H0C A;  2VGS A;  2ZUK A;  2CY8 A;  2HP1 A;  1LC7 A;  1TAS A;  4XEW A;  5FT4 A;  3FDD A;  3K28 A;  3GSB A;  4AH3 A;  4CXQ A;  3QBO A;  2VMV A;  3DOD A;  2QBT A;  2R5E A;  1H1C A;  1M7Y A;  2ZSL A;  5D5S A;  1V2F A;  1D7R A;  1MAP A;  4WLJ A;  4EMY A;  1C7O A;  1SZS A;  1TOK A;  3HBX A;  4AZK A;  2BWO A;  3HL2 A;  7AAT A;  4ZSY A;  3QN6 A;  5G4J A;  4OTL A;  2W8W A;  4GE9 A;  4GSA A;  2XBN A;  3AEJ C;  4IXS A;  1IAY A;  2C7T A;  2DGM A;  2VLF A;  5E5I A;  1KL1 A;  1LK9 A;  1OXP A;  1CZC A;  5DB5 A;  4IYO A;  1P3W A;  3FVX A;  5D95 A;  1AHX A;  3FDB A;  4IW7 A;  2VGT A;  1AJS B;  2WK9 A;  1S0A A;  2AY7 A;  3FFH A;  3AOW A;  2HOR A;  3G8M A;  1GEX A;  1SPA A;  1BKG A;  4W1W A;  2JG2 A;  3WY7 A;  4PIW A;  2W7G A;  5BJ3 A;  1C7N A;  1PMM A;  2O7C A;  3LVL B;  2CJG A;  4U2H A;  4A0F A;  4ADE A;  2GQN A;  3B8X A;  4WB0 B;  3E77 A;  3LY1 A;  1ASL A;  1ARI A;  2D5Y A;  3W1J A;  3MC6 A;  4Q76 A;  2VGU A;  3N5M A;  2AY8 A;  3F6T A;  4K2B A;  4KXK A;  8AAT A;  1EQB A;  1V2E A;  5EUD A;  2XH1 A;  4Y0I A;  4RKC A;  4ZM3 A;  3FSL A;  3P1T A;  4PFN A;  1D7V A;  2FQ6 A;  3AEM C;  4A6U A;  1BW0 A;  3UWC A;  2DR1 A;  2DOU A;  4M2K A;  4UHN A;  1S06 A;  3ELE A;  2EZ2 A;  4N0B A;  3GR9 A;  3PDX A;  3CQ6 A;  1ASA A;  1QJ3 A;  3FQA A;  3MBB A;  3NU8 A;  1C4K A;  1YNU A;  2JJE A;  3AEL A;  2AY5 A;  2YCN A;  4MGR A;  4HF8 A;  3H7F A;  3QI6 A;  3AEO A;  1BJW A;  4M2M A;  2BYJ A;  4WLH A;  1LW4 A;  2ZY5 A;  1G4V A;  1QIS A;  1UU2 A;  4R2N A;  4CBR A;  1BQA A;  4AO9 A;  3MKJ A;  1DJU A;  1WYV B;  5EUE A;  1OHW A;  3BB8 A;  3E2Z B;  4JEZ A;  2D65 A;  4AOA A;  3HVY A;  2PO3 A;  2TPL A;  4KAM A;  2E7I A;  2YRR A;  1LS3 A;  3E9K A;  2VMW A;  1IVR A;  2OKJ A;  1M6S A;  1X29 A;  2ZC0 A;  3QHX A;  5TF5 A;  3R9A A;  2DKJ A;  3RUY A;  2VMT A;  1IUG A;  1GC2 A;  1S09 A;  4LNJ A;  1TOJ A;  1YAA A;  5EAV A;  4ZDO A;  3HQT A;  3AEN A;  3HLM A;  2C44 A;  4ITG A;  2VYC A;  2VMO A;  1AHG A;  1O69 A;  2X5F A;  3ZZK A;  4F5J A;  3DR7 A;  2CIN A;  4RKD A;  4Q31 A;  1QGN A;  1IX8 A;  1QIT A;  1SZK A;  2AEU A;  2JJF A;  4P7Y A; 
#chains in the Genus database with same CATH topology
 1B9H A;  1D7U A;  5M46 A;  1VEF A;  2EH6 A;  1C9C A;  1RV4 A;  4GE7 A;  5HHY A;  1PMO A;  3OKS A;  1AHY A;  3B1D A;  1TAT A;  2FYF A;  2CB1 A;  4J5U A;  4L0O A;  1N2T A;  4WXF A;  4Y0D A;  2D61 A;  2W7I A;  1QZ9 A;  1PFF A;  2CH1 A;  2QA3 A;  1WYU B;  1MGV A;  1DJ9 A;  1GC0 A;  4Q6R A;  1EJI A;  2F8J A;  3MAU A;  3D6K A;  4WYD A;  5M49 A;  2Z20 A;  5EAA A;  3ZZJ A;  5E3K A;  1B9I A;  1SF2 A;  4R5Z A;  3FVS A;  4ZM4 A;  1X2A A;  4MY5 A;  1GD9 A;  5I92 A;  4LC3 A;  2QMA A;  2FN6 A;  4JF0 A;  3HMU A;  1JS3 A;  3FTB A;  2C81 A;  3PD6 B;  1B5P A;  3EI9 A;  2VMS A;  4GEB A;  3K40 A;  4LNL A;  3WGB A;  1CQ7 A;  2ZYJ A;  2VMY A;  3ECD A;  4A0G A;  4EB5 A;  4MQR A;  2W8V A;  3EIB A;  3JWB A;  4XJO A;  2R5C B;  4W1V A;  2BI5 A;  2CJD A;  3RBF A;  2AEV A;  3DRD A;  1KAF A;  1JG8 A;  1OHY A;  1PG8 A;  2W7D A;  2Z9W A;  4UQV A;  4XJP A;  2W8U A;  2Z1Y A;  2HUU A;  4GRX A;  2YHK A;  1MDZ A;  3FQ7 A;  5J8Q A;  4GDY A;  3M5U A;  2ZY3 A;  3PJ0 A;  1CQ6 A;  4A6T A;  1G7W A;  4RJY A;  1ASM A;  4NOG A;  1CS1 A;  2HOY A;  3MEB A;  3P6K A;  3Q8N A;  1ASN A;  4JEW A;  2VGZ A;  2VIB A;  4UHM A;  2CFB A;  3KGW A;  4UOY A;  4ZWM A;  3AEJ A;  1RVU A;  1AMR A;  3EIA A;  3II0 A;  1O62 A;  4W1X A;  2AY2 A;  4WXB A;  2V1P A;  4DQ6 A;  2EGY A;  3G7Q A;  3COG A;  2HUF A;  1KL2 A;  2HOX A;  4OMA A;  1XI9 A;  2BIA A;  3A9Z A;  3F0H A;  4WYE A;  1O61 A;  1GC4 A;  4PVF A;  4IX8 A;  5FT6 A;  2BWN A;  1ARG A;  1ZOB A;  1JS6 A;  1KMK A;  4ATQ A;  4XQ2 A;  1OAT A;  1ART A;  3KKI A;  2VMX A;  2A1V A;  1D2F A;  1LW5 A;  1SFF A;  4LW2 A;  4F5M A;  2Q7W A;  1I29 A;  2W7H A;  2YKY A;  2Z61 A;  4RM1 A;  1BJO A;  1ZOD A;  4JE5 A;  4I8A A;  1ARS A;  1WYT A;  3ACZ A;  2FNI A;  4XJM A;  3G0T A;  4IYO B;  1AJR A;  2WKA A;  2OKK A;  2BI9 A;  3N0L A;  3PDB A;  1LKC A;  2D7Z A;  2R2N A;  4RJ0 A;  3WGC A;  2FNU A;  1AIA A;  2CJH A;  1M0P A;  1CQ8 A;  1B5O A;  1ECX A;  3VP6 A;  3VAX A;  3NTJ A;  2EPJ A;  3MAD A;  3NYT A;  1WKH A;  1CZE A;  4AZJ A;  1BS0 A;  1YJZ A;  2QB3 A;  3BCB A;  1YOO A;  1M0N A;  2VMU A;  2ZY2 A;  2JJH A;  3MC6 C;  5DJ9 A;  3W1I A;  4A72 A;  3FD0 A;  2Z67 A;  2ZJG A;  3NDN A;  3B46 A;  3VK2 A;  3W1H A;  2JIS A;  5G09 A;  2ORD A;  1FG3 A;  5LH9 A;  3CQ4 A;  2W7J A;  4RLG A;  5M4B A;  1CL2 A;  1WYV A;  4JEV A;  3NUB A;  3GZC A;  1AKB A;  4R5F A;  1T3I A;  3MAF A;  4WYC A;  1M0Q A;  4ADB A;  1ASC A;  4TV7 A;  2CAN A;  1CL1 A;  2WK7 A;  3JWA A;  3ZRR A;  3BWN C;  3WKS A;  2EZ1 A;  2CST A;  3LWS A;  2BYL A;  1Z3Z A;  2AY6 A;  3F9T A;  3IHJ A;  3ZRP A;  1ELQ A;  1KMJ A;  1AHE A;  2YKU A;  1AMQ A;  3DU4 A;  3GZD A;  4E1O A;  4F4E A;  1AAW A;  1RVY A;  3EI5 A;  2VI8 A;  1UU1 A;  3WKR A;  2R0T A;  3FFR A;  1J04 A;  1G4X A;  2X5D A;  1IX7 A;  2VMP A;  1V72 A;  2YRI A;  4O6Z A;  3UE8 A;  4F5L A;  1YJS A;  1XEY A;  3RCH A;  2AY9 A;  2CTZ A;  2VMQ A;  1JF9 A;  4KYO A;  4ZAS A;  1AIB A;  5EQC A;  5G0A A;  4ATP A;  4FFC A;  3TFT A;  3JTX A;  3PPL A;  5E4Z A;  1FG7 A;  2OGE A;  1BQD A;  1TOG A;  3N75 A;  4K05 A;  3QM2 A;  1O4S A;  3AOV A;  2FM1 A;  1ASD A;  4EU1 A;  4ZSW A;  2YCP A;  2X3L A;  1I43 A;  3CBF A;  3ISL A;  3LV2 A;  1MDO A;  2E7U A;  2ZP7 A;  5M4D A;  2BIE A;  3N4R A;  1N31 A;  5DJ1 A;  5FT5 A;  4LNM A;  2VI9 A;  3HT4 A;  1AY8 A;  3RI6 A;  4ZWV A;  1E5F A;  3A8U X;  4MSO A;  2O0R A;  4BMK A;  4OC9 A;  1ASE A;  1W3U A;  4B9B A;  4Y0H A;  1DFO A;  4BA5 A;  4CVQ A;  1OHV A;  3UAK A;  4OT8 A;  4CBS A;  5EIG A;  2EO5 A;  2HOZ A;  3BS8 A;  4H51 A;  4OBV A;  4WYA A;  2VGV A;  3KGX A;  4OYT A;  1YIY A;  3NU7 A;  4ZAH A;  3QPG A;  4TN4 A;  3WCN A;  2C0R A;  4DBC A;  3EZ1 A;  3TAT A;  2W7E A;  3EI7 A;  3L8A A;  3I4J A;  3R4T A;  9AAT A;  5KTB A;  1GBN A;  3DXW A;  5EUN A;  4J8L A;  2HUI A;  4A00 A;  4A0H A;  3QGU A;  2GSA A;  5K8B A;  1UKJ A;  4JEY A;  3TFU A;  1MDX A;  4GE4 A;  1YIZ A;  1SVV A;  4QGR A;  4F5G A;  1LC5 A;  2W7M A;  2PB2 A;  1M32 A;  5JAY A;  1WST A;  1SZU A;  2BHX A;  2Z9V A;  1E5E A;  1GDE A;  1QJ5 A;  3BCA A;  4EFF A;  1ZC9 A;  3EI6 A;  4OCA A;  3WCO A;  3ELP A;  3H14 A;  1M4N A;  2AAT A;  2BI3 A;  4WP0 A;  2E54 A;  2DGK A;  3VOM A;  2Z1Z A;  4K2M A;  3DZZ A;  2AY1 A;  4LW4 A;  2GB3 A;  1AJS A;  2VMR A;  3AEP A;  1AHF A;  4ADC A;  2GMU A;  4P3M A;  5AX8 A;  4XAU A;  2AY4 A;  4JE5 D;  4WB0 A;  2AY3 A;  4IXZ A;  1AX4 A;  3RBL A;  2QLR A;  3GJU A;  3PAA A;  1IX6 A;  2Z9X A;  3E2F A;  3TCM A;  1GC3 A;  3LVM A;  4UHO A;  2Z9U A;  4K2I A;  1EG5 A;  1TPL A;  3AV7 A;  3AAT A;  3NRA A;  1FC4 A;  4MQP A;  1GEY A;  2RFV A;  1AKA A;  3I5T A;  3PGY A;  3FQ8 A;  2DKB A;  2OQX A;  3FRK A;  3PA9 A;  4E77 A;  1CJ0 A;  1V2D A;  1G7X A;  4FL0 A;  4IY7 A;  4WBT A;  1X28 A;  1AY5 A;  4A0R A;  4E3Q A;  1W7M A;  3IF2 A;  1ELU A;  1B8G A;  3AEM A;  2NMP A;  2WK8 A;  3OP7 A;  4RIT A;  1IJI A;  1LC8 A;  1VJO A;  3A9Y A;  3B1C A;  3NNK A;  2W8J A;  4R8D A;  2HP2 A;  4F5F A;  1Y4I A;  1AIC A;  5EFS A;  2BWP A;  2BI2 A;  2ZY4 A;  1UU0 A;  3BCX A;  4M2J A;  2BKW A;  3LVK A;  1BJO B;  4RIZ A;  2W7K A;  1WYT B;  1S07 A;  2YKV A;  4U1T A;  1ASF A;  1DGE A;  3N4S A;  1DJE A;  3CQ5 A;  4ITX A;  3B1E A;  2VGW A;  2YCT A;  3DR4 A;  3KE3 A;  3RQ1 A;  5HDM A;  3PDB B;  3USF A;  3ASA A;  2HZP A;  1ORD A;  1TOE A;  3E2Z A;  1C7G A;  5HXX A;  4TMR A;  4ZDL A;  3WZF A;  3A2B A;  4F5I A;  3EZS A;  3ZRQ A;  4Q75 A;  3T32 A;  2CH2 A;  1GCK A;  1OXO A;  3PIU A;  2D64 A;  2QB2 A;  4OBU A;  1J32 A;  3BWN A;  4JEX A;  5DX5 A;  3WX9 A;  1D7S A;  2ZSM A;  3EI8 A;  1DTY A;  2DGL A;  3L44 A;  4HVK A;  4ZLV A;  2GMS A;  3GET A;  3WLX A;  3JU7 A;  3K7Y A;  1MLY A;  1AY4 A;  3BC8 A;  3FZ6 A;  2D7Y A;  3FKD A;  3NYS A;  1GEW A;  5BJ4 A;  1TAR A;  1AMA A;  2JGT A;  1MLZ A;  4PFF A;  3BV0 A;  3I16 A;  3JW9 A;  3NX3 A;  2G7J A;  4ADD A;  1C0N A;  1ASB A;  2OAT A;  4BA4 A;  1S08 A;  3CAI A;  4WXG A;  3MAF B;  4N0W A;  1RV3 A;  3ATH A;  1U08 A;  4W8I A;  5C6U A;  1TOI A;  4WYG A;  1I48 A;  3FVU A;  5F8V A;  1N8P A;  2V0Y A;  4MQQ A;  5G2Q A;  3GZD C;  1W23 A;  1ARH A;  1KKP A;  2PB0 A;  3FZ7 A;  1DGD A;  3JZL A;  4JF1 A;  1BT4 A;  2VMN A;  3EUC A;  3N4X A;  3A9X A;  1WYU A;  3VK4 A;  1AMS A;  4BHD A;  3VK3 A;  5FT8 A;  3AEN B;  2D63 A;  2W7L A;  4IXO A;  2E7J A;  4AO4 A;  3RCH B;  3GBX A;  1W7L A;  5G2P A;  1M0O A;  3BWO A;  4RAE A;  4E3R A;  3E2Y A;  4XK1 A;  1KKJ A;  5IWQ A;  4W91 A;  2W7F A;  4MKJ A;  4XJL A;  1W7N A;  1YJY A;  3DYD A;  1B4X A;  1QIR A;  2D66 A;  3FZ8 A;  3PD6 A;  4F5K A;  2YOB A;  1BJ4 A;  1ASG A;  3HDO A;  2YKX A;  2G6W A;  4A6R A;  1I41 A;  3E6G A;  1Z7D A;  3LG0 A;  4WYF A;  3ASB A;  1BJN A;  3FCR A;  2O1B A;  2R5C A;  3DXV A;  1DKA A;  3DC1 A;  4DGT A;  2BIG A;  3NUI A;  1AAM A;  3GWP A;  4MKK A;  2VIA A;  1IAX A;  5F9S A;  5LHA A;  2JJG A;  1IBJ A;  3LVJ A;  5G4I A;  3TQX A;  4ISY A;  4BQ0 A;  4F5H A;  4ZDP A;  1AKC A;  1MAQ A;  3NYU A;  2W8T A;  5EIG B;  4WD2 A;  1VP4 A;  2BI1 A;  2OGA A;  2QSR A;  2WB6 A;  2VLH A;  4EB7 A;  3BN1 A;  2VMZ A;  4CXR A;  1WKG A;  2X8U A;  4W5K A;  1X0M A;  4B98 A;  1H0C A;  2VGS A;  2ZUK A;  2CY8 A;  2HP1 A;  1LC7 A;  1TAS A;  4XEW A;  5FT4 A;  3FDD A;  3K28 A;  3GSB A;  4AH3 A;  4CXQ A;  3QBO A;  2VMV A;  3DOD A;  2QBT A;  2R5E A;  1H1C A;  1M7Y A;  2ZSL A;  5D5S A;  1V2F A;  1D7R A;  1MAP A;  4WLJ A;  4EMY A;  1C7O A;  1SZS A;  1TOK A;  3HBX A;  4AZK A;  2BWO A;  3HL2 A;  7AAT A;  4ZSY A;  3QN6 A;  5G4J A;  4OTL A;  2W8W A;  4GE9 A;  4GSA A;  2XBN A;  3AEJ C;  4IXS A;  1IAY A;  2C7T A;  2DGM A;  2VLF A;  5E5I A;  1KL1 A;  1LK9 A;  3H9X A;  1OXP A;  1CZC A;  5DB5 A;  4IYO A;  1P3W A;  3FVX A;  5D95 A;  1AHX A;  3FDB A;  4IW7 A;  2VGT A;  1AJS B;  2WK9 A;  1S0A A;  2AY7 A;  3FFH A;  3AOW A;  2HOR A;  3G8M A;  1GEX A;  1SPA A;  1BKG A;  4W1W A;  2JG2 A;  3WY7 A;  4PIW A;  2W7G A;  5BJ3 A;  1C7N A;  1PMM A;  2O7C A;  3LVL B;  2CJG A;  4U2H A;  4A0F A;  4ADE A;  2GQN A;  3B8X A;  4WB0 B;  3E77 A;  3LY1 A;  1ASL A;  1ARI A;  2D5Y A;  3W1J A;  3MC6 A;  4Q76 A;  2VGU A;  3N5M A;  2AY8 A;  3F6T A;  4K2B A;  4KXK A;  8AAT A;  1EQB A;  1V2E A;  5EUD A;  2XH1 A;  4Y0I A;  2FKI A;  4RKC A;  4ZM3 A;  3FSL A;  3P1T A;  4PFN A;  1D7V A;  2FQ6 A;  3AEM C;  4A6U A;  1BW0 A;  3UWC A;  2DR1 A;  2DOU A;  4M2K A;  4UHN A;  1S06 A;  3ELE A;  2EZ2 A;  4N0B A;  3GR9 A;  3PDX A;  3CQ6 A;  1ASA A;  1QJ3 A;  3FQA A;  3MBB A;  3NU8 A;  1C4K A;  1YNU A;  2JJE A;  3AEL A;  2AY5 A;  2YCN A;  4MGR A;  4HF8 A;  3H7F A;  3QI6 A;  3AEO A;  1BJW A;  4M2M A;  2BYJ A;  4WLH A;  1LW4 A;  2ZY5 A;  2EYQ A;  1G4V A;  1QIS A;  1UU2 A;  4R2N A;  4CBR A;  1BQA A;  4AO9 A;  3MKJ A;  1DJU A;  1WYV B;  5EUE A;  1OHW A;  3BB8 A;  3E2Z B;  4JEZ A;  2D65 A;  4AOA A;  3HVY A;  2PO3 A;  2TPL A;  4KAM A;  2E7I A;  2YRR A;  1LS3 A;  3E9K A;  2VMW A;  1IVR A;  2OKJ A;  1M6S A;  1X29 A;  2ZC0 A;  3QHX A;  5TF5 A;  3R9A A;  2DKJ A;  3RUY A;  2VMT A;  1IUG A;  1GC2 A;  1S09 A;  4LNJ A;  1TOJ A;  1YAA A;  5EAV A;  4ZDO A;  3N7N A;  3HQT A;  3AEN A;  3HLM A;  2C44 A;  4ITG A;  2VYC A;  2VMO A;  1AHG A;  1O69 A;  2X5F A;  3ZZK A;  4F5J A;  3DR7 A;  4H63 Q;  2CIN A;  4RKD A;  2KFP A;  4Q31 A;  1QGN A;  1IX8 A;  1QIT A;  1SZK A;  2AEU A;  2JJF A;  4P7Y A; 
#chains in the Genus database with same CATH homology
 1B9H A;  1D7U A;  5M46 A;  1VEF A;  2EH6 A;  1C9C A;  1RV4 A;  4GE7 A;  5HHY A;  1PMO A;  3OKS A;  1AHY A;  3B1D A;  1TAT A;  2FYF A;  2CB1 A;  4J5U A;  4L0O A;  1N2T A;  4WXF A;  4Y0D A;  2D61 A;  2W7I A;  1QZ9 A;  1PFF A;  2CH1 A;  2QA3 A;  1WYU B;  1MGV A;  1DJ9 A;  1GC0 A;  4Q6R A;  1EJI A;  2F8J A;  3MAU A;  3D6K A;  4WYD A;  5M49 A;  2Z20 A;  5EAA A;  3ZZJ A;  5E3K A;  1B9I A;  1SF2 A;  4R5Z A;  3FVS A;  4ZM4 A;  1X2A A;  4MY5 A;  1GD9 A;  5I92 A;  4LC3 A;  2QMA A;  2FN6 A;  4JF0 A;  3HMU A;  1JS3 A;  3FTB A;  2C81 A;  3PD6 B;  1B5P A;  3EI9 A;  2VMS A;  4GEB A;  3K40 A;  4LNL A;  3WGB A;  1CQ7 A;  2ZYJ A;  2VMY A;  3ECD A;  4A0G A;  4EB5 A;  4MQR A;  2W8V A;  3EIB A;  3JWB A;  4XJO A;  2R5C B;  4W1V A;  2BI5 A;  2CJD A;  3RBF A;  2AEV A;  3DRD A;  1JG8 A;  1OHY A;  1PG8 A;  2W7D A;  2Z9W A;  4UQV A;  4XJP A;  2W8U A;  2Z1Y A;  2HUU A;  4GRX A;  2YHK A;  1MDZ A;  3FQ7 A;  5J8Q A;  4GDY A;  3M5U A;  2ZY3 A;  3PJ0 A;  1CQ6 A;  4A6T A;  1G7W A;  4RJY A;  1ASM A;  4NOG A;  1CS1 A;  2HOY A;  3MEB A;  3P6K A;  3Q8N A;  1ASN A;  4JEW A;  2VGZ A;  2VIB A;  4UHM A;  2CFB A;  3KGW A;  4UOY A;  4ZWM A;  3AEJ A;  1RVU A;  1AMR A;  3EIA A;  3II0 A;  1O62 A;  4W1X A;  2AY2 A;  4WXB A;  2V1P A;  4DQ6 A;  2EGY A;  3G7Q A;  3COG A;  2HUF A;  1KL2 A;  2HOX A;  4OMA A;  1XI9 A;  2BIA A;  3A9Z A;  3F0H A;  4WYE A;  1O61 A;  1GC4 A;  4PVF A;  4IX8 A;  5FT6 A;  2BWN A;  1ARG A;  1ZOB A;  1JS6 A;  1KMK A;  4ATQ A;  4XQ2 A;  1OAT A;  1ART A;  3KKI A;  2VMX A;  2A1V A;  1D2F A;  1LW5 A;  1SFF A;  4LW2 A;  4F5M A;  2Q7W A;  1I29 A;  2W7H A;  2YKY A;  2Z61 A;  4RM1 A;  1BJO A;  1ZOD A;  4JE5 A;  4I8A A;  1ARS A;  1WYT A;  3ACZ A;  2FNI A;  4XJM A;  3G0T A;  4IYO B;  1AJR A;  2WKA A;  2OKK A;  2BI9 A;  3N0L A;  3PDB A;  1LKC A;  2D7Z A;  2R2N A;  4RJ0 A;  3WGC A;  2FNU A;  1AIA A;  2CJH A;  1M0P A;  1CQ8 A;  1B5O A;  1ECX A;  3VP6 A;  3VAX A;  3NTJ A;  2EPJ A;  3MAD A;  3NYT A;  1WKH A;  1CZE A;  4AZJ A;  1BS0 A;  1YJZ A;  2QB3 A;  3BCB A;  1YOO A;  1M0N A;  2VMU A;  2ZY2 A;  2JJH A;  3MC6 C;  5DJ9 A;  3W1I A;  4A72 A;  3FD0 A;  2Z67 A;  2ZJG A;  3NDN A;  3B46 A;  3VK2 A;  3W1H A;  2JIS A;  5G09 A;  2ORD A;  1FG3 A;  5LH9 A;  3CQ4 A;  2W7J A;  4RLG A;  5M4B A;  1CL2 A;  1WYV A;  4JEV A;  3NUB A;  3GZC A;  1AKB A;  4R5F A;  1T3I A;  3MAF A;  4WYC A;  1M0Q A;  4ADB A;  1ASC A;  4TV7 A;  2CAN A;  1CL1 A;  2WK7 A;  3JWA A;  3ZRR A;  3BWN C;  3WKS A;  2EZ1 A;  2CST A;  3LWS A;  2BYL A;  1Z3Z A;  2AY6 A;  3F9T A;  3IHJ A;  3ZRP A;  1ELQ A;  1KMJ A;  1AHE A;  2YKU A;  1AMQ A;  3DU4 A;  3GZD A;  4E1O A;  4F4E A;  1AAW A;  1RVY A;  3EI5 A;  2VI8 A;  1UU1 A;  3WKR A;  2R0T A;  3FFR A;  1J04 A;  1G4X A;  2X5D A;  1IX7 A;  2VMP A;  1V72 A;  2YRI A;  4O6Z A;  3UE8 A;  4F5L A;  1YJS A;  1XEY A;  3RCH A;  2AY9 A;  2CTZ A;  2VMQ A;  1JF9 A;  4KYO A;  4ZAS A;  1AIB A;  5EQC A;  5G0A A;  4ATP A;  4FFC A;  3TFT A;  3JTX A;  3PPL A;  5E4Z A;  1FG7 A;  2OGE A;  1BQD A;  1TOG A;  3N75 A;  4K05 A;  3QM2 A;  1O4S A;  3AOV A;  2FM1 A;  1ASD A;  4EU1 A;  4ZSW A;  2YCP A;  2X3L A;  1I43 A;  3CBF A;  3ISL A;  3LV2 A;  1MDO A;  2E7U A;  2ZP7 A;  5M4D A;  2BIE A;  3N4R A;  1N31 A;  5DJ1 A;  5FT5 A;  4LNM A;  2VI9 A;  3HT4 A;  1AY8 A;  3RI6 A;  4ZWV A;  1E5F A;  3A8U X;  4MSO A;  2O0R A;  4BMK A;  4OC9 A;  1ASE A;  1W3U A;  4B9B A;  4Y0H A;  1DFO A;  4BA5 A;  4CVQ A;  1OHV A;  3UAK A;  4OT8 A;  4CBS A;  5EIG A;  2EO5 A;  2HOZ A;  3BS8 A;  4H51 A;  4OBV A;  4WYA A;  2VGV A;  3KGX A;  4OYT A;  1YIY A;  3NU7 A;  4ZAH A;  3QPG A;  4TN4 A;  3WCN A;  2C0R A;  4DBC A;  3EZ1 A;  3TAT A;  2W7E A;  3EI7 A;  3L8A A;  3I4J A;  3R4T A;  9AAT A;  5KTB A;  1GBN A;  3DXW A;  5EUN A;  4J8L A;  2HUI A;  4A00 A;  4A0H A;  3QGU A;  2GSA A;  5K8B A;  1UKJ A;  4JEY A;  3TFU A;  1MDX A;  4GE4 A;  1YIZ A;  1SVV A;  4QGR A;  4F5G A;  1LC5 A;  2W7M A;  2PB2 A;  1M32 A;  5JAY A;  1WST A;  1SZU A;  2BHX A;  2Z9V A;  1E5E A;  1GDE A;  1QJ5 A;  3BCA A;  4EFF A;  1ZC9 A;  3EI6 A;  4OCA A;  3WCO A;  3ELP A;  3H14 A;  1M4N A;  2AAT A;  2BI3 A;  4WP0 A;  2E54 A;  2DGK A;  3VOM A;  2Z1Z A;  4K2M A;  3DZZ A;  2AY1 A;  4LW4 A;  2GB3 A;  1AJS A;  2VMR A;  3AEP A;  1AHF A;  4ADC A;  2GMU A;  4P3M A;  5AX8 A;  4XAU A;  2AY4 A;  4JE5 D;  4WB0 A;  2AY3 A;  4IXZ A;  1AX4 A;  3RBL A;  2QLR A;  3GJU A;  3PAA A;  1IX6 A;  2Z9X A;  3E2F A;  3TCM A;  1GC3 A;  3LVM A;  4UHO A;  2Z9U A;  4K2I A;  1EG5 A;  1TPL A;  3AV7 A;  3AAT A;  3NRA A;  1FC4 A;  4MQP A;  1GEY A;  2RFV A;  1AKA A;  3I5T A;  3PGY A;  3FQ8 A;  2DKB A;  2OQX A;  3FRK A;  3PA9 A;  4E77 A;  1CJ0 A;  1V2D A;  1G7X A;  4FL0 A;  4IY7 A;  4WBT A;  1X28 A;  1AY5 A;  4A0R A;  4E3Q A;  1W7M A;  3IF2 A;  1ELU A;  1B8G A;  3AEM A;  2NMP A;  2WK8 A;  3OP7 A;  4RIT A;  1IJI A;  1LC8 A;  1VJO A;  3A9Y A;  3B1C A;  3NNK A;  2W8J A;  4R8D A;  2HP2 A;  4F5F A;  1Y4I A;  1AIC A;  5EFS A;  2BWP A;  2BI2 A;  2ZY4 A;  1UU0 A;  3BCX A;  4M2J A;  2BKW A;  3LVK A;  1BJO B;  4RIZ A;  2W7K A;  1WYT B;  1S07 A;  2YKV A;  4U1T A;  1ASF A;  1DGE A;  3N4S A;  1DJE A;  3CQ5 A;  4ITX A;  3B1E A;  2VGW A;  2YCT A;  3DR4 A;  3KE3 A;  3RQ1 A;  5HDM A;  3PDB B;  3USF A;  3ASA A;  2HZP A;  1ORD A;  1TOE A;  3E2Z A;  1C7G A;  5HXX A;  4TMR A;  4ZDL A;  3WZF A;  3A2B A;  4F5I A;  3EZS A;  3ZRQ A;  4Q75 A;  3T32 A;  2CH2 A;  1GCK A;  1OXO A;  3PIU A;  2D64 A;  2QB2 A;  4OBU A;  1J32 A;  3BWN A;  4JEX A;  5DX5 A;  3WX9 A;  1D7S A;  2ZSM A;  3EI8 A;  1DTY A;  2DGL A;  3L44 A;  4HVK A;  4ZLV A;  2GMS A;  3GET A;  3WLX A;  3JU7 A;  3K7Y A;  1MLY A;  1AY4 A;  3BC8 A;  3FZ6 A;  2D7Y A;  3FKD A;  3NYS A;  1GEW A;  5BJ4 A;  1TAR A;  1AMA A;  2JGT A;  1MLZ A;  4PFF A;  3BV0 A;  3I16 A;  3JW9 A;  3NX3 A;  2G7J A;  4ADD A;  1C0N A;  1ASB A;  2OAT A;  4BA4 A;  1S08 A;  3CAI A;  4WXG A;  3MAF B;  4N0W A;  1RV3 A;  3ATH A;  1U08 A;  4W8I A;  5C6U A;  1TOI A;  4WYG A;  1I48 A;  3FVU A;  5F8V A;  1N8P A;  2V0Y A;  4MQQ A;  5G2Q A;  3GZD C;  1W23 A;  1ARH A;  1KKP A;  2PB0 A;  3FZ7 A;  1DGD A;  3JZL A;  4JF1 A;  1BT4 A;  2VMN A;  3EUC A;  3N4X A;  3A9X A;  1WYU A;  3VK4 A;  1AMS A;  4BHD A;  3VK3 A;  5FT8 A;  3AEN B;  2D63 A;  2W7L A;  4IXO A;  2E7J A;  4AO4 A;  3RCH B;  3GBX A;  1W7L A;  5G2P A;  1M0O A;  3BWO A;  4RAE A;  4E3R A;  3E2Y A;  4XK1 A;  1KKJ A;  5IWQ A;  4W91 A;  2W7F A;  4MKJ A;  4XJL A;  1W7N A;  1YJY A;  3DYD A;  1B4X A;  1QIR A;  2D66 A;  3FZ8 A;  3PD6 A;  4F5K A;  2YOB A;  1BJ4 A;  1ASG A;  3HDO A;  2YKX A;  2G6W A;  4A6R A;  1I41 A;  3E6G A;  1Z7D A;  3LG0 A;  4WYF A;  3ASB A;  1BJN A;  3FCR A;  2O1B A;  2R5C A;  3DXV A;  1DKA A;  3DC1 A;  4DGT A;  2BIG A;  3NUI A;  1AAM A;  3GWP A;  4MKK A;  2VIA A;  1IAX A;  5F9S A;  5LHA A;  2JJG A;  1IBJ A;  3LVJ A;  5G4I A;  3TQX A;  4ISY A;  4BQ0 A;  4F5H A;  4ZDP A;  1AKC A;  1MAQ A;  3NYU A;  2W8T A;  5EIG B;  4WD2 A;  1VP4 A;  2BI1 A;  2OGA A;  2QSR A;  2WB6 A;  2VLH A;  4EB7 A;  3BN1 A;  2VMZ A;  4CXR A;  1WKG A;  2X8U A;  4W5K A;  1X0M A;  4B98 A;  1H0C A;  2VGS A;  2ZUK A;  2CY8 A;  2HP1 A;  1LC7 A;  1TAS A;  4XEW A;  5FT4 A;  3FDD A;  3K28 A;  3GSB A;  4AH3 A;  4CXQ A;  3QBO A;  2VMV A;  3DOD A;  2QBT A;  2R5E A;  1H1C A;  1M7Y A;  2ZSL A;  5D5S A;  1V2F A;  1D7R A;  1MAP A;  4WLJ A;  4EMY A;  1C7O A;  1SZS A;  1TOK A;  3HBX A;  4AZK A;  2BWO A;  3HL2 A;  7AAT A;  4ZSY A;  3QN6 A;  5G4J A;  4OTL A;  2W8W A;  4GE9 A;  4GSA A;  2XBN A;  3AEJ C;  4IXS A;  1IAY A;  2C7T A;  2DGM A;  2VLF A;  5E5I A;  1KL1 A;  1LK9 A;  3H9X A;  1OXP A;  1CZC A;  5DB5 A;  4IYO A;  1P3W A;  3FVX A;  5D95 A;  1AHX A;  3FDB A;  4IW7 A;  2VGT A;  1AJS B;  2WK9 A;  1S0A A;  2AY7 A;  3FFH A;  3AOW A;  2HOR A;  3G8M A;  1GEX A;  1SPA A;  1BKG A;  4W1W A;  2JG2 A;  3WY7 A;  4PIW A;  2W7G A;  5BJ3 A;  1C7N A;  1PMM A;  2O7C A;  3LVL B;  2CJG A;  4U2H A;  4A0F A;  4ADE A;  2GQN A;  3B8X A;  4WB0 B;  3E77 A;  3LY1 A;  1ASL A;  1ARI A;  2D5Y A;  3W1J A;  3MC6 A;  4Q76 A;  2VGU A;  3N5M A;  2AY8 A;  3F6T A;  4K2B A;  4KXK A;  8AAT A;  1EQB A;  1V2E A;  5EUD A;  2XH1 A;  4Y0I A;  2FKI A;  4RKC A;  4ZM3 A;  3FSL A;  3P1T A;  4PFN A;  1D7V A;  2FQ6 A;  3AEM C;  4A6U A;  1BW0 A;  3UWC A;  2DR1 A;  2DOU A;  4M2K A;  4UHN A;  1S06 A;  3ELE A;  2EZ2 A;  4N0B A;  3GR9 A;  3PDX A;  3CQ6 A;  1ASA A;  1QJ3 A;  3FQA A;  3MBB A;  3NU8 A;  1C4K A;  1YNU A;  2JJE A;  3AEL A;  2AY5 A;  2YCN A;  4MGR A;  4HF8 A;  3H7F A;  3QI6 A;  3AEO A;  1BJW A;  4M2M A;  2BYJ A;  4WLH A;  1LW4 A;  2ZY5 A;  2EYQ A;  1G4V A;  1QIS A;  1UU2 A;  4R2N A;  4CBR A;  1BQA A;  4AO9 A;  3MKJ A;  1DJU A;  1WYV B;  5EUE A;  1OHW A;  3BB8 A;  3E2Z B;  4JEZ A;  2D65 A;  4AOA A;  3HVY A;  2PO3 A;  2TPL A;  4KAM A;  2E7I A;  2YRR A;  1LS3 A;  3E9K A;  2VMW A;  1IVR A;  2OKJ A;  1M6S A;  1X29 A;  2ZC0 A;  3QHX A;  5TF5 A;  3R9A A;  2DKJ A;  3RUY A;  2VMT A;  1IUG A;  1GC2 A;  1S09 A;  4LNJ A;  1TOJ A;  1YAA A;  5EAV A;  4ZDO A;  3N7N A;  3HQT A;  3AEN A;  3HLM A;  2C44 A;  4ITG A;  2VYC A;  2VMO A;  1AHG A;  1O69 A;  2X5F A;  3ZZK A;  4F5J A;  3DR7 A;  4H63 Q;  2CIN A;  4RKD A;  2KFP A;  4Q31 A;  1QGN A;  1IX8 A;  1QIT A;  1SZK A;  2AEU A;  2JJF A;  4P7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...