1QISA

Aspartate aminotransferase from escherichia coli, c191f mutation, with bound maleate
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGFCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Role of Residues Outside the Active Site in Catalysis: Structural Basis for Function of C191 Mutants of E. Coli Aspartate Aminotransferase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Aminotransferase
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 140
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1999-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1qisA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1qisA01
2D64A 2VGUA 3UWCA 1FG3A 4TMRA 4P3MA 1GCKA 4OBUA 2JG2A 4M2MA 4W1WA 4Y0IA 2VGZA 3BV0A 3FFHA 3QPGA 4PFFA 5DJ9A 1SFFA 1AKBA 4LW4A 2HOYA 2YRIA 1AY5A 4WYFA 2E7UA 2JISA 1UKJA 2YOBA 3GZDC 2YRRA 4WXGA 3HT4A 4CXQA 2O7CA 1AICA 2C81A 3RCHB 4F5GA 3RCHA 2C7TA 1TATA 4WYCA 1WYVB 3BN1A 1YOOA 3MEBA 1ASBA 1YIZA 1S09A 2D66A 3EUCA 2X5DA 3NYSA 4OCAA 1CZCA 3NRAA 1ARIA 2ZY2A 1FG7A 2HOZA 1IUGA 2Z9VA 1B4XA 1KKJA 4E3RA 4I8AA 3HDOA 3T32A 2VGTA 4W1VA 3D6KA 1RV3A 1BJ4A 1QJ3A 1BJOA 1C7GA 3DODA 2Z20A 1ASGA 1Y4IA 1B5OA 3LVKA 3VOMA 1IX8A 2R2NA 1UU2A 3BCXA 3JWBA 1X2AA 2VI9A 2Z9UA 3EZ1A 2V1PA 1PG8A 5EQCA 4WLJA 2D5YA 1TASA 3FD0A 2QMAA 4A0HA 4A0FA 1WYUA 4CBRA 4L0OA 1ZOBA 4XAUA 1S08A 3QHXA 2AY8A 2RFVA 3FVSA 1VEFA 1OHVA 2Z1ZA 4ZM3A 2AY6A 1KL2A 3B1DA 1KMKA 2ZJGA 3E6GA 3OP7A 2R5CA 3LWSA 3FZ7A 1AAMA 2VMZA 4Q75A 1AAWA 1VJOA 1WYUB 2BWNA 1LK9A 4EFFA 4F5IA 1YIYA 2VGSA 4ZDOA 1H1CA 4MGRA 1OHYA 2YKUA 1AMQA 1OXOA 3ZZJA 3COGA 1N8PA 4WBTA 2X8UA 3E2ZA 4MKKA 4JE5D 3WKRA 4F5LA 1D7SA 1LC8A 1W3UA 4N0WA 4ATQA 3PDBB 1X29A 2BIGA 2ZY4A 3PGYA 2HP1A 4XJOA 4M2JA 1ORDA 3HVYA 1MLZA 4UQVA 5DB5A 2W8UA 4F5FA 2VMYA 1DJEA 1XI9A 3CQ5A 4IY7A 5C6UA 2W8VA 3ELEA 2VMUA 4TV7A 4XEWA 1H0CA 4JEXA 2X5FA 3PAAA 3AENA 4DBCA 5G09A 1S0AA 1QZ9A 2BWOA 1UU1A 1WYVA 2Z67A 4RJYA 5G0AA 2D7ZA 3WY7A 4R2NA 5G2QA 1CQ6A 2EPJA 4A00A 3FZ8A 2VMWA 1ASDA 3BB8A 2W7LA 1AMRA 1I29A 2D63A 2NMPA 3GSBA 3MKJA 3E77A 5EAAA 4NOGA 1RV4A 4ZSWA 1G7XA 3HBXA 3Q8NA 4WLHA 5LHAA 2PO3A 2W8WA 2DKBA 2YKXA 3ACZA 4AZJA 1DGEA 3GWPA 4DQ6A 1DFOA 5JAYA 3JWAA 4JF0A 2EZ1A 2HOXA 2VMSA 1ASCA 2D7YA 3G7QA 3I4JA 1VP4A 3MAFB 4JF1A 4W91A 5FT8A 4ZAHA 1WSTA 3KKIA 4RKCA 3HLMA 1W7LA 3CQ4A 3E9KA 1AHFA 1PMMA 1RVYA 1M7YA 1CL1A 1D7VA 2CANA 4WD2A 2EO5A 2Q7WA 1BJWA 2CINA 3MAUA 4UHNA 3VP6A 1BQDA 3LVMA 1M0OA 2TPLA 3N75A 4QGRA 1GC3A 2ORDA 4RITA 4IYOB 2E7IA 1ARGA 2CTZA 2GMUA 2O1BA 1GEYA 4MSOA 3LG0A 5HDMA 4PVFA 1ECXA 1QIRA 1IX6A 1G4VA 1I43A 3II0A 3NNKA 3EIAA 4J5UA 4JEVA 3RI6A 5J8QA 3PJ0A 2FN6A 3A9XA 2BI2A 3FDDA 2G6WA 3H7FA 3ZRRA 2BKWA 4BMKA 1C7NA 1OATA 3CAIA 4ZDLA 4E3QA 1ASFA 1BS0A 1GEXA 2V0YA 1SZUA 4ZASA 3AOWA 2D65A 4GE4A 3F6TA 4WYDA 5HHYA 1GDEA 4WXBA 4P7YA 4ZSYA 1CJ0A 1RVUA 2FNUA 2HUUA 3NTJA 3FQ7A 1D7UA 1P3WA 3JW9A 2VLHA 3GBXA 4XJLA 1AY8A 1IAYA 5G2PA 1N31A 1O4SA 3EI5A 4M2KA 5EIGA 3A2BA 4FL0A 2AY7A 2BI9A 2ZP7A 1I48A 4LNMA 2ZY5A 5HXXA 2VMOA 4XJPA 1LKCA 2QB2A 3HQTA 4GEBA 4HF8A 3DXWA 2QA3A 1KKPA 4Q6RA 2E7JA 4BA4A 4Y0HA 4AH3A 2PB0A 2AEVA 3FCRA 4OT8A 5G4IA 3MADA 2ZYJA 5FT6A 3HMUA 4RKDA 1ASAA 3AEMA 1AHYA 1WYTB 4WYAA 5FT5A 4LNJA 5M49A 3FSLA 4EB5A 1AHXA 1BW0A 3BWOA 1G4XA 1Z3ZA 4WP0A 4KXKA 3BS8A 2W7HA 2PB2A 3LVJA 4XQ2A 1ARHA 2OKJA 2Z61A 3EI9A 2W7EA 1V2EA 4TN4A 2QBTA 3A9YA 3GZDA 3DRDA 3WGCA 2HP2A 2YHKA 2F8JA 1W7MA 1CQ7A 4IXOA 4W8IA 1GEWA 3F9TA 2ZY3A 3B46A 2JJHA 3FQAA 3LVLB 3FVXA 3WGBA 2EZ2A 3NYUA 4W1XA 1W7NA 9AATA 4AZKA 3MC6C 3WCOA 1YAAA 3GZCA 4J8LA 2VIBA 2WK8A 1DTYA 2CH1A 3PA9A 3N0LA 4WB0A 3QI6A 4RM1A 3EI6A 3WZFA 1CL2A 3PD6A 2ZC0A 3WCNA 3NUBA 1BT4A 2W7JA 4IX8A 3WLXA 1JG8A 1ZODA 1M6SA 2BIAA 4K2IA 3JU7A 4MQPA 4WXFA 1LS3A 1DJUA 2D61A 1AHGA 3DC1A 2VMNA 2DGMA 2BYLA 4F5MA 3AEPA 5FT4A 3B8XA 4ADBA 4ZM4A 1CS1A 1ARTA 1ARSA 1V2FA 5EFSA 4Q31A 3K40A 1T3IA 2WK9A 2YCPA 3ISLA 1O62A 1O61A 5BJ3A 5EAVA 3BC8A 1BKGA 1PFFA 1UU0A 2DKJA 5IWQA 2CY8A 1LW4A 1MAPA 4E77A 3FKDA 2CSTA 1KMJA 1KL1A 2FYFA 2OQXA 4N0BA 2X3LA 3A8UX 3ASAA 1M0NA 2E54A 2FNIA 3B1CA 3CQ6A 5AX8A 4A6UA 4ZLVA 2DR1A 2HZPA 1GC4A 2VMXA 2VI8A 4MQQA 1OHWA 1TOEA 3P6KA 4IXZA 1OXPA 4ISYA 3W1JA 1AJRA 3FQ8A 1U08A 3WX9A 5M4BA 3TATA 4LNLA 2DGLA 2AY4A 5I92A 3LV2A 4WB0B 3HL2A 2XH1A 2W8JA 1WKHA 2HUIA 3DZZA 4ADEA 4K2MA 3KE3A 4U1TA 2JJEA 5F9SA 8AATA 4HVKA 1TOGA 3FRKA 1C0NA 4MY5A 5TF5A 1ELQA 3EZSA 4JEZA 2AY3A 4GE9A 1V2DA 7AATA 4EB7A 5F8VA 1V72A 3IF2A 3BCAA 1N2TA 2ZSMA 4GRXA 2CJDA 3QN6A 3TFUA 3FTBA 3NYTA 4ITXA 2VIAA 1TARA 1LW5A 2BI5A 2CH2A 1SZSA 2EGYA 3GJUA 1B5PA 1DKAA 2GSAA 3A9ZA 1DGDA 4LW2A 3AELA 4BA5A 3L8AA 4DGTA 3TQXA 2CFBA 3BWNA 3AEJC 1B8GA 1I41A 2BIEA 2GQNA 2R5EA 3NU7A 1EG5A 3NUIA 3QGUA 2QB3A 3M5UA 3TFTA 3ECDA 3AV7A 3ZRPA 5M4DA 2WKAA 2BI1A 2VLFA 1MDZA 4CVQA 2GB3A 2W7DA 4AO9A 4EMYA 2C0RA 4RIZA 2AY2A 4GDYA 3VAXA 1MLYA 4A72A 2R5CB 1GC0A 1LC7A 1QJ5A 1QGNA 4OBVA 2GMSA 4F5KA 2VGWA 3ZRQA 1EJIA 1X0MA 4FFCA 1Z7DA 3RBLA 2ZSLA 3RBFA 3PIUA 3GETA 3WKSA 1BQAA 4PIWA 3G8MA 4RLGA 3AATA 3ELPA 2R0TA 3NX3A 1AKAA 4ADDA 1CQ8A 3R9AA 1ASLA 3ATHA 4AO4A 1GC2A 1SF2A 3JTXA 1ASEA 5M46A 2W7FA 1BJNA 3MAFA 4A6RA 4BHDA 4UHOA 1AX4A 3F0HA 3JZLA 1AY4A 1MAQA 1TOIA 4LC3A 5D5SA 4WYEA 2JJGA 1IJIA 5EIGB 1AHEA 2FM1A 2AEUA 1B9HA 2BYJA 3I16A 4ZWMA 4A0GA 3ASBA 3MBBA 2OGEA 4ATPA 4B98A 2AY5A 4ZDPA 2VYCA 1E5FA 1AKCA 1M32A 3AENB 4PFNA 5D95A 4ZWVA 5BJ4A 1S07A 2CB1A 2W7MA 4AOAA 1M0QA 3DU4A 5EUDA 3QM2A 2C44A 1LC5A 2WK7A 4IXSA 2JJFA 2OATA 4GSAA 3USFA 3MC6A 4F5JA 3KGXA 3EIBA 3RQ1A 1C4KA 2W7KA 3AOVA 3P1TA 1X28A 1IX7A 4U2HA 1GD9A 3PDBA 3VK3A 1ASNA 2CJHA 2Z1YA 4KYOA 5E4ZA 3EI7A 4A6TA 1MDXA 2VMVA 3AEOA 3DR4A 1D2FA 3FVUA 3E2ZB 1IBJA 3L44A 4XK1A 1MDOA 3QBOA 5DJ1A 3IHJA 3AEMC 1CZEA 1E5EA 4RJ0A 4B9BA 1XEYA 2QLRA 4UHMA 4O6ZA 5EUNA 1IVRA 4UOYA 1YNUA 2VMQA 4W5KA 1YJSA 2OKKA 1O69A 1TPLA 3DR7A 1W23A 1J04A 1IAXA 2BI3A 2AY1A 3B1EA 2W7GA 3BCBA 4RAEA 5G4JA 3W1HA 4EU1A 1FC4A 3AEJA 2Z9WA 4CBSA 3N5MA 4K2BA 2BWPA 4BQ0A 1PMOA 4OC9A 2XBNA 5EUEA 2EH6A 1QISA 4JEWA 3FZ6A 4Q76A 4WYGA 4GE7A 1MGVA 4XJMA 4OTLA 5E5IA 4A0RA 3G0TA 3K28A 4KAMA 2VMRA 4E1OA 1ASMA 1YJZA 3GR9A 4R5FA 5K8BA 3BWNC 2YCTA 2O0RA 5DX5A 2HUFA 1SVVA 3EI8A 3FFRA 3PDXA 1GBNA 4H51A 4F4EA 2Z9XA 1WKGA 2AY9A 2W7IA 4ITGA 1WYTA 2VMTA 2ZUKA 4OYTA 3E2YA 4OMAA 3PD6B 4F5HA 2DOUA 1JS3A 3I5TA 3H14A 4JEYA 4JE5A 5E3KA 3DXVA 3K7YA 1M0PA 3TCMA 2JGTA 1AJSA 2YCNA 3R4TA 3ZZKA 2YKYA 3FDBA 2W8TA 4R5ZA 1AIAA 2AATA 2HORA 2DGKA 3LY1A 1YJYA 1AIBA 3VK4A 1S06A 4ADCA 1C9CA 2FQ6A 4R8DA 1SZKA 1AJSB 4MKJA 3UAKA 3W1IA 3RUYA 4Y0DA 1BJOB 1AMSA 1ZC9A 1TOKA 3CBFA 3NDNA 1D7RA 1DJ9A 4IYOA 1AMAA 3E2FA 2CJGA 1SPAA 1TOJA 2VGVA 2VMPA 1EQBA 4MQRA 2OGAA 1M4NA 1J32A 1QITA 1ELUA 3KGWA 4IW7A 3VK2A 3DYDA 1B9IA 2YKVA 3UE8A 3NU8A 5LH9A 3PPLA 1JF9A 1G7WA 4CXRA 1C7OA 2BHXA 1JS6A 3OKSA
chains in the Genus database with same CATH superfamily
2D64A 2VGUA 3UWCA 1FG3A 4TMRA 4P3MA 1GCKA 4OBUA 2JG2A 4M2MA 4W1WA 4Y0IA 2VGZA 3BV0A 3FFHA 3QPGA 4PFFA 5DJ9A 1SFFA 1AKBA 4LW4A 2HOYA 2YRIA 1AY5A 4WYFA 2E7UA 2JISA 1UKJA 2YOBA 3GZDC 2YRRA 4WXGA 3HT4A 4CXQA 2O7CA 1AICA 2C81A 3RCHB 4F5GA 3RCHA 2C7TA 1TATA 4WYCA 1WYVB 3BN1A 1YOOA 3MEBA 1ASBA 1YIZA 1S09A 2D66A 3EUCA 2X5DA 3NYSA 4OCAA 1CZCA 3NRAA 1ARIA 2ZY2A 1FG7A 2HOZA 1IUGA 2Z9VA 1B4XA 1KKJA 4E3RA 4I8AA 3HDOA 3T32A 2VGTA 4W1VA 3D6KA 1RV3A 1BJ4A 1QJ3A 1BJOA 1C7GA 3DODA 2Z20A 1ASGA 1Y4IA 1B5OA 3LVKA 3VOMA 1IX8A 2R2NA 2KFPA 1UU2A 3BCXA 3JWBA 1X2AA 2VI9A 2Z9UA 3EZ1A 2V1PA 1PG8A 5EQCA 4WLJA 2D5YA 1TASA 3FD0A 2QMAA 4A0HA 4A0FA 1WYUA 4CBRA 4L0OA 1ZOBA 4XAUA 1S08A 3QHXA 2AY8A 2RFVA 3FVSA 1VEFA 1OHVA 2Z1ZA 4ZM3A 2AY6A 1KL2A 3B1DA 1KMKA 2ZJGA 3E6GA 3OP7A 2R5CA 3LWSA 3FZ7A 1AAMA 2VMZA 4Q75A 1AAWA 1VJOA 1WYUB 2BWNA 1LK9A 4EFFA 4F5IA 1YIYA 2VGSA 4ZDOA 1H1CA 4MGRA 1OHYA 2YKUA 1AMQA 1OXOA 3ZZJA 3COGA 1N8PA 4WBTA 2X8UA 3E2ZA 4MKKA 4JE5D 3WKRA 4F5LA 1D7SA 1LC8A 1W3UA 4N0WA 4ATQA 3PDBB 1X29A 2BIGA 2ZY4A 3PGYA 2HP1A 4XJOA 4M2JA 1ORDA 3HVYA 1MLZA 4UQVA 5DB5A 2W8UA 4F5FA 2VMYA 1DJEA 1XI9A 3CQ5A 4IY7A 4K05A 5C6UA 2W8VA 3ELEA 2VMUA 4TV7A 4XEWA 1H0CA 4JEXA 2X5FA 3PAAA 3AENA 4DBCA 5G09A 1S0AA 1QZ9A 2BWOA 1UU1A 1WYVA 2Z67A 4RJYA 5G0AA 2D7ZA 3WY7A 4R2NA 5G2QA 1CQ6A 2EPJA 4A00A 3FZ8A 2VMWA 1ASDA 3BB8A 2W7LA 1AMRA 1I29A 2D63A 2NMPA 3GSBA 3MKJA 3E77A 5EAAA 4NOGA 1RV4A 4ZSWA 1G7XA 3HBXA 3Q8NA 4WLHA 5LHAA 2PO3A 2W8WA 2DKBA 2YKXA 3ACZA 4AZJA 1DGEA 3GWPA 4DQ6A 1DFOA 5JAYA 3JWAA 4JF0A 2EZ1A 2HOXA 2VMSA 1ASCA 2D7YA 3G7QA 3I4JA 1VP4A 3MAFB 4JF1A 4W91A 5FT8A 4ZAHA 1WSTA 3KKIA 4RKCA 3HLMA 1W7LA 3CQ4A 3E9KA 1AHFA 1PMMA 1RVYA 1M7YA 1CL1A 1D7VA 2CANA 4WD2A 2EO5A 2Q7WA 1BJWA 2CINA 3MAUA 4UHNA 3VP6A 1BQDA 3LVMA 1M0OA 2TPLA 3N75A 4QGRA 1GC3A 2ORDA 4RITA 4IYOB 2E7IA 1ARGA 2CTZA 2GMUA 2O1BA 1GEYA 4MSOA 3LG0A 5HDMA 4PVFA 1ECXA 1QIRA 1IX6A 1G4VA 1I43A 3II0A 3NNKA 3EIAA 4J5UA 4JEVA 3RI6A 5J8QA 3PJ0A 2FN6A 3A9XA 2BI2A 3FDDA 2G6WA 3H7FA 3ZRRA 2BKWA 4BMKA 1C7NA 1OATA 3CAIA 4ZDLA 4E3QA 1ASFA 1BS0A 1GEXA 2V0YA 1SZUA 4ZASA 3AOWA 2D65A 4GE4A 3F6TA 4WYDA 5HHYA 1GDEA 4WXBA 4P7YA 4ZSYA 1CJ0A 1RVUA 2FNUA 2HUUA 3NTJA 3N4XA 3FQ7A 1D7UA 1P3WA 3JW9A 2VLHA 3GBXA 2A1VA 4XJLA 1AY8A 1IAYA 5G2PA 1N31A 1O4SA 3EI5A 4M2KA 5EIGA 3A2BA 4FL0A 2AY7A 2BI9A 2ZP7A 1I48A 4LNMA 2WB6A 5HXXA 2ZY5A 2VMOA 4XJPA 1LKCA 2QB2A 3HQTA 4GEBA 4HF8A 3DXWA 2QA3A 1KKPA 4Q6RA 2E7JA 4BA4A 4Y0HA 4AH3A 2PB0A 2AEVA 3FCRA 4OT8A 5G4IA 3MADA 2ZYJA 5FT6A 3HMUA 4RKDA 1ASAA 3AEMA 1AHYA 1WYTB 4WYAA 5FT5A 4LNJA 5M49A 3FSLA 4EB5A 1AHXA 1BW0A 3BWOA 1G4XA 1Z3ZA 4WP0A 4KXKA 3BS8A 2W7HA 2PB2A 3LVJA 4XQ2A 1ARHA 2OKJA 2Z61A 3EI9A 2W7EA 1V2EA 4TN4A 2QBTA 3A9YA 3GZDA 3DRDA 3WGCA 2HP2A 2YHKA 2F8JA 1W7MA 1CQ7A 4IXOA 4W8IA 1GEWA 3F9TA 2QSRA 2ZY3A 3B46A 2JJHA 3FQAA 3LVLB 3FVXA 3WGBA 2EZ2A 3NYUA 4W1XA 1W7NA 9AATA 4AZKA 3MC6C 3WCOA 1YAAA 3GZCA 4J8LA 2VIBA 2WK8A 1DTYA 2CH1A 3PA9A 3N0LA 4WB0A 3QI6A 4RM1A 3EI6A 3WZFA 1CL2A 3PD6A 2ZC0A 3WCNA 3NUBA 1BT4A 2W7JA 4IX8A 3WLXA 1JG8A 1ZODA 1M6SA 2BIAA 4K2IA 3JU7A 4MQPA 4WXFA 1LS3A 1DJUA 2D61A 1AHGA 3DC1A 2VMNA 2DGMA 2BYLA 4F5MA 3AEPA 5FT4A 3B8XA 4ADBA 4ZM4A 1CS1A 1ARTA 1ARSA 1V2FA 5EFSA 4Q31A 3K40A 1T3IA 2WK9A 2YCPA 3ISLA 1O62A 1O61A 5BJ3A 5EAVA 3BC8A 3N4SA 1BKGA 1PFFA 1UU0A 2DKJA 5IWQA 2CY8A 1LW4A 1MAPA 4E77A 3FKDA 2CSTA 1KMJA 1KL1A 2FYFA 2OQXA 4N0BA 2X3LA 3A8UX 3ASAA 1M0NA 2E54A 2FNIA 3B1CA 3CQ6A 5AX8A 4A6UA 4ZLVA 2DR1A 2HZPA 1GC4A 2VMXA 2VI8A 4MQQA 1OHWA 1TOEA 3P6KA 4IXZA 1OXPA 4ISYA 3W1JA 1AJRA 3FQ8A 1U08A 3WX9A 5M4BA 3TATA 4LNLA 2DGLA 2AY4A 5I92A 3LV2A 4WB0B 3HL2A 2XH1A 2W8JA 1WKHA 2HUIA 3DZZA 4ADEA 4K2MA 3KE3A 4U1TA 2JJEA 5F9SA 8AATA 4HVKA 1TOGA 3FRKA 1C0NA 4MY5A 5TF5A 1ELQA 3EZSA 4JEZA 2AY3A 4GE9A 1V2DA 7AATA 4EB7A 5F8VA 1V72A 3IF2A 3BCAA 1N2TA 2ZSMA 4GRXA 2CJDA 3QN6A 3TFUA 3FTBA 3NYTA 4ITXA 2VIAA 1TARA 1LW5A 2BI5A 2CH2A 1SZSA 2EGYA 3GJUA 1B5PA 1DKAA 2GSAA 3A9ZA 1DGDA 4LW2A 3AELA 4BA5A 3L8AA 4DGTA 3TQXA 2CFBA 3BWNA 3AEJC 1B8GA 1I41A 2BIEA 2GQNA 2R5EA 3NU7A 1EG5A 3NUIA 3QGUA 2QB3A 3M5UA 3TFTA 3N7NA 3ECDA 3AV7A 3ZRPA 5M4DA 2WKAA 2BI1A 2VLFA 1MDZA 4CVQA 2GB3A 2W7DA 4AO9A 4EMYA 2C0RA 4RIZA 2AY2A 4GDYA 3VAXA 1MLYA 4A72A 2R5CB 1GC0A 1LC7A 1QJ5A 1QGNA 4OBVA 2GMSA 4F5KA 2VGWA 3ZRQA 1EJIA 1X0MA 4FFCA 1Z7DA 3RBLA 2ZSLA 3RBFA 3PIUA 3GETA 3WKSA 1BQAA 4PIWA 3G8MA 4RLGA 3AATA 3ELPA 2R0TA 3NX3A 1AKAA 4ADDA 1CQ8A 3R9AA 1ASLA 3ATHA 4AO4A 1GC2A 1SF2A 3JTXA 1ASEA 5M46A 2W7FA 1BJNA 3MAFA 4A6RA 4BHDA 4UHOA 1AX4A 3F0HA 3JZLA 1AY4A 1KAFA 1MAQA 1TOIA 4LC3A 5D5SA 4WYEA 2JJGA 1IJIA 5EIGB 1AHEA 2FM1A 2AEUA 1B9HA 2BYJA 3I16A 4ZWMA 4A0GA 3ASBA 3MBBA 2OGEA 4ATPA 4B98A 2AY5A 4ZDPA 2VYCA 1E5FA 1AKCA 1M32A 3AENB 4PFNA 5D95A 4ZWVA 5BJ4A 1S07A 2CB1A 2W7MA 4AOAA 1M0QA 3DU4A 5EUDA 3QM2A 2C44A 1LC5A 2WK7A 4IXSA 2JJFA 2OATA 4GSAA 3USFA 3MC6A 4F5JA 3KGXA 3EIBA 3H9XA 3RQ1A 1C4KA 2W7KA 3AOVA 3P1TA 1X28A 1IX7A 4U2HA 1GD9A 3PDBA 3VK3A 1ASNA 2CJHA 2Z1YA 4KYOA 5E4ZA 3EI7A 3N4RA 4A6TA 1MDXA 2VMVA 3AEOA 3DR4A 1D2FA 3FVUA 3E2ZB 1IBJA 3L44A 4XK1A 1MDOA 3QBOA 5DJ1A 3IHJA 3AEMC 2EYQA 1CZEA 1E5EA 4RJ0A 4B9BA 1XEYA 2QLRA 4UHMA 4O6ZA 5EUNA 1IVRA 4UOYA 1YNUA 2VMQA 4W5KA 1YJSA 2OKKA 1O69A 1TPLA 3DR7A 4H63Q 1W23A 1J04A 1IAXA 2BI3A 2AY1A 3B1EA 2W7GA 3BCBA 4RAEA 5G4JA 3W1HA 4EU1A 1FC4A 3AEJA 2Z9WA 4CBSA 3N5MA 4K2BA 5KTBA 2BWPA 4BQ0A 1PMOA 4OC9A 2XBNA 5EUEA 2EH6A 1QISA 4JEWA 3FZ6A 4Q76A 4WYGA 4GE7A 1MGVA 4XJMA 4OTLA 5E5IA 4A0RA 3G0TA 3K28A 4KAMA 2VMRA 4E1OA 1ASMA 1YJZA 3GR9A 4R5FA 5K8BA 3BWNC 2YCTA 2O0RA 5DX5A 2HUFA 1SVVA 3EI8A 3FFRA 3PDXA 1GBNA 4H51A 4F4EA 2Z9XA 1WKGA 2AY9A 2W7IA 4ITGA 1WYTA 2VMTA 2ZUKA 4OYTA 3E2YA 4OMAA 2G7JA 3PD6B 4F5HA 2DOUA 1JS3A 3I5TA 3H14A 4JEYA 4JE5A 5E3KA 3DXVA 3K7YA 1M0PA 3TCMA 2JGTA 1AJSA 2YCNA 3R4TA 3ZZKA 2YKYA 3FDBA 2W8TA 4R5ZA 1AIAA 2AATA 2HORA 2DGKA 3LY1A 1YJYA 1AIBA 3VK4A 1S06A 4ADCA 1C9CA 2FQ6A 4R8DA 1SZKA 1AJSB 4MKJA 3UAKA 3W1IA 3RUYA 4Y0DA 1BJOB 1AMSA 1ZC9A 1TOKA 3CBFA 3NDNA 1D7RA 1DJ9A 4IYOA 1AMAA 3E2FA 2CJGA 1SPAA 1TOJA 2VGVA 2VMPA 1EQBA 4MQRA 2OGAA 1M4NA 1J32A 1QITA 1ELUA 3KGWA 4IW7A 3VK2A 3DYDA 1B9IA 2YKVA 3UE8A 3NU8A 5LH9A 3PPLA 1JF9A 2FKIA 1G7WA 4CXRA 1C7OA 2BHXA 1JS6A 3OKSA
chains in the Genus database with same CATH topology
2D64A 2VGUA 3UWCA 1FG3A 4TMRA 4P3MA 1GCKA 4OBUA 2JG2A 4M2MA 4W1WA 4Y0IA 2VGZA 3BV0A 3FFHA 3QPGA 4PFFA 5DJ9A 1SFFA 1AKBA 4LW4A 2HOYA 2YRIA 1AY5A 4WYFA 2E7UA 2JISA 1UKJA 2YOBA 3GZDC 2YRRA 4WXGA 3HT4A 4CXQA 2O7CA 1AICA 2C81A 3RCHB 4F5GA 3RCHA 2C7TA 1TATA 4WYCA 1WYVB 3BN1A 1YOOA 3MEBA 1ASBA 1YIZA 1S09A 2D66A 3EUCA 2X5DA 3NYSA 4OCAA 1CZCA 3NRAA 1ARIA 2ZY2A 1FG7A 2HOZA 1IUGA 2Z9VA 1B4XA 1KKJA 4E3RA 4I8AA 3HDOA 3T32A 2VGTA 4W1VA 3D6KA 1RV3A 1BJ4A 1QJ3A 1BJOA 1C7GA 3DODA 2Z20A 1ASGA 1Y4IA 1B5OA 3LVKA 3VOMA 1IX8A 2R2NA 2KFPA 1UU2A 3BCXA 3JWBA 1X2AA 2VI9A 2Z9UA 3EZ1A 2V1PA 1PG8A 5EQCA 4WLJA 2D5YA 1TASA 3FD0A 2QMAA 4A0HA 4A0FA 1WYUA 4CBRA 4L0OA 1ZOBA 4XAUA 1S08A 3QHXA 2AY8A 2RFVA 3FVSA 1VEFA 1OHVA 2Z1ZA 4ZM3A 2AY6A 1KL2A 3B1DA 1KMKA 2ZJGA 3E6GA 3OP7A 2R5CA 3LWSA 3FZ7A 1AAMA 2VMZA 4Q75A 1AAWA 1VJOA 1WYUB 2BWNA 1LK9A 4EFFA 4F5IA 1YIYA 2VGSA 4ZDOA 1H1CA 4MGRA 1OHYA 2YKUA 1AMQA 1OXOA 3ZZJA 3COGA 1N8PA 4WBTA 2X8UA 3E2ZA 4MKKA 4JE5D 3WKRA 4F5LA 1D7SA 1LC8A 1W3UA 4N0WA 4ATQA 3PDBB 1X29A 2BIGA 2ZY4A 3PGYA 2HP1A 4XJOA 4M2JA 1ORDA 3HVYA 1MLZA 4UQVA 5DB5A 2W8UA 4F5FA 2VMYA 1DJEA 1XI9A 3CQ5A 4IY7A 4K05A 5C6UA 2W8VA 3ELEA 2VMUA 4TV7A 4XEWA 1H0CA 4JEXA 2X5FA 3PAAA 3AENA 4DBCA 5G09A 1S0AA 1QZ9A 2BWOA 1UU1A 1WYVA 2Z67A 4RJYA 5G0AA 2D7ZA 3WY7A 4R2NA 5G2QA 1CQ6A 2EPJA 4A00A 3FZ8A 2VMWA 1ASDA 3BB8A 2W7LA 1AMRA 1I29A 2D63A 2NMPA 3GSBA 3MKJA 3E77A 5EAAA 4NOGA 1RV4A 4ZSWA 1G7XA 3HBXA 3Q8NA 4WLHA 5LHAA 2PO3A 2W8WA 2DKBA 2YKXA 3ACZA 4AZJA 1DGEA 3GWPA 4DQ6A 1DFOA 5JAYA 3JWAA 4JF0A 2EZ1A 2HOXA 2VMSA 1ASCA 2D7YA 3G7QA 3I4JA 1VP4A 3MAFB 4JF1A 4W91A 5FT8A 4ZAHA 1WSTA 3KKIA 4RKCA 3HLMA 1W7LA 3CQ4A 3E9KA 1AHFA 1PMMA 1RVYA 1M7YA 1CL1A 1D7VA 2CANA 4WD2A 2EO5A 2Q7WA 1BJWA 2CINA 3MAUA 4UHNA 3VP6A 1BQDA 3LVMA 1M0OA 2TPLA 3N75A 4QGRA 1GC3A 2ORDA 4RITA 4IYOB 2E7IA 1ARGA 2CTZA 2GMUA 2O1BA 1GEYA 4MSOA 3LG0A 5HDMA 4PVFA 1ECXA 1QIRA 1IX6A 1G4VA 1I43A 3II0A 3NNKA 3EIAA 4J5UA 4JEVA 3RI6A 5J8QA 3PJ0A 2FN6A 3A9XA 2BI2A 3FDDA 2G6WA 3H7FA 3ZRRA 2BKWA 4BMKA 1C7NA 1OATA 3CAIA 4ZDLA 4E3QA 1ASFA 1BS0A 1GEXA 2V0YA 1SZUA 4ZASA 3AOWA 2D65A 4GE4A 3F6TA 4WYDA 5HHYA 1GDEA 4WXBA 4P7YA 4ZSYA 1CJ0A 1RVUA 2FNUA 2HUUA 3NTJA 3N4XA 3FQ7A 1D7UA 1P3WA 3JW9A 2VLHA 3GBXA 2A1VA 4XJLA 1AY8A 1IAYA 5G2PA 1N31A 1O4SA 3EI5A 4M2KA 5EIGA 3A2BA 4FL0A 2AY7A 2BI9A 2ZP7A 1I48A 4LNMA 2WB6A 5HXXA 2ZY5A 2VMOA 4XJPA 1LKCA 2QB2A 3HQTA 4GEBA 4HF8A 3DXWA 2QA3A 1KKPA 4Q6RA 2E7JA 4BA4A 4Y0HA 4AH3A 2PB0A 2AEVA 3FCRA 4OT8A 5G4IA 3MADA 2ZYJA 5FT6A 3HMUA 4RKDA 1ASAA 3AEMA 1AHYA 1WYTB 4WYAA 5FT5A 4LNJA 5M49A 3FSLA 4EB5A 1AHXA 1BW0A 3BWOA 1G4XA 1Z3ZA 4WP0A 4KXKA 3BS8A 2W7HA 2PB2A 3LVJA 4XQ2A 1ARHA 2OKJA 2Z61A 3EI9A 2W7EA 1V2EA 4TN4A 2QBTA 3A9YA 3GZDA 3DRDA 3WGCA 2HP2A 2YHKA 2F8JA 1W7MA 1CQ7A 4IXOA 4W8IA 1GEWA 3F9TA 2QSRA 2ZY3A 3B46A 2JJHA 3FQAA 3LVLB 3FVXA 3WGBA 2EZ2A 3NYUA 4W1XA 1W7NA 9AATA 4AZKA 3MC6C 3WCOA 1YAAA 3GZCA 4J8LA 2VIBA 2WK8A 1DTYA 2CH1A 3PA9A 3N0LA 4WB0A 3QI6A 4RM1A 3EI6A 3WZFA 1CL2A 3PD6A 2ZC0A 3WCNA 3NUBA 1BT4A 2W7JA 4IX8A 3WLXA 1JG8A 1ZODA 1M6SA 2BIAA 4K2IA 3JU7A 4MQPA 4WXFA 1LS3A 1DJUA 2D61A 1AHGA 3DC1A 2VMNA 2DGMA 2BYLA 4F5MA 3AEPA 5FT4A 3B8XA 4ADBA 4ZM4A 1CS1A 1ARTA 1ARSA 1V2FA 5EFSA 4Q31A 3K40A 1T3IA 2WK9A 2YCPA 3ISLA 1O62A 1O61A 5BJ3A 5EAVA 3BC8A 3N4SA 1BKGA 1PFFA 1UU0A 2DKJA 5IWQA 2CY8A 1LW4A 1MAPA 4E77A 3FKDA 2CSTA 1KMJA 1KL1A 2FYFA 2OQXA 4N0BA 2X3LA 3A8UX 3ASAA 1M0NA 2E54A 2FNIA 3B1CA 3CQ6A 5AX8A 4A6UA 4ZLVA 2DR1A 2HZPA 1GC4A 2VMXA 2VI8A 4MQQA 1OHWA 1TOEA 3P6KA 4IXZA 1OXPA 4ISYA 3W1JA 1AJRA 3FQ8A 1U08A 3WX9A 5M4BA 3TATA 4LNLA 2DGLA 2AY4A 5I92A 3LV2A 4WB0B 3HL2A 2XH1A 2W8JA 1WKHA 2HUIA 3DZZA 4ADEA 4K2MA 3KE3A 4U1TA 2JJEA 5F9SA 8AATA 4HVKA 1TOGA 3FRKA 1C0NA 4MY5A 5TF5A 1ELQA 3EZSA 4JEZA 2AY3A 4GE9A 1V2DA 7AATA 4EB7A 5F8VA 1V72A 3IF2A 3BCAA 1N2TA 2ZSMA 4GRXA 2CJDA 3QN6A 3TFUA 3FTBA 3NYTA 4ITXA 2VIAA 1TARA 1LW5A 2BI5A 2CH2A 1SZSA 2EGYA 3GJUA 1B5PA 1DKAA 2GSAA 3A9ZA 1DGDA 4LW2A 3AELA 4BA5A 3L8AA 4DGTA 3TQXA 2CFBA 3BWNA 3AEJC 1B8GA 1I41A 2BIEA 2GQNA 2R5EA 3NU7A 1EG5A 3NUIA 3QGUA 2QB3A 3M5UA 3TFTA 3N7NA 3ECDA 3AV7A 3ZRPA 5M4DA 2WKAA 2BI1A 2VLFA 1MDZA 4CVQA 2GB3A 2W7DA 4AO9A 4EMYA 2C0RA 4RIZA 2AY2A 4GDYA 3VAXA 1MLYA 4A72A 2R5CB 1GC0A 1LC7A 1QJ5A 1QGNA 4OBVA 2GMSA 4F5KA 2VGWA 3ZRQA 1EJIA 1X0MA 4FFCA 1Z7DA 3RBLA 2ZSLA 3RBFA 3PIUA 3GETA 3WKSA 1BQAA 4PIWA 3G8MA 4RLGA 3AATA 3ELPA 2R0TA 3NX3A 1AKAA 4ADDA 1CQ8A 3R9AA 1ASLA 3ATHA 4AO4A 1GC2A 1SF2A 3JTXA 1ASEA 5M46A 2W7FA 1BJNA 3MAFA 4A6RA 4BHDA 4UHOA 1AX4A 3F0HA 3JZLA 1AY4A 1MAQA 1TOIA 4LC3A 5D5SA 4WYEA 2JJGA 1IJIA 5EIGB 1AHEA 2FM1A 2AEUA 1B9HA 2BYJA 3I16A 4ZWMA 4A0GA 3ASBA 3MBBA 2OGEA 4ATPA 4B98A 2AY5A 4ZDPA 2VYCA 1E5FA 1AKCA 1M32A 3AENB 4PFNA 5D95A 4ZWVA 5BJ4A 1S07A 2CB1A 2W7MA 4AOAA 1M0QA 3DU4A 5EUDA 3QM2A 2C44A 1LC5A 2WK7A 4IXSA 2JJFA 2OATA 4GSAA 3USFA 3MC6A 4F5JA 3KGXA 3EIBA 3H9XA 3RQ1A 1C4KA 2W7KA 3AOVA 3P1TA 1X28A 1IX7A 4U2HA 1GD9A 3PDBA 3VK3A 1ASNA 2CJHA 2Z1YA 4KYOA 5E4ZA 3EI7A 3N4RA 4A6TA 1MDXA 2VMVA 3AEOA 3DR4A 1D2FA 3FVUA 3E2ZB 1IBJA 3L44A 4XK1A 1MDOA 3QBOA 5DJ1A 3IHJA 3AEMC 2EYQA 1CZEA 1E5EA 4RJ0A 4B9BA 1XEYA 2QLRA 4UHMA 4O6ZA 5EUNA 1IVRA 4UOYA 1YNUA 2VMQA 4W5KA 1YJSA 2OKKA 1O69A 1TPLA 3DR7A 4H63Q 1W23A 1J04A 1IAXA 2BI3A 2AY1A 3B1EA 2W7GA 3BCBA 4RAEA 5G4JA 3W1HA 4EU1A 1FC4A 3AEJA 2Z9WA 4CBSA 3N5MA 4K2BA 5KTBA 2BWPA 4BQ0A 1PMOA 4OC9A 2XBNA 5EUEA 2EH6A 1QISA 4JEWA 3FZ6A 4Q76A 4WYGA 4GE7A 1MGVA 4XJMA 4OTLA 5E5IA 4A0RA 3G0TA 3K28A 4KAMA 2VMRA 4E1OA 1ASMA 1YJZA 3GR9A 4R5FA 5K8BA 3BWNC 2YCTA 2O0RA 5DX5A 2HUFA 1SVVA 3EI8A 3FFRA 3PDXA 1GBNA 4H51A 4F4EA 2Z9XA 1WKGA 2AY9A 2W7IA 4ITGA 1WYTA 2VMTA 2ZUKA 4OYTA 3E2YA 4OMAA 2G7JA 3PD6B 4F5HA 2DOUA 1JS3A 3I5TA 3H14A 4JEYA 4JE5A 5E3KA 3DXVA 3K7YA 1M0PA 3TCMA 2JGTA 1AJSA 2YCNA 3R4TA 3ZZKA 2YKYA 3FDBA 2W8TA 4R5ZA 1AIAA 2AATA 2HORA 2DGKA 3LY1A 1YJYA 1AIBA 3VK4A 1S06A 4ADCA 1C9CA 2FQ6A 4R8DA 1SZKA 1AJSB 4MKJA 3UAKA 3W1IA 3RUYA 4Y0DA 1BJOB 1AMSA 1ZC9A 1TOKA 3CBFA 3NDNA 1D7RA 1DJ9A 4IYOA 1AMAA 3E2FA 2CJGA 1SPAA 1TOJA 2VGVA 2VMPA 1EQBA 4MQRA 2OGAA 1M4NA 1J32A 1QITA 1ELUA 3KGWA 4IW7A 3VK2A 3DYDA 1B9IA 2YKVA 3UE8A 3NU8A 5LH9A 3PPLA 1JF9A 2FKIA 1G7WA 4CXRA 1C7OA 2BHXA 1JS6A 3OKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D64 A;  2VGU A;  3UWC A;  1FG3 A;  4TMR A;  4P3M A;  1GCK A;  4OBU A;  2JG2 A;  4M2M A;  4W1W A;  4Y0I A;  2VGZ A;  3BV0 A;  3FFH A;  3QPG A;  4PFF A;  5DJ9 A;  1SFF A;  1AKB A;  4LW4 A;  2HOY A;  2YRI A;  1AY5 A;  4WYF A;  2E7U A;  2JIS A;  1UKJ A;  2YOB A;  3GZD C;  2YRR A;  4WXG A;  3HT4 A;  4CXQ A;  2O7C A;  1AIC A;  2C81 A;  3RCH B;  4F5G A;  3RCH A;  2C7T A;  1TAT A;  4WYC A;  1WYV B;  3BN1 A;  1YOO A;  3MEB A;  1ASB A;  1YIZ A;  1S09 A;  2D66 A;  3EUC A;  2X5D A;  3NYS A;  4OCA A;  1CZC A;  3NRA A;  1ARI A;  2ZY2 A;  1FG7 A;  2HOZ A;  1IUG A;  2Z9V A;  1B4X A;  1KKJ A;  4E3R A;  4I8A A;  3HDO A;  3T32 A;  2VGT A;  4W1V A;  3D6K A;  1RV3 A;  1BJ4 A;  1QJ3 A;  1BJO A;  1C7G A;  3DOD A;  2Z20 A;  1ASG A;  1Y4I A;  1B5O A;  3LVK A;  3VOM A;  1IX8 A;  2R2N A;  1UU2 A;  3BCX A;  3JWB A;  1X2A A;  2VI9 A;  2Z9U A;  3EZ1 A;  2V1P A;  1PG8 A;  5EQC A;  4WLJ A;  2D5Y A;  1TAS A;  3FD0 A;  2QMA A;  4A0H A;  4A0F A;  1WYU A;  4CBR A;  4L0O A;  1ZOB A;  4XAU A;  1S08 A;  3QHX A;  2AY8 A;  2RFV A;  3FVS A;  1VEF A;  1OHV A;  2Z1Z A;  4ZM3 A;  2AY6 A;  1KL2 A;  3B1D A;  1KMK A;  2ZJG A;  3E6G A;  3OP7 A;  2R5C A;  3LWS A;  3FZ7 A;  1AAM A;  2VMZ A;  4Q75 A;  1AAW A;  1VJO A;  1WYU B;  2BWN A;  1LK9 A;  4EFF A;  4F5I A;  1YIY A;  2VGS A;  4ZDO A;  1H1C A;  4MGR A;  1OHY A;  2YKU A;  1AMQ A;  1OXO A;  3ZZJ A;  3COG A;  1N8P A;  4WBT A;  2X8U A;  3E2Z A;  4MKK A;  4JE5 D;  3WKR A;  4F5L A;  1D7S A;  1LC8 A;  1W3U A;  4N0W A;  4ATQ A;  3PDB B;  1X29 A;  2BIG A;  2ZY4 A;  3PGY A;  2HP1 A;  4XJO A;  4M2J A;  1ORD A;  3HVY A;  1MLZ A;  4UQV A;  5DB5 A;  2W8U A;  4F5F A;  2VMY A;  1DJE A;  1XI9 A;  3CQ5 A;  4IY7 A;  5C6U A;  2W8V A;  3ELE A;  2VMU A;  4TV7 A;  4XEW A;  1H0C A;  4JEX A;  2X5F A;  3PAA A;  3AEN A;  4DBC A;  5G09 A;  1S0A A;  1QZ9 A;  2BWO A;  1UU1 A;  1WYV A;  2Z67 A;  4RJY A;  5G0A A;  2D7Z A;  3WY7 A;  4R2N A;  5G2Q A;  1CQ6 A;  2EPJ A;  4A00 A;  3FZ8 A;  2VMW A;  1ASD A;  3BB8 A;  2W7L A;  1AMR A;  1I29 A;  2D63 A;  2NMP A;  3GSB A;  3MKJ A;  3E77 A;  5EAA A;  4NOG A;  1RV4 A;  4ZSW A;  1G7X A;  3HBX A;  3Q8N A;  4WLH A;  5LHA A;  2PO3 A;  2W8W A;  2DKB A;  2YKX A;  3ACZ A;  4AZJ A;  1DGE A;  3GWP A;  4DQ6 A;  1DFO A;  5JAY A;  3JWA A;  4JF0 A;  2EZ1 A;  2HOX A;  2VMS A;  1ASC A;  2D7Y A;  3G7Q A;  3I4J A;  1VP4 A;  3MAF B;  4JF1 A;  4W91 A;  5FT8 A;  4ZAH A;  1WST A;  3KKI A;  4RKC A;  3HLM A;  1W7L A;  3CQ4 A;  3E9K A;  1AHF A;  1PMM A;  1RVY A;  1M7Y A;  1CL1 A;  1D7V A;  2CAN A;  4WD2 A;  2EO5 A;  2Q7W A;  1BJW A;  2CIN A;  3MAU A;  4UHN A;  3VP6 A;  1BQD A;  3LVM A;  1M0O A;  2TPL A;  3N75 A;  4QGR A;  1GC3 A;  2ORD A;  4RIT A;  4IYO B;  2E7I A;  1ARG A;  2CTZ A;  2GMU A;  2O1B A;  1GEY A;  4MSO A;  3LG0 A;  5HDM A;  4PVF A;  1ECX A;  1QIR A;  1IX6 A;  1G4V A;  1I43 A;  3II0 A;  3NNK A;  3EIA A;  4J5U A;  4JEV A;  3RI6 A;  5J8Q A;  3PJ0 A;  2FN6 A;  3A9X A;  2BI2 A;  3FDD A;  2G6W A;  3H7F A;  3ZRR A;  2BKW A;  4BMK A;  1C7N A;  1OAT A;  3CAI A;  4ZDL A;  4E3Q A;  1ASF A;  1BS0 A;  1GEX A;  2V0Y A;  1SZU A;  4ZAS A;  3AOW A;  2D65 A;  4GE4 A;  3F6T A;  4WYD A;  5HHY A;  1GDE A;  4WXB A;  4P7Y A;  4ZSY A;  1CJ0 A;  1RVU A;  2FNU A;  2HUU A;  3NTJ A;  3FQ7 A;  1D7U A;  1P3W A;  3JW9 A;  2VLH A;  3GBX A;  4XJL A;  1AY8 A;  1IAY A;  5G2P A;  1N31 A;  1O4S A;  3EI5 A;  4M2K A;  5EIG A;  3A2B A;  4FL0 A;  2AY7 A;  2BI9 A;  2ZP7 A;  1I48 A;  4LNM A;  2ZY5 A;  5HXX A;  2VMO A;  4XJP A;  1LKC A;  2QB2 A;  3HQT A;  4GEB A;  4HF8 A;  3DXW A;  2QA3 A;  1KKP A;  4Q6R A;  2E7J A;  4BA4 A;  4Y0H A;  4AH3 A;  2PB0 A;  2AEV A;  3FCR A;  4OT8 A;  5G4I A;  3MAD A;  2ZYJ A;  5FT6 A;  3HMU A;  4RKD A;  1ASA A;  3AEM A;  1AHY A;  1WYT B;  4WYA A;  5FT5 A;  4LNJ A;  5M49 A;  3FSL A;  4EB5 A;  1AHX A;  1BW0 A;  3BWO A;  1G4X A;  1Z3Z A;  4WP0 A;  4KXK A;  3BS8 A;  2W7H A;  2PB2 A;  3LVJ A;  4XQ2 A;  1ARH A;  2OKJ A;  2Z61 A;  3EI9 A;  2W7E A;  1V2E A;  4TN4 A;  2QBT A;  3A9Y A;  3GZD A;  3DRD A;  3WGC A;  2HP2 A;  2YHK A;  2F8J A;  1W7M A;  1CQ7 A;  4IXO A;  4W8I A;  1GEW A;  3F9T A;  2ZY3 A;  3B46 A;  2JJH A;  3FQA A;  3LVL B;  3FVX A;  3WGB A;  2EZ2 A;  3NYU A;  4W1X A;  1W7N A;  9AAT A;  4AZK A;  3MC6 C;  3WCO A;  1YAA A;  3GZC A;  4J8L A;  2VIB A;  2WK8 A;  1DTY A;  2CH1 A;  3PA9 A;  3N0L A;  4WB0 A;  3QI6 A;  4RM1 A;  3EI6 A;  3WZF A;  1CL2 A;  3PD6 A;  2ZC0 A;  3WCN A;  3NUB A;  1BT4 A;  2W7J A;  4IX8 A;  3WLX A;  1JG8 A;  1ZOD A;  1M6S A;  2BIA A;  4K2I A;  3JU7 A;  4MQP A;  4WXF A;  1LS3 A;  1DJU A;  2D61 A;  1AHG A;  3DC1 A;  2VMN A;  2DGM A;  2BYL A;  4F5M A;  3AEP A;  5FT4 A;  3B8X A;  4ADB A;  4ZM4 A;  1CS1 A;  1ART A;  1ARS A;  1V2F A;  5EFS A;  4Q31 A;  3K40 A;  1T3I A;  2WK9 A;  2YCP A;  3ISL A;  1O62 A;  1O61 A;  5BJ3 A;  5EAV A;  3BC8 A;  1BKG A;  1PFF A;  1UU0 A;  2DKJ A;  5IWQ A;  2CY8 A;  1LW4 A;  1MAP A;  4E77 A;  3FKD A;  2CST A;  1KMJ A;  1KL1 A;  2FYF A;  2OQX A;  4N0B A;  2X3L A;  3A8U X;  3ASA A;  1M0N A;  2E54 A;  2FNI A;  3B1C A;  3CQ6 A;  5AX8 A;  4A6U A;  4ZLV A;  2DR1 A;  2HZP A;  1GC4 A;  2VMX A;  2VI8 A;  4MQQ A;  1OHW A;  1TOE A;  3P6K A;  4IXZ A;  1OXP A;  4ISY A;  3W1J A;  1AJR A;  3FQ8 A;  1U08 A;  3WX9 A;  5M4B A;  3TAT A;  4LNL A;  2DGL A;  2AY4 A;  5I92 A;  3LV2 A;  4WB0 B;  3HL2 A;  2XH1 A;  2W8J A;  1WKH A;  2HUI A;  3DZZ A;  4ADE A;  4K2M A;  3KE3 A;  4U1T A;  2JJE A;  5F9S A;  8AAT A;  4HVK A;  1TOG A;  3FRK A;  1C0N A;  4MY5 A;  5TF5 A;  1ELQ A;  3EZS A;  4JEZ A;  2AY3 A;  4GE9 A;  1V2D A;  7AAT A;  4EB7 A;  5F8V A;  1V72 A;  3IF2 A;  3BCA A;  1N2T A;  2ZSM A;  4GRX A;  2CJD A;  3QN6 A;  3TFU A;  3FTB A;  3NYT A;  4ITX A;  2VIA A;  1TAR A;  1LW5 A;  2BI5 A;  2CH2 A;  1SZS A;  2EGY A;  3GJU A;  1B5P A;  1DKA A;  2GSA A;  3A9Z A;  1DGD A;  4LW2 A;  3AEL A;  4BA5 A;  3L8A A;  4DGT A;  3TQX A;  2CFB A;  3BWN A;  3AEJ C;  1B8G A;  1I41 A;  2BIE A;  2GQN A;  2R5E A;  3NU7 A;  1EG5 A;  3NUI A;  3QGU A;  2QB3 A;  3M5U A;  3TFT A;  3ECD A;  3AV7 A;  3ZRP A;  5M4D A;  2WKA A;  2BI1 A;  2VLF A;  1MDZ A;  4CVQ A;  2GB3 A;  2W7D A;  4AO9 A;  4EMY A;  2C0R A;  4RIZ A;  2AY2 A;  4GDY A;  3VAX A;  1MLY A;  4A72 A;  2R5C B;  1GC0 A;  1LC7 A;  1QJ5 A;  1QGN A;  4OBV A;  2GMS A;  4F5K A;  2VGW A;  3ZRQ A;  1EJI A;  1X0M A;  4FFC A;  1Z7D A;  3RBL A;  2ZSL A;  3RBF A;  3PIU A;  3GET A;  3WKS A;  1BQA A;  4PIW A;  3G8M A;  4RLG A;  3AAT A;  3ELP A;  2R0T A;  3NX3 A;  1AKA A;  4ADD A;  1CQ8 A;  3R9A A;  1ASL A;  3ATH A;  4AO4 A;  1GC2 A;  1SF2 A;  3JTX A;  1ASE A;  5M46 A;  2W7F A;  1BJN A;  3MAF A;  4A6R A;  4BHD A;  4UHO A;  1AX4 A;  3F0H A;  3JZL A;  1AY4 A;  1MAQ A;  1TOI A;  4LC3 A;  5D5S A;  4WYE A;  2JJG A;  1IJI A;  5EIG B;  1AHE A;  2FM1 A;  2AEU A;  1B9H A;  2BYJ A;  3I16 A;  4ZWM A;  4A0G A;  3ASB A;  3MBB A;  2OGE A;  4ATP A;  4B98 A;  2AY5 A;  4ZDP A;  2VYC A;  1E5F A;  1AKC A;  1M32 A;  3AEN B;  4PFN A;  5D95 A;  4ZWV A;  5BJ4 A;  1S07 A;  2CB1 A;  2W7M A;  4AOA A;  1M0Q A;  3DU4 A;  5EUD A;  3QM2 A;  2C44 A;  1LC5 A;  2WK7 A;  4IXS A;  2JJF A;  2OAT A;  4GSA A;  3USF A;  3MC6 A;  4F5J A;  3KGX A;  3EIB A;  3RQ1 A;  1C4K A;  2W7K A;  3AOV A;  3P1T A;  1X28 A;  1IX7 A;  4U2H A;  1GD9 A;  3PDB A;  3VK3 A;  1ASN A;  2CJH A;  2Z1Y A;  4KYO A;  5E4Z A;  3EI7 A;  4A6T A;  1MDX A;  2VMV A;  3AEO A;  3DR4 A;  1D2F A;  3FVU A;  3E2Z B;  1IBJ A;  3L44 A;  4XK1 A;  1MDO A;  3QBO A;  5DJ1 A;  3IHJ A;  3AEM C;  1CZE A;  1E5E A;  4RJ0 A;  4B9B A;  1XEY A;  2QLR A;  4UHM A;  4O6Z A;  5EUN A;  1IVR A;  4UOY A;  1YNU A;  2VMQ A;  4W5K A;  1YJS A;  2OKK A;  1O69 A;  1TPL A;  3DR7 A;  1W23 A;  1J04 A;  1IAX A;  2BI3 A;  2AY1 A;  3B1E A;  2W7G A;  3BCB A;  4RAE A;  5G4J A;  3W1H A;  4EU1 A;  1FC4 A;  3AEJ A;  2Z9W A;  4CBS A;  3N5M A;  4K2B A;  2BWP A;  4BQ0 A;  1PMO A;  4OC9 A;  2XBN A;  5EUE A;  2EH6 A;  1QIS A;  4JEW A;  3FZ6 A;  4Q76 A;  4WYG A;  4GE7 A;  1MGV A;  4XJM A;  4OTL A;  5E5I A;  4A0R A;  3G0T A;  3K28 A;  4KAM A;  2VMR A;  4E1O A;  1ASM A;  1YJZ A;  3GR9 A;  4R5F A;  5K8B A;  3BWN C;  2YCT A;  2O0R A;  5DX5 A;  2HUF A;  1SVV A;  3EI8 A;  3FFR A;  3PDX A;  1GBN A;  4H51 A;  4F4E A;  2Z9X A;  1WKG A;  2AY9 A;  2W7I A;  4ITG A;  1WYT A;  2VMT A;  2ZUK A;  4OYT A;  3E2Y A;  4OMA A;  3PD6 B;  4F5H A;  2DOU A;  1JS3 A;  3I5T A;  3H14 A;  4JEY A;  4JE5 A;  5E3K A;  3DXV A;  3K7Y A;  1M0P A;  3TCM A;  2JGT A;  1AJS A;  2YCN A;  3R4T A;  3ZZK A;  2YKY A;  3FDB A;  2W8T A;  4R5Z A;  1AIA A;  2AAT A;  2HOR A;  2DGK A;  3LY1 A;  1YJY A;  1AIB A;  3VK4 A;  1S06 A;  4ADC A;  1C9C A;  2FQ6 A;  4R8D A;  1SZK A;  1AJS B;  4MKJ A;  3UAK A;  3W1I A;  3RUY A;  4Y0D A;  1BJO B;  1AMS A;  1ZC9 A;  1TOK A;  3CBF A;  3NDN A;  1D7R A;  1DJ9 A;  4IYO A;  1AMA A;  3E2F A;  2CJG A;  1SPA A;  1TOJ A;  2VGV A;  2VMP A;  1EQB A;  4MQR A;  2OGA A;  1M4N A;  1J32 A;  1QIT A;  1ELU A;  3KGW A;  4IW7 A;  3VK2 A;  3DYD A;  1B9I A;  2YKV A;  3UE8 A;  3NU8 A;  5LH9 A;  3PPL A;  1JF9 A;  1G7W A;  4CXR A;  1C7O A;  2BHX A;  1JS6 A;  3OKS A; 
#chains in the Genus database with same CATH topology
 2D64 A;  2VGU A;  3UWC A;  1FG3 A;  4TMR A;  4P3M A;  1GCK A;  4OBU A;  2JG2 A;  4M2M A;  4W1W A;  4Y0I A;  2VGZ A;  3BV0 A;  3FFH A;  3QPG A;  4PFF A;  5DJ9 A;  1SFF A;  1AKB A;  4LW4 A;  2HOY A;  2YRI A;  1AY5 A;  4WYF A;  2E7U A;  2JIS A;  1UKJ A;  2YOB A;  3GZD C;  2YRR A;  4WXG A;  3HT4 A;  4CXQ A;  2O7C A;  1AIC A;  2C81 A;  3RCH B;  4F5G A;  3RCH A;  2C7T A;  1TAT A;  4WYC A;  1WYV B;  3BN1 A;  1YOO A;  3MEB A;  1ASB A;  1YIZ A;  1S09 A;  2D66 A;  3EUC A;  2X5D A;  3NYS A;  4OCA A;  1CZC A;  3NRA A;  1ARI A;  2ZY2 A;  1FG7 A;  2HOZ A;  1IUG A;  2Z9V A;  1B4X A;  1KKJ A;  4E3R A;  4I8A A;  3HDO A;  3T32 A;  2VGT A;  4W1V A;  3D6K A;  1RV3 A;  1BJ4 A;  1QJ3 A;  1BJO A;  1C7G A;  3DOD A;  2Z20 A;  1ASG A;  1Y4I A;  1B5O A;  3LVK A;  3VOM A;  1IX8 A;  2R2N A;  2KFP A;  1UU2 A;  3BCX A;  3JWB A;  1X2A A;  2VI9 A;  2Z9U A;  3EZ1 A;  2V1P A;  1PG8 A;  5EQC A;  4WLJ A;  2D5Y A;  1TAS A;  3FD0 A;  2QMA A;  4A0H A;  4A0F A;  1WYU A;  4CBR A;  4L0O A;  1ZOB A;  4XAU A;  1S08 A;  3QHX A;  2AY8 A;  2RFV A;  3FVS A;  1VEF A;  1OHV A;  2Z1Z A;  4ZM3 A;  2AY6 A;  1KL2 A;  3B1D A;  1KMK A;  2ZJG A;  3E6G A;  3OP7 A;  2R5C A;  3LWS A;  3FZ7 A;  1AAM A;  2VMZ A;  4Q75 A;  1AAW A;  1VJO A;  1WYU B;  2BWN A;  1LK9 A;  4EFF A;  4F5I A;  1YIY A;  2VGS A;  4ZDO A;  1H1C A;  4MGR A;  1OHY A;  2YKU A;  1AMQ A;  1OXO A;  3ZZJ A;  3COG A;  1N8P A;  4WBT A;  2X8U A;  3E2Z A;  4MKK A;  4JE5 D;  3WKR A;  4F5L A;  1D7S A;  1LC8 A;  1W3U A;  4N0W A;  4ATQ A;  3PDB B;  1X29 A;  2BIG A;  2ZY4 A;  3PGY A;  2HP1 A;  4XJO A;  4M2J A;  1ORD A;  3HVY A;  1MLZ A;  4UQV A;  5DB5 A;  2W8U A;  4F5F A;  2VMY A;  1DJE A;  1XI9 A;  3CQ5 A;  4IY7 A;  4K05 A;  5C6U A;  2W8V A;  3ELE A;  2VMU A;  4TV7 A;  4XEW A;  1H0C A;  4JEX A;  2X5F A;  3PAA A;  3AEN A;  4DBC A;  5G09 A;  1S0A A;  1QZ9 A;  2BWO A;  1UU1 A;  1WYV A;  2Z67 A;  4RJY A;  5G0A A;  2D7Z A;  3WY7 A;  4R2N A;  5G2Q A;  1CQ6 A;  2EPJ A;  4A00 A;  3FZ8 A;  2VMW A;  1ASD A;  3BB8 A;  2W7L A;  1AMR A;  1I29 A;  2D63 A;  2NMP A;  3GSB A;  3MKJ A;  3E77 A;  5EAA A;  4NOG A;  1RV4 A;  4ZSW A;  1G7X A;  3HBX A;  3Q8N A;  4WLH A;  5LHA A;  2PO3 A;  2W8W A;  2DKB A;  2YKX A;  3ACZ A;  4AZJ A;  1DGE A;  3GWP A;  4DQ6 A;  1DFO A;  5JAY A;  3JWA A;  4JF0 A;  2EZ1 A;  2HOX A;  2VMS A;  1ASC A;  2D7Y A;  3G7Q A;  3I4J A;  1VP4 A;  3MAF B;  4JF1 A;  4W91 A;  5FT8 A;  4ZAH A;  1WST A;  3KKI A;  4RKC A;  3HLM A;  1W7L A;  3CQ4 A;  3E9K A;  1AHF A;  1PMM A;  1RVY A;  1M7Y A;  1CL1 A;  1D7V A;  2CAN A;  4WD2 A;  2EO5 A;  2Q7W A;  1BJW A;  2CIN A;  3MAU A;  4UHN A;  3VP6 A;  1BQD A;  3LVM A;  1M0O A;  2TPL A;  3N75 A;  4QGR A;  1GC3 A;  2ORD A;  4RIT A;  4IYO B;  2E7I A;  1ARG A;  2CTZ A;  2GMU A;  2O1B A;  1GEY A;  4MSO A;  3LG0 A;  5HDM A;  4PVF A;  1ECX A;  1QIR A;  1IX6 A;  1G4V A;  1I43 A;  3II0 A;  3NNK A;  3EIA A;  4J5U A;  4JEV A;  3RI6 A;  5J8Q A;  3PJ0 A;  2FN6 A;  3A9X A;  2BI2 A;  3FDD A;  2G6W A;  3H7F A;  3ZRR A;  2BKW A;  4BMK A;  1C7N A;  1OAT A;  3CAI A;  4ZDL A;  4E3Q A;  1ASF A;  1BS0 A;  1GEX A;  2V0Y A;  1SZU A;  4ZAS A;  3AOW A;  2D65 A;  4GE4 A;  3F6T A;  4WYD A;  5HHY A;  1GDE A;  4WXB A;  4P7Y A;  4ZSY A;  1CJ0 A;  1RVU A;  2FNU A;  2HUU A;  3NTJ A;  3N4X A;  3FQ7 A;  1D7U A;  1P3W A;  3JW9 A;  2VLH A;  3GBX A;  2A1V A;  4XJL A;  1AY8 A;  1IAY A;  5G2P A;  1N31 A;  1O4S A;  3EI5 A;  4M2K A;  5EIG A;  3A2B A;  4FL0 A;  2AY7 A;  2BI9 A;  2ZP7 A;  1I48 A;  4LNM A;  2WB6 A;  5HXX A;  2ZY5 A;  2VMO A;  4XJP A;  1LKC A;  2QB2 A;  3HQT A;  4GEB A;  4HF8 A;  3DXW A;  2QA3 A;  1KKP A;  4Q6R A;  2E7J A;  4BA4 A;  4Y0H A;  4AH3 A;  2PB0 A;  2AEV A;  3FCR A;  4OT8 A;  5G4I A;  3MAD A;  2ZYJ A;  5FT6 A;  3HMU A;  4RKD A;  1ASA A;  3AEM A;  1AHY A;  1WYT B;  4WYA A;  5FT5 A;  4LNJ A;  5M49 A;  3FSL A;  4EB5 A;  1AHX A;  1BW0 A;  3BWO A;  1G4X A;  1Z3Z A;  4WP0 A;  4KXK A;  3BS8 A;  2W7H A;  2PB2 A;  3LVJ A;  4XQ2 A;  1ARH A;  2OKJ A;  2Z61 A;  3EI9 A;  2W7E A;  1V2E A;  4TN4 A;  2QBT A;  3A9Y A;  3GZD A;  3DRD A;  3WGC A;  2HP2 A;  2YHK A;  2F8J A;  1W7M A;  1CQ7 A;  4IXO A;  4W8I A;  1GEW A;  3F9T A;  2QSR A;  2ZY3 A;  3B46 A;  2JJH A;  3FQA A;  3LVL B;  3FVX A;  3WGB A;  2EZ2 A;  3NYU A;  4W1X A;  1W7N A;  9AAT A;  4AZK A;  3MC6 C;  3WCO A;  1YAA A;  3GZC A;  4J8L A;  2VIB A;  2WK8 A;  1DTY A;  2CH1 A;  3PA9 A;  3N0L A;  4WB0 A;  3QI6 A;  4RM1 A;  3EI6 A;  3WZF A;  1CL2 A;  3PD6 A;  2ZC0 A;  3WCN A;  3NUB A;  1BT4 A;  2W7J A;  4IX8 A;  3WLX A;  1JG8 A;  1ZOD A;  1M6S A;  2BIA A;  4K2I A;  3JU7 A;  4MQP A;  4WXF A;  1LS3 A;  1DJU A;  2D61 A;  1AHG A;  3DC1 A;  2VMN A;  2DGM A;  2BYL A;  4F5M A;  3AEP A;  5FT4 A;  3B8X A;  4ADB A;  4ZM4 A;  1CS1 A;  1ART A;  1ARS A;  1V2F A;  5EFS A;  4Q31 A;  3K40 A;  1T3I A;  2WK9 A;  2YCP A;  3ISL A;  1O62 A;  1O61 A;  5BJ3 A;  5EAV A;  3BC8 A;  3N4S A;  1BKG A;  1PFF A;  1UU0 A;  2DKJ A;  5IWQ A;  2CY8 A;  1LW4 A;  1MAP A;  4E77 A;  3FKD A;  2CST A;  1KMJ A;  1KL1 A;  2FYF A;  2OQX A;  4N0B A;  2X3L A;  3A8U X;  3ASA A;  1M0N A;  2E54 A;  2FNI A;  3B1C A;  3CQ6 A;  5AX8 A;  4A6U A;  4ZLV A;  2DR1 A;  2HZP A;  1GC4 A;  2VMX A;  2VI8 A;  4MQQ A;  1OHW A;  1TOE A;  3P6K A;  4IXZ A;  1OXP A;  4ISY A;  3W1J A;  1AJR A;  3FQ8 A;  1U08 A;  3WX9 A;  5M4B A;  3TAT A;  4LNL A;  2DGL A;  2AY4 A;  5I92 A;  3LV2 A;  4WB0 B;  3HL2 A;  2XH1 A;  2W8J A;  1WKH A;  2HUI A;  3DZZ A;  4ADE A;  4K2M A;  3KE3 A;  4U1T A;  2JJE A;  5F9S A;  8AAT A;  4HVK A;  1TOG A;  3FRK A;  1C0N A;  4MY5 A;  5TF5 A;  1ELQ A;  3EZS A;  4JEZ A;  2AY3 A;  4GE9 A;  1V2D A;  7AAT A;  4EB7 A;  5F8V A;  1V72 A;  3IF2 A;  3BCA A;  1N2T A;  2ZSM A;  4GRX A;  2CJD A;  3QN6 A;  3TFU A;  3FTB A;  3NYT A;  4ITX A;  2VIA A;  1TAR A;  1LW5 A;  2BI5 A;  2CH2 A;  1SZS A;  2EGY A;  3GJU A;  1B5P A;  1DKA A;  2GSA A;  3A9Z A;  1DGD A;  4LW2 A;  3AEL A;  4BA5 A;  3L8A A;  4DGT A;  3TQX A;  2CFB A;  3BWN A;  3AEJ C;  1B8G A;  1I41 A;  2BIE A;  2GQN A;  2R5E A;  3NU7 A;  1EG5 A;  3NUI A;  3QGU A;  2QB3 A;  3M5U A;  3TFT A;  3N7N A;  3ECD A;  3AV7 A;  3ZRP A;  5M4D A;  2WKA A;  2BI1 A;  2VLF A;  1MDZ A;  4CVQ A;  2GB3 A;  2W7D A;  4AO9 A;  4EMY A;  2C0R A;  4RIZ A;  2AY2 A;  4GDY A;  3VAX A;  1MLY A;  4A72 A;  2R5C B;  1GC0 A;  1LC7 A;  1QJ5 A;  1QGN A;  4OBV A;  2GMS A;  4F5K A;  2VGW A;  3ZRQ A;  1EJI A;  1X0M A;  4FFC A;  1Z7D A;  3RBL A;  2ZSL A;  3RBF A;  3PIU A;  3GET A;  3WKS A;  1BQA A;  4PIW A;  3G8M A;  4RLG A;  3AAT A;  3ELP A;  2R0T A;  3NX3 A;  1AKA A;  4ADD A;  1CQ8 A;  3R9A A;  1ASL A;  3ATH A;  4AO4 A;  1GC2 A;  1SF2 A;  3JTX A;  1ASE A;  5M46 A;  2W7F A;  1BJN A;  3MAF A;  4A6R A;  4BHD A;  4UHO A;  1AX4 A;  3F0H A;  3JZL A;  1AY4 A;  1KAF A;  1MAQ A;  1TOI A;  4LC3 A;  5D5S A;  4WYE A;  2JJG A;  1IJI A;  5EIG B;  1AHE A;  2FM1 A;  2AEU A;  1B9H A;  2BYJ A;  3I16 A;  4ZWM A;  4A0G A;  3ASB A;  3MBB A;  2OGE A;  4ATP A;  4B98 A;  2AY5 A;  4ZDP A;  2VYC A;  1E5F A;  1AKC A;  1M32 A;  3AEN B;  4PFN A;  5D95 A;  4ZWV A;  5BJ4 A;  1S07 A;  2CB1 A;  2W7M A;  4AOA A;  1M0Q A;  3DU4 A;  5EUD A;  3QM2 A;  2C44 A;  1LC5 A;  2WK7 A;  4IXS A;  2JJF A;  2OAT A;  4GSA A;  3USF A;  3MC6 A;  4F5J A;  3KGX A;  3EIB A;  3H9X A;  3RQ1 A;  1C4K A;  2W7K A;  3AOV A;  3P1T A;  1X28 A;  1IX7 A;  4U2H A;  1GD9 A;  3PDB A;  3VK3 A;  1ASN A;  2CJH A;  2Z1Y A;  4KYO A;  5E4Z A;  3EI7 A;  3N4R A;  4A6T A;  1MDX A;  2VMV A;  3AEO A;  3DR4 A;  1D2F A;  3FVU A;  3E2Z B;  1IBJ A;  3L44 A;  4XK1 A;  1MDO A;  3QBO A;  5DJ1 A;  3IHJ A;  3AEM C;  2EYQ A;  1CZE A;  1E5E A;  4RJ0 A;  4B9B A;  1XEY A;  2QLR A;  4UHM A;  4O6Z A;  5EUN A;  1IVR A;  4UOY A;  1YNU A;  2VMQ A;  4W5K A;  1YJS A;  2OKK A;  1O69 A;  1TPL A;  3DR7 A;  4H63 Q;  1W23 A;  1J04 A;  1IAX A;  2BI3 A;  2AY1 A;  3B1E A;  2W7G A;  3BCB A;  4RAE A;  5G4J A;  3W1H A;  4EU1 A;  1FC4 A;  3AEJ A;  2Z9W A;  4CBS A;  3N5M A;  4K2B A;  5KTB A;  2BWP A;  4BQ0 A;  1PMO A;  4OC9 A;  2XBN A;  5EUE A;  2EH6 A;  1QIS A;  4JEW A;  3FZ6 A;  4Q76 A;  4WYG A;  4GE7 A;  1MGV A;  4XJM A;  4OTL A;  5E5I A;  4A0R A;  3G0T A;  3K28 A;  4KAM A;  2VMR A;  4E1O A;  1ASM A;  1YJZ A;  3GR9 A;  4R5F A;  5K8B A;  3BWN C;  2YCT A;  2O0R A;  5DX5 A;  2HUF A;  1SVV A;  3EI8 A;  3FFR A;  3PDX A;  1GBN A;  4H51 A;  4F4E A;  2Z9X A;  1WKG A;  2AY9 A;  2W7I A;  4ITG A;  1WYT A;  2VMT A;  2ZUK A;  4OYT A;  3E2Y A;  4OMA A;  2G7J A;  3PD6 B;  4F5H A;  2DOU A;  1JS3 A;  3I5T A;  3H14 A;  4JEY A;  4JE5 A;  5E3K A;  3DXV A;  3K7Y A;  1M0P A;  3TCM A;  2JGT A;  1AJS A;  2YCN A;  3R4T A;  3ZZK A;  2YKY A;  3FDB A;  2W8T A;  4R5Z A;  1AIA A;  2AAT A;  2HOR A;  2DGK A;  3LY1 A;  1YJY A;  1AIB A;  3VK4 A;  1S06 A;  4ADC A;  1C9C A;  2FQ6 A;  4R8D A;  1SZK A;  1AJS B;  4MKJ A;  3UAK A;  3W1I A;  3RUY A;  4Y0D A;  1BJO B;  1AMS A;  1ZC9 A;  1TOK A;  3CBF A;  3NDN A;  1D7R A;  1DJ9 A;  4IYO A;  1AMA A;  3E2F A;  2CJG A;  1SPA A;  1TOJ A;  2VGV A;  2VMP A;  1EQB A;  4MQR A;  2OGA A;  1M4N A;  1J32 A;  1QIT A;  1ELU A;  3KGW A;  4IW7 A;  3VK2 A;  3DYD A;  1B9I A;  2YKV A;  3UE8 A;  3NU8 A;  5LH9 A;  3PPL A;  1JF9 A;  2FKI A;  1G7W A;  4CXR A;  1C7O A;  2BHX A;  1JS6 A;  3OKS A; 
#chains in the Genus database with same CATH homology
 2D64 A;  2VGU A;  3UWC A;  1FG3 A;  4TMR A;  4P3M A;  1GCK A;  4OBU A;  2JG2 A;  4M2M A;  4W1W A;  4Y0I A;  2VGZ A;  3BV0 A;  3FFH A;  3QPG A;  4PFF A;  5DJ9 A;  1SFF A;  1AKB A;  4LW4 A;  2HOY A;  2YRI A;  1AY5 A;  4WYF A;  2E7U A;  2JIS A;  1UKJ A;  2YOB A;  3GZD C;  2YRR A;  4WXG A;  3HT4 A;  4CXQ A;  2O7C A;  1AIC A;  2C81 A;  3RCH B;  4F5G A;  3RCH A;  2C7T A;  1TAT A;  4WYC A;  1WYV B;  3BN1 A;  1YOO A;  3MEB A;  1ASB A;  1YIZ A;  1S09 A;  2D66 A;  3EUC A;  2X5D A;  3NYS A;  4OCA A;  1CZC A;  3NRA A;  1ARI A;  2ZY2 A;  1FG7 A;  2HOZ A;  1IUG A;  2Z9V A;  1B4X A;  1KKJ A;  4E3R A;  4I8A A;  3HDO A;  3T32 A;  2VGT A;  4W1V A;  3D6K A;  1RV3 A;  1BJ4 A;  1QJ3 A;  1BJO A;  1C7G A;  3DOD A;  2Z20 A;  1ASG A;  1Y4I A;  1B5O A;  3LVK A;  3VOM A;  1IX8 A;  2R2N A;  2KFP A;  1UU2 A;  3BCX A;  3JWB A;  1X2A A;  2VI9 A;  2Z9U A;  3EZ1 A;  2V1P A;  1PG8 A;  5EQC A;  4WLJ A;  2D5Y A;  1TAS A;  3FD0 A;  2QMA A;  4A0H A;  4A0F A;  1WYU A;  4CBR A;  4L0O A;  1ZOB A;  4XAU A;  1S08 A;  3QHX A;  2AY8 A;  2RFV A;  3FVS A;  1VEF A;  1OHV A;  2Z1Z A;  4ZM3 A;  2AY6 A;  1KL2 A;  3B1D A;  1KMK A;  2ZJG A;  3E6G A;  3OP7 A;  2R5C A;  3LWS A;  3FZ7 A;  1AAM A;  2VMZ A;  4Q75 A;  1AAW A;  1VJO A;  1WYU B;  2BWN A;  1LK9 A;  4EFF A;  4F5I A;  1YIY A;  2VGS A;  4ZDO A;  1H1C A;  4MGR A;  1OHY A;  2YKU A;  1AMQ A;  1OXO A;  3ZZJ A;  3COG A;  1N8P A;  4WBT A;  2X8U A;  3E2Z A;  4MKK A;  4JE5 D;  3WKR A;  4F5L A;  1D7S A;  1LC8 A;  1W3U A;  4N0W A;  4ATQ A;  3PDB B;  1X29 A;  2BIG A;  2ZY4 A;  3PGY A;  2HP1 A;  4XJO A;  4M2J A;  1ORD A;  3HVY A;  1MLZ A;  4UQV A;  5DB5 A;  2W8U A;  4F5F A;  2VMY A;  1DJE A;  1XI9 A;  3CQ5 A;  4IY7 A;  4K05 A;  5C6U A;  2W8V A;  3ELE A;  2VMU A;  4TV7 A;  4XEW A;  1H0C A;  4JEX A;  2X5F A;  3PAA A;  3AEN A;  4DBC A;  5G09 A;  1S0A A;  1QZ9 A;  2BWO A;  1UU1 A;  1WYV A;  2Z67 A;  4RJY A;  5G0A A;  2D7Z A;  3WY7 A;  4R2N A;  5G2Q A;  1CQ6 A;  2EPJ A;  4A00 A;  3FZ8 A;  2VMW A;  1ASD A;  3BB8 A;  2W7L A;  1AMR A;  1I29 A;  2D63 A;  2NMP A;  3GSB A;  3MKJ A;  3E77 A;  5EAA A;  4NOG A;  1RV4 A;  4ZSW A;  1G7X A;  3HBX A;  3Q8N A;  4WLH A;  5LHA A;  2PO3 A;  2W8W A;  2DKB A;  2YKX A;  3ACZ A;  4AZJ A;  1DGE A;  3GWP A;  4DQ6 A;  1DFO A;  5JAY A;  3JWA A;  4JF0 A;  2EZ1 A;  2HOX A;  2VMS A;  1ASC A;  2D7Y A;  3G7Q A;  3I4J A;  1VP4 A;  3MAF B;  4JF1 A;  4W91 A;  5FT8 A;  4ZAH A;  1WST A;  3KKI A;  4RKC A;  3HLM A;  1W7L A;  3CQ4 A;  3E9K A;  1AHF A;  1PMM A;  1RVY A;  1M7Y A;  1CL1 A;  1D7V A;  2CAN A;  4WD2 A;  2EO5 A;  2Q7W A;  1BJW A;  2CIN A;  3MAU A;  4UHN A;  3VP6 A;  1BQD A;  3LVM A;  1M0O A;  2TPL A;  3N75 A;  4QGR A;  1GC3 A;  2ORD A;  4RIT A;  4IYO B;  2E7I A;  1ARG A;  2CTZ A;  2GMU A;  2O1B A;  1GEY A;  4MSO A;  3LG0 A;  5HDM A;  4PVF A;  1ECX A;  1QIR A;  1IX6 A;  1G4V A;  1I43 A;  3II0 A;  3NNK A;  3EIA A;  4J5U A;  4JEV A;  3RI6 A;  5J8Q A;  3PJ0 A;  2FN6 A;  3A9X A;  2BI2 A;  3FDD A;  2G6W A;  3H7F A;  3ZRR A;  2BKW A;  4BMK A;  1C7N A;  1OAT A;  3CAI A;  4ZDL A;  4E3Q A;  1ASF A;  1BS0 A;  1GEX A;  2V0Y A;  1SZU A;  4ZAS A;  3AOW A;  2D65 A;  4GE4 A;  3F6T A;  4WYD A;  5HHY A;  1GDE A;  4WXB A;  4P7Y A;  4ZSY A;  1CJ0 A;  1RVU A;  2FNU A;  2HUU A;  3NTJ A;  3N4X A;  3FQ7 A;  1D7U A;  1P3W A;  3JW9 A;  2VLH A;  3GBX A;  2A1V A;  4XJL A;  1AY8 A;  1IAY A;  5G2P A;  1N31 A;  1O4S A;  3EI5 A;  4M2K A;  5EIG A;  3A2B A;  4FL0 A;  2AY7 A;  2BI9 A;  2ZP7 A;  1I48 A;  4LNM A;  2WB6 A;  5HXX A;  2ZY5 A;  2VMO A;  4XJP A;  1LKC A;  2QB2 A;  3HQT A;  4GEB A;  4HF8 A;  3DXW A;  2QA3 A;  1KKP A;  4Q6R A;  2E7J A;  4BA4 A;  4Y0H A;  4AH3 A;  2PB0 A;  2AEV A;  3FCR A;  4OT8 A;  5G4I A;  3MAD A;  2ZYJ A;  5FT6 A;  3HMU A;  4RKD A;  1ASA A;  3AEM A;  1AHY A;  1WYT B;  4WYA A;  5FT5 A;  4LNJ A;  5M49 A;  3FSL A;  4EB5 A;  1AHX A;  1BW0 A;  3BWO A;  1G4X A;  1Z3Z A;  4WP0 A;  4KXK A;  3BS8 A;  2W7H A;  2PB2 A;  3LVJ A;  4XQ2 A;  1ARH A;  2OKJ A;  2Z61 A;  3EI9 A;  2W7E A;  1V2E A;  4TN4 A;  2QBT A;  3A9Y A;  3GZD A;  3DRD A;  3WGC A;  2HP2 A;  2YHK A;  2F8J A;  1W7M A;  1CQ7 A;  4IXO A;  4W8I A;  1GEW A;  3F9T A;  2QSR A;  2ZY3 A;  3B46 A;  2JJH A;  3FQA A;  3LVL B;  3FVX A;  3WGB A;  2EZ2 A;  3NYU A;  4W1X A;  1W7N A;  9AAT A;  4AZK A;  3MC6 C;  3WCO A;  1YAA A;  3GZC A;  4J8L A;  2VIB A;  2WK8 A;  1DTY A;  2CH1 A;  3PA9 A;  3N0L A;  4WB0 A;  3QI6 A;  4RM1 A;  3EI6 A;  3WZF A;  1CL2 A;  3PD6 A;  2ZC0 A;  3WCN A;  3NUB A;  1BT4 A;  2W7J A;  4IX8 A;  3WLX A;  1JG8 A;  1ZOD A;  1M6S A;  2BIA A;  4K2I A;  3JU7 A;  4MQP A;  4WXF A;  1LS3 A;  1DJU A;  2D61 A;  1AHG A;  3DC1 A;  2VMN A;  2DGM A;  2BYL A;  4F5M A;  3AEP A;  5FT4 A;  3B8X A;  4ADB A;  4ZM4 A;  1CS1 A;  1ART A;  1ARS A;  1V2F A;  5EFS A;  4Q31 A;  3K40 A;  1T3I A;  2WK9 A;  2YCP A;  3ISL A;  1O62 A;  1O61 A;  5BJ3 A;  5EAV A;  3BC8 A;  3N4S A;  1BKG A;  1PFF A;  1UU0 A;  2DKJ A;  5IWQ A;  2CY8 A;  1LW4 A;  1MAP A;  4E77 A;  3FKD A;  2CST A;  1KMJ A;  1KL1 A;  2FYF A;  2OQX A;  4N0B A;  2X3L A;  3A8U X;  3ASA A;  1M0N A;  2E54 A;  2FNI A;  3B1C A;  3CQ6 A;  5AX8 A;  4A6U A;  4ZLV A;  2DR1 A;  2HZP A;  1GC4 A;  2VMX A;  2VI8 A;  4MQQ A;  1OHW A;  1TOE A;  3P6K A;  4IXZ A;  1OXP A;  4ISY A;  3W1J A;  1AJR A;  3FQ8 A;  1U08 A;  3WX9 A;  5M4B A;  3TAT A;  4LNL A;  2DGL A;  2AY4 A;  5I92 A;  3LV2 A;  4WB0 B;  3HL2 A;  2XH1 A;  2W8J A;  1WKH A;  2HUI A;  3DZZ A;  4ADE A;  4K2M A;  3KE3 A;  4U1T A;  2JJE A;  5F9S A;  8AAT A;  4HVK A;  1TOG A;  3FRK A;  1C0N A;  4MY5 A;  5TF5 A;  1ELQ A;  3EZS A;  4JEZ A;  2AY3 A;  4GE9 A;  1V2D A;  7AAT A;  4EB7 A;  5F8V A;  1V72 A;  3IF2 A;  3BCA A;  1N2T A;  2ZSM A;  4GRX A;  2CJD A;  3QN6 A;  3TFU A;  3FTB A;  3NYT A;  4ITX A;  2VIA A;  1TAR A;  1LW5 A;  2BI5 A;  2CH2 A;  1SZS A;  2EGY A;  3GJU A;  1B5P A;  1DKA A;  2GSA A;  3A9Z A;  1DGD A;  4LW2 A;  3AEL A;  4BA5 A;  3L8A A;  4DGT A;  3TQX A;  2CFB A;  3BWN A;  3AEJ C;  1B8G A;  1I41 A;  2BIE A;  2GQN A;  2R5E A;  3NU7 A;  1EG5 A;  3NUI A;  3QGU A;  2QB3 A;  3M5U A;  3TFT A;  3N7N A;  3ECD A;  3AV7 A;  3ZRP A;  5M4D A;  2WKA A;  2BI1 A;  2VLF A;  1MDZ A;  4CVQ A;  2GB3 A;  2W7D A;  4AO9 A;  4EMY A;  2C0R A;  4RIZ A;  2AY2 A;  4GDY A;  3VAX A;  1MLY A;  4A72 A;  2R5C B;  1GC0 A;  1LC7 A;  1QJ5 A;  1QGN A;  4OBV A;  2GMS A;  4F5K A;  2VGW A;  3ZRQ A;  1EJI A;  1X0M A;  4FFC A;  1Z7D A;  3RBL A;  2ZSL A;  3RBF A;  3PIU A;  3GET A;  3WKS A;  1BQA A;  4PIW A;  3G8M A;  4RLG A;  3AAT A;  3ELP A;  2R0T A;  3NX3 A;  1AKA A;  4ADD A;  1CQ8 A;  3R9A A;  1ASL A;  3ATH A;  4AO4 A;  1GC2 A;  1SF2 A;  3JTX A;  1ASE A;  5M46 A;  2W7F A;  1BJN A;  3MAF A;  4A6R A;  4BHD A;  4UHO A;  1AX4 A;  3F0H A;  3JZL A;  1AY4 A;  1MAQ A;  1TOI A;  4LC3 A;  5D5S A;  4WYE A;  2JJG A;  1IJI A;  5EIG B;  1AHE A;  2FM1 A;  2AEU A;  1B9H A;  2BYJ A;  3I16 A;  4ZWM A;  4A0G A;  3ASB A;  3MBB A;  2OGE A;  4ATP A;  4B98 A;  2AY5 A;  4ZDP A;  2VYC A;  1E5F A;  1AKC A;  1M32 A;  3AEN B;  4PFN A;  5D95 A;  4ZWV A;  5BJ4 A;  1S07 A;  2CB1 A;  2W7M A;  4AOA A;  1M0Q A;  3DU4 A;  5EUD A;  3QM2 A;  2C44 A;  1LC5 A;  2WK7 A;  4IXS A;  2JJF A;  2OAT A;  4GSA A;  3USF A;  3MC6 A;  4F5J A;  3KGX A;  3EIB A;  3H9X A;  3RQ1 A;  1C4K A;  2W7K A;  3AOV A;  3P1T A;  1X28 A;  1IX7 A;  4U2H A;  1GD9 A;  3PDB A;  3VK3 A;  1ASN A;  2CJH A;  2Z1Y A;  4KYO A;  5E4Z A;  3EI7 A;  3N4R A;  4A6T A;  1MDX A;  2VMV A;  3AEO A;  3DR4 A;  1D2F A;  3FVU A;  3E2Z B;  1IBJ A;  3L44 A;  4XK1 A;  1MDO A;  3QBO A;  5DJ1 A;  3IHJ A;  3AEM C;  2EYQ A;  1CZE A;  1E5E A;  4RJ0 A;  4B9B A;  1XEY A;  2QLR A;  4UHM A;  4O6Z A;  5EUN A;  1IVR A;  4UOY A;  1YNU A;  2VMQ A;  4W5K A;  1YJS A;  2OKK A;  1O69 A;  1TPL A;  3DR7 A;  4H63 Q;  1W23 A;  1J04 A;  1IAX A;  2BI3 A;  2AY1 A;  3B1E A;  2W7G A;  3BCB A;  4RAE A;  5G4J A;  3W1H A;  4EU1 A;  1FC4 A;  3AEJ A;  2Z9W A;  4CBS A;  3N5M A;  4K2B A;  5KTB A;  2BWP A;  4BQ0 A;  1PMO A;  4OC9 A;  2XBN A;  5EUE A;  2EH6 A;  1QIS A;  4JEW A;  3FZ6 A;  4Q76 A;  4WYG A;  4GE7 A;  1MGV A;  4XJM A;  4OTL A;  5E5I A;  4A0R A;  3G0T A;  3K28 A;  4KAM A;  2VMR A;  4E1O A;  1ASM A;  1YJZ A;  3GR9 A;  4R5F A;  5K8B A;  3BWN C;  2YCT A;  2O0R A;  5DX5 A;  2HUF A;  1SVV A;  3EI8 A;  3FFR A;  3PDX A;  1GBN A;  4H51 A;  4F4E A;  2Z9X A;  1WKG A;  2AY9 A;  2W7I A;  4ITG A;  1WYT A;  2VMT A;  2ZUK A;  4OYT A;  3E2Y A;  4OMA A;  2G7J A;  3PD6 B;  4F5H A;  2DOU A;  1JS3 A;  3I5T A;  3H14 A;  4JEY A;  4JE5 A;  5E3K A;  3DXV A;  3K7Y A;  1M0P A;  3TCM A;  2JGT A;  1AJS A;  2YCN A;  3R4T A;  3ZZK A;  2YKY A;  3FDB A;  2W8T A;  4R5Z A;  1AIA A;  2AAT A;  2HOR A;  2DGK A;  3LY1 A;  1YJY A;  1AIB A;  3VK4 A;  1S06 A;  4ADC A;  1C9C A;  2FQ6 A;  4R8D A;  1SZK A;  1AJS B;  4MKJ A;  3UAK A;  3W1I A;  3RUY A;  4Y0D A;  1BJO B;  1AMS A;  1ZC9 A;  1TOK A;  3CBF A;  3NDN A;  1D7R A;  1DJ9 A;  4IYO A;  1AMA A;  3E2F A;  2CJG A;  1SPA A;  1TOJ A;  2VGV A;  2VMP A;  1EQB A;  4MQR A;  2OGA A;  1M4N A;  1J32 A;  1QIT A;  1ELU A;  3KGW A;  4IW7 A;  3VK2 A;  3DYD A;  1B9I A;  2YKV A;  3UE8 A;  3NU8 A;  5LH9 A;  3PPL A;  1JF9 A;  2FKI A;  1G7W A;  4CXR A;  1C7O A;  2BHX A;  1JS6 A;  3OKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...