1QISA

Aspartate aminotransferase from escherichia coli, c191f mutation, with bound maleate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGFCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title The Role of Residues Outside the Active Site in Catalysis: Structural Basis for Function of C191 Mutants of E. Coli Aspartate Aminotransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminotransferase
total genus 140
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1qisA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1qisA01
3GZCA 4GEBA 1AY5A 3AEOA 1KKJA 3NUBA 5FT4A 1M32A 4OCAA 2BYJA 4N0WA 3AENA 1GBNA 1ASDA 2VGWA 2ZJGA 2R5EA 3PJ0A 3ELPA 2AY3A 3MC6C 4N0BA 4WYAA 2W7HA 3KGXA 3JZLA 4UOYA 2EPJA 2GSAA 3USFA 3MADA 2Z67A 3H7FA 2PB2A 4Q6RA 3WKRA 4P7YA 1CQ7A 2BYLA 3BWNC 4TV7A 3EI5A 4Y0DA 3RCHA 1AIAA 1AICA 4IY7A 3BCXA 3E6GA 2VGZA 5G2QA 4JE5D 3CQ5A 3WLXA 3PGYA 3NUIA 3PIUA 1D7UA 1B5PA 3GZDC 3LY1A 1AHEA 5I92A 4MGRA 1MDZA 3DC1A 3CAIA 1SZSA 3DR7A 3II0A 3WX9A 1G4VA 2DGKA 1EJIA 3AOWA 1JS3A 2D7ZA 5K8BA 3I4JA 4ISYA 5M4BA 1ASLA 4BMKA 1WYVA 1W23A 4ADCA 3LG0A 1G4XA 3ECDA 1M7YA 2VMSA 3EZ1A 4JEWA 4R5FA 3W1JA 4PFNA 3HT4A 5LHAA 3ZRRA 4WXBA 1YNUA 1V72A 1IX7A 4ATQA 2JJHA 3PDBB 5DJ9A 1H0CA 2VGUA 1C9CA 1IJIA 3E9KA 3JWBA 3MEBA 4Q76A 4XJOA 3ATHA 1UU1A 1ARHA 1EQBA 1C0NA 2CFBA 3WKSA 4M2MA 3G7QA 4R8DA 1TARA 1RVUA 2W8JA 1V2FA 1RV3A 3DYDA 4JF0A 4R2NA 3MAFA 4QGRA 2Z9UA 3A9YA 4RKDA 5EAVA 2QMAA 1ASFA 1S08A 1ASBA 4I8AA 3VK3A 4ZDOA 1AJSA 2CJDA 2E7JA 2JJGA 3ASBA 4EMYA 1AAWA 2ZUKA 1C4KA 4OYTA 1IUGA 2BI2A 3ELEA 2EO5A 2R0TA 2XBNA 3F9TA 1I41A 4TN4A 4LC3A 1D7RA 4CVQA 5EUDA 3NU7A 4WYEA 5EQCA 1UKJA 3LVMA 1O4SA 4Y0IA 5J8QA 4ITXA 3E77A 3I5TA 7AATA 4DGTA 3EIAA 3H14A 1BS0A 1LW4A 2W7FA 1KL2A 3FVUA 2RFVA 1J04A 3HMUA 3OKSA 4MY5A 4ZM4A 3ZZJA 2JJFA 1P3WA 4GE4A 4GE9A 2WK7A 4XJLA 5AX8A 3W1IA 2ZY5A 4IXSA 1JG8A 1V2EA 2BKWA 2ZP7A 3FFRA 3K40A 4WD2A 3FZ7A 1AY4A 1DKAA 2VMRA 3PPLA 3QI6A 2VIBA 5D5SA 1DFOA 2HOXA 2YKXA 4H51A 4XK1A 3AEJC 2OGEA 2CJGA 3LV2A 2AY6A 2Z9XA 3QGUA 2YRIA 4F5GA 4IYOB 4MQRA 5G4JA 2E54A 1AKAA 4GE7A 1CZCA 1TOKA 3B1DA 3MBBA 4LNJA 4M2JA 1GD9A 3B1EA 1EG5A 1QIRA 1TASA 2JGTA 3NU8A 5TF5A 3HLMA 1X28A 1YAAA 1WSTA 3AEJA 1ARGA 2BHXA 2DGMA 3HVYA 4A00A 3QHXA 1YJZA 3A2BA 3DXWA 1BJOB 3GJUA 2W7DA 3NTJA 4Q75A 3MKJA 1D7SA 4JEZA 1D2FA 1CZEA 1O62A 1ORDA 2X3LA 3FRKA 3FZ6A 1SFFA 3EI7A 4F5JA 5C6UA 5JAYA 2OGAA 5EIGB 4PFFA 5F9SA 2VGTA 3FSLA 2W7JA 3CQ4A 3FZ8A 4XQ2A 5E5IA 4BA4A 3R4TA 4J5UA 5LH9A 3Q8NA 4ZWMA 5DX5A 5DB5A 4AH3A 2W8WA 3B1CA 1W7LA 2CTZA 3KE3A 1XI9A 3RI6A 3HBXA 4LW2A 3AV7A 4A6RA 1OHWA 4BHDA 5IWQA 1UU2A 1KL1A 2ORDA 3CBFA 3DODA 4RJYA 1IAYA 3K28A 4JF1A 3VP6A 3VAXA 2CB1A 3FDDA 2JISA 5E3KA 3UAKA 4TMRA 3K7YA 2D61A 1ASCA 2BIAA 4JE5A 4CBSA 2Z9WA 4CXRA 2VMVA 1YJSA 2ZYJA 1X29A 3IF2A 4W5KA 4AZJA 4F5MA 1OXPA 3GBXA 1LKCA 1ZC9A 3DXVA 3M5UA 1JF9A 1S0AA 3TFUA 1CQ8A 4F5HA 3COGA 1AHXA 2QB3A 4W91A 2D5YA 2W7EA 2ZSMA 4ZAHA 1XEYA 2DKJA 5D95A 5BJ4A 4HF8A 2YCTA 1E5FA 1MGVA 2YKYA 2VLHA 1MLYA 1WYUA 1M0QA 2G6WA 1QJ5A 2WKAA 1LC7A 1BQDA 1BW0A 3EZSA 4F5IA 1QGNA 1ARTA 4ZASA 1FG3A 3AELA 2YCPA 1MAPA 4A6UA 3NYTA 3EI6A 3G8MA 4EB7A 4M2KA 2V0YA 4CBRA 4WLJA 1W7MA 4ZWVA 5EUNA 1CJ0A 4NOGA 4WYFA 2HZPA 4EB5A 2CJHA 2D64A 1MLZA 2HP1A 4RKCA 4A72A 4W1VA 1B5OA 2HUIA 2R2NA 3FQAA 4FFCA 4CXQA 1GEXA 3GR9A 3ZRPA 3AEPA 3KKIA 2AEVA 3E2ZB 1S07A 4OT8A 1PMOA 4UHMA 4ADEA 1M6SA 1G7WA 1WYTB 3BN1A 3VOMA 1IBJA 4AZKA 3L8AA 3BCBA 1T3IA 5EFSA 1ZOBA 4WYCA 1B9IA 2F8JA 3EUCA 4MQPA 2X8UA 4UQVA 4WXGA 3PD6A 2W8VA 2C44A 1MAQA 4GDYA 3DRDA 4WB0B 2BI9A 1B4XA 1GEWA 4OMAA 1M0NA 1SPAA 3FKDA 4MKKA 3WGBA 2Z1YA 2EH6A 2GB3A 2FYFA 3IHJA 3HQTA 1SZKA 2OQXA 1BJWA 1MDXA 1M0OA 4RAEA 2AATA 4F4EA 1CS1A 1G7XA 2AY8A 3VK2A 5HXXA 1H1CA 1IVRA 4K2BA 3WGCA 1SVVA 3WZFA 1BKGA 2D65A 2GQNA 2YOBA 1W3UA 5FT8A 4A0FA 3N75A 1ASAA 1DJ9A 1DGEA 1YOOA 2BI3A 2W8TA 4ZM3A 2VMPA 2AY2A 3TCMA 1O61A 4ADDA 1ECXA 1GC2A 3NDNA 2CH1A 2ZSLA 2D7YA 1B9HA 3QN6A 2FQ6A 3AATA 1CL1A 2BIEA 1M4NA 3W1HA 3JW9A 2ZY3A 1KMKA 3CQ6A 3MAUA 4ITGA 1B8GA 1IX6A 5EUEA 4IXZA 2OATA 2VI8A 2QLRA 4BA5A 1YJYA 1IAXA 4XJMA 1ELQA 2BWPA 5BJ3A 3EI8A 3JU7A 1YIYA 4BQ0A 3BWOA 1AHYA 3E2YA 4E77A 3GETA 3BC8A 3TQXA 2D66A 4W8IA 5FT5A 2O1BA 1AAMA 2O7CA 3KGWA 3BB8A 1X0MA 9AATA 2QBTA 3QBOA 2W8UA 1QISA 4F5KA 2CANA 3T32A 3A9ZA 2DOUA 1AHFA 4UHOA 3GSBA 1ARIA 1CQ6A 4GRXA 3PDBA 1LS3A 4OTLA 2HP2A 4AOAA 3MAFB 3RBFA 2ZY4A 2WK8A 1AMAA 1QJ3A 1TPLA 2OKKA 4FL0A 4UHNA 3VK4A 4ATPA 2HORA 4A0GA 1AJSB 1BT4A 2DKBA 3F6TA 5G2PA 2PO3A 1CL2A 2C0RA 2YRRA 1VP4A 2VMNA 1DJEA 4R5ZA 4WP0A 2R5CB 1U08A 2FNIA 3E2ZA 4E3QA 1AIBA 1AMRA 1BJ4A 2HUFA 1DGDA 3NRAA 4E1OA 2V1PA 3QPGA 1WYTA 2BI1A 3FTBA 4L0OA 3HL2A 3I16A 1FC4A 3LVKA 4JEYA 3R9AA 4P3MA 1JS6A 4E3RA 4EU1A 1E5EA 1OXOA 3FQ8A 1BQAA 1WKHA 1LC8A 1GC3A 5G4IA 1AKBA 2YHKA 4ZDPA 1SF2A 2VI9A 4WB0A 4XAUA 3DZZA 2BIGA 4WYDA 5M46A 3WCNA 1BJNA 1PMMA 1N8PA 4RM1A 2NMPA 5HDMA 2E7UA 4OBVA 1UU0A 4K2IA 3RBLA 5G09A 4K2MA 2VLFA 3F0HA 1LK9A 4XEWA 4AO4A 1GC4A 3FQ7A 3ACZA 1C7OA 2QB2A 2ZY2A 3MC6A 1SZUA 2VMXA 2YKVA 4WYGA 3TATA 1AY8A 2EZ2A 2C7TA 3E2FA 3NYUA 4A6TA 5F8VA 4IYOA 1O69A 3A8UX 2FN6A 4GSAA 3BWNA 1J32A 4WLHA 1C7GA 2BWNA 4JEVA 1YIZA 3JTXA 3NYSA 3OP7A 2VMTA 1OHYA 2E7IA 4IX8A 2DGLA 4EFFA 3GZDA 1AHGA 1BJOA 2X5DA 4LNMA 3GWPA 3UWCA 2FNUA 1Z3ZA 2VIAA 3PAAA 1OHVA 3PA9A 3ZZKA 2HUUA 2YCNA 1TOGA 2WK9A 4J8LA 4W1XA 1KMJA 2DR1A 3ASAA 2Z9VA 1GDEA 2AY9A 2BWOA 5EIGA 2CSTA 1ZODA 2TPLA 2EZ1A 4AO9A 4LNLA 4OBUA 1RV4A 5HHYA 1Z7DA 2W7GA 1D7VA 4U1TA 8AATA 3AENB 1QITA 1ASEA 4IXOA 4Y0HA 3L44A 1QZ9A 2FM1A 1W7NA 2Z20A 3AEMC 4W1WA 5M49A 1LC5A 3DU4A 3B8XA 1N2TA 2AEUA 4MKJA 1FG7A 3RCHB 2AY5A 1AMSA 1WKGA 1ASGA 3HDOA 3NX3A 4JEXA 4O6ZA 2W7MA 3RUYA 3EI9A 4ADBA 2ZC0A 1N31A 1DTYA 2Z1ZA 1Y4IA 2VMZA 1RVYA 4RLGA 5G0AA 2R5CA 1M0PA 3AEMA 4WBTA 1KKPA 3QM2A 4DBCA 3FD0A 3D6KA 4ZLVA 3ISLA 3BV0A 2Q7WA 2VGSA 2GMUA 4DQ6A 2W7KA 3P1TA 4ZDLA 2O0RA 1X2AA 3FCRA 4KYOA 1AKCA 3JWAA 1WYUB 2BI5A 2PB0A 1WYVB 4Q31A 4A0RA 1MDOA 2JG2A 3A9XA 1AJRA 2CH2A 2VMWA 2QA3A 4HVKA 2Z61A 2VMYA 4KXKA 3LWSA 1VJOA 1DJUA 2AY4A 3UE8A 3WY7A 1S09A 2VMQA 1ASMA 1ELUA 3BS8A 3ZRQA 3DR4A 2VGVA 2W7LA 2C81A 3FDBA 4OC9A 3G0TA 1TOIA 4RJ0A 3LVLB 5DJ1A 1IX8A 2XH1A 2HOZA 1V2DA 4LW4A 1S06A 5EAAA 1PFFA 1GC0A 1ARSA 3N5MA 2VYCA 2W7IA 4PIWA 3WCOA 3EIBA 2CINA 4A0HA 4B98A 1GCKA 3TFTA 2VMOA 3P6KA 5M4DA 1AMQA 1ASNA 1AX4A 1GEYA 1PG8A 3BCAA 3N0LA 3PDXA 2EGYA 3AOVA 4ZSWA 2GMSA 4WXFA 4KAMA 4IW7A 4B9BA 1TOEA 2HOYA 3B46A 2YKUA 2JJEA 4PVFA 1I29A 1C7NA 3NNKA 2VMUA 4XJPA 3RQ1A 1OATA 4ZSYA 1I48A 4RITA 4RIZA 2AY1A 3LVJA 3FFHA 2D63A 3FVSA 1VEFA 3PD6B 4U2HA 5FT6A 4MQQA 2CY8A 2OKJA 1TOJA 3FVXA 1LW5A 4MSOA 2AY7A 4F5LA 5E4ZA 4F5FA 2X5FA 1I43A 1TATA
chains in the Genus database with same CATH superfamily
3GZCA 4GEBA 1AY5A 3AEOA 1KKJA 3NUBA 5FT4A 1M32A 4OCAA 2BYJA 4N0WA 3AENA 1GBNA 2G7JA 1ASDA 2VGWA 2ZJGA 2R5EA 3PJ0A 3ELPA 2AY3A 3MC6C 4N0BA 4WYAA 2W7HA 3KGXA 3JZLA 4UOYA 2EPJA 2GSAA 3USFA 3MADA 2Z67A 3H7FA 2PB2A 4Q6RA 3WKRA 4P7YA 1CQ7A 2BYLA 3BWNC 4TV7A 3EI5A 4Y0DA 3RCHA 1AIAA 1AICA 4IY7A 3BCXA 3E6GA 2VGZA 5G2QA 4JE5D 3CQ5A 3WLXA 3PGYA 3NUIA 3PIUA 1D7UA 1B5PA 3GZDC 3LY1A 1AHEA 5I92A 4MGRA 1MDZA 3DC1A 3CAIA 1SZSA 3DR7A 3II0A 3WX9A 1G4VA 2DGKA 1EJIA 3AOWA 1JS3A 2D7ZA 5K8BA 3I4JA 4ISYA 5M4BA 1ASLA 4BMKA 3N4RA 1WYVA 1W23A 4ADCA 3LG0A 1G4XA 3ECDA 1M7YA 2VMSA 3EZ1A 4JEWA 4R5FA 3W1JA 4PFNA 3HT4A 5LHAA 3ZRRA 4WXBA 1KAFA 1YNUA 1V72A 1IX7A 4ATQA 2JJHA 3PDBB 5DJ9A 1H0CA 2VGUA 1C9CA 1IJIA 3E9KA 3JWBA 3MEBA 4Q76A 4XJOA 3ATHA 1UU1A 1ARHA 1EQBA 1C0NA 2CFBA 3WKSA 4M2MA 3G7QA 4R8DA 1TARA 1RVUA 2W8JA 1V2FA 1RV3A 3DYDA 4JF0A 4R2NA 3MAFA 4QGRA 2Z9UA 3A9YA 4RKDA 5EAVA 2QMAA 1ASFA 1S08A 1ASBA 4I8AA 3VK3A 4ZDOA 1AJSA 2CJDA 2E7JA 2JJGA 3ASBA 4EMYA 1AAWA 2ZUKA 1C4KA 4OYTA 1IUGA 2BI2A 3ELEA 2EO5A 2R0TA 2XBNA 3F9TA 1I41A 4TN4A 4LC3A 1D7RA 4CVQA 5EUDA 3NU7A 4WYEA 5EQCA 1UKJA 3LVMA 1O4SA 4Y0IA 5J8QA 4ITXA 3E77A 3I5TA 7AATA 4DGTA 3EIAA 3H14A 1BS0A 1LW4A 2W7FA 1KL2A 3FVUA 2RFVA 1J04A 3HMUA 3OKSA 4MY5A 4ZM4A 3ZZJA 2JJFA 1P3WA 4GE4A 4GE9A 2WK7A 4XJLA 5AX8A 3W1IA 2ZY5A 4IXSA 1JG8A 1V2EA 2BKWA 2ZP7A 3FFRA 3K40A 4WD2A 3FZ7A 1AY4A 1DKAA 2VMRA 3PPLA 3QI6A 2VIBA 5D5SA 1DFOA 2HOXA 2YKXA 4H51A 4XK1A 3AEJC 2OGEA 2CJGA 3LV2A 2AY6A 2Z9XA 3QGUA 2YRIA 4F5GA 4IYOB 4MQRA 5G4JA 2E54A 1AKAA 4GE7A 1CZCA 1TOKA 3B1DA 3MBBA 4LNJA 4M2JA 1GD9A 3B1EA 1EG5A 1QIRA 1TASA 2JGTA 3NU8A 5TF5A 3HLMA 1X28A 1YAAA 1WSTA 3AEJA 1ARGA 2BHXA 2DGMA 3HVYA 4A00A 3QHXA 1YJZA 3A2BA 3DXWA 2WB6A 1BJOB 3GJUA 2W7DA 3NTJA 4Q75A 3H9XA 3MKJA 1D7SA 4JEZA 1D2FA 1CZEA 1O62A 1ORDA 2X3LA 3FRKA 3FZ6A 1SFFA 3EI7A 4F5JA 5C6UA 5JAYA 2OGAA 3N4XA 5EIGB 4PFFA 5F9SA 2VGTA 3FSLA 2W7JA 3CQ4A 3FZ8A 4XQ2A 5E5IA 4BA4A 3R4TA 4J5UA 5LH9A 3Q8NA 4ZWMA 5DX5A 5DB5A 4AH3A 2W8WA 3B1CA 1W7LA 2CTZA 3KE3A 1XI9A 3RI6A 3HBXA 4LW2A 3AV7A 4A6RA 1OHWA 4BHDA 5IWQA 1UU2A 1KL1A 2ORDA 4K05A 3CBFA 3DODA 4RJYA 1IAYA 3K28A 4JF1A 3VP6A 3VAXA 2CB1A 3FDDA 2JISA 5E3KA 3UAKA 4TMRA 3K7YA 2D61A 1ASCA 2BIAA 4JE5A 4CBSA 2Z9WA 4CXRA 2VMVA 1YJSA 2ZYJA 1X29A 3IF2A 4W5KA 4AZJA 4F5MA 1OXPA 3GBXA 1LKCA 1ZC9A 3DXVA 3M5UA 1JF9A 1S0AA 3TFUA 1CQ8A 4F5HA 3COGA 1AHXA 2QB3A 4W91A 2D5YA 2W7EA 2ZSMA 4ZAHA 1XEYA 2DKJA 5D95A 5BJ4A 4HF8A 2YCTA 1E5FA 1MGVA 2YKYA 2VLHA 1MLYA 1WYUA 1M0QA 2G6WA 1QJ5A 2WKAA 1LC7A 1BQDA 1BW0A 3EZSA 4F5IA 1QGNA 1ARTA 4ZASA 1FG3A 3AELA 2YCPA 1MAPA 4A6UA 3NYTA 3EI6A 3G8MA 4EB7A 4M2KA 2V0YA 4CBRA 4WLJA 1W7MA 4ZWVA 5EUNA 1CJ0A 4NOGA 4WYFA 2HZPA 4EB5A 2CJHA 2D64A 1MLZA 2HP1A 4RKCA 4A72A 4W1VA 1B5OA 2HUIA 2R2NA 3FQAA 4FFCA 4CXQA 1GEXA 3GR9A 3ZRPA 3N7NA 3AEPA 3KKIA 2AEVA 3E2ZB 2KFPA 1S07A 4OT8A 1PMOA 4UHMA 4ADEA 1M6SA 1G7WA 1WYTB 3BN1A 3VOMA 1IBJA 4AZKA 3L8AA 3BCBA 1T3IA 5EFSA 1ZOBA 4WYCA 1B9IA 2F8JA 3EUCA 4MQPA 2X8UA 4UQVA 4WXGA 3PD6A 2W8VA 2C44A 1MAQA 4GDYA 3DRDA 4WB0B 2BI9A 1B4XA 1GEWA 4OMAA 1M0NA 1SPAA 3FKDA 4MKKA 3WGBA 2Z1YA 2EH6A 2GB3A 2FYFA 3IHJA 3HQTA 1SZKA 2OQXA 1BJWA 1MDXA 1M0OA 4RAEA 2AATA 4F4EA 1CS1A 1G7XA 2AY8A 3VK2A 5HXXA 1H1CA 1IVRA 4K2BA 3WGCA 1SVVA 3WZFA 1BKGA 2D65A 2GQNA 2YOBA 1W3UA 5FT8A 4A0FA 3N75A 1ASAA 2FKIA 1DJ9A 1DGEA 1YOOA 2BI3A 2W8TA 4ZM3A 2VMPA 2AY2A 3TCMA 1O61A 4ADDA 1ECXA 1GC2A 3NDNA 2CH1A 2ZSLA 2D7YA 1B9HA 3QN6A 2FQ6A 3AATA 1CL1A 2BIEA 1M4NA 3W1HA 3JW9A 2ZY3A 1KMKA 3CQ6A 3MAUA 4ITGA 1B8GA 1IX6A 5EUEA 4IXZA 2OATA 2VI8A 2QLRA 4BA5A 1YJYA 1IAXA 4XJMA 1ELQA 2BWPA 5BJ3A 3EI8A 3JU7A 1YIYA 4BQ0A 3BWOA 1AHYA 3E2YA 4E77A 3GETA 3BC8A 3TQXA 2D66A 4W8IA 2QSRA 5FT5A 2O1BA 1AAMA 2O7CA 3KGWA 3BB8A 1X0MA 9AATA 2QBTA 3QBOA 2W8UA 1QISA 4F5KA 2CANA 3T32A 3A9ZA 4H63Q 2DOUA 1AHFA 4UHOA 3GSBA 1ARIA 1CQ6A 4GRXA 3PDBA 1LS3A 4OTLA 2HP2A 4AOAA 3MAFB 3RBFA 2ZY4A 2WK8A 1AMAA 1QJ3A 1TPLA 2OKKA 4FL0A 4UHNA 3VK4A 4ATPA 2HORA 4A0GA 1AJSB 1BT4A 2DKBA 3F6TA 5G2PA 2PO3A 1CL2A 2C0RA 2YRRA 1VP4A 2VMNA 1DJEA 4R5ZA 4WP0A 2R5CB 1U08A 2FNIA 3E2ZA 4E3QA 1AIBA 1AMRA 1BJ4A 2HUFA 1DGDA 3NRAA 4E1OA 2V1PA 3QPGA 1WYTA 2BI1A 3FTBA 4L0OA 3HL2A 3I16A 1FC4A 3LVKA 4JEYA 3R9AA 4P3MA 1JS6A 4E3RA 4EU1A 1E5EA 1OXOA 3FQ8A 1BQAA 1WKHA 1LC8A 1GC3A 5G4IA 1AKBA 2YHKA 4ZDPA 1SF2A 2VI9A 4WB0A 4XAUA 3DZZA 2BIGA 4WYDA 5M46A 3WCNA 1BJNA 1PMMA 1N8PA 4RM1A 2NMPA 5HDMA 2E7UA 4OBVA 1UU0A 4K2IA 3RBLA 5G09A 4K2MA 2VLFA 3F0HA 1LK9A 4XEWA 4AO4A 1GC4A 3FQ7A 3ACZA 5KTBA 1C7OA 2QB2A 2ZY2A 3MC6A 1SZUA 2VMXA 2YKVA 4WYGA 3TATA 1AY8A 2EZ2A 2C7TA 3E2FA 3NYUA 4A6TA 5F8VA 4IYOA 1O69A 3A8UX 2FN6A 4GSAA 3BWNA 1J32A 4WLHA 1C7GA 2BWNA 4JEVA 1YIZA 3JTXA 3NYSA 3OP7A 2VMTA 1OHYA 2E7IA 4IX8A 2DGLA 4EFFA 3GZDA 1AHGA 1BJOA 2X5DA 4LNMA 3GWPA 3UWCA 2FNUA 1Z3ZA 2VIAA 3PAAA 1OHVA 3PA9A 3ZZKA 2HUUA 2YCNA 1TOGA 2WK9A 4J8LA 4W1XA 1KMJA 2DR1A 3ASAA 2Z9VA 1GDEA 2AY9A 2BWOA 5EIGA 2CSTA 1ZODA 2TPLA 2EZ1A 4AO9A 4LNLA 4OBUA 1RV4A 5HHYA 1Z7DA 2W7GA 1D7VA 4U1TA 8AATA 3AENB 1QITA 1ASEA 4IXOA 4Y0HA 3L44A 1QZ9A 2FM1A 1W7NA 2Z20A 3AEMC 4W1WA 5M49A 1LC5A 2EYQA 3DU4A 3B8XA 1N2TA 2AEUA 4MKJA 1FG7A 3RCHB 2AY5A 1AMSA 1WKGA 1ASGA 3HDOA 3NX3A 4JEXA 4O6ZA 2W7MA 3RUYA 3EI9A 4ADBA 2ZC0A 1N31A 1DTYA 2Z1ZA 1Y4IA 2VMZA 1RVYA 4RLGA 5G0AA 2R5CA 1M0PA 3AEMA 4WBTA 1KKPA 3QM2A 4DBCA 3FD0A 3D6KA 4ZLVA 3ISLA 3BV0A 2Q7WA 2VGSA 3N4SA 2GMUA 4DQ6A 2W7KA 3P1TA 4ZDLA 2O0RA 1X2AA 3FCRA 4KYOA 1AKCA 3JWAA 1WYUB 2BI5A 2PB0A 1WYVB 4Q31A 4A0RA 1MDOA 2JG2A 3A9XA 1AJRA 2CH2A 2VMWA 2QA3A 4HVKA 2Z61A 2VMYA 4KXKA 3LWSA 1VJOA 1DJUA 2AY4A 3UE8A 3WY7A 1S09A 2VMQA 1ASMA 1ELUA 3BS8A 3ZRQA 3DR4A 2VGVA 2W7LA 2C81A 3FDBA 4OC9A 3G0TA 1TOIA 4RJ0A 3LVLB 5DJ1A 1IX8A 2XH1A 2HOZA 1V2DA 4LW4A 1S06A 5EAAA 1PFFA 1GC0A 2A1VA 1ARSA 3N5MA 2VYCA 2W7IA 4PIWA 3WCOA 3EIBA 2CINA 4A0HA 4B98A 1GCKA 3TFTA 2VMOA 3P6KA 5M4DA 1AMQA 1ASNA 1AX4A 1GEYA 1PG8A 3BCAA 3N0LA 3PDXA 2EGYA 3AOVA 4ZSWA 2GMSA 4WXFA 4KAMA 4IW7A 4B9BA 1TOEA 2HOYA 3B46A 2YKUA 2JJEA 4PVFA 1I29A 1C7NA 3NNKA 2VMUA 4XJPA 3RQ1A 1OATA 4ZSYA 1I48A 4RITA 4RIZA 2AY1A 3LVJA 3FFHA 2D63A 3FVSA 1VEFA 3PD6B 4U2HA 5FT6A 4MQQA 2CY8A 2OKJA 1TOJA 3FVXA 1LW5A 4MSOA 2AY7A 4F5LA 5E4ZA 4F5FA 2X5FA 1I43A 1TATA
chains in the Genus database with same CATH topology
3GZCA 4GEBA 1AY5A 3AEOA 1KKJA 3NUBA 5FT4A 1M32A 4OCAA 2BYJA 4N0WA 3AENA 1GBNA 2G7JA 1ASDA 2VGWA 2ZJGA 2R5EA 3PJ0A 3ELPA 2AY3A 3MC6C 4N0BA 4WYAA 2W7HA 3KGXA 3JZLA 4UOYA 2EPJA 2GSAA 3USFA 3MADA 2Z67A 3H7FA 2PB2A 4Q6RA 3WKRA 4P7YA 1CQ7A 2BYLA 3BWNC 4TV7A 3EI5A 4Y0DA 3RCHA 1AIAA 1AICA 4IY7A 3BCXA 3E6GA 2VGZA 5G2QA 4JE5D 3CQ5A 3WLXA 3PGYA 3NUIA 3PIUA 1D7UA 1B5PA 3GZDC 3LY1A 1AHEA 5I92A 4MGRA 1MDZA 3DC1A 3CAIA 1SZSA 3DR7A 3II0A 3WX9A 1G4VA 2DGKA 1EJIA 3AOWA 1JS3A 2D7ZA 5K8BA 3I4JA 4ISYA 5M4BA 1ASLA 4BMKA 3N4RA 1WYVA 1W23A 4ADCA 3LG0A 1G4XA 3ECDA 1M7YA 2VMSA 3EZ1A 4JEWA 4R5FA 3W1JA 4PFNA 3HT4A 5LHAA 3ZRRA 4WXBA 1YNUA 1V72A 1IX7A 4ATQA 2JJHA 3PDBB 5DJ9A 1H0CA 2VGUA 1C9CA 1IJIA 3E9KA 3JWBA 3MEBA 4Q76A 4XJOA 3ATHA 1UU1A 1ARHA 1EQBA 1C0NA 2CFBA 3WKSA 4M2MA 3G7QA 4R8DA 1TARA 1RVUA 2W8JA 1V2FA 1RV3A 3DYDA 4JF0A 4R2NA 3MAFA 4QGRA 2Z9UA 3A9YA 4RKDA 5EAVA 2QMAA 1ASFA 1S08A 1ASBA 4I8AA 3VK3A 4ZDOA 1AJSA 2CJDA 2E7JA 2JJGA 3ASBA 4EMYA 1AAWA 2ZUKA 1C4KA 4OYTA 1IUGA 2BI2A 3ELEA 2EO5A 2R0TA 2XBNA 3F9TA 1I41A 4TN4A 4LC3A 1D7RA 4CVQA 5EUDA 3NU7A 4WYEA 5EQCA 1UKJA 3LVMA 1O4SA 4Y0IA 5J8QA 4ITXA 3E77A 3I5TA 7AATA 4DGTA 3EIAA 3H14A 1BS0A 1LW4A 2W7FA 1KL2A 3FVUA 2RFVA 1J04A 3HMUA 3OKSA 4MY5A 4ZM4A 3ZZJA 2JJFA 1P3WA 4GE4A 4GE9A 2WK7A 4XJLA 5AX8A 3W1IA 2ZY5A 4IXSA 1JG8A 1V2EA 2BKWA 2ZP7A 3FFRA 3K40A 4WD2A 3FZ7A 1AY4A 1DKAA 2VMRA 3PPLA 3QI6A 2VIBA 5D5SA 1DFOA 2HOXA 2YKXA 4H51A 4XK1A 3AEJC 2OGEA 2CJGA 3LV2A 2AY6A 2Z9XA 3QGUA 2YRIA 4F5GA 4IYOB 4MQRA 5G4JA 2E54A 1AKAA 4GE7A 1CZCA 1TOKA 3B1DA 3MBBA 4LNJA 4M2JA 1GD9A 3B1EA 1EG5A 1QIRA 1TASA 2JGTA 3NU8A 5TF5A 3HLMA 1X28A 1YAAA 1WSTA 3AEJA 1ARGA 2BHXA 2DGMA 3HVYA 4A00A 3QHXA 1YJZA 3A2BA 3DXWA 2WB6A 1BJOB 3GJUA 2W7DA 3NTJA 4Q75A 3H9XA 3MKJA 1D7SA 4JEZA 1D2FA 1CZEA 1O62A 1ORDA 2X3LA 3FRKA 3FZ6A 1SFFA 3EI7A 4F5JA 5C6UA 5JAYA 2OGAA 3N4XA 5EIGB 4PFFA 5F9SA 2VGTA 3FSLA 2W7JA 3CQ4A 3FZ8A 4XQ2A 5E5IA 4BA4A 3R4TA 4J5UA 5LH9A 3Q8NA 4ZWMA 5DX5A 5DB5A 4AH3A 2W8WA 3B1CA 1W7LA 2CTZA 3KE3A 1XI9A 3RI6A 3HBXA 4LW2A 3AV7A 4A6RA 1OHWA 4BHDA 5IWQA 1UU2A 1KL1A 2ORDA 4K05A 3CBFA 3DODA 4RJYA 1IAYA 3K28A 4JF1A 3VP6A 3VAXA 2CB1A 3FDDA 2JISA 5E3KA 3UAKA 4TMRA 3K7YA 2D61A 1ASCA 2BIAA 4JE5A 4CBSA 2Z9WA 4CXRA 2VMVA 1YJSA 2ZYJA 1X29A 3IF2A 4W5KA 4AZJA 4F5MA 1OXPA 3GBXA 1LKCA 1ZC9A 3DXVA 3M5UA 1JF9A 1S0AA 3TFUA 1CQ8A 4F5HA 3COGA 1AHXA 2QB3A 4W91A 2D5YA 2W7EA 2ZSMA 4ZAHA 1XEYA 2DKJA 5D95A 5BJ4A 4HF8A 2YCTA 1E5FA 1MGVA 2YKYA 2VLHA 1MLYA 1WYUA 1M0QA 2G6WA 1QJ5A 2WKAA 1LC7A 1BQDA 1BW0A 3EZSA 4F5IA 1QGNA 1ARTA 4ZASA 1FG3A 3AELA 2YCPA 1MAPA 4A6UA 3NYTA 3EI6A 3G8MA 4EB7A 4M2KA 2V0YA 4CBRA 4WLJA 1W7MA 4ZWVA 5EUNA 1CJ0A 4NOGA 4WYFA 2HZPA 4EB5A 2CJHA 2D64A 1MLZA 2HP1A 4RKCA 4A72A 4W1VA 1B5OA 2HUIA 2R2NA 3FQAA 4FFCA 4CXQA 1GEXA 3GR9A 3ZRPA 3N7NA 3AEPA 3KKIA 2AEVA 3E2ZB 2KFPA 1S07A 4OT8A 1PMOA 4UHMA 4ADEA 1M6SA 1G7WA 1WYTB 3BN1A 3VOMA 1IBJA 4AZKA 3L8AA 3BCBA 1T3IA 5EFSA 1ZOBA 4WYCA 1B9IA 2F8JA 3EUCA 4MQPA 2X8UA 4UQVA 4WXGA 3PD6A 2W8VA 2C44A 1MAQA 4GDYA 3DRDA 4WB0B 2BI9A 1B4XA 1GEWA 4OMAA 1M0NA 1SPAA 3FKDA 4MKKA 3WGBA 2Z1YA 2EH6A 2GB3A 2FYFA 3IHJA 3HQTA 1SZKA 2OQXA 1BJWA 1MDXA 1M0OA 4RAEA 2AATA 4F4EA 1CS1A 1G7XA 2AY8A 3VK2A 5HXXA 1H1CA 1IVRA 4K2BA 3WGCA 1SVVA 3WZFA 1BKGA 2D65A 2GQNA 2YOBA 1W3UA 5FT8A 4A0FA 3N75A 1ASAA 2FKIA 1DJ9A 1DGEA 1YOOA 2BI3A 2W8TA 4ZM3A 2VMPA 2AY2A 3TCMA 1O61A 4ADDA 1ECXA 1GC2A 3NDNA 2CH1A 2ZSLA 2D7YA 1B9HA 3QN6A 2FQ6A 3AATA 1CL1A 2BIEA 1M4NA 3W1HA 3JW9A 2ZY3A 1KMKA 3CQ6A 3MAUA 4ITGA 1B8GA 1IX6A 5EUEA 4IXZA 2OATA 2VI8A 2QLRA 4BA5A 1YJYA 1IAXA 4XJMA 1ELQA 2BWPA 5BJ3A 3EI8A 3JU7A 1YIYA 4BQ0A 3BWOA 1AHYA 3E2YA 4E77A 3GETA 3BC8A 3TQXA 2D66A 4W8IA 2QSRA 5FT5A 2O1BA 1AAMA 2O7CA 3KGWA 3BB8A 1X0MA 9AATA 2QBTA 3QBOA 2W8UA 1QISA 4F5KA 2CANA 3T32A 3A9ZA 4H63Q 2DOUA 1AHFA 4UHOA 3GSBA 1ARIA 1CQ6A 4GRXA 3PDBA 1LS3A 4OTLA 2HP2A 4AOAA 3MAFB 3RBFA 2ZY4A 2WK8A 1AMAA 1QJ3A 1TPLA 2OKKA 4FL0A 4UHNA 3VK4A 4ATPA 2HORA 4A0GA 1AJSB 1BT4A 2DKBA 3F6TA 5G2PA 2PO3A 1CL2A 2C0RA 2YRRA 1VP4A 2VMNA 1DJEA 4R5ZA 4WP0A 2R5CB 1U08A 2FNIA 3E2ZA 4E3QA 1AIBA 1AMRA 1BJ4A 2HUFA 1DGDA 3NRAA 4E1OA 2V1PA 3QPGA 1WYTA 2BI1A 3FTBA 4L0OA 3HL2A 3I16A 1FC4A 3LVKA 4JEYA 3R9AA 4P3MA 1JS6A 4E3RA 4EU1A 1E5EA 1OXOA 3FQ8A 1BQAA 1WKHA 1LC8A 1GC3A 5G4IA 1AKBA 2YHKA 4ZDPA 1SF2A 2VI9A 4WB0A 4XAUA 3DZZA 2BIGA 4WYDA 5M46A 3WCNA 1BJNA 1PMMA 1N8PA 4RM1A 2NMPA 5HDMA 2E7UA 4OBVA 1UU0A 4K2IA 3RBLA 5G09A 4K2MA 2VLFA 3F0HA 1LK9A 4XEWA 4AO4A 1GC4A 3FQ7A 3ACZA 5KTBA 1C7OA 2QB2A 2ZY2A 3MC6A 1SZUA 2VMXA 2YKVA 4WYGA 3TATA 1AY8A 2EZ2A 2C7TA 3E2FA 3NYUA 4A6TA 5F8VA 4IYOA 1O69A 3A8UX 2FN6A 4GSAA 3BWNA 1J32A 4WLHA 1C7GA 2BWNA 4JEVA 1YIZA 3JTXA 3NYSA 3OP7A 2VMTA 1OHYA 2E7IA 4IX8A 2DGLA 4EFFA 3GZDA 1AHGA 1BJOA 2X5DA 4LNMA 3GWPA 3UWCA 2FNUA 1Z3ZA 2VIAA 3PAAA 1OHVA 3PA9A 3ZZKA 2HUUA 2YCNA 1TOGA 2WK9A 4J8LA 4W1XA 1KMJA 2DR1A 3ASAA 2Z9VA 1GDEA 2AY9A 2BWOA 5EIGA 2CSTA 1ZODA 2TPLA 2EZ1A 4AO9A 4LNLA 4OBUA 1RV4A 5HHYA 1Z7DA 2W7GA 1D7VA 4U1TA 8AATA 3AENB 1QITA 1ASEA 4IXOA 4Y0HA 3L44A 1QZ9A 2FM1A 1W7NA 2Z20A 3AEMC 4W1WA 5M49A 1LC5A 2EYQA 3DU4A 3B8XA 1N2TA 2AEUA 4MKJA 1FG7A 3RCHB 2AY5A 1AMSA 1WKGA 1ASGA 3HDOA 3NX3A 4JEXA 4O6ZA 2W7MA 3RUYA 3EI9A 4ADBA 2ZC0A 1N31A 1DTYA 2Z1ZA 1Y4IA 2VMZA 1RVYA 4RLGA 5G0AA 2R5CA 1M0PA 3AEMA 4WBTA 1KKPA 3QM2A 4DBCA 3FD0A 3D6KA 4ZLVA 3ISLA 3BV0A 2Q7WA 2VGSA 3N4SA 2GMUA 4DQ6A 2W7KA 3P1TA 4ZDLA 2O0RA 1X2AA 3FCRA 4KYOA 1AKCA 3JWAA 1WYUB 2BI5A 2PB0A 1WYVB 4Q31A 4A0RA 1MDOA 2JG2A 3A9XA 1AJRA 2CH2A 2VMWA 2QA3A 4HVKA 2Z61A 2VMYA 4KXKA 3LWSA 1VJOA 1DJUA 2AY4A 3UE8A 3WY7A 1S09A 2VMQA 1ASMA 1ELUA 3BS8A 3ZRQA 3DR4A 2VGVA 2W7LA 2C81A 3FDBA 4OC9A 3G0TA 1TOIA 4RJ0A 3LVLB 5DJ1A 1IX8A 2XH1A 2HOZA 1V2DA 4LW4A 1S06A 5EAAA 1PFFA 1GC0A 2A1VA 1ARSA 3N5MA 2VYCA 2W7IA 4PIWA 3WCOA 3EIBA 2CINA 4A0HA 4B98A 1GCKA 3TFTA 2VMOA 3P6KA 5M4DA 1AMQA 1ASNA 1AX4A 1GEYA 1PG8A 3BCAA 3N0LA 3PDXA 2EGYA 3AOVA 4ZSWA 2GMSA 4WXFA 4KAMA 4IW7A 4B9BA 1TOEA 2HOYA 3B46A 2YKUA 2JJEA 4PVFA 1I29A 1C7NA 3NNKA 2VMUA 4XJPA 3RQ1A 1OATA 4ZSYA 1I48A 4RITA 4RIZA 2AY1A 3LVJA 3FFHA 2D63A 3FVSA 1VEFA 3PD6B 4U2HA 5FT6A 4MQQA 2CY8A 2OKJA 1TOJA 3FVXA 1LW5A 4MSOA 2AY7A 4F5LA 5E4ZA 4F5FA 2X5FA 1I43A 1TATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZC A;  4GEB A;  1AY5 A;  3AEO A;  1KKJ A;  3NUB A;  5FT4 A;  1M32 A;  4OCA A;  2BYJ A;  4N0W A;  3AEN A;  1GBN A;  1ASD A;  2VGW A;  2ZJG A;  2R5E A;  3PJ0 A;  3ELP A;  2AY3 A;  3MC6 C;  4N0B A;  4WYA A;  2W7H A;  3KGX A;  3JZL A;  4UOY A;  2EPJ A;  2GSA A;  3USF A;  3MAD A;  2Z67 A;  3H7F A;  2PB2 A;  4Q6R A;  3WKR A;  4P7Y A;  1CQ7 A;  2BYL A;  3BWN C;  4TV7 A;  3EI5 A;  4Y0D A;  3RCH A;  1AIA A;  1AIC A;  4IY7 A;  3BCX A;  3E6G A;  2VGZ A;  5G2Q A;  4JE5 D;  3CQ5 A;  3WLX A;  3PGY A;  3NUI A;  3PIU A;  1D7U A;  1B5P A;  3GZD C;  3LY1 A;  1AHE A;  5I92 A;  4MGR A;  1MDZ A;  3DC1 A;  3CAI A;  1SZS A;  3DR7 A;  3II0 A;  3WX9 A;  1G4V A;  2DGK A;  1EJI A;  3AOW A;  1JS3 A;  2D7Z A;  5K8B A;  3I4J A;  4ISY A;  5M4B A;  1ASL A;  4BMK A;  1WYV A;  1W23 A;  4ADC A;  3LG0 A;  1G4X A;  3ECD A;  1M7Y A;  2VMS A;  3EZ1 A;  4JEW A;  4R5F A;  3W1J A;  4PFN A;  3HT4 A;  5LHA A;  3ZRR A;  4WXB A;  1YNU A;  1V72 A;  1IX7 A;  4ATQ A;  2JJH A;  3PDB B;  5DJ9 A;  1H0C A;  2VGU A;  1C9C A;  1IJI A;  3E9K A;  3JWB A;  3MEB A;  4Q76 A;  4XJO A;  3ATH A;  1UU1 A;  1ARH A;  1EQB A;  1C0N A;  2CFB A;  3WKS A;  4M2M A;  3G7Q A;  4R8D A;  1TAR A;  1RVU A;  2W8J A;  1V2F A;  1RV3 A;  3DYD A;  4JF0 A;  4R2N A;  3MAF A;  4QGR A;  2Z9U A;  3A9Y A;  4RKD A;  5EAV A;  2QMA A;  1ASF A;  1S08 A;  1ASB A;  4I8A A;  3VK3 A;  4ZDO A;  1AJS A;  2CJD A;  2E7J A;  2JJG A;  3ASB A;  4EMY A;  1AAW A;  2ZUK A;  1C4K A;  4OYT A;  1IUG A;  2BI2 A;  3ELE A;  2EO5 A;  2R0T A;  2XBN A;  3F9T A;  1I41 A;  4TN4 A;  4LC3 A;  1D7R A;  4CVQ A;  5EUD A;  3NU7 A;  4WYE A;  5EQC A;  1UKJ A;  3LVM A;  1O4S A;  4Y0I A;  5J8Q A;  4ITX A;  3E77 A;  3I5T A;  7AAT A;  4DGT A;  3EIA A;  3H14 A;  1BS0 A;  1LW4 A;  2W7F A;  1KL2 A;  3FVU A;  2RFV A;  1J04 A;  3HMU A;  3OKS A;  4MY5 A;  4ZM4 A;  3ZZJ A;  2JJF A;  1P3W A;  4GE4 A;  4GE9 A;  2WK7 A;  4XJL A;  5AX8 A;  3W1I A;  2ZY5 A;  4IXS A;  1JG8 A;  1V2E A;  2BKW A;  2ZP7 A;  3FFR A;  3K40 A;  4WD2 A;  3FZ7 A;  1AY4 A;  1DKA A;  2VMR A;  3PPL A;  3QI6 A;  2VIB A;  5D5S A;  1DFO A;  2HOX A;  2YKX A;  4H51 A;  4XK1 A;  3AEJ C;  2OGE A;  2CJG A;  3LV2 A;  2AY6 A;  2Z9X A;  3QGU A;  2YRI A;  4F5G A;  4IYO B;  4MQR A;  5G4J A;  2E54 A;  1AKA A;  4GE7 A;  1CZC A;  1TOK A;  3B1D A;  3MBB A;  4LNJ A;  4M2J A;  1GD9 A;  3B1E A;  1EG5 A;  1QIR A;  1TAS A;  2JGT A;  3NU8 A;  5TF5 A;  3HLM A;  1X28 A;  1YAA A;  1WST A;  3AEJ A;  1ARG A;  2BHX A;  2DGM A;  3HVY A;  4A00 A;  3QHX A;  1YJZ A;  3A2B A;  3DXW A;  1BJO B;  3GJU A;  2W7D A;  3NTJ A;  4Q75 A;  3MKJ A;  1D7S A;  4JEZ A;  1D2F A;  1CZE A;  1O62 A;  1ORD A;  2X3L A;  3FRK A;  3FZ6 A;  1SFF A;  3EI7 A;  4F5J A;  5C6U A;  5JAY A;  2OGA A;  5EIG B;  4PFF A;  5F9S A;  2VGT A;  3FSL A;  2W7J A;  3CQ4 A;  3FZ8 A;  4XQ2 A;  5E5I A;  4BA4 A;  3R4T A;  4J5U A;  5LH9 A;  3Q8N A;  4ZWM A;  5DX5 A;  5DB5 A;  4AH3 A;  2W8W A;  3B1C A;  1W7L A;  2CTZ A;  3KE3 A;  1XI9 A;  3RI6 A;  3HBX A;  4LW2 A;  3AV7 A;  4A6R A;  1OHW A;  4BHD A;  5IWQ A;  1UU2 A;  1KL1 A;  2ORD A;  3CBF A;  3DOD A;  4RJY A;  1IAY A;  3K28 A;  4JF1 A;  3VP6 A;  3VAX A;  2CB1 A;  3FDD A;  2JIS A;  5E3K A;  3UAK A;  4TMR A;  3K7Y A;  2D61 A;  1ASC A;  2BIA A;  4JE5 A;  4CBS A;  2Z9W A;  4CXR A;  2VMV A;  1YJS A;  2ZYJ A;  1X29 A;  3IF2 A;  4W5K A;  4AZJ A;  4F5M A;  1OXP A;  3GBX A;  1LKC A;  1ZC9 A;  3DXV A;  3M5U A;  1JF9 A;  1S0A A;  3TFU A;  1CQ8 A;  4F5H A;  3COG A;  1AHX A;  2QB3 A;  4W91 A;  2D5Y A;  2W7E A;  2ZSM A;  4ZAH A;  1XEY A;  2DKJ A;  5D95 A;  5BJ4 A;  4HF8 A;  2YCT A;  1E5F A;  1MGV A;  2YKY A;  2VLH A;  1MLY A;  1WYU A;  1M0Q A;  2G6W A;  1QJ5 A;  2WKA A;  1LC7 A;  1BQD A;  1BW0 A;  3EZS A;  4F5I A;  1QGN A;  1ART A;  4ZAS A;  1FG3 A;  3AEL A;  2YCP A;  1MAP A;  4A6U A;  3NYT A;  3EI6 A;  3G8M A;  4EB7 A;  4M2K A;  2V0Y A;  4CBR A;  4WLJ A;  1W7M A;  4ZWV A;  5EUN A;  1CJ0 A;  4NOG A;  4WYF A;  2HZP A;  4EB5 A;  2CJH A;  2D64 A;  1MLZ A;  2HP1 A;  4RKC A;  4A72 A;  4W1V A;  1B5O A;  2HUI A;  2R2N A;  3FQA A;  4FFC A;  4CXQ A;  1GEX A;  3GR9 A;  3ZRP A;  3AEP A;  3KKI A;  2AEV A;  3E2Z B;  1S07 A;  4OT8 A;  1PMO A;  4UHM A;  4ADE A;  1M6S A;  1G7W A;  1WYT B;  3BN1 A;  3VOM A;  1IBJ A;  4AZK A;  3L8A A;  3BCB A;  1T3I A;  5EFS A;  1ZOB A;  4WYC A;  1B9I A;  2F8J A;  3EUC A;  4MQP A;  2X8U A;  4UQV A;  4WXG A;  3PD6 A;  2W8V A;  2C44 A;  1MAQ A;  4GDY A;  3DRD A;  4WB0 B;  2BI9 A;  1B4X A;  1GEW A;  4OMA A;  1M0N A;  1SPA A;  3FKD A;  4MKK A;  3WGB A;  2Z1Y A;  2EH6 A;  2GB3 A;  2FYF A;  3IHJ A;  3HQT A;  1SZK A;  2OQX A;  1BJW A;  1MDX A;  1M0O A;  4RAE A;  2AAT A;  4F4E A;  1CS1 A;  1G7X A;  2AY8 A;  3VK2 A;  5HXX A;  1H1C A;  1IVR A;  4K2B A;  3WGC A;  1SVV A;  3WZF A;  1BKG A;  2D65 A;  2GQN A;  2YOB A;  1W3U A;  5FT8 A;  4A0F A;  3N75 A;  1ASA A;  1DJ9 A;  1DGE A;  1YOO A;  2BI3 A;  2W8T A;  4ZM3 A;  2VMP A;  2AY2 A;  3TCM A;  1O61 A;  4ADD A;  1ECX A;  1GC2 A;  3NDN A;  2CH1 A;  2ZSL A;  2D7Y A;  1B9H A;  3QN6 A;  2FQ6 A;  3AAT A;  1CL1 A;  2BIE A;  1M4N A;  3W1H A;  3JW9 A;  2ZY3 A;  1KMK A;  3CQ6 A;  3MAU A;  4ITG A;  1B8G A;  1IX6 A;  5EUE A;  4IXZ A;  2OAT A;  2VI8 A;  2QLR A;  4BA5 A;  1YJY A;  1IAX A;  4XJM A;  1ELQ A;  2BWP A;  5BJ3 A;  3EI8 A;  3JU7 A;  1YIY A;  4BQ0 A;  3BWO A;  1AHY A;  3E2Y A;  4E77 A;  3GET A;  3BC8 A;  3TQX A;  2D66 A;  4W8I A;  5FT5 A;  2O1B A;  1AAM A;  2O7C A;  3KGW A;  3BB8 A;  1X0M A;  9AAT A;  2QBT A;  3QBO A;  2W8U A;  1QIS A;  4F5K A;  2CAN A;  3T32 A;  3A9Z A;  2DOU A;  1AHF A;  4UHO A;  3GSB A;  1ARI A;  1CQ6 A;  4GRX A;  3PDB A;  1LS3 A;  4OTL A;  2HP2 A;  4AOA A;  3MAF B;  3RBF A;  2ZY4 A;  2WK8 A;  1AMA A;  1QJ3 A;  1TPL A;  2OKK A;  4FL0 A;  4UHN A;  3VK4 A;  4ATP A;  2HOR A;  4A0G A;  1AJS B;  1BT4 A;  2DKB A;  3F6T A;  5G2P A;  2PO3 A;  1CL2 A;  2C0R A;  2YRR A;  1VP4 A;  2VMN A;  1DJE A;  4R5Z A;  4WP0 A;  2R5C B;  1U08 A;  2FNI A;  3E2Z A;  4E3Q A;  1AIB A;  1AMR A;  1BJ4 A;  2HUF A;  1DGD A;  3NRA A;  4E1O A;  2V1P A;  3QPG A;  1WYT A;  2BI1 A;  3FTB A;  4L0O A;  3HL2 A;  3I16 A;  1FC4 A;  3LVK A;  4JEY A;  3R9A A;  4P3M A;  1JS6 A;  4E3R A;  4EU1 A;  1E5E A;  1OXO A;  3FQ8 A;  1BQA A;  1WKH A;  1LC8 A;  1GC3 A;  5G4I A;  1AKB A;  2YHK A;  4ZDP A;  1SF2 A;  2VI9 A;  4WB0 A;  4XAU A;  3DZZ A;  2BIG A;  4WYD A;  5M46 A;  3WCN A;  1BJN A;  1PMM A;  1N8P A;  4RM1 A;  2NMP A;  5HDM A;  2E7U A;  4OBV A;  1UU0 A;  4K2I A;  3RBL A;  5G09 A;  4K2M A;  2VLF A;  3F0H A;  1LK9 A;  4XEW A;  4AO4 A;  1GC4 A;  3FQ7 A;  3ACZ A;  1C7O A;  2QB2 A;  2ZY2 A;  3MC6 A;  1SZU A;  2VMX A;  2YKV A;  4WYG A;  3TAT A;  1AY8 A;  2EZ2 A;  2C7T A;  3E2F A;  3NYU A;  4A6T A;  5F8V A;  4IYO A;  1O69 A;  3A8U X;  2FN6 A;  4GSA A;  3BWN A;  1J32 A;  4WLH A;  1C7G A;  2BWN A;  4JEV A;  1YIZ A;  3JTX A;  3NYS A;  3OP7 A;  2VMT A;  1OHY A;  2E7I A;  4IX8 A;  2DGL A;  4EFF A;  3GZD A;  1AHG A;  1BJO A;  2X5D A;  4LNM A;  3GWP A;  3UWC A;  2FNU A;  1Z3Z A;  2VIA A;  3PAA A;  1OHV A;  3PA9 A;  3ZZK A;  2HUU A;  2YCN A;  1TOG A;  2WK9 A;  4J8L A;  4W1X A;  1KMJ A;  2DR1 A;  3ASA A;  2Z9V A;  1GDE A;  2AY9 A;  2BWO A;  5EIG A;  2CST A;  1ZOD A;  2TPL A;  2EZ1 A;  4AO9 A;  4LNL A;  4OBU A;  1RV4 A;  5HHY A;  1Z7D A;  2W7G A;  1D7V A;  4U1T A;  8AAT A;  3AEN B;  1QIT A;  1ASE A;  4IXO A;  4Y0H A;  3L44 A;  1QZ9 A;  2FM1 A;  1W7N A;  2Z20 A;  3AEM C;  4W1W A;  5M49 A;  1LC5 A;  3DU4 A;  3B8X A;  1N2T A;  2AEU A;  4MKJ A;  1FG7 A;  3RCH B;  2AY5 A;  1AMS A;  1WKG A;  1ASG A;  3HDO A;  3NX3 A;  4JEX A;  4O6Z A;  2W7M A;  3RUY A;  3EI9 A;  4ADB A;  2ZC0 A;  1N31 A;  1DTY A;  2Z1Z A;  1Y4I A;  2VMZ A;  1RVY A;  4RLG A;  5G0A A;  2R5C A;  1M0P A;  3AEM A;  4WBT A;  1KKP A;  3QM2 A;  4DBC A;  3FD0 A;  3D6K A;  4ZLV A;  3ISL A;  3BV0 A;  2Q7W A;  2VGS A;  2GMU A;  4DQ6 A;  2W7K A;  3P1T A;  4ZDL A;  2O0R A;  1X2A A;  3FCR A;  4KYO A;  1AKC A;  3JWA A;  1WYU B;  2BI5 A;  2PB0 A;  1WYV B;  4Q31 A;  4A0R A;  1MDO A;  2JG2 A;  3A9X A;  1AJR A;  2CH2 A;  2VMW A;  2QA3 A;  4HVK A;  2Z61 A;  2VMY A;  4KXK A;  3LWS A;  1VJO A;  1DJU A;  2AY4 A;  3UE8 A;  3WY7 A;  1S09 A;  2VMQ A;  1ASM A;  1ELU A;  3BS8 A;  3ZRQ A;  3DR4 A;  2VGV A;  2W7L A;  2C81 A;  3FDB A;  4OC9 A;  3G0T A;  1TOI A;  4RJ0 A;  3LVL B;  5DJ1 A;  1IX8 A;  2XH1 A;  2HOZ A;  1V2D A;  4LW4 A;  1S06 A;  5EAA A;  1PFF A;  1GC0 A;  1ARS A;  3N5M A;  2VYC A;  2W7I A;  4PIW A;  3WCO A;  3EIB A;  2CIN A;  4A0H A;  4B98 A;  1GCK A;  3TFT A;  2VMO A;  3P6K A;  5M4D A;  1AMQ A;  1ASN A;  1AX4 A;  1GEY A;  1PG8 A;  3BCA A;  3N0L A;  3PDX A;  2EGY A;  3AOV A;  4ZSW A;  2GMS A;  4WXF A;  4KAM A;  4IW7 A;  4B9B A;  1TOE A;  2HOY A;  3B46 A;  2YKU A;  2JJE A;  4PVF A;  1I29 A;  1C7N A;  3NNK A;  2VMU A;  4XJP A;  3RQ1 A;  1OAT A;  4ZSY A;  1I48 A;  4RIT A;  4RIZ A;  2AY1 A;  3LVJ A;  3FFH A;  2D63 A;  3FVS A;  1VEF A;  3PD6 B;  4U2H A;  5FT6 A;  4MQQ A;  2CY8 A;  2OKJ A;  1TOJ A;  3FVX A;  1LW5 A;  4MSO A;  2AY7 A;  4F5L A;  5E4Z A;  4F5F A;  2X5F A;  1I43 A;  1TAT A; 
#chains in the Genus database with same CATH topology
 3GZC A;  4GEB A;  1AY5 A;  3AEO A;  1KKJ A;  3NUB A;  5FT4 A;  1M32 A;  4OCA A;  2BYJ A;  4N0W A;  3AEN A;  1GBN A;  2G7J A;  1ASD A;  2VGW A;  2ZJG A;  2R5E A;  3PJ0 A;  3ELP A;  2AY3 A;  3MC6 C;  4N0B A;  4WYA A;  2W7H A;  3KGX A;  3JZL A;  4UOY A;  2EPJ A;  2GSA A;  3USF A;  3MAD A;  2Z67 A;  3H7F A;  2PB2 A;  4Q6R A;  3WKR A;  4P7Y A;  1CQ7 A;  2BYL A;  3BWN C;  4TV7 A;  3EI5 A;  4Y0D A;  3RCH A;  1AIA A;  1AIC A;  4IY7 A;  3BCX A;  3E6G A;  2VGZ A;  5G2Q A;  4JE5 D;  3CQ5 A;  3WLX A;  3PGY A;  3NUI A;  3PIU A;  1D7U A;  1B5P A;  3GZD C;  3LY1 A;  1AHE A;  5I92 A;  4MGR A;  1MDZ A;  3DC1 A;  3CAI A;  1SZS A;  3DR7 A;  3II0 A;  3WX9 A;  1G4V A;  2DGK A;  1EJI A;  3AOW A;  1JS3 A;  2D7Z A;  5K8B A;  3I4J A;  4ISY A;  5M4B A;  1ASL A;  4BMK A;  3N4R A;  1WYV A;  1W23 A;  4ADC A;  3LG0 A;  1G4X A;  3ECD A;  1M7Y A;  2VMS A;  3EZ1 A;  4JEW A;  4R5F A;  3W1J A;  4PFN A;  3HT4 A;  5LHA A;  3ZRR A;  4WXB A;  1KAF A;  1YNU A;  1V72 A;  1IX7 A;  4ATQ A;  2JJH A;  3PDB B;  5DJ9 A;  1H0C A;  2VGU A;  1C9C A;  1IJI A;  3E9K A;  3JWB A;  3MEB A;  4Q76 A;  4XJO A;  3ATH A;  1UU1 A;  1ARH A;  1EQB A;  1C0N A;  2CFB A;  3WKS A;  4M2M A;  3G7Q A;  4R8D A;  1TAR A;  1RVU A;  2W8J A;  1V2F A;  1RV3 A;  3DYD A;  4JF0 A;  4R2N A;  3MAF A;  4QGR A;  2Z9U A;  3A9Y A;  4RKD A;  5EAV A;  2QMA A;  1ASF A;  1S08 A;  1ASB A;  4I8A A;  3VK3 A;  4ZDO A;  1AJS A;  2CJD A;  2E7J A;  2JJG A;  3ASB A;  4EMY A;  1AAW A;  2ZUK A;  1C4K A;  4OYT A;  1IUG A;  2BI2 A;  3ELE A;  2EO5 A;  2R0T A;  2XBN A;  3F9T A;  1I41 A;  4TN4 A;  4LC3 A;  1D7R A;  4CVQ A;  5EUD A;  3NU7 A;  4WYE A;  5EQC A;  1UKJ A;  3LVM A;  1O4S A;  4Y0I A;  5J8Q A;  4ITX A;  3E77 A;  3I5T A;  7AAT A;  4DGT A;  3EIA A;  3H14 A;  1BS0 A;  1LW4 A;  2W7F A;  1KL2 A;  3FVU A;  2RFV A;  1J04 A;  3HMU A;  3OKS A;  4MY5 A;  4ZM4 A;  3ZZJ A;  2JJF A;  1P3W A;  4GE4 A;  4GE9 A;  2WK7 A;  4XJL A;  5AX8 A;  3W1I A;  2ZY5 A;  4IXS A;  1JG8 A;  1V2E A;  2BKW A;  2ZP7 A;  3FFR A;  3K40 A;  4WD2 A;  3FZ7 A;  1AY4 A;  1DKA A;  2VMR A;  3PPL A;  3QI6 A;  2VIB A;  5D5S A;  1DFO A;  2HOX A;  2YKX A;  4H51 A;  4XK1 A;  3AEJ C;  2OGE A;  2CJG A;  3LV2 A;  2AY6 A;  2Z9X A;  3QGU A;  2YRI A;  4F5G A;  4IYO B;  4MQR A;  5G4J A;  2E54 A;  1AKA A;  4GE7 A;  1CZC A;  1TOK A;  3B1D A;  3MBB A;  4LNJ A;  4M2J A;  1GD9 A;  3B1E A;  1EG5 A;  1QIR A;  1TAS A;  2JGT A;  3NU8 A;  5TF5 A;  3HLM A;  1X28 A;  1YAA A;  1WST A;  3AEJ A;  1ARG A;  2BHX A;  2DGM A;  3HVY A;  4A00 A;  3QHX A;  1YJZ A;  3A2B A;  3DXW A;  2WB6 A;  1BJO B;  3GJU A;  2W7D A;  3NTJ A;  4Q75 A;  3H9X A;  3MKJ A;  1D7S A;  4JEZ A;  1D2F A;  1CZE A;  1O62 A;  1ORD A;  2X3L A;  3FRK A;  3FZ6 A;  1SFF A;  3EI7 A;  4F5J A;  5C6U A;  5JAY A;  2OGA A;  3N4X A;  5EIG B;  4PFF A;  5F9S A;  2VGT A;  3FSL A;  2W7J A;  3CQ4 A;  3FZ8 A;  4XQ2 A;  5E5I A;  4BA4 A;  3R4T A;  4J5U A;  5LH9 A;  3Q8N A;  4ZWM A;  5DX5 A;  5DB5 A;  4AH3 A;  2W8W A;  3B1C A;  1W7L A;  2CTZ A;  3KE3 A;  1XI9 A;  3RI6 A;  3HBX A;  4LW2 A;  3AV7 A;  4A6R A;  1OHW A;  4BHD A;  5IWQ A;  1UU2 A;  1KL1 A;  2ORD A;  4K05 A;  3CBF A;  3DOD A;  4RJY A;  1IAY A;  3K28 A;  4JF1 A;  3VP6 A;  3VAX A;  2CB1 A;  3FDD A;  2JIS A;  5E3K A;  3UAK A;  4TMR A;  3K7Y A;  2D61 A;  1ASC A;  2BIA A;  4JE5 A;  4CBS A;  2Z9W A;  4CXR A;  2VMV A;  1YJS A;  2ZYJ A;  1X29 A;  3IF2 A;  4W5K A;  4AZJ A;  4F5M A;  1OXP A;  3GBX A;  1LKC A;  1ZC9 A;  3DXV A;  3M5U A;  1JF9 A;  1S0A A;  3TFU A;  1CQ8 A;  4F5H A;  3COG A;  1AHX A;  2QB3 A;  4W91 A;  2D5Y A;  2W7E A;  2ZSM A;  4ZAH A;  1XEY A;  2DKJ A;  5D95 A;  5BJ4 A;  4HF8 A;  2YCT A;  1E5F A;  1MGV A;  2YKY A;  2VLH A;  1MLY A;  1WYU A;  1M0Q A;  2G6W A;  1QJ5 A;  2WKA A;  1LC7 A;  1BQD A;  1BW0 A;  3EZS A;  4F5I A;  1QGN A;  1ART A;  4ZAS A;  1FG3 A;  3AEL A;  2YCP A;  1MAP A;  4A6U A;  3NYT A;  3EI6 A;  3G8M A;  4EB7 A;  4M2K A;  2V0Y A;  4CBR A;  4WLJ A;  1W7M A;  4ZWV A;  5EUN A;  1CJ0 A;  4NOG A;  4WYF A;  2HZP A;  4EB5 A;  2CJH A;  2D64 A;  1MLZ A;  2HP1 A;  4RKC A;  4A72 A;  4W1V A;  1B5O A;  2HUI A;  2R2N A;  3FQA A;  4FFC A;  4CXQ A;  1GEX A;  3GR9 A;  3ZRP A;  3N7N A;  3AEP A;  3KKI A;  2AEV A;  3E2Z B;  2KFP A;  1S07 A;  4OT8 A;  1PMO A;  4UHM A;  4ADE A;  1M6S A;  1G7W A;  1WYT B;  3BN1 A;  3VOM A;  1IBJ A;  4AZK A;  3L8A A;  3BCB A;  1T3I A;  5EFS A;  1ZOB A;  4WYC A;  1B9I A;  2F8J A;  3EUC A;  4MQP A;  2X8U A;  4UQV A;  4WXG A;  3PD6 A;  2W8V A;  2C44 A;  1MAQ A;  4GDY A;  3DRD A;  4WB0 B;  2BI9 A;  1B4X A;  1GEW A;  4OMA A;  1M0N A;  1SPA A;  3FKD A;  4MKK A;  3WGB A;  2Z1Y A;  2EH6 A;  2GB3 A;  2FYF A;  3IHJ A;  3HQT A;  1SZK A;  2OQX A;  1BJW A;  1MDX A;  1M0O A;  4RAE A;  2AAT A;  4F4E A;  1CS1 A;  1G7X A;  2AY8 A;  3VK2 A;  5HXX A;  1H1C A;  1IVR A;  4K2B A;  3WGC A;  1SVV A;  3WZF A;  1BKG A;  2D65 A;  2GQN A;  2YOB A;  1W3U A;  5FT8 A;  4A0F A;  3N75 A;  1ASA A;  2FKI A;  1DJ9 A;  1DGE A;  1YOO A;  2BI3 A;  2W8T A;  4ZM3 A;  2VMP A;  2AY2 A;  3TCM A;  1O61 A;  4ADD A;  1ECX A;  1GC2 A;  3NDN A;  2CH1 A;  2ZSL A;  2D7Y A;  1B9H A;  3QN6 A;  2FQ6 A;  3AAT A;  1CL1 A;  2BIE A;  1M4N A;  3W1H A;  3JW9 A;  2ZY3 A;  1KMK A;  3CQ6 A;  3MAU A;  4ITG A;  1B8G A;  1IX6 A;  5EUE A;  4IXZ A;  2OAT A;  2VI8 A;  2QLR A;  4BA5 A;  1YJY A;  1IAX A;  4XJM A;  1ELQ A;  2BWP A;  5BJ3 A;  3EI8 A;  3JU7 A;  1YIY A;  4BQ0 A;  3BWO A;  1AHY A;  3E2Y A;  4E77 A;  3GET A;  3BC8 A;  3TQX A;  2D66 A;  4W8I A;  2QSR A;  5FT5 A;  2O1B A;  1AAM A;  2O7C A;  3KGW A;  3BB8 A;  1X0M A;  9AAT A;  2QBT A;  3QBO A;  2W8U A;  1QIS A;  4F5K A;  2CAN A;  3T32 A;  3A9Z A;  4H63 Q;  2DOU A;  1AHF A;  4UHO A;  3GSB A;  1ARI A;  1CQ6 A;  4GRX A;  3PDB A;  1LS3 A;  4OTL A;  2HP2 A;  4AOA A;  3MAF B;  3RBF A;  2ZY4 A;  2WK8 A;  1AMA A;  1QJ3 A;  1TPL A;  2OKK A;  4FL0 A;  4UHN A;  3VK4 A;  4ATP A;  2HOR A;  4A0G A;  1AJS B;  1BT4 A;  2DKB A;  3F6T A;  5G2P A;  2PO3 A;  1CL2 A;  2C0R A;  2YRR A;  1VP4 A;  2VMN A;  1DJE A;  4R5Z A;  4WP0 A;  2R5C B;  1U08 A;  2FNI A;  3E2Z A;  4E3Q A;  1AIB A;  1AMR A;  1BJ4 A;  2HUF A;  1DGD A;  3NRA A;  4E1O A;  2V1P A;  3QPG A;  1WYT A;  2BI1 A;  3FTB A;  4L0O A;  3HL2 A;  3I16 A;  1FC4 A;  3LVK A;  4JEY A;  3R9A A;  4P3M A;  1JS6 A;  4E3R A;  4EU1 A;  1E5E A;  1OXO A;  3FQ8 A;  1BQA A;  1WKH A;  1LC8 A;  1GC3 A;  5G4I A;  1AKB A;  2YHK A;  4ZDP A;  1SF2 A;  2VI9 A;  4WB0 A;  4XAU A;  3DZZ A;  2BIG A;  4WYD A;  5M46 A;  3WCN A;  1BJN A;  1PMM A;  1N8P A;  4RM1 A;  2NMP A;  5HDM A;  2E7U A;  4OBV A;  1UU0 A;  4K2I A;  3RBL A;  5G09 A;  4K2M A;  2VLF A;  3F0H A;  1LK9 A;  4XEW A;  4AO4 A;  1GC4 A;  3FQ7 A;  3ACZ A;  5KTB A;  1C7O A;  2QB2 A;  2ZY2 A;  3MC6 A;  1SZU A;  2VMX A;  2YKV A;  4WYG A;  3TAT A;  1AY8 A;  2EZ2 A;  2C7T A;  3E2F A;  3NYU A;  4A6T A;  5F8V A;  4IYO A;  1O69 A;  3A8U X;  2FN6 A;  4GSA A;  3BWN A;  1J32 A;  4WLH A;  1C7G A;  2BWN A;  4JEV A;  1YIZ A;  3JTX A;  3NYS A;  3OP7 A;  2VMT A;  1OHY A;  2E7I A;  4IX8 A;  2DGL A;  4EFF A;  3GZD A;  1AHG A;  1BJO A;  2X5D A;  4LNM A;  3GWP A;  3UWC A;  2FNU A;  1Z3Z A;  2VIA A;  3PAA A;  1OHV A;  3PA9 A;  3ZZK A;  2HUU A;  2YCN A;  1TOG A;  2WK9 A;  4J8L A;  4W1X A;  1KMJ A;  2DR1 A;  3ASA A;  2Z9V A;  1GDE A;  2AY9 A;  2BWO A;  5EIG A;  2CST A;  1ZOD A;  2TPL A;  2EZ1 A;  4AO9 A;  4LNL A;  4OBU A;  1RV4 A;  5HHY A;  1Z7D A;  2W7G A;  1D7V A;  4U1T A;  8AAT A;  3AEN B;  1QIT A;  1ASE A;  4IXO A;  4Y0H A;  3L44 A;  1QZ9 A;  2FM1 A;  1W7N A;  2Z20 A;  3AEM C;  4W1W A;  5M49 A;  1LC5 A;  2EYQ A;  3DU4 A;  3B8X A;  1N2T A;  2AEU A;  4MKJ A;  1FG7 A;  3RCH B;  2AY5 A;  1AMS A;  1WKG A;  1ASG A;  3HDO A;  3NX3 A;  4JEX A;  4O6Z A;  2W7M A;  3RUY A;  3EI9 A;  4ADB A;  2ZC0 A;  1N31 A;  1DTY A;  2Z1Z A;  1Y4I A;  2VMZ A;  1RVY A;  4RLG A;  5G0A A;  2R5C A;  1M0P A;  3AEM A;  4WBT A;  1KKP A;  3QM2 A;  4DBC A;  3FD0 A;  3D6K A;  4ZLV A;  3ISL A;  3BV0 A;  2Q7W A;  2VGS A;  3N4S A;  2GMU A;  4DQ6 A;  2W7K A;  3P1T A;  4ZDL A;  2O0R A;  1X2A A;  3FCR A;  4KYO A;  1AKC A;  3JWA A;  1WYU B;  2BI5 A;  2PB0 A;  1WYV B;  4Q31 A;  4A0R A;  1MDO A;  2JG2 A;  3A9X A;  1AJR A;  2CH2 A;  2VMW A;  2QA3 A;  4HVK A;  2Z61 A;  2VMY A;  4KXK A;  3LWS A;  1VJO A;  1DJU A;  2AY4 A;  3UE8 A;  3WY7 A;  1S09 A;  2VMQ A;  1ASM A;  1ELU A;  3BS8 A;  3ZRQ A;  3DR4 A;  2VGV A;  2W7L A;  2C81 A;  3FDB A;  4OC9 A;  3G0T A;  1TOI A;  4RJ0 A;  3LVL B;  5DJ1 A;  1IX8 A;  2XH1 A;  2HOZ A;  1V2D A;  4LW4 A;  1S06 A;  5EAA A;  1PFF A;  1GC0 A;  2A1V A;  1ARS A;  3N5M A;  2VYC A;  2W7I A;  4PIW A;  3WCO A;  3EIB A;  2CIN A;  4A0H A;  4B98 A;  1GCK A;  3TFT A;  2VMO A;  3P6K A;  5M4D A;  1AMQ A;  1ASN A;  1AX4 A;  1GEY A;  1PG8 A;  3BCA A;  3N0L A;  3PDX A;  2EGY A;  3AOV A;  4ZSW A;  2GMS A;  4WXF A;  4KAM A;  4IW7 A;  4B9B A;  1TOE A;  2HOY A;  3B46 A;  2YKU A;  2JJE A;  4PVF A;  1I29 A;  1C7N A;  3NNK A;  2VMU A;  4XJP A;  3RQ1 A;  1OAT A;  4ZSY A;  1I48 A;  4RIT A;  4RIZ A;  2AY1 A;  3LVJ A;  3FFH A;  2D63 A;  3FVS A;  1VEF A;  3PD6 B;  4U2H A;  5FT6 A;  4MQQ A;  2CY8 A;  2OKJ A;  1TOJ A;  3FVX A;  1LW5 A;  4MSO A;  2AY7 A;  4F5L A;  5E4Z A;  4F5F A;  2X5F A;  1I43 A;  1TAT A; 
#chains in the Genus database with same CATH homology
 3GZC A;  4GEB A;  1AY5 A;  3AEO A;  1KKJ A;  3NUB A;  5FT4 A;  1M32 A;  4OCA A;  2BYJ A;  4N0W A;  3AEN A;  1GBN A;  2G7J A;  1ASD A;  2VGW A;  2ZJG A;  2R5E A;  3PJ0 A;  3ELP A;  2AY3 A;  3MC6 C;  4N0B A;  4WYA A;  2W7H A;  3KGX A;  3JZL A;  4UOY A;  2EPJ A;  2GSA A;  3USF A;  3MAD A;  2Z67 A;  3H7F A;  2PB2 A;  4Q6R A;  3WKR A;  4P7Y A;  1CQ7 A;  2BYL A;  3BWN C;  4TV7 A;  3EI5 A;  4Y0D A;  3RCH A;  1AIA A;  1AIC A;  4IY7 A;  3BCX A;  3E6G A;  2VGZ A;  5G2Q A;  4JE5 D;  3CQ5 A;  3WLX A;  3PGY A;  3NUI A;  3PIU A;  1D7U A;  1B5P A;  3GZD C;  3LY1 A;  1AHE A;  5I92 A;  4MGR A;  1MDZ A;  3DC1 A;  3CAI A;  1SZS A;  3DR7 A;  3II0 A;  3WX9 A;  1G4V A;  2DGK A;  1EJI A;  3AOW A;  1JS3 A;  2D7Z A;  5K8B A;  3I4J A;  4ISY A;  5M4B A;  1ASL A;  4BMK A;  3N4R A;  1WYV A;  1W23 A;  4ADC A;  3LG0 A;  1G4X A;  3ECD A;  1M7Y A;  2VMS A;  3EZ1 A;  4JEW A;  4R5F A;  3W1J A;  4PFN A;  3HT4 A;  5LHA A;  3ZRR A;  4WXB A;  1YNU A;  1V72 A;  1IX7 A;  4ATQ A;  2JJH A;  3PDB B;  5DJ9 A;  1H0C A;  2VGU A;  1C9C A;  1IJI A;  3E9K A;  3JWB A;  3MEB A;  4Q76 A;  4XJO A;  3ATH A;  1UU1 A;  1ARH A;  1EQB A;  1C0N A;  2CFB A;  3WKS A;  4M2M A;  3G7Q A;  4R8D A;  1TAR A;  1RVU A;  2W8J A;  1V2F A;  1RV3 A;  3DYD A;  4JF0 A;  4R2N A;  3MAF A;  4QGR A;  2Z9U A;  3A9Y A;  4RKD A;  5EAV A;  2QMA A;  1ASF A;  1S08 A;  1ASB A;  4I8A A;  3VK3 A;  4ZDO A;  1AJS A;  2CJD A;  2E7J A;  2JJG A;  3ASB A;  4EMY A;  1AAW A;  2ZUK A;  1C4K A;  4OYT A;  1IUG A;  2BI2 A;  3ELE A;  2EO5 A;  2R0T A;  2XBN A;  3F9T A;  1I41 A;  4TN4 A;  4LC3 A;  1D7R A;  4CVQ A;  5EUD A;  3NU7 A;  4WYE A;  5EQC A;  1UKJ A;  3LVM A;  1O4S A;  4Y0I A;  5J8Q A;  4ITX A;  3E77 A;  3I5T A;  7AAT A;  4DGT A;  3EIA A;  3H14 A;  1BS0 A;  1LW4 A;  2W7F A;  1KL2 A;  3FVU A;  2RFV A;  1J04 A;  3HMU A;  3OKS A;  4MY5 A;  4ZM4 A;  3ZZJ A;  2JJF A;  1P3W A;  4GE4 A;  4GE9 A;  2WK7 A;  4XJL A;  5AX8 A;  3W1I A;  2ZY5 A;  4IXS A;  1JG8 A;  1V2E A;  2BKW A;  2ZP7 A;  3FFR A;  3K40 A;  4WD2 A;  3FZ7 A;  1AY4 A;  1DKA A;  2VMR A;  3PPL A;  3QI6 A;  2VIB A;  5D5S A;  1DFO A;  2HOX A;  2YKX A;  4H51 A;  4XK1 A;  3AEJ C;  2OGE A;  2CJG A;  3LV2 A;  2AY6 A;  2Z9X A;  3QGU A;  2YRI A;  4F5G A;  4IYO B;  4MQR A;  5G4J A;  2E54 A;  1AKA A;  4GE7 A;  1CZC A;  1TOK A;  3B1D A;  3MBB A;  4LNJ A;  4M2J A;  1GD9 A;  3B1E A;  1EG5 A;  1QIR A;  1TAS A;  2JGT A;  3NU8 A;  5TF5 A;  3HLM A;  1X28 A;  1YAA A;  1WST A;  3AEJ A;  1ARG A;  2BHX A;  2DGM A;  3HVY A;  4A00 A;  3QHX A;  1YJZ A;  3A2B A;  3DXW A;  2WB6 A;  1BJO B;  3GJU A;  2W7D A;  3NTJ A;  4Q75 A;  3H9X A;  3MKJ A;  1D7S A;  4JEZ A;  1D2F A;  1CZE A;  1O62 A;  1ORD A;  2X3L A;  3FRK A;  3FZ6 A;  1SFF A;  3EI7 A;  4F5J A;  5C6U A;  5JAY A;  2OGA A;  3N4X A;  5EIG B;  4PFF A;  5F9S A;  2VGT A;  3FSL A;  2W7J A;  3CQ4 A;  3FZ8 A;  4XQ2 A;  5E5I A;  4BA4 A;  3R4T A;  4J5U A;  5LH9 A;  3Q8N A;  4ZWM A;  5DX5 A;  5DB5 A;  4AH3 A;  2W8W A;  3B1C A;  1W7L A;  2CTZ A;  3KE3 A;  1XI9 A;  3RI6 A;  3HBX A;  4LW2 A;  3AV7 A;  4A6R A;  1OHW A;  4BHD A;  5IWQ A;  1UU2 A;  1KL1 A;  2ORD A;  4K05 A;  3CBF A;  3DOD A;  4RJY A;  1IAY A;  3K28 A;  4JF1 A;  3VP6 A;  3VAX A;  2CB1 A;  3FDD A;  2JIS A;  5E3K A;  3UAK A;  4TMR A;  3K7Y A;  2D61 A;  1ASC A;  2BIA A;  4JE5 A;  4CBS A;  2Z9W A;  4CXR A;  2VMV A;  1YJS A;  2ZYJ A;  1X29 A;  3IF2 A;  4W5K A;  4AZJ A;  4F5M A;  1OXP A;  3GBX A;  1LKC A;  1ZC9 A;  3DXV A;  3M5U A;  1JF9 A;  1S0A A;  3TFU A;  1CQ8 A;  4F5H A;  3COG A;  1AHX A;  2QB3 A;  4W91 A;  2D5Y A;  2W7E A;  2ZSM A;  4ZAH A;  1XEY A;  2DKJ A;  5D95 A;  5BJ4 A;  4HF8 A;  2YCT A;  1E5F A;  1MGV A;  2YKY A;  2VLH A;  1MLY A;  1WYU A;  1M0Q A;  2G6W A;  1QJ5 A;  2WKA A;  1LC7 A;  1BQD A;  1BW0 A;  3EZS A;  4F5I A;  1QGN A;  1ART A;  4ZAS A;  1FG3 A;  3AEL A;  2YCP A;  1MAP A;  4A6U A;  3NYT A;  3EI6 A;  3G8M A;  4EB7 A;  4M2K A;  2V0Y A;  4CBR A;  4WLJ A;  1W7M A;  4ZWV A;  5EUN A;  1CJ0 A;  4NOG A;  4WYF A;  2HZP A;  4EB5 A;  2CJH A;  2D64 A;  1MLZ A;  2HP1 A;  4RKC A;  4A72 A;  4W1V A;  1B5O A;  2HUI A;  2R2N A;  3FQA A;  4FFC A;  4CXQ A;  1GEX A;  3GR9 A;  3ZRP A;  3N7N A;  3AEP A;  3KKI A;  2AEV A;  3E2Z B;  2KFP A;  1S07 A;  4OT8 A;  1PMO A;  4UHM A;  4ADE A;  1M6S A;  1G7W A;  1WYT B;  3BN1 A;  3VOM A;  1IBJ A;  4AZK A;  3L8A A;  3BCB A;  1T3I A;  5EFS A;  1ZOB A;  4WYC A;  1B9I A;  2F8J A;  3EUC A;  4MQP A;  2X8U A;  4UQV A;  4WXG A;  3PD6 A;  2W8V A;  2C44 A;  1MAQ A;  4GDY A;  3DRD A;  4WB0 B;  2BI9 A;  1B4X A;  1GEW A;  4OMA A;  1M0N A;  1SPA A;  3FKD A;  4MKK A;  3WGB A;  2Z1Y A;  2EH6 A;  2GB3 A;  2FYF A;  3IHJ A;  3HQT A;  1SZK A;  2OQX A;  1BJW A;  1MDX A;  1M0O A;  4RAE A;  2AAT A;  4F4E A;  1CS1 A;  1G7X A;  2AY8 A;  3VK2 A;  5HXX A;  1H1C A;  1IVR A;  4K2B A;  3WGC A;  1SVV A;  3WZF A;  1BKG A;  2D65 A;  2GQN A;  2YOB A;  1W3U A;  5FT8 A;  4A0F A;  3N75 A;  1ASA A;  2FKI A;  1DJ9 A;  1DGE A;  1YOO A;  2BI3 A;  2W8T A;  4ZM3 A;  2VMP A;  2AY2 A;  3TCM A;  1O61 A;  4ADD A;  1ECX A;  1GC2 A;  3NDN A;  2CH1 A;  2ZSL A;  2D7Y A;  1B9H A;  3QN6 A;  2FQ6 A;  3AAT A;  1CL1 A;  2BIE A;  1M4N A;  3W1H A;  3JW9 A;  2ZY3 A;  1KMK A;  3CQ6 A;  3MAU A;  4ITG A;  1B8G A;  1IX6 A;  5EUE A;  4IXZ A;  2OAT A;  2VI8 A;  2QLR A;  4BA5 A;  1YJY A;  1IAX A;  4XJM A;  1ELQ A;  2BWP A;  5BJ3 A;  3EI8 A;  3JU7 A;  1YIY A;  4BQ0 A;  3BWO A;  1AHY A;  3E2Y A;  4E77 A;  3GET A;  3BC8 A;  3TQX A;  2D66 A;  4W8I A;  2QSR A;  5FT5 A;  2O1B A;  1AAM A;  2O7C A;  3KGW A;  3BB8 A;  1X0M A;  9AAT A;  2QBT A;  3QBO A;  2W8U A;  1QIS A;  4F5K A;  2CAN A;  3T32 A;  3A9Z A;  4H63 Q;  2DOU A;  1AHF A;  4UHO A;  3GSB A;  1ARI A;  1CQ6 A;  4GRX A;  3PDB A;  1LS3 A;  4OTL A;  2HP2 A;  4AOA A;  3MAF B;  3RBF A;  2ZY4 A;  2WK8 A;  1AMA A;  1QJ3 A;  1TPL A;  2OKK A;  4FL0 A;  4UHN A;  3VK4 A;  4ATP A;  2HOR A;  4A0G A;  1AJS B;  1BT4 A;  2DKB A;  3F6T A;  5G2P A;  2PO3 A;  1CL2 A;  2C0R A;  2YRR A;  1VP4 A;  2VMN A;  1DJE A;  4R5Z A;  4WP0 A;  2R5C B;  1U08 A;  2FNI A;  3E2Z A;  4E3Q A;  1AIB A;  1AMR A;  1BJ4 A;  2HUF A;  1DGD A;  3NRA A;  4E1O A;  2V1P A;  3QPG A;  1WYT A;  2BI1 A;  3FTB A;  4L0O A;  3HL2 A;  3I16 A;  1FC4 A;  3LVK A;  4JEY A;  3R9A A;  4P3M A;  1JS6 A;  4E3R A;  4EU1 A;  1E5E A;  1OXO A;  3FQ8 A;  1BQA A;  1WKH A;  1LC8 A;  1GC3 A;  5G4I A;  1AKB A;  2YHK A;  4ZDP A;  1SF2 A;  2VI9 A;  4WB0 A;  4XAU A;  3DZZ A;  2BIG A;  4WYD A;  5M46 A;  3WCN A;  1BJN A;  1PMM A;  1N8P A;  4RM1 A;  2NMP A;  5HDM A;  2E7U A;  4OBV A;  1UU0 A;  4K2I A;  3RBL A;  5G09 A;  4K2M A;  2VLF A;  3F0H A;  1LK9 A;  4XEW A;  4AO4 A;  1GC4 A;  3FQ7 A;  3ACZ A;  5KTB A;  1C7O A;  2QB2 A;  2ZY2 A;  3MC6 A;  1SZU A;  2VMX A;  2YKV A;  4WYG A;  3TAT A;  1AY8 A;  2EZ2 A;  2C7T A;  3E2F A;  3NYU A;  4A6T A;  5F8V A;  4IYO A;  1O69 A;  3A8U X;  2FN6 A;  4GSA A;  3BWN A;  1J32 A;  4WLH A;  1C7G A;  2BWN A;  4JEV A;  1YIZ A;  3JTX A;  3NYS A;  3OP7 A;  2VMT A;  1OHY A;  2E7I A;  4IX8 A;  2DGL A;  4EFF A;  3GZD A;  1AHG A;  1BJO A;  2X5D A;  4LNM A;  3GWP A;  3UWC A;  2FNU A;  1Z3Z A;  2VIA A;  3PAA A;  1OHV A;  3PA9 A;  3ZZK A;  2HUU A;  2YCN A;  1TOG A;  2WK9 A;  4J8L A;  4W1X A;  1KMJ A;  2DR1 A;  3ASA A;  2Z9V A;  1GDE A;  2AY9 A;  2BWO A;  5EIG A;  2CST A;  1ZOD A;  2TPL A;  2EZ1 A;  4AO9 A;  4LNL A;  4OBU A;  1RV4 A;  5HHY A;  1Z7D A;  2W7G A;  1D7V A;  4U1T A;  8AAT A;  3AEN B;  1QIT A;  1ASE A;  4IXO A;  4Y0H A;  3L44 A;  1QZ9 A;  2FM1 A;  1W7N A;  2Z20 A;  3AEM C;  4W1W A;  5M49 A;  1LC5 A;  2EYQ A;  3DU4 A;  3B8X A;  1N2T A;  2AEU A;  4MKJ A;  1FG7 A;  3RCH B;  2AY5 A;  1AMS A;  1WKG A;  1ASG A;  3HDO A;  3NX3 A;  4JEX A;  4O6Z A;  2W7M A;  3RUY A;  3EI9 A;  4ADB A;  2ZC0 A;  1N31 A;  1DTY A;  2Z1Z A;  1Y4I A;  2VMZ A;  1RVY A;  4RLG A;  5G0A A;  2R5C A;  1M0P A;  3AEM A;  4WBT A;  1KKP A;  3QM2 A;  4DBC A;  3FD0 A;  3D6K A;  4ZLV A;  3ISL A;  3BV0 A;  2Q7W A;  2VGS A;  3N4S A;  2GMU A;  4DQ6 A;  2W7K A;  3P1T A;  4ZDL A;  2O0R A;  1X2A A;  3FCR A;  4KYO A;  1AKC A;  3JWA A;  1WYU B;  2BI5 A;  2PB0 A;  1WYV B;  4Q31 A;  4A0R A;  1MDO A;  2JG2 A;  3A9X A;  1AJR A;  2CH2 A;  2VMW A;  2QA3 A;  4HVK A;  2Z61 A;  2VMY A;  4KXK A;  3LWS A;  1VJO A;  1DJU A;  2AY4 A;  3UE8 A;  3WY7 A;  1S09 A;  2VMQ A;  1ASM A;  1ELU A;  3BS8 A;  3ZRQ A;  3DR4 A;  2VGV A;  2W7L A;  2C81 A;  3FDB A;  4OC9 A;  3G0T A;  1TOI A;  4RJ0 A;  3LVL B;  5DJ1 A;  1IX8 A;  2XH1 A;  2HOZ A;  1V2D A;  4LW4 A;  1S06 A;  5EAA A;  1PFF A;  1GC0 A;  2A1V A;  1ARS A;  3N5M A;  2VYC A;  2W7I A;  4PIW A;  3WCO A;  3EIB A;  2CIN A;  4A0H A;  4B98 A;  1GCK A;  3TFT A;  2VMO A;  3P6K A;  5M4D A;  1AMQ A;  1ASN A;  1AX4 A;  1GEY A;  1PG8 A;  3BCA A;  3N0L A;  3PDX A;  2EGY A;  3AOV A;  4ZSW A;  2GMS A;  4WXF A;  4KAM A;  4IW7 A;  4B9B A;  1TOE A;  2HOY A;  3B46 A;  2YKU A;  2JJE A;  4PVF A;  1I29 A;  1C7N A;  3NNK A;  2VMU A;  4XJP A;  3RQ1 A;  1OAT A;  4ZSY A;  1I48 A;  4RIT A;  4RIZ A;  2AY1 A;  3LVJ A;  3FFH A;  2D63 A;  3FVS A;  1VEF A;  3PD6 B;  4U2H A;  5FT6 A;  4MQQ A;  2CY8 A;  2OKJ A;  1TOJ A;  3FVX A;  1LW5 A;  4MSO A;  2AY7 A;  4F5L A;  5E4Z A;  4F5F A;  2X5F A;  1I43 A;  1TAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...