1QJDA

Flavocytochrome c3 from shewanella frigidimarina
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FLAVOCYTOCHROME C3
publication title Structural and Mechanistic Mapping of a Unique Fumarate Reductase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 197
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 1999-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1qjdA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1qjdA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1qjdA01
2GF3A 3IHMA 2X99A 1FS7A 2WPEA 1KSUA 4FDCB 5ER0A 1S3EA 1JRYA 1YQZA 3DA1A 3CGBA 4YKGA 1D4CA 3IF9A 1MO9A 2E4GA 4ECHA 3DH9A 1PJ6A 4RG3A 4A6NB 3P9UA 3BNGA 2GAHB 2V3AA 5IQ4A 3NGCX 3LADA 1E1MA 2RF7A 4HB9A 2WP5A 1YY5A 2EQ9A 3NNEA 2ZBWA 3ALLA 4J56A 4OPGA 1GXFA 1JNZA 2AQJA 1DXLA 1TDNA 1RSGA 3NLCA 4AT0A 5BUKA 2OLNA 2Z5XA 4EMIA 3LZWA 2RGHA 1K0IA 3AEEA 4YWOA 3T37A 4CY6A 1IUUA 2GQWA 1JRXA 4LA1A 3NYCA 2YVGA 3GMBA 1QDBA 2GRTA 4KX6A 2WOIA 2VQ7A 3QVPA 4BJYA 1JRZA 4USRA 1M6IA 3NYEA 2J7AA 2JAEA 3AWIA 3G5RA 3FBSA 3LZXA 4GDPA 2WESA 4K5SA 4IVOB 4L3YA 4H4VA 4E0VA 3B6DA 2H88A 1ZX9A 3EF6A 3IWAA 4J33A 4YSHA 2JB1A 2YG4A 1B37A 3S5WA 1S3BA 1Q1WA 2E1MA 2V60A 4EM3A 2XLUA 4CCQA 3ADAB 3UP4A 1XANA 2TMDA 3NTDA 3UTHA 1DODA 3K7QX 2YAUA 4H4RA 1PBEA 4K8DA 1D7LA 1FEBA 3COXA 4U2TA 1JNRA 2QAEA 4D04A 4ZCCA 2C66A 2YG7A 4A5LA 4DSGA 3I6DA 4CBQA 1H82A 1TDKA 3NK1X 4OVIA 3H8IA 1D7YA 3GD3A 2O9ZA 1PXAA 4YSZA 2XLPA 1DOEA 2XFUA 3TORA 4H2RA 1ZMCA 4A79A 2RABA 4L3ZA 3CGCA 4Z26A 3UTEA 1LV0A 4EQWA 4USQA 5KVIA 1QO8A 1ELIA 1ZK7A 3SFDA 3UOZA 5HYMA 1F8WA 3G5QA 3VQRA 2BCPA 3AYLA 4X9NA 4EMWA 4EIQA 2GVCA 4EM4A 1Q1RA 2XVHA 4I58A 4J34A 4Q0TA 1DOBA 2EQ8A 4NEVA 3K30A 2RGJA 2GV8A 1PBBA 3DJJA 4GRTA 2YR5A 2GR0A 1GRFA 2YG3A 3GD4A 2AAQA 2GQFA 1CF3A 1PDHA 3UKLA 4EQSA 3C4NA 3ALJA 1GRAA 1TDFA 2OAMA 3GRSA 3Q6JA 1DJQA 4H50A 2R45A 3UKQA 1P2HA 2WDVA 2YQUA 1KFYA 2GAGB 1KSSA 5M0ZA 2XFOA 4TLXA 5U1OA 1IUSA 1CL0A 1VDCA 3UOXA 2C72A 4RSLA 3F29A 2BS4A 1FS8A 5GRTA 3FO3A 4Z43A 3URHA 1NG3A 2IVEA 2C64A 1B8SA 4CNKA 5FMHA 3P4QA 1GETA 1XDIA 2OLOA 1M1QA 4H4TA 1NG4A 4Q17A 2BACA 3DGHA 5FS7A 2X3NA 4H2PA 3AYIA 4KPRA 3DGZA 2JB2A 4NTCA 3VR9A 4CNJA 3Q9TA 1FEAA 4H2NA 1GERA 1UKVG 4H4PA 1FS9A 3L8KA 3SQPA 2YVJA 4NZHA 4A7AA 1GT8A 4OCGA 2Z5YA 5GSNA 2X8HA 2BCGG 3BNHA 1VRQB 3SXQA 3NH3X 1E1NA 1B5QA 2C75A 1DOCA 3NKSA 4TLZA 4A99A 3TTBA 3I3LA 2B9XA 3OC4A 3P4SA 1ZOVA 2WHDA 1GALA 2YVFA 3CNJA 2R0CA 3PS9A 1SP3A 3LG1A 2VR0A 1CJ4A 1GTHA 1TRBA 1CJ2A 3QFBA 2GR2A 5KXJA 1IJHA 1P2EA 1JOAA 1ZMDA 1LVLA 3UTGA 1PBCA 5C2TA 3NTAA 1IUVA 1H81A 4CRTA 2F5ZA 4U8KA 3CNDA 1GSNA 3OZ2A 5DBJA 3K7MX 2YR4A 3BNJA 3BHFA 2B76A 3GDNA 1RP0A 1ONFA 2BS2A 2VVMA 2EQ6A 2C3CA 2XFPA 3P4RA 4K22A 3R9UA 3RHAA 2X8GA 4YKFA 3CNSA 4BURA 2ZZCA 1NPXA 1L9EA 5IPYA 2WU5A 4N9XA 2GR3A 1PHHA 5CKUA 1XHCA 3AB1A 5LV9A 2B7SA 1XPQA 3AD8B 5FS6A 1BWCA 1CC6A 3KPFA 5HXIA 5KOXA 2Q0LA 1VQWA 3M12A 1LPFA 3BNMA 4JY2A 4TM3A 1X31B 4U8LA 3F8DA 1H83A 4U8JA 2YLSA 5KVHA 2QA2A 4C3XA 4JQ9A 3AEBA 2XLRA 3KA7A 3BI4A 3K7TA 3GDPA 3NT6A 1FT5A 4TM0A 4NEWA 4B67A 3EPTA 3GWDA 3EANA 1GRHA 3GYXA 1BKWA 2FBWA 4U2LA 4OPIA 2BC0A 2WOVA 2YWLA 1REOA 3E1TA 4JNAA 4O5UA 2XVJA 2WQYA 3OWMA 5JCKA 2WS3A 3PO7A 2J3NA 3PVCA 1F6MA 2BS3A 3GYIA 3QVRA 4J31A 2XFQA 2JKCA 3ABVA 4X9MA 3NIXA 3AEGA 3AD9B 1MOKA 1Y0PA 3UKKA 3DMEA 3SM8A 5J60A 4OPDA 4H4WA 4TM1A 3AECA 3VR8A 3DK9A 3L1TA 2K3VA 1GPEA 2WP6A 3BI5A 2OALA 4FX9A 3NK0X 5FS8A 2XYOA 2WDRA 4Y4MA 1KDGA 3BNFA 2R4EA 2XVEA 1O5WA 4OPLA 3QFAA 4EIPA 4MJWA 4ZCDA 1GRBA 4Q5CA 3FPZA 3EAOA 1E1KA 1K4QA 2UZZA 1S2QA 2ARDA 2DKIA 3AEFA 1E6EA 2Y6QA 4B68A 4YSXA 5KWFA 4GCMA 1PXCA 5BRTA 4H4XA 1N4UA 1KNPA 1SEZA 2Q0KA 1GTEA 4U8PA 1VG9A 3O0HA 4LIIA 1BGJA 2H89A 3UKFA 4JDRA 4OPTA 4TM4A 1OAHA 1FCDA 2VVLG 1Y56B 2Q6UA 2CULA 4O5QA 5U63A 1YQ3A 1PBFA 2TPRA 1AOGA 3RP7A 3UP5A 3UKAA 1JNIA 4FK1C 2W0HA 5L46A 3RKHA 3LOVA 1KF6A 5FS9A 2R0GA 4IV9A 3BNUA 3NRNA 1GESA 2WPCA 4JN9A 2E5VA 3RP8A 2E80A 1BZLA 1CC2A 1N4VA 2R4JA 3ICSA 1FT6A 4H4QA 4Z2UA 2WP9A 4P9SA 3GWFA 5BVAA 2BA9A 3LGQA 2YM2A 1H86A 3DK8A 2XVIA 4XWRA 2NPXA 4NTDA 2XFNA 1JU2A 2ZZ0A 4EMJA 1N1PA 3G5SA 4B65A 2EQ7A 2FJBA 3ATQA 4U8NA 3UOYA 1GREA 5HY5A 4Y4NA 4Z2RA 2IIDA 1CJ3A 1GV4A 2BK3A 4C3YA 2GMHA 1Z6LA 2CVJA 1M64A 2ZZBA 1H6VA 4H4SA 4RG4A 3ZYXA 1W4XA 3B3RA 2V61A 3QJ4A 2YLTA 2E81A 4JNQA 1Y56A 4ZN0A 2ACZA 5JCNA 1S2YA 5HHFA 4PABA 1M1RA 1O94A 3C4AA 4GF7A 2FJEA 2GH5A 3S61A 3UOVA 1L0VA 4BK1A 4Q1OA 2RGOA 3NG7X 2B9YA 3AYJA 4B69A 3ITJA 3KD9A 1LTXR 2XLTA 4HA6A 2VOUA 1MXTA 1IUXA 5U25A 1OJCA 1NHQA 2C67A 2XCGA 2C65A 1TDOA 2RDZA 2IVDA 3CNTA 4B63A 3BHKA 1E1LA 1PJ5A 3SFEA 4BK3A 3AE2A 4C5OA 1F8RA 2NVKX 3AE1A 3GMCA 4K2XA 4U2SA 3UTFA 4A9WA 2PHHA 3HZLA 1COYA 1NAAA 4AP3A 2R46A 3AE4A 1GNDA 2WOWA 4D03A 3H8LA 5EB5A 2WU2A 4BK2A 4Z25A 3LB8A 2WPFA 4UDQA 3GM6A 4A65A 4DSHA 1N4WA 2BC1A 4REKA 5EOWA 3ZDNA 3ALMA 4YTNA 4B1BA 4AOXA 5JCIA 4WJYA 3NK2X 2QCUA 1YQ4A 1IUWA 3VRAA 2V5ZA 1BGNA 2WDQA 1ZKQA 3D1IA 5IQ1A 1E39A 1D5TA 3UKPA 2LFCA 3RP6A 5J7XA 3UCLA 4WX1A 4JY3A 4Q4UA 3IC9A 3H4KA 3CPJG 4M52A 4U8IA 1GU6A 2A8XA 3LJPA 4GDEA 4XXGA 2GEWA 4YTMA 2Y6RA 5M10A 2A87A 2YLZA 1OJ9A 1Q9IA 4CY8A 3VRBA 2XDOA 1NHSA 1DJNA 4IVMB 4ICYA 2YLRA 2YG5A 1M1PA 1PBDA 4BJZA 1K0JA 2I0ZA 2DKHA 3AEAA 2VRMA 2YLXA 1PXBA 4K5RA 3WE0A 3SCEA 2Q7VA 3P1WA 2BK4A 4U8OA 3QSEA 3DK4A 1H7WA 2XLSA 4AP1A 4YT0A 1O95A 1DNCA 2FJAA 5JCMA 1FL2A 3UKHA 2GMJA 3DJEA 1L9DA 3FIMB 1EBDA 3CGDA 1JEHA 3ISHA 4UP3A 1BVBA 4H2QA 4J57A 2C70A 4IA6A 1TYTA 3LXDA 3AXBA 4YSYA 1EL8A 2B7RA 2JB3A 3GSIA 1LJ1A 1EL7A 3F8PA 1EL9A 1IUTA 1GEUA 4XWZA 3AD7B 3V3OA 2QA1A 1ZY8A 2BABA 3CPIG 5JCLA 3QSSA 4YXDA 4Q5BA 2HQMA 4OPUA 5EBKA 4YTPA 3ICRA 4L38A 1D4DA 4PAAA 3AE5A 1KNRA 4A6NA 2BXRA 4L3XA 2ZO5A 3CGEA 2APGA 1LQTA 2VVLA 3RNMA 3C96A 2V3BA 1K0LA 4EQRA 4BV6A 5BULA 4U8MA 4Z44A 4EQXA 3DJGX 1CHUA 2VZ2A 1NHRA 2BYBA 2CDUA 3KLJA 3NHOX 3P4PA 4I59A 5TR3A 4B64A 2R9ZA 1F3PA 2PYXA 3S7WA 4IA5A 4C74A 1E7PA 3DJDA 1NENA 3CIRA 3IHGA 1TYPA 4DNAA 3F8RA 2YM1A 1FECA 1GRTA 1H7XA 1LQUA 2X50A 4UDRA 5CQFA 5KOWA 1F8SA 1FOHA 1CBOA 4H4ZA 3FMWA 1HYUA 4GUVA 1CC4A 4J36A 1GRGA 3CNPA 3GYJA 4CCRA 1YKJA 1CJCA 2GB0A 3ATRA 5KRQA 3KU9A 2JBVA 3AEDA 4FK1A 1PJ7A 5EB4A 3L1RA 1H84A 3NN0X 3FG2P 3NYFA 1ZDLA 3AE7A 2WEUA 2FJDA 2C3DA 1NDAA 2YR6A 3AE6A 3CPHG 1QLBA 2BXSA 3VRDB 2OA1A 5C3JA 3UU9A 1EL5A 2JK6A 1RYIA 2BK5A 2AR8A 2YG6A 1QJDA 4K7ZA 2C73A 3KVEA 1OJAA 4APNA 1NEKA 3D1CA 2CFYA 3M13A 4DGKA 2OT4A 3CN8A 3II4A 1NHPA 4WCTA 3SGLA 2YLWA 3CTYA 4ADWA 4AOSA 1PN0A 3MMOA 4NTEA 4OPCA 2R0PA 4GR1A 3REDA 1L9CA 2A89A 1OJTA 2WETA 2X8CA 1D4EA 3QSMA 2VRLA 1B4VA 2GR1A 3NN6X 4UDPA 4J2WA 2B9WA 1TDEA 2VQBA 1PS9A 3M0OA 3AE9A 3V76A 1GOSA 2C76A 2WBAA 2C7GA 3AE3A 3BI2A 4H4UA 3D8XA 4LU6A 4Z24A 3ICTA 4C77A 4Z2TA 2XVFA 3AE8A 1VG0A 1ZP0A 4X4JA 3GRTA 3V3NA 1ZOYA 4H4YA 4B66A 1BF3A 1OJDA 3UBRA 4AT2A 4Y4LA 2V6OA 3JSKA 1V59A 3KKJA 4H7UA
chains in the Genus database with same CATH superfamily
2GF3A 3IHMA 2X99A 1FS7A 2WPEA 1KSUA 4FDCB 5ER0A 3T31A 1S3EA 1JRYA 1YQZA 3DA1A 3CGBA 3HYXA 4YKGA 1D4CA 3IF9A 1MO9A 2E4GA 4G74A 3DH9A 1PJ6A 4RG3A 4A6NB 3P9UA 3BNGA 2GAHB 2V3AA 5IQ4A 3NGCX 3LADA 1E1MA 2RF7A 4HB9A 2WP5A 1YY5A 2EQ9A 3NNEA 2ZBWA 3ALLA 4J56A 4G6GA 4OPGA 3SZ0A 1GXFA 1JNZA 2AQJA 1DXLA 1TDNA 1RSGA 3NLCA 4AT0A 2C4CA 5BUKA 2OLNA 2Z5XA 4EMIA 3LZWA 2RGHA 1K0IA 3AEEA 4YWOA 3T37A 4CY6A 1IUUA 2GQWA 1JRXA 4LA1A 3NYCA 4NWZA 2YVGA 3GMBA 1QDBA 2GRTA 4KX6A 2WOIA 2VQ7A 3QVPA 4BJYA 1JRZA 4USRA 1M6IA 3NYEA 2J7AA 2JAEA 3AWIA 3G5RA 3FBSA 3LZXA 4GDPA 2WESA 4K5SA 4IVOB 4L3YA 4H4VA 4E0VA 3B6DA 2H88A 1ZX9A 3EF6A 3IWAA 4J33A 4YSHA 2JB1A 2YG4A 1B37A 3S5WA 2CZSA 1S3BA 1Q1WA 3SZCA 2E1MA 2V60A 4EM3A 2XLUA 3T2YA 4CCQA 3ADAB 3UP4A 1XANA 2TMDA 3NTDA 3UTHA 1DODA 3K7QX 2YAUA 4H4RA 1PBEA 4K8DA 1D7LA 1FEBA 3COXA 4U2TA 1JNRA 2QAEA 4D04A 4ZCCA 2C66A 2YG7A 4A5LA 4DSGA 3I6DA 4CBQA 1H82A 1TDKA 3NK1X 4OVIA 3H8IA 1D7YA 3GD3A 2O9ZA 1PXAA 4YSZA 2XLPA 1DOEA 2XFUA 3T14A 3TORA 4H2RA 1ZMCA 4A79A 2RABA 4L3ZA 3CGCA 4Z26A 3UTEA 1LV0A 4EQWA 4USQA 5KVIA 1QO8A 1ELIA 1ZK7A 3SFDA 3UOZA 5HYMA 5KMPA 1F8WA 3G5QA 3VQRA 2BCPA 3AYLA 4X9NA 4EMWA 4EIQA 2GVCA 4GAVA 4EM4A 1Q1RA 2XVHA 4II3A 4I58A 4J34A 4Q0TA 1DOBA 2EQ8A 4NEVA 3K30A 2RGJA 2GV8A 1PBBA 3DJJA 4GRTA 2YR5A 3SZWA 2GR0A 1GRFA 2YG3A 3GD4A 2AAQA 2GQFA 1CF3A 1PDHA 3UKLA 4EQSA 3C4NA 3ALJA 1GRAA 1TDFA 2OAMA 3GRSA 3Q6JA 1DJQA 4H50A 2R45A 3UKQA 1P2HA 2WDVA 2YQUA 1KFYA 2GAGB 1KSSA 5M0ZA 2XFOA 4TLXA 5U1OA 1IUSA 1CL0A 1VDCA 3UOXA 2C72A 4RSLA 3F29A 2BS4A 1FS8A 5GRTA 3FO3A 4Z43A 3URHA 1NG3A 2IVEA 2C64A 1B8SA 4CNKA 5FMHA 3P4QA 1GETA 1XDIA 2OLOA 1M1QA 4H4TA 1NG4A 4Q17A 2BACA 3DGHA 5FS7A 2X3NA 4H2PA 3AYIA 4KPRA 4NNJA 3DGZA 2JB2A 4NTCA 3VR9A 4CNJA 3Q9TA 1FEAA 4H2NA 1GERA 1UKVG 4H4PA 1FS9A 3L8KA 3SQPA 2YVJA 4NZHA 4A7AA 1GT8A 4OCGA 2Z5YA 5GSNA 2X8HA 2BCGG 3BNHA 1VRQB 3SXQA 3NH3X 1E1NA 1B5QA 2C75A 1DOCA 3NKSA 4TLZA 4A99A 3TTBA 3I3LA 2B9XA 3OC4A 3P4SA 1ZOVA 2WHDA 1GALA 2YVFA 3CNJA 2R0CA 3PS9A 1SP3A 3LG1A 2VR0A 1CJ4A 1GTHA 1TRBA 1CJ2A 3QFBA 2GR2A 5KXJA 1IJHA 1P2EA 1JOAA 1ZMDA 1LVLA 3UTGA 1PBCA 5C2TA 3NTAA 1IUVA 1H81A 4CRTA 2F5ZA 4U8KA 3CNDA 1GSNA 3OZ2A 5DBJA 3K7MX 2YR4A 3BNJA 3BHFA 2B76A 3GDNA 1RP0A 1ONFA 2BS2A 2VVMA 2EQ6A 2C3CA 2XFPA 3P4RA 4K22A 3R9UA 3RHAA 2X8GA 4YKFA 3CNSA 4BURA 2ZZCA 1NPXA 1L9EA 5IPYA 2WU5A 4N9XA 2GR3A 1PHHA 5CKUA 1XHCA 3AB1A 5LV9A 2B7SA 1XPQA 3AD8B 3SY4A 5FS6A 1BWCA 1CC6A 3KPFA 5HXIA 5KOXA 2Q0LA 1VQWA 5KNLA 3M12A 1LPFA 3BNMA 4JY2A 4TM3A 1X31B 4U8LA 3F8DA 1H83A 4U8JA 2YLSA 5KVHA 2QA2A 4C3XA 4JQ9A 3AEBA 2XLRA 3KA7A 3BI4A 3K7TA 3GDPA 3NT6A 1FT5A 4TM0A 4NEWA 4B67A 3EPTA 3GWDA 3EANA 1GRHA 3GYXA 1BKWA 2FBWA 4U2LA 4OPIA 2BC0A 2WOVA 2YWLA 1REOA 3E1TA 4JNAA 4O5UA 2XVJA 2WQYA 3OWMA 3SXIA 5JCKA 2WS3A 3PO7A 2J3NA 3PVCA 1F6MA 2BS3A 3GYIA 3QVRA 4J31A 2XFQA 2JKCA 3ABVA 4X9MA 3NIXA 3AEGA 3AD9B 1MOKA 1Y0PA 3UKKA 3DMEA 3SM8A 5J60A 4OPDA 4H4WA 4TM1A 3AECA 3VR8A 3DK9A 3L1TA 2K3VA 1GPEA 2WP6A 3BI5A 2OALA 4FX9A 3NK0X 5FS8A 2XYOA 2WDRA 4Y4MA 1KDGA 3BNFA 2R4EA 2XVEA 1O5WA 4OPLA 3QFAA 4EIPA 4MJWA 4ZCDA 1GRBA 4Q5CA 3FPZA 4GAPA 3EAOA 1E1KA 1K4QA 2UZZA 1S2QA 2ARDA 2DKIA 3AEFA 1E6EA 2Y6QA 4B68A 4YSXA 5KWFA 4GCMA 1PXCA 5BRTA 4H4XA 1N4UA 1KNPA 1SEZA 2Q0KA 1GTEA 4U8PA 1VG9A 3O0HA 4LIIA 1BGJA 5KMSA 2H89A 3UKFA 4JDRA 4OPTA 4TM4A 1OAHA 1FCDA 2VVLG 1Y56B 2Q6UA 2CULA 4O5QA 5U63A 1YQ3A 1PBFA 2TPRA 1AOGA 3RP7A 4G9KA 3T2ZA 3UP5A 3UKAA 1JNIA 4FK1C 2W0HA 5L46A 3KPKA 3RKHA 3LOVA 1KF6A 5FS9A 2R0GA 4IV9A 3BNUA 3NRNA 1GESA 2WPCA 4JN9A 2E5VA 3RP8A 2E80A 1BZLA 1CC2A 1N4VA 2R4JA 3ICSA 1FT6A 4H4QA 4Z2UA 2WP9A 4P9SA 3GWFA 5BVAA 2BA9A 3LGQA 2YM2A 1H86A 3DK8A 2XVIA 4XWRA 2NPXA 4NTDA 2XFNA 1JU2A 2ZZ0A 4EMJA 1N1PA 3G5SA 4B65A 2EQ7A 2FJBA 3ATQA 4U8NA 3UOYA 1GREA 5HY5A 4Y4NA 4Z2RA 2IIDA 1CJ3A 1GV4A 2BK3A 4C3YA 3T2KA 2GMHA 1Z6LA 2CVJA 1M64A 2ZZBA 1H6VA 3HYVA 4H4SA 4RG4A 3ZYXA 1W4XA 3B3RA 2V61A 3QJ4A 2YLTA 2E81A 4JNQA 3T0KA 1Y56A 4ZN0A 2ACZA 5JCNA 1S2YA 5HHFA 4PABA 1M1RA 1O94A 3C4AA 4GF7A 2FJEA 2GH5A 3S61A 3UOVA 1L0VA 4BK1A 4Q1OA 2RGOA 3NG7X 2B9YA 3AYJA 4B69A 3ITJA 3KD9A 1LTXR 2XLTA 4HA6A 2VOUA 1MXTA 1IUXA 5U25A 1OJCA 1NHQA 2C67A 2XCGA 2C65A 1TDOA 2RDZA 2IVDA 3CNTA 4B63A 2BRYA 3BHKA 1E1LA 1PJ5A 3SFEA 4BK3A 3AE2A 4C5OA 1F8RA 2NVKX 3AE1A 3GMCA 4K2XA 4U2SA 3UTFA 4A9WA 2PHHA 3HZLA 1COYA 1NAAA 4AP3A 2R46A 3AE4A 1GNDA 2WOWA 4D03A 3H8LA 5EB5A 2WU2A 4BK2A 4Z25A 3LB8A 2WPFA 4UDQA 3GM6A 4A65A 4DSHA 1N4WA 2BC1A 4REKA 5EOWA 3ZDNA 3ALMA 4YTNA 4B1BA 4AOXA 5JCIA 4WJYA 3NK2X 2QCUA 1YQ4A 1IUWA 2BRAA 3VRAA 2V5ZA 1BGNA 2WDQA 1ZKQA 3D1IA 4G73A 5IQ1A 1E39A 3HYWA 1D5TA 3UKPA 2LFCA 3RP6A 5J7XA 3UCLA 4WX1A 4JY3A 4Q4UA 3IC9A 3H4KA 3CPJG 4M52A 4U8IA 1GU6A 2A8XA 3LJPA 4GDEA 4XXGA 2GEWA 4YTMA 2Y6RA 5M10A 2A87A 2YLZA 1OJ9A 1Q9IA 4CY8A 3VRBA 2XDOA 1NHSA 1DJNA 4IVMB 4ICYA 2YLRA 2YG5A 1M1PA 1PBDA 4BJZA 1K0JA 2I0ZA 2DKHA 3AEAA 2VRMA 2YLXA 1PXBA 4K5RA 3WE0A 3SCEA 2Q7VA 3P1WA 2BK4A 4U8OA 3QSEA 3DK4A 1H7WA 2XLSA 4AP1A 4YT0A 1O95A 1DNCA 2FJAA 5JCMA 1FL2A 3UKHA 2GMJA 3DJEA 1L9DA 3FIMB 1EBDA 3CGDA 1JEHA 3ISHA 4UP3A 1BVBA 4H2QA 4J57A 2C70A 4IA6A 1TYTA 3LXDA 3AXBA 4YSYA 1EL8A 2B7RA 2JB3A 3GSIA 1LJ1A 1EL7A 3F8PA 1EL9A 1IUTA 1GEUA 4XWZA 3AD7B 3SZFA 3V3OA 2QA1A 1ZY8A 2BABA 3CPIG 5JCLA 3QSSA 4YXDA 4Q5BA 2HQMA 4OPUA 5EBKA 4YTPA 3ICRA 4L38A 1D4DA 4PAAA 3AE5A 1KNRA 4A6NA 2BXRA 4L3XA 2ZO5A 3CGEA 2APGA 1LQTA 2VVLA 3RNMA 3C96A 2V3BA 1K0LA 4EQRA 4BV6A 5BULA 4U8MA 4Z44A 4EQXA 3DJGX 1CHUA 2VZ2A 1NHRA 2BYBA 2CDUA 3KLJA 3NHOX 3P4PA 4I59A 5TR3A 4B64A 2R9ZA 1F3PA 2PYXA 3S7WA 4IA5A 4C74A 1E7PA 3DJDA 1NENA 3CIRA 3IHGA 1TYPA 4DNAA 3SYIA 3F8RA 2YM1A 1FECA 1GRTA 1H7XA 1LQUA 2X50A 4UDRA 5CQFA 4ECHA 1F8SA 1FOHA 1CBOA 4H4ZA 3FMWA 1HYUA 4GUVA 1CC4A 4J36A 1GRGA 3CNPA 3GYJA 4CCRA 1YKJA 1CJCA 2GB0A 3ATRA 5KRQA 3KU9A 2JBVA 3AEDA 4FK1A 1PJ7A 5EB4A 5KOWA 3L1RA 1H84A 3NN0X 3FG2P 5KMRA 3NYFA 1ZDLA 3AE7A 2WEUA 2FJDA 2C3DA 1NDAA 2YR6A 3AE6A 3CPHG 1QLBA 2BXSA 3VRDB 2OA1A 5C3JA 3UU9A 1EL5A 2JK6A 1RYIA 2BK5A 2AR8A 2YG6A 1QJDA 4K7ZA 2C73A 3KVEA 1OJAA 4APNA 5KMQA 1NEKA 3D1CA 2CFYA 3M13A 4DGKA 2OT4A 3CN8A 3II4A 1NHPA 4WCTA 3SGLA 2YLWA 3CTYA 4ADWA 4AOSA 1PN0A 3MMOA 4NTEA 4OPCA 2R0PA 4GR1A 3REDA 1L9CA 2A89A 1OJTA 2WETA 2X8CA 1D4EA 3QSMA 2VRLA 1B4VA 2GR1A 3NN6X 4UDPA 4J2WA 3SX6A 2B9WA 1TDEA 2VQBA 3CMMA 1PS9A 3M0OA 3AE9A 3V76A 1GOSA 2C76A 2WBAA 2C7GA 3AE3A 3BI2A 4H4UA 3D8XA 4LU6A 4Z24A 3ICTA 4C77A 4Z2TA 2XVFA 3AE8A 1VG0A 1ZP0A 4II2A 4X4JA 3GRTA 3V3NA 1ZOYA 4H4YA 4B66A 4G6HA 1BF3A 1OJDA 3UBRA 4AT2A 4Y4LA 2V6OA 3JSKA 1V59A 3KKJA 4H7UA
chains in the Genus database with same CATH topology
2GF3A 3IHMA 2X99A 1FS7A 2WPEA 1KSUA 4FDCB 5ER0A 3T31A 1S3EA 1JRYA 1YQZA 3DA1A 3CGBA 3HYXA 4YKGA 1D4CA 3IF9A 1MO9A 2E4GA 4G74A 3DH9A 1PJ6A 4RG3A 4A6NB 3P9UA 3BNGA 2GAHB 2V3AA 5IQ4A 3NGCX 3LADA 1E1MA 2RF7A 4HB9A 2WP5A 1YY5A 2EQ9A 3NNEA 2ZBWA 3ALLA 4J56A 4G6GA 4OPGA 3SZ0A 1GXFA 1JNZA 2AQJA 1DXLA 1TDNA 1RSGA 3NLCA 4AT0A 2C4CA 5BUKA 2OLNA 2Z5XA 4EMIA 3LZWA 2RGHA 1K0IA 3AEEA 4YWOA 3T37A 4CY6A 1IUUA 2GQWA 1JRXA 4LA1A 3NYCA 4NWZA 2YVGA 3GMBA 1QDBA 2GRTA 4KX6A 2WOIA 2VQ7A 3QVPA 4BJYA 1JRZA 4USRA 1M6IA 3NYEA 2J7AA 2JAEA 3AWIA 3G5RA 3FBSA 3LZXA 4GDPA 2WESA 4K5SA 4IVOB 4L3YA 4H4VA 4E0VA 3B6DA 2H88A 1ZX9A 3EF6A 3IWAA 4J33A 4YSHA 2JB1A 2YG4A 1B37A 3S5WA 1S3BA 1Q1WA 3SZCA 2E1MA 2V60A 4EM3A 2XLUA 3T2YA 4CCQA 3ADAB 3UP4A 1XANA 2TMDA 3NTDA 3UTHA 1DODA 3K7QX 2YAUA 4H4RA 1PBEA 4K8DA 1D7LA 1FEBA 3COXA 4U2TA 1JNRA 2QAEA 4D04A 4ZCCA 2C66A 2YG7A 4A5LA 4DSGA 3I6DA 4CBQA 1H82A 1TDKA 3NK1X 4OVIA 3H8IA 1D7YA 3GD3A 2O9ZA 1PXAA 4YSZA 2XLPA 1DOEA 2XFUA 3T14A 3TORA 4H2RA 1ZMCA 4A79A 2RABA 4L3ZA 3CGCA 4Z26A 3UTEA 1LV0A 4EQWA 4USQA 5KVIA 1QO8A 1ELIA 1ZK7A 3SFDA 3UOZA 5HYMA 5KMPA 1F8WA 3G5QA 3VQRA 2BCPA 3AYLA 4X9NA 4EMWA 4EIQA 2GVCA 4GAVA 4EM4A 1Q1RA 2XVHA 4II3A 4I58A 4J34A 4Q0TA 1DOBA 2EQ8A 4NEVA 3K30A 2RGJA 2GV8A 1PBBA 3DJJA 4GRTA 2YR5A 3SZWA 2GR0A 1GRFA 2YG3A 3GD4A 2AAQA 2GQFA 1CF3A 1PDHA 3UKLA 4EQSA 3C4NA 3ALJA 1GRAA 1TDFA 2OAMA 3GRSA 3Q6JA 1DJQA 4H50A 2R45A 3UKQA 1P2HA 2WDVA 2YQUA 1KFYA 2GAGB 1KSSA 5M0ZA 2XFOA 4TLXA 5U1OA 1IUSA 1CL0A 1VDCA 3UOXA 2C72A 4RSLA 3F29A 2BS4A 1FS8A 5GRTA 3FO3A 4Z43A 3URHA 1NG3A 2IVEA 2C64A 1B8SA 4CNKA 5FMHA 3P4QA 1GETA 1XDIA 2OLOA 1M1QA 4H4TA 1NG4A 4Q17A 2BACA 3DGHA 5FS7A 2X3NA 4H2PA 3AYIA 4KPRA 4NNJA 3DGZA 2JB2A 4NTCA 3VR9A 4CNJA 3Q9TA 1FEAA 4H2NA 1GERA 1UKVG 4H4PA 1FS9A 3L8KA 3SQPA 2YVJA 4NZHA 4A7AA 1GT8A 4OCGA 2Z5YA 5GSNA 2X8HA 2BCGG 3BNHA 1VRQB 3SXQA 3NH3X 1E1NA 1B5QA 2C75A 1DOCA 3NKSA 4TLZA 4A99A 3TTBA 3I3LA 2B9XA 3OC4A 3P4SA 1ZOVA 2WHDA 1GALA 2YVFA 3CNJA 2R0CA 3PS9A 1SP3A 3LG1A 2VR0A 1CJ4A 1GTHA 1TRBA 1CJ2A 3QFBA 2GR2A 5KXJA 1IJHA 1P2EA 1JOAA 1ZMDA 1LVLA 3UTGA 1PBCA 5C2TA 3NTAA 1IUVA 1H81A 4CRTA 2F5ZA 4U8KA 3CNDA 1GSNA 3OZ2A 5DBJA 3K7MX 2YR4A 3BNJA 3BHFA 2B76A 3GDNA 1RP0A 1ONFA 2BS2A 2VVMA 2EQ6A 2C3CA 2XFPA 3P4RA 4K22A 3R9UA 3RHAA 2X8GA 4YKFA 3CNSA 4BURA 2ZZCA 1NPXA 1L9EA 5IPYA 2WU5A 4N9XA 2GR3A 1PHHA 5CKUA 1XHCA 3AB1A 5LV9A 2B7SA 1XPQA 3AD8B 3SY4A 5FS6A 1BWCA 1CC6A 3KPFA 5HXIA 5KOXA 2Q0LA 1VQWA 5KNLA 3M12A 1LPFA 3BNMA 4JY2A 4TM3A 1X31B 4U8LA 3F8DA 1H83A 4U8JA 2YLSA 5KVHA 2QA2A 4C3XA 4JQ9A 3AEBA 2XLRA 3KA7A 3BI4A 3K7TA 3GDPA 3NT6A 1FT5A 4TM0A 4NEWA 4B67A 3EPTA 3GWDA 3EANA 1GRHA 3GYXA 1BKWA 2FBWA 4U2LA 4OPIA 2BC0A 2WOVA 2YWLA 1REOA 3E1TA 4JNAA 4O5UA 2XVJA 2WQYA 3OWMA 3SXIA 5JCKA 2WS3A 3PO7A 2J3NA 3PVCA 1F6MA 2BS3A 3GYIA 3QVRA 4J31A 2XFQA 2JKCA 3ABVA 4X9MA 3NIXA 3AEGA 3AD9B 1MOKA 1Y0PA 3UKKA 3DMEA 3SM8A 5J60A 4OPDA 4H4WA 4TM1A 3AECA 3VR8A 3DK9A 3L1TA 2K3VA 1GPEA 2WP6A 3BI5A 2OALA 4FX9A 3NK0X 5FS8A 2XYOA 2WDRA 4Y4MA 1KDGA 3BNFA 2R4EA 2XVEA 1O5WA 4OPLA 3QFAA 4EIPA 4MJWA 4ZCDA 1GRBA 4Q5CA 3FPZA 4GAPA 3EAOA 1E1KA 1K4QA 2UZZA 1S2QA 2ARDA 2DKIA 3AEFA 1E6EA 2Y6QA 4B68A 4YSXA 5KWFA 4GCMA 1PXCA 5BRTA 4H4XA 1N4UA 1KNPA 1SEZA 2Q0KA 1GTEA 4U8PA 1VG9A 3O0HA 4LIIA 1BGJA 5KMSA 2H89A 3UKFA 4JDRA 4OPTA 4TM4A 1OAHA 1FCDA 2VVLG 1Y56B 2Q6UA 2CULA 4O5QA 5U63A 1YQ3A 1PBFA 2TPRA 1AOGA 3RP7A 4G9KA 3T2ZA 3UP5A 3UKAA 1JNIA 4FK1C 2W0HA 5L46A 3KPKA 3RKHA 3LOVA 1KF6A 5FS9A 2R0GA 4IV9A 3BNUA 3NRNA 1GESA 2WPCA 4JN9A 2E5VA 3RP8A 2E80A 1BZLA 1CC2A 1N4VA 2R4JA 3ICSA 1FT6A 4H4QA 4Z2UA 2WP9A 4P9SA 3GWFA 5BVAA 2BA9A 3LGQA 2YM2A 1H86A 3DK8A 2XVIA 4XWRA 2NPXA 4NTDA 2XFNA 1JU2A 2ZZ0A 4EMJA 1N1PA 3G5SA 4B65A 2EQ7A 2FJBA 3ATQA 4U8NA 3UOYA 1GREA 5HY5A 4Y4NA 4Z2RA 2IIDA 1CJ3A 1GV4A 2BK3A 4C3YA 3T2KA 2GMHA 1Z6LA 2CVJA 1M64A 2ZZBA 1H6VA 3HYVA 4H4SA 4RG4A 3ZYXA 1W4XA 3B3RA 2V61A 3QJ4A 2YLTA 2E81A 4JNQA 3T0KA 1Y56A 4ZN0A 2ACZA 5JCNA 1S2YA 5HHFA 4PABA 1M1RA 1O94A 3C4AA 4GF7A 2FJEA 2GH5A 3S61A 3UOVA 1L0VA 4BK1A 4Q1OA 2RGOA 3NG7X 2B9YA 3AYJA 4B69A 3ITJA 3KD9A 1LTXR 2XLTA 4HA6A 2VOUA 1MXTA 1IUXA 5U25A 1OJCA 1NHQA 2C67A 2XCGA 2C65A 1TDOA 2RDZA 2IVDA 3CNTA 4B63A 2BRYA 3BHKA 1E1LA 1PJ5A 3SFEA 4BK3A 3AE2A 4C5OA 1F8RA 2NVKX 3AE1A 3GMCA 4K2XA 4U2SA 3UTFA 4A9WA 2PHHA 3HZLA 1COYA 1NAAA 4AP3A 2R46A 3AE4A 1GNDA 2WOWA 4D03A 3H8LA 5EB5A 2WU2A 4BK2A 4Z25A 3LB8A 2WPFA 4UDQA 3GM6A 4A65A 4DSHA 1N4WA 2BC1A 4REKA 5EOWA 3ZDNA 3ALMA 4YTNA 4B1BA 4AOXA 5JCIA 4WJYA 3NK2X 2QCUA 1YQ4A 1IUWA 2BRAA 3VRAA 2V5ZA 1BGNA 2WDQA 1ZKQA 3D1IA 4G73A 5IQ1A 1E39A 3HYWA 1D5TA 3UKPA 2LFCA 3RP6A 5J7XA 3UCLA 4WX1A 4JY3A 4Q4UA 3IC9A 3H4KA 3CPJG 4M52A 4U8IA 1GU6A 2A8XA 3LJPA 4GDEA 4XXGA 2GEWA 4YTMA 2Y6RA 5M10A 2A87A 2YLZA 1OJ9A 1Q9IA 4CY8A 3VRBA 2XDOA 1NHSA 1DJNA 4IVMB 4ICYA 2YLRA 2YG5A 1M1PA 1PBDA 4BJZA 1K0JA 2I0ZA 2DKHA 3AEAA 2VRMA 2YLXA 1PXBA 4K5RA 3WE0A 3SCEA 2Q7VA 3P1WA 2BK4A 4U8OA 3QSEA 3DK4A 1H7WA 2XLSA 4AP1A 4YT0A 1O95A 1DNCA 2FJAA 5JCMA 1FL2A 3UKHA 2GMJA 3DJEA 1L9DA 3FIMB 1EBDA 3CGDA 1JEHA 3ISHA 4UP3A 1BVBA 4H2QA 4J57A 2C70A 4IA6A 1TYTA 3LXDA 3AXBA 4YSYA 1EL8A 2B7RA 2JB3A 3GSIA 1LJ1A 1EL7A 3F8PA 1EL9A 1IUTA 1GEUA 4XWZA 3AD7B 3SZFA 3V3OA 2QA1A 1ZY8A 2BABA 3CPIG 5JCLA 3QSSA 4YXDA 4Q5BA 2HQMA 4OPUA 5EBKA 4YTPA 3ICRA 4L38A 1D4DA 4PAAA 3AE5A 1KNRA 4A6NA 2BXRA 4L3XA 2ZO5A 3CGEA 2APGA 1LQTA 2VVLA 3RNMA 3C96A 2V3BA 1K0LA 4EQRA 4BV6A 5BULA 4U8MA 4Z44A 4EQXA 3DJGX 1CHUA 2VZ2A 1NHRA 2BYBA 2CDUA 3KLJA 3NHOX 3P4PA 4I59A 5TR3A 4B64A 2R9ZA 1F3PA 2PYXA 3S7WA 4IA5A 4C74A 1E7PA 3DJDA 1NENA 3CIRA 3IHGA 1TYPA 4DNAA 3SYIA 3F8RA 2YM1A 1FECA 1GRTA 1H7XA 1LQUA 2X50A 4UDRA 5CQFA 4ECHA 1F8SA 1FOHA 1CBOA 4H4ZA 3FMWA 1HYUA 4GUVA 1CC4A 4J36A 1GRGA 3CNPA 3GYJA 4CCRA 1YKJA 1CJCA 2GB0A 3ATRA 5KRQA 3KU9A 2JBVA 3AEDA 4FK1A 1PJ7A 5EB4A 5KOWA 3L1RA 1H84A 3NN0X 3FG2P 5KMRA 3NYFA 1ZDLA 3AE7A 2WEUA 2FJDA 2C3DA 1NDAA 2YR6A 3AE6A 3CPHG 1QLBA 2BXSA 3VRDB 2OA1A 5C3JA 3UU9A 1EL5A 2JK6A 1RYIA 2BK5A 2AR8A 2YG6A 1QJDA 4K7ZA 2C73A 3KVEA 1OJAA 4APNA 5KMQA 1NEKA 3D1CA 2CFYA 3M13A 4DGKA 2OT4A 3CN8A 3II4A 1NHPA 4WCTA 3SGLA 2YLWA 3CTYA 4ADWA 4AOSA 1PN0A 3MMOA 4NTEA 4OPCA 2R0PA 4GR1A 3REDA 1L9CA 2A89A 1OJTA 2WETA 2X8CA 1D4EA 3QSMA 2VRLA 1B4VA 2GR1A 3NN6X 4UDPA 4J2WA 3SX6A 2B9WA 1TDEA 2VQBA 3CMMA 1PS9A 3M0OA 3AE9A 3V76A 1GOSA 2C76A 2WBAA 2C7GA 3AE3A 3BI2A 4H4UA 3D8XA 4LU6A 4Z24A 3ICTA 4C77A 4Z2TA 2XVFA 3AE8A 1VG0A 1ZP0A 4II2A 4X4JA 3GRTA 3V3NA 1ZOYA 4H4YA 4B66A 4G6HA 1BF3A 1OJDA 3UBRA 4AT2A 4Y4LA 2V6OA 3JSKA 1V59A 3KKJA 4H7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GF3 A;  3IHM A;  2X99 A;  1FS7 A;  2WPE A;  1KSU A;  4FDC B;  5ER0 A;  1S3E A;  1JRY A;  1YQZ A;  3DA1 A;  3CGB A;  4YKG A;  1D4C A;  3IF9 A;  1MO9 A;  2E4G A;  4ECH A;  3DH9 A;  1PJ6 A;  4RG3 A;  4A6N B;  3P9U A;  3BNG A;  2GAH B;  2V3A A;  5IQ4 A;  3NGC X;  3LAD A;  1E1M A;  2RF7 A;  4HB9 A;  2WP5 A;  1YY5 A;  2EQ9 A;  3NNE A;  2ZBW A;  3ALL A;  4J56 A;  4OPG A;  1GXF A;  1JNZ A;  2AQJ A;  1DXL A;  1TDN A;  1RSG A;  3NLC A;  4AT0 A;  5BUK A;  2OLN A;  2Z5X A;  4EMI A;  3LZW A;  2RGH A;  1K0I A;  3AEE A;  4YWO A;  3T37 A;  4CY6 A;  1IUU A;  2GQW A;  1JRX A;  4LA1 A;  3NYC A;  2YVG A;  3GMB A;  1QDB A;  2GRT A;  4KX6 A;  2WOI A;  2VQ7 A;  3QVP A;  4BJY A;  1JRZ A;  4USR A;  1M6I A;  3NYE A;  2J7A A;  2JAE A;  3AWI A;  3G5R A;  3FBS A;  3LZX A;  4GDP A;  2WES A;  4K5S A;  4IVO B;  4L3Y A;  4H4V A;  4E0V A;  3B6D A;  2H88 A;  1ZX9 A;  3EF6 A;  3IWA A;  4J33 A;  4YSH A;  2JB1 A;  2YG4 A;  1B37 A;  3S5W A;  1S3B A;  1Q1W A;  2E1M A;  2V60 A;  4EM3 A;  2XLU A;  4CCQ A;  3ADA B;  3UP4 A;  1XAN A;  2TMD A;  3NTD A;  3UTH A;  1DOD A;  3K7Q X;  2YAU A;  4H4R A;  1PBE A;  4K8D A;  1D7L A;  1FEB A;  3COX A;  4U2T A;  1JNR A;  2QAE A;  4D04 A;  4ZCC A;  2C66 A;  2YG7 A;  4A5L A;  4DSG A;  3I6D A;  4CBQ A;  1H82 A;  1TDK A;  3NK1 X;  4OVI A;  3H8I A;  1D7Y A;  3GD3 A;  2O9Z A;  1PXA A;  4YSZ A;  2XLP A;  1DOE A;  2XFU A;  3TOR A;  4H2R A;  1ZMC A;  4A79 A;  2RAB A;  4L3Z A;  3CGC A;  4Z26 A;  3UTE A;  1LV0 A;  4EQW A;  4USQ A;  5KVI A;  1QO8 A;  1ELI A;  1ZK7 A;  3SFD A;  3UOZ A;  5HYM A;  1F8W A;  3G5Q A;  3VQR A;  2BCP A;  3AYL A;  4X9N A;  4EMW A;  4EIQ A;  2GVC A;  4EM4 A;  1Q1R A;  2XVH A;  4I58 A;  4J34 A;  4Q0T A;  1DOB A;  2EQ8 A;  4NEV A;  3K30 A;  2RGJ A;  2GV8 A;  1PBB A;  3DJJ A;  4GRT A;  2YR5 A;  2GR0 A;  1GRF A;  2YG3 A;  3GD4 A;  2AAQ A;  2GQF A;  1CF3 A;  1PDH A;  3UKL A;  4EQS A;  3C4N A;  3ALJ A;  1GRA A;  1TDF A;  2OAM A;  3GRS A;  3Q6J A;  1DJQ A;  4H50 A;  2R45 A;  3UKQ A;  1P2H A;  2WDV A;  2YQU A;  1KFY A;  2GAG B;  1KSS A;  5M0Z A;  2XFO A;  4TLX A;  5U1O A;  1IUS A;  1CL0 A;  1VDC A;  3UOX A;  2C72 A;  4RSL A;  3F29 A;  2BS4 A;  1FS8 A;  5GRT A;  3FO3 A;  4Z43 A;  3URH A;  1NG3 A;  2IVE A;  2C64 A;  1B8S A;  4CNK A;  5FMH A;  3P4Q A;  1GET A;  1XDI A;  2OLO A;  1M1Q A;  4H4T A;  1NG4 A;  4Q17 A;  2BAC A;  3DGH A;  5FS7 A;  2X3N A;  4H2P A;  3AYI A;  4KPR A;  3DGZ A;  2JB2 A;  4NTC A;  3VR9 A;  4CNJ A;  3Q9T A;  1FEA A;  4H2N A;  1GER A;  1UKV G;  4H4P A;  1FS9 A;  3L8K A;  3SQP A;  2YVJ A;  4NZH A;  4A7A A;  1GT8 A;  4OCG A;  2Z5Y A;  5GSN A;  2X8H A;  2BCG G;  3BNH A;  1VRQ B;  3SXQ A;  3NH3 X;  1E1N A;  1B5Q A;  2C75 A;  1DOC A;  3NKS A;  4TLZ A;  4A99 A;  3TTB A;  3I3L A;  2B9X A;  3OC4 A;  3P4S A;  1ZOV A;  2WHD A;  1GAL A;  2YVF A;  3CNJ A;  2R0C A;  3PS9 A;  1SP3 A;  3LG1 A;  2VR0 A;  1CJ4 A;  1GTH A;  1TRB A;  1CJ2 A;  3QFB A;  2GR2 A;  5KXJ A;  1IJH A;  1P2E A;  1JOA A;  1ZMD A;  1LVL A;  3UTG A;  1PBC A;  5C2T A;  3NTA A;  1IUV A;  1H81 A;  4CRT A;  2F5Z A;  4U8K A;  3CND A;  1GSN A;  3OZ2 A;  5DBJ A;  3K7M X;  2YR4 A;  3BNJ A;  3BHF A;  2B76 A;  3GDN A;  1RP0 A;  1ONF A;  2BS2 A;  2VVM A;  2EQ6 A;  2C3C A;  2XFP A;  3P4R A;  4K22 A;  3R9U A;  3RHA A;  2X8G A;  4YKF A;  3CNS A;  4BUR A;  2ZZC A;  1NPX A;  1L9E A;  5IPY A;  2WU5 A;  4N9X A;  2GR3 A;  1PHH A;  5CKU A;  1XHC A;  3AB1 A;  5LV9 A;  2B7S A;  1XPQ A;  3AD8 B;  5FS6 A;  1BWC A;  1CC6 A;  3KPF A;  5HXI A;  5KOX A;  2Q0L A;  1VQW A;  3M12 A;  1LPF A;  3BNM A;  4JY2 A;  4TM3 A;  1X31 B;  4U8L A;  3F8D A;  1H83 A;  4U8J A;  2YLS A;  5KVH A;  2QA2 A;  4C3X A;  4JQ9 A;  3AEB A;  2XLR A;  3KA7 A;  3BI4 A;  3K7T A;  3GDP A;  3NT6 A;  1FT5 A;  4TM0 A;  4NEW A;  4B67 A;  3EPT A;  3GWD A;  3EAN A;  1GRH A;  3GYX A;  1BKW A;  2FBW A;  4U2L A;  4OPI A;  2BC0 A;  2WOV A;  2YWL A;  1REO A;  3E1T A;  4JNA A;  4O5U A;  2XVJ A;  2WQY A;  3OWM A;  5JCK A;  2WS3 A;  3PO7 A;  2J3N A;  3PVC A;  1F6M A;  2BS3 A;  3GYI A;  3QVR A;  4J31 A;  2XFQ A;  2JKC A;  3ABV A;  4X9M A;  3NIX A;  3AEG A;  3AD9 B;  1MOK A;  1Y0P A;  3UKK A;  3DME A;  3SM8 A;  5J60 A;  4OPD A;  4H4W A;  4TM1 A;  3AEC A;  3VR8 A;  3DK9 A;  3L1T A;  2K3V A;  1GPE A;  2WP6 A;  3BI5 A;  2OAL A;  4FX9 A;  3NK0 X;  5FS8 A;  2XYO A;  2WDR A;  4Y4M A;  1KDG A;  3BNF A;  2R4E A;  2XVE A;  1O5W A;  4OPL A;  3QFA A;  4EIP A;  4MJW A;  4ZCD A;  1GRB A;  4Q5C A;  3FPZ A;  3EAO A;  1E1K A;  1K4Q A;  2UZZ A;  1S2Q A;  2ARD A;  2DKI A;  3AEF A;  1E6E A;  2Y6Q A;  4B68 A;  4YSX A;  5KWF A;  4GCM A;  1PXC A;  5BRT A;  4H4X A;  1N4U A;  1KNP A;  1SEZ A;  2Q0K A;  1GTE A;  4U8P A;  1VG9 A;  3O0H A;  4LII A;  1BGJ A;  2H89 A;  3UKF A;  4JDR A;  4OPT A;  4TM4 A;  1OAH A;  1FCD A;  2VVL G;  1Y56 B;  2Q6U A;  2CUL A;  4O5Q A;  5U63 A;  1YQ3 A;  1PBF A;  2TPR A;  1AOG A;  3RP7 A;  3UP5 A;  3UKA A;  1JNI A;  4FK1 C;  2W0H A;  5L46 A;  3RKH A;  3LOV A;  1KF6 A;  5FS9 A;  2R0G A;  4IV9 A;  3BNU A;  3NRN A;  1GES A;  2WPC A;  4JN9 A;  2E5V A;  3RP8 A;  2E80 A;  1BZL A;  1CC2 A;  1N4V A;  2R4J A;  3ICS A;  1FT6 A;  4H4Q A;  4Z2U A;  2WP9 A;  4P9S A;  3GWF A;  5BVA A;  2BA9 A;  3LGQ A;  2YM2 A;  1H86 A;  3DK8 A;  2XVI A;  4XWR A;  2NPX A;  4NTD A;  2XFN A;  1JU2 A;  2ZZ0 A;  4EMJ A;  1N1P A;  3G5S A;  4B65 A;  2EQ7 A;  2FJB A;  3ATQ A;  4U8N A;  3UOY A;  1GRE A;  5HY5 A;  4Y4N A;  4Z2R A;  2IID A;  1CJ3 A;  1GV4 A;  2BK3 A;  4C3Y A;  2GMH A;  1Z6L A;  2CVJ A;  1M64 A;  2ZZB A;  1H6V A;  4H4S A;  4RG4 A;  3ZYX A;  1W4X A;  3B3R A;  2V61 A;  3QJ4 A;  2YLT A;  2E81 A;  4JNQ A;  1Y56 A;  4ZN0 A;  2ACZ A;  5JCN A;  1S2Y A;  5HHF A;  4PAB A;  1M1R A;  1O94 A;  3C4A A;  4GF7 A;  2FJE A;  2GH5 A;  3S61 A;  3UOV A;  1L0V A;  4BK1 A;  4Q1O A;  2RGO A;  3NG7 X;  2B9Y A;  3AYJ A;  4B69 A;  3ITJ A;  3KD9 A;  1LTX R;  2XLT A;  4HA6 A;  2VOU A;  1MXT A;  1IUX A;  5U25 A;  1OJC A;  1NHQ A;  2C67 A;  2XCG A;  2C65 A;  1TDO A;  2RDZ A;  2IVD A;  3CNT A;  4B63 A;  3BHK A;  1E1L A;  1PJ5 A;  3SFE A;  4BK3 A;  3AE2 A;  4C5O A;  1F8R A;  2NVK X;  3AE1 A;  3GMC A;  4K2X A;  4U2S A;  3UTF A;  4A9W A;  2PHH A;  3HZL A;  1COY A;  1NAA A;  4AP3 A;  2R46 A;  3AE4 A;  1GND A;  2WOW A;  4D03 A;  3H8L A;  5EB5 A;  2WU2 A;  4BK2 A;  4Z25 A;  3LB8 A;  2WPF A;  4UDQ A;  3GM6 A;  4A65 A;  4DSH A;  1N4W A;  2BC1 A;  4REK A;  5EOW A;  3ZDN A;  3ALM A;  4YTN A;  4B1B A;  4AOX A;  5JCI A;  4WJY A;  3NK2 X;  2QCU A;  1YQ4 A;  1IUW A;  3VRA A;  2V5Z A;  1BGN A;  2WDQ A;  1ZKQ A;  3D1I A;  5IQ1 A;  1E39 A;  1D5T A;  3UKP A;  2LFC A;  3RP6 A;  5J7X A;  3UCL A;  4WX1 A;  4JY3 A;  4Q4U A;  3IC9 A;  3H4K A;  3CPJ G;  4M52 A;  4U8I A;  1GU6 A;  2A8X A;  3LJP A;  4GDE A;  4XXG A;  2GEW A;  4YTM A;  2Y6R A;  5M10 A;  2A87 A;  2YLZ A;  1OJ9 A;  1Q9I A;  4CY8 A;  3VRB A;  2XDO A;  1NHS A;  1DJN A;  4IVM B;  4ICY A;  2YLR A;  2YG5 A;  1M1P A;  1PBD A;  4BJZ A;  1K0J A;  2I0Z A;  2DKH A;  3AEA A;  2VRM A;  2YLX A;  1PXB A;  4K5R A;  3WE0 A;  3SCE A;  2Q7V A;  3P1W A;  2BK4 A;  4U8O A;  3QSE A;  3DK4 A;  1H7W A;  2XLS A;  4AP1 A;  4YT0 A;  1O95 A;  1DNC A;  2FJA A;  5JCM A;  1FL2 A;  3UKH A;  2GMJ A;  3DJE A;  1L9D A;  3FIM B;  1EBD A;  3CGD A;  1JEH A;  3ISH A;  4UP3 A;  1BVB A;  4H2Q A;  4J57 A;  2C70 A;  4IA6 A;  1TYT A;  3LXD A;  3AXB A;  4YSY A;  1EL8 A;  2B7R A;  2JB3 A;  3GSI A;  1LJ1 A;  1EL7 A;  3F8P A;  1EL9 A;  1IUT A;  1GEU A;  4XWZ A;  3AD7 B;  3V3O A;  2QA1 A;  1ZY8 A;  2BAB A;  3CPI G;  5JCL A;  3QSS A;  4YXD A;  4Q5B A;  2HQM A;  4OPU A;  5EBK A;  4YTP A;  3ICR A;  4L38 A;  1D4D A;  4PAA A;  3AE5 A;  1KNR A;  4A6N A;  2BXR A;  4L3X A;  2ZO5 A;  3CGE A;  2APG A;  1LQT A;  2VVL A;  3RNM A;  3C96 A;  2V3B A;  1K0L A;  4EQR A;  4BV6 A;  5BUL A;  4U8M A;  4Z44 A;  4EQX A;  3DJG X;  1CHU A;  2VZ2 A;  1NHR A;  2BYB A;  2CDU A;  3KLJ A;  3NHO X;  3P4P A;  4I59 A;  5TR3 A;  4B64 A;  2R9Z A;  1F3P A;  2PYX A;  3S7W A;  4IA5 A;  4C74 A;  1E7P A;  3DJD A;  1NEN A;  3CIR A;  3IHG A;  1TYP A;  4DNA A;  3F8R A;  2YM1 A;  1FEC A;  1GRT A;  1H7X A;  1LQU A;  2X50 A;  4UDR A;  5CQF A;  5KOW A;  1F8S A;  1FOH A;  1CBO A;  4H4Z A;  3FMW A;  1HYU A;  4GUV A;  1CC4 A;  4J36 A;  1GRG A;  3CNP A;  3GYJ A;  4CCR A;  1YKJ A;  1CJC A;  2GB0 A;  3ATR A;  5KRQ A;  3KU9 A;  2JBV A;  3AED A;  4FK1 A;  1PJ7 A;  5EB4 A;  3L1R A;  1H84 A;  3NN0 X;  3FG2 P;  3NYF A;  1ZDL A;  3AE7 A;  2WEU A;  2FJD A;  2C3D A;  1NDA A;  2YR6 A;  3AE6 A;  3CPH G;  1QLB A;  2BXS A;  3VRD B;  2OA1 A;  5C3J A;  3UU9 A;  1EL5 A;  2JK6 A;  1RYI A;  2BK5 A;  2AR8 A;  2YG6 A;  1QJD A;  4K7Z A;  2C73 A;  3KVE A;  1OJA A;  4APN A;  1NEK A;  3D1C A;  2CFY A;  3M13 A;  4DGK A;  2OT4 A;  3CN8 A;  3II4 A;  1NHP A;  4WCT A;  3SGL A;  2YLW A;  3CTY A;  4ADW A;  4AOS A;  1PN0 A;  3MMO A;  4NTE A;  4OPC A;  2R0P A;  4GR1 A;  3RED A;  1L9C A;  2A89 A;  1OJT A;  2WET A;  2X8C A;  1D4E A;  3QSM A;  2VRL A;  1B4V A;  2GR1 A;  3NN6 X;  4UDP A;  4J2W A;  2B9W A;  1TDE A;  2VQB A;  1PS9 A;  3M0O A;  3AE9 A;  3V76 A;  1GOS A;  2C76 A;  2WBA A;  2C7G A;  3AE3 A;  3BI2 A;  4H4U A;  3D8X A;  4LU6 A;  4Z24 A;  3ICT A;  4C77 A;  4Z2T A;  2XVF A;  3AE8 A;  1VG0 A;  1ZP0 A;  4X4J A;  3GRT A;  3V3N A;  1ZOY A;  4H4Y A;  4B66 A;  1BF3 A;  1OJD A;  3UBR A;  4AT2 A;  4Y4L A;  2V6O A;  3JSK A;  1V59 A;  3KKJ A;  4H7U A; 
#chains in the Genus database with same CATH topology
 2GF3 A;  3IHM A;  2X99 A;  1FS7 A;  2WPE A;  1KSU A;  4FDC B;  5ER0 A;  3T31 A;  1S3E A;  1JRY A;  1YQZ A;  3DA1 A;  3CGB A;  3HYX A;  4YKG A;  1D4C A;  3IF9 A;  1MO9 A;  2E4G A;  4G74 A;  3DH9 A;  1PJ6 A;  4RG3 A;  4A6N B;  3P9U A;  3BNG A;  2GAH B;  2V3A A;  5IQ4 A;  3NGC X;  3LAD A;  1E1M A;  2RF7 A;  4HB9 A;  2WP5 A;  1YY5 A;  2EQ9 A;  3NNE A;  2ZBW A;  3ALL A;  4J56 A;  4G6G A;  4OPG A;  3SZ0 A;  1GXF A;  1JNZ A;  2AQJ A;  1DXL A;  1TDN A;  1RSG A;  3NLC A;  4AT0 A;  2C4C A;  5BUK A;  2OLN A;  2Z5X A;  4EMI A;  3LZW A;  2RGH A;  1K0I A;  3AEE A;  4YWO A;  3T37 A;  4CY6 A;  1IUU A;  2GQW A;  1JRX A;  4LA1 A;  3NYC A;  4NWZ A;  2YVG A;  3GMB A;  1QDB A;  2GRT A;  4KX6 A;  2WOI A;  2VQ7 A;  3QVP A;  4BJY A;  1JRZ A;  4USR A;  1M6I A;  3NYE A;  2J7A A;  2JAE A;  3AWI A;  3G5R A;  3FBS A;  3LZX A;  4GDP A;  2WES A;  4K5S A;  4IVO B;  4L3Y A;  4H4V A;  4E0V A;  3B6D A;  2H88 A;  1ZX9 A;  3EF6 A;  3IWA A;  4J33 A;  4YSH A;  2JB1 A;  2YG4 A;  1B37 A;  3S5W A;  2CZS A;  1S3B A;  1Q1W A;  3SZC A;  2E1M A;  2V60 A;  4EM3 A;  2XLU A;  3T2Y A;  4CCQ A;  3ADA B;  3UP4 A;  1XAN A;  2TMD A;  3NTD A;  3UTH A;  1DOD A;  3K7Q X;  2YAU A;  4H4R A;  1PBE A;  4K8D A;  1D7L A;  1FEB A;  3COX A;  4U2T A;  1JNR A;  2QAE A;  4D04 A;  4ZCC A;  2C66 A;  2YG7 A;  4A5L A;  4DSG A;  3I6D A;  4CBQ A;  1H82 A;  1TDK A;  3NK1 X;  4OVI A;  3H8I A;  1D7Y A;  3GD3 A;  2O9Z A;  1PXA A;  4YSZ A;  2XLP A;  1DOE A;  2XFU A;  3T14 A;  3TOR A;  4H2R A;  1ZMC A;  4A79 A;  2RAB A;  4L3Z A;  3CGC A;  4Z26 A;  3UTE A;  1LV0 A;  4EQW A;  4USQ A;  5KVI A;  1QO8 A;  1ELI A;  1ZK7 A;  3SFD A;  3UOZ A;  5HYM A;  5KMP A;  1F8W A;  3G5Q A;  3VQR A;  2BCP A;  3AYL A;  4X9N A;  4EMW A;  4EIQ A;  2GVC A;  4GAV A;  4EM4 A;  1Q1R A;  2XVH A;  4II3 A;  4I58 A;  4J34 A;  4Q0T A;  1DOB A;  2EQ8 A;  4NEV A;  3K30 A;  2RGJ A;  2GV8 A;  1PBB A;  3DJJ A;  4GRT A;  2YR5 A;  3SZW A;  2GR0 A;  1GRF A;  2YG3 A;  3GD4 A;  2AAQ A;  2GQF A;  1CF3 A;  1PDH A;  3UKL A;  4EQS A;  3C4N A;  3ALJ A;  1GRA A;  1TDF A;  2OAM A;  3GRS A;  3Q6J A;  1DJQ A;  4H50 A;  2R45 A;  3UKQ A;  1P2H A;  2WDV A;  2YQU A;  1KFY A;  2GAG B;  1KSS A;  5M0Z A;  2XFO A;  4TLX A;  5U1O A;  1IUS A;  1CL0 A;  1VDC A;  3UOX A;  2C72 A;  4RSL A;  3F29 A;  2BS4 A;  1FS8 A;  5GRT A;  3FO3 A;  4Z43 A;  3URH A;  1NG3 A;  2IVE A;  2C64 A;  1B8S A;  4CNK A;  5FMH A;  3P4Q A;  1GET A;  1XDI A;  2OLO A;  1M1Q A;  4H4T A;  1NG4 A;  4Q17 A;  2BAC A;  3DGH A;  5FS7 A;  2X3N A;  4H2P A;  3AYI A;  4KPR A;  4NNJ A;  3DGZ A;  2JB2 A;  4NTC A;  3VR9 A;  4CNJ A;  3Q9T A;  1FEA A;  4H2N A;  1GER A;  1UKV G;  4H4P A;  1FS9 A;  3L8K A;  3SQP A;  2YVJ A;  4NZH A;  4A7A A;  1GT8 A;  4OCG A;  2Z5Y A;  5GSN A;  2X8H A;  2BCG G;  3BNH A;  1VRQ B;  3SXQ A;  3NH3 X;  1E1N A;  1B5Q A;  2C75 A;  1DOC A;  3NKS A;  4TLZ A;  4A99 A;  3TTB A;  3I3L A;  2B9X A;  3OC4 A;  3P4S A;  1ZOV A;  2WHD A;  1GAL A;  2YVF A;  3CNJ A;  2R0C A;  3PS9 A;  1SP3 A;  3LG1 A;  2VR0 A;  1CJ4 A;  1GTH A;  1TRB A;  1CJ2 A;  3QFB A;  2GR2 A;  5KXJ A;  1IJH A;  1P2E A;  1JOA A;  1ZMD A;  1LVL A;  3UTG A;  1PBC A;  5C2T A;  3NTA A;  1IUV A;  1H81 A;  4CRT A;  2F5Z A;  4U8K A;  3CND A;  1GSN A;  3OZ2 A;  5DBJ A;  3K7M X;  2YR4 A;  3BNJ A;  3BHF A;  2B76 A;  3GDN A;  1RP0 A;  1ONF A;  2BS2 A;  2VVM A;  2EQ6 A;  2C3C A;  2XFP A;  3P4R A;  4K22 A;  3R9U A;  3RHA A;  2X8G A;  4YKF A;  3CNS A;  4BUR A;  2ZZC A;  1NPX A;  1L9E A;  5IPY A;  2WU5 A;  4N9X A;  2GR3 A;  1PHH A;  5CKU A;  1XHC A;  3AB1 A;  5LV9 A;  2B7S A;  1XPQ A;  3AD8 B;  3SY4 A;  5FS6 A;  1BWC A;  1CC6 A;  3KPF A;  5HXI A;  5KOX A;  2Q0L A;  1VQW A;  5KNL A;  3M12 A;  1LPF A;  3BNM A;  4JY2 A;  4TM3 A;  1X31 B;  4U8L A;  3F8D A;  1H83 A;  4U8J A;  2YLS A;  5KVH A;  2QA2 A;  4C3X A;  4JQ9 A;  3AEB A;  2XLR A;  3KA7 A;  3BI4 A;  3K7T A;  3GDP A;  3NT6 A;  1FT5 A;  4TM0 A;  4NEW A;  4B67 A;  3EPT A;  3GWD A;  3EAN A;  1GRH A;  3GYX A;  1BKW A;  2FBW A;  4U2L A;  4OPI A;  2BC0 A;  2WOV A;  2YWL A;  1REO A;  3E1T A;  4JNA A;  4O5U A;  2XVJ A;  2WQY A;  3OWM A;  3SXI A;  5JCK A;  2WS3 A;  3PO7 A;  2J3N A;  3PVC A;  1F6M A;  2BS3 A;  3GYI A;  3QVR A;  4J31 A;  2XFQ A;  2JKC A;  3ABV A;  4X9M A;  3NIX A;  3AEG A;  3AD9 B;  1MOK A;  1Y0P A;  3UKK A;  3DME A;  3SM8 A;  5J60 A;  4OPD A;  4H4W A;  4TM1 A;  3AEC A;  3VR8 A;  3DK9 A;  3L1T A;  2K3V A;  1GPE A;  2WP6 A;  3BI5 A;  2OAL A;  4FX9 A;  3NK0 X;  5FS8 A;  2XYO A;  2WDR A;  4Y4M A;  1KDG A;  3BNF A;  2R4E A;  2XVE A;  1O5W A;  4OPL A;  3QFA A;  4EIP A;  4MJW A;  4ZCD A;  1GRB A;  4Q5C A;  3FPZ A;  4GAP A;  3EAO A;  1E1K A;  1K4Q A;  2UZZ A;  1S2Q A;  2ARD A;  2DKI A;  3AEF A;  1E6E A;  2Y6Q A;  4B68 A;  4YSX A;  5KWF A;  4GCM A;  1PXC A;  5BRT A;  4H4X A;  1N4U A;  1KNP A;  1SEZ A;  2Q0K A;  1GTE A;  4U8P A;  1VG9 A;  3O0H A;  4LII A;  1BGJ A;  5KMS A;  2H89 A;  3UKF A;  4JDR A;  4OPT A;  4TM4 A;  1OAH A;  1FCD A;  2VVL G;  1Y56 B;  2Q6U A;  2CUL A;  4O5Q A;  5U63 A;  1YQ3 A;  1PBF A;  2TPR A;  1AOG A;  3RP7 A;  4G9K A;  3T2Z A;  3UP5 A;  3UKA A;  1JNI A;  4FK1 C;  2W0H A;  5L46 A;  3KPK A;  3RKH A;  3LOV A;  1KF6 A;  5FS9 A;  2R0G A;  4IV9 A;  3BNU A;  3NRN A;  1GES A;  2WPC A;  4JN9 A;  2E5V A;  3RP8 A;  2E80 A;  1BZL A;  1CC2 A;  1N4V A;  2R4J A;  3ICS A;  1FT6 A;  4H4Q A;  4Z2U A;  2WP9 A;  4P9S A;  3GWF A;  5BVA A;  2BA9 A;  3LGQ A;  2YM2 A;  1H86 A;  3DK8 A;  2XVI A;  4XWR A;  2NPX A;  4NTD A;  2XFN A;  1JU2 A;  2ZZ0 A;  4EMJ A;  1N1P A;  3G5S A;  4B65 A;  2EQ7 A;  2FJB A;  3ATQ A;  4U8N A;  3UOY A;  1GRE A;  5HY5 A;  4Y4N A;  4Z2R A;  2IID A;  1CJ3 A;  1GV4 A;  2BK3 A;  4C3Y A;  3T2K A;  2GMH A;  1Z6L A;  2CVJ A;  1M64 A;  2ZZB A;  1H6V A;  3HYV A;  4H4S A;  4RG4 A;  3ZYX A;  1W4X A;  3B3R A;  2V61 A;  3QJ4 A;  2YLT A;  2E81 A;  4JNQ A;  3T0K A;  1Y56 A;  4ZN0 A;  2ACZ A;  5JCN A;  1S2Y A;  5HHF A;  4PAB A;  1M1R A;  1O94 A;  3C4A A;  4GF7 A;  2FJE A;  2GH5 A;  3S61 A;  3UOV A;  1L0V A;  4BK1 A;  4Q1O A;  2RGO A;  3NG7 X;  2B9Y A;  3AYJ A;  4B69 A;  3ITJ A;  3KD9 A;  1LTX R;  2XLT A;  4HA6 A;  2VOU A;  1MXT A;  1IUX A;  5U25 A;  1OJC A;  1NHQ A;  2C67 A;  2XCG A;  2C65 A;  1TDO A;  2RDZ A;  2IVD A;  3CNT A;  4B63 A;  2BRY A;  3BHK A;  1E1L A;  1PJ5 A;  3SFE A;  4BK3 A;  3AE2 A;  4C5O A;  1F8R A;  2NVK X;  3AE1 A;  3GMC A;  4K2X A;  4U2S A;  3UTF A;  4A9W A;  2PHH A;  3HZL A;  1COY A;  1NAA A;  4AP3 A;  2R46 A;  3AE4 A;  1GND A;  2WOW A;  4D03 A;  3H8L A;  5EB5 A;  2WU2 A;  4BK2 A;  4Z25 A;  3LB8 A;  2WPF A;  4UDQ A;  3GM6 A;  4A65 A;  4DSH A;  1N4W A;  2BC1 A;  4REK A;  5EOW A;  3ZDN A;  3ALM A;  4YTN A;  4B1B A;  4AOX A;  5JCI A;  4WJY A;  3NK2 X;  2QCU A;  1YQ4 A;  1IUW A;  2BRA A;  3VRA A;  2V5Z A;  1BGN A;  2WDQ A;  1ZKQ A;  3D1I A;  4G73 A;  5IQ1 A;  1E39 A;  3HYW A;  1D5T A;  3UKP A;  2LFC A;  3RP6 A;  5J7X A;  3UCL A;  4WX1 A;  4JY3 A;  4Q4U A;  3IC9 A;  3H4K A;  3CPJ G;  4M52 A;  4U8I A;  1GU6 A;  2A8X A;  3LJP A;  4GDE A;  4XXG A;  2GEW A;  4YTM A;  2Y6R A;  5M10 A;  2A87 A;  2YLZ A;  1OJ9 A;  1Q9I A;  4CY8 A;  3VRB A;  2XDO A;  1NHS A;  1DJN A;  4IVM B;  4ICY A;  2YLR A;  2YG5 A;  1M1P A;  1PBD A;  4BJZ A;  1K0J A;  2I0Z A;  2DKH A;  3AEA A;  2VRM A;  2YLX A;  1PXB A;  4K5R A;  3WE0 A;  3SCE A;  2Q7V A;  3P1W A;  2BK4 A;  4U8O A;  3QSE A;  3DK4 A;  1H7W A;  2XLS A;  4AP1 A;  4YT0 A;  1O95 A;  1DNC A;  2FJA A;  5JCM A;  1FL2 A;  3UKH A;  2GMJ A;  3DJE A;  1L9D A;  3FIM B;  1EBD A;  3CGD A;  1JEH A;  3ISH A;  4UP3 A;  1BVB A;  4H2Q A;  4J57 A;  2C70 A;  4IA6 A;  1TYT A;  3LXD A;  3AXB A;  4YSY A;  1EL8 A;  2B7R A;  2JB3 A;  3GSI A;  1LJ1 A;  1EL7 A;  3F8P A;  1EL9 A;  1IUT A;  1GEU A;  4XWZ A;  3AD7 B;  3SZF A;  3V3O A;  2QA1 A;  1ZY8 A;  2BAB A;  3CPI G;  5JCL A;  3QSS A;  4YXD A;  4Q5B A;  2HQM A;  4OPU A;  5EBK A;  4YTP A;  3ICR A;  4L38 A;  1D4D A;  4PAA A;  3AE5 A;  1KNR A;  4A6N A;  2BXR A;  4L3X A;  2ZO5 A;  3CGE A;  2APG A;  1LQT A;  2VVL A;  3RNM A;  3C96 A;  2V3B A;  1K0L A;  4EQR A;  4BV6 A;  5BUL A;  4U8M A;  4Z44 A;  4EQX A;  3DJG X;  1CHU A;  2VZ2 A;  1NHR A;  2BYB A;  2CDU A;  3KLJ A;  3NHO X;  3P4P A;  4I59 A;  5TR3 A;  4B64 A;  2R9Z A;  1F3P A;  2PYX A;  3S7W A;  4IA5 A;  4C74 A;  1E7P A;  3DJD A;  1NEN A;  3CIR A;  3IHG A;  1TYP A;  4DNA A;  3SYI A;  3F8R A;  2YM1 A;  1FEC A;  1GRT A;  1H7X A;  1LQU A;  2X50 A;  4UDR A;  5CQF A;  4ECH A;  1F8S A;  1FOH A;  1CBO A;  4H4Z A;  3FMW A;  1HYU A;  4GUV A;  1CC4 A;  4J36 A;  1GRG A;  3CNP A;  3GYJ A;  4CCR A;  1YKJ A;  1CJC A;  2GB0 A;  3ATR A;  5KRQ A;  3KU9 A;  2JBV A;  3AED A;  4FK1 A;  1PJ7 A;  5EB4 A;  5KOW A;  3L1R A;  1H84 A;  3NN0 X;  3FG2 P;  5KMR A;  3NYF A;  1ZDL A;  3AE7 A;  2WEU A;  2FJD A;  2C3D A;  1NDA A;  2YR6 A;  3AE6 A;  3CPH G;  1QLB A;  2BXS A;  3VRD B;  2OA1 A;  5C3J A;  3UU9 A;  1EL5 A;  2JK6 A;  1RYI A;  2BK5 A;  2AR8 A;  2YG6 A;  1QJD A;  4K7Z A;  2C73 A;  3KVE A;  1OJA A;  4APN A;  5KMQ A;  1NEK A;  3D1C A;  2CFY A;  3M13 A;  4DGK A;  2OT4 A;  3CN8 A;  3II4 A;  1NHP A;  4WCT A;  3SGL A;  2YLW A;  3CTY A;  4ADW A;  4AOS A;  1PN0 A;  3MMO A;  4NTE A;  4OPC A;  2R0P A;  4GR1 A;  3RED A;  1L9C A;  2A89 A;  1OJT A;  2WET A;  2X8C A;  1D4E A;  3QSM A;  2VRL A;  1B4V A;  2GR1 A;  3NN6 X;  4UDP A;  4J2W A;  3SX6 A;  2B9W A;  1TDE A;  2VQB A;  3CMM A;  1PS9 A;  3M0O A;  3AE9 A;  3V76 A;  1GOS A;  2C76 A;  2WBA A;  2C7G A;  3AE3 A;  3BI2 A;  4H4U A;  3D8X A;  4LU6 A;  4Z24 A;  3ICT A;  4C77 A;  4Z2T A;  2XVF A;  3AE8 A;  1VG0 A;  1ZP0 A;  4II2 A;  4X4J A;  3GRT A;  3V3N A;  1ZOY A;  4H4Y A;  4B66 A;  4G6H A;  1BF3 A;  1OJD A;  3UBR A;  4AT2 A;  4Y4L A;  2V6O A;  3JSK A;  1V59 A;  3KKJ A;  4H7U A; 
#chains in the Genus database with same CATH homology
 2GF3 A;  3IHM A;  2X99 A;  1FS7 A;  2WPE A;  1KSU A;  4FDC B;  5ER0 A;  3T31 A;  1S3E A;  1JRY A;  1YQZ A;  3DA1 A;  3CGB A;  3HYX A;  4YKG A;  1D4C A;  3IF9 A;  1MO9 A;  2E4G A;  4G74 A;  3DH9 A;  1PJ6 A;  4RG3 A;  4A6N B;  3P9U A;  3BNG A;  2GAH B;  2V3A A;  5IQ4 A;  3NGC X;  3LAD A;  1E1M A;  2RF7 A;  4HB9 A;  2WP5 A;  1YY5 A;  2EQ9 A;  3NNE A;  2ZBW A;  3ALL A;  4J56 A;  4G6G A;  4OPG A;  3SZ0 A;  1GXF A;  1JNZ A;  2AQJ A;  1DXL A;  1TDN A;  1RSG A;  3NLC A;  4AT0 A;  2C4C A;  5BUK A;  2OLN A;  2Z5X A;  4EMI A;  3LZW A;  2RGH A;  1K0I A;  3AEE A;  4YWO A;  3T37 A;  4CY6 A;  1IUU A;  2GQW A;  1JRX A;  4LA1 A;  3NYC A;  4NWZ A;  2YVG A;  3GMB A;  1QDB A;  2GRT A;  4KX6 A;  2WOI A;  2VQ7 A;  3QVP A;  4BJY A;  1JRZ A;  4USR A;  1M6I A;  3NYE A;  2J7A A;  2JAE A;  3AWI A;  3G5R A;  3FBS A;  3LZX A;  4GDP A;  2WES A;  4K5S A;  4IVO B;  4L3Y A;  4H4V A;  4E0V A;  3B6D A;  2H88 A;  1ZX9 A;  3EF6 A;  3IWA A;  4J33 A;  4YSH A;  2JB1 A;  2YG4 A;  1B37 A;  3S5W A;  1S3B A;  1Q1W A;  3SZC A;  2E1M A;  2V60 A;  4EM3 A;  2XLU A;  3T2Y A;  4CCQ A;  3ADA B;  3UP4 A;  1XAN A;  2TMD A;  3NTD A;  3UTH A;  1DOD A;  3K7Q X;  2YAU A;  4H4R A;  1PBE A;  4K8D A;  1D7L A;  1FEB A;  3COX A;  4U2T A;  1JNR A;  2QAE A;  4D04 A;  4ZCC A;  2C66 A;  2YG7 A;  4A5L A;  4DSG A;  3I6D A;  4CBQ A;  1H82 A;  1TDK A;  3NK1 X;  4OVI A;  3H8I A;  1D7Y A;  3GD3 A;  2O9Z A;  1PXA A;  4YSZ A;  2XLP A;  1DOE A;  2XFU A;  3T14 A;  3TOR A;  4H2R A;  1ZMC A;  4A79 A;  2RAB A;  4L3Z A;  3CGC A;  4Z26 A;  3UTE A;  1LV0 A;  4EQW A;  4USQ A;  5KVI A;  1QO8 A;  1ELI A;  1ZK7 A;  3SFD A;  3UOZ A;  5HYM A;  5KMP A;  1F8W A;  3G5Q A;  3VQR A;  2BCP A;  3AYL A;  4X9N A;  4EMW A;  4EIQ A;  2GVC A;  4GAV A;  4EM4 A;  1Q1R A;  2XVH A;  4II3 A;  4I58 A;  4J34 A;  4Q0T A;  1DOB A;  2EQ8 A;  4NEV A;  3K30 A;  2RGJ A;  2GV8 A;  1PBB A;  3DJJ A;  4GRT A;  2YR5 A;  3SZW A;  2GR0 A;  1GRF A;  2YG3 A;  3GD4 A;  2AAQ A;  2GQF A;  1CF3 A;  1PDH A;  3UKL A;  4EQS A;  3C4N A;  3ALJ A;  1GRA A;  1TDF A;  2OAM A;  3GRS A;  3Q6J A;  1DJQ A;  4H50 A;  2R45 A;  3UKQ A;  1P2H A;  2WDV A;  2YQU A;  1KFY A;  2GAG B;  1KSS A;  5M0Z A;  2XFO A;  4TLX A;  5U1O A;  1IUS A;  1CL0 A;  1VDC A;  3UOX A;  2C72 A;  4RSL A;  3F29 A;  2BS4 A;  1FS8 A;  5GRT A;  3FO3 A;  4Z43 A;  3URH A;  1NG3 A;  2IVE A;  2C64 A;  1B8S A;  4CNK A;  5FMH A;  3P4Q A;  1GET A;  1XDI A;  2OLO A;  1M1Q A;  4H4T A;  1NG4 A;  4Q17 A;  2BAC A;  3DGH A;  5FS7 A;  2X3N A;  4H2P A;  3AYI A;  4KPR A;  4NNJ A;  3DGZ A;  2JB2 A;  4NTC A;  3VR9 A;  4CNJ A;  3Q9T A;  1FEA A;  4H2N A;  1GER A;  1UKV G;  4H4P A;  1FS9 A;  3L8K A;  3SQP A;  2YVJ A;  4NZH A;  4A7A A;  1GT8 A;  4OCG A;  2Z5Y A;  5GSN A;  2X8H A;  2BCG G;  3BNH A;  1VRQ B;  3SXQ A;  3NH3 X;  1E1N A;  1B5Q A;  2C75 A;  1DOC A;  3NKS A;  4TLZ A;  4A99 A;  3TTB A;  3I3L A;  2B9X A;  3OC4 A;  3P4S A;  1ZOV A;  2WHD A;  1GAL A;  2YVF A;  3CNJ A;  2R0C A;  3PS9 A;  1SP3 A;  3LG1 A;  2VR0 A;  1CJ4 A;  1GTH A;  1TRB A;  1CJ2 A;  3QFB A;  2GR2 A;  5KXJ A;  1IJH A;  1P2E A;  1JOA A;  1ZMD A;  1LVL A;  3UTG A;  1PBC A;  5C2T A;  3NTA A;  1IUV A;  1H81 A;  4CRT A;  2F5Z A;  4U8K A;  3CND A;  1GSN A;  3OZ2 A;  5DBJ A;  3K7M X;  2YR4 A;  3BNJ A;  3BHF A;  2B76 A;  3GDN A;  1RP0 A;  1ONF A;  2BS2 A;  2VVM A;  2EQ6 A;  2C3C A;  2XFP A;  3P4R A;  4K22 A;  3R9U A;  3RHA A;  2X8G A;  4YKF A;  3CNS A;  4BUR A;  2ZZC A;  1NPX A;  1L9E A;  5IPY A;  2WU5 A;  4N9X A;  2GR3 A;  1PHH A;  5CKU A;  1XHC A;  3AB1 A;  5LV9 A;  2B7S A;  1XPQ A;  3AD8 B;  3SY4 A;  5FS6 A;  1BWC A;  1CC6 A;  3KPF A;  5HXI A;  5KOX A;  2Q0L A;  1VQW A;  5KNL A;  3M12 A;  1LPF A;  3BNM A;  4JY2 A;  4TM3 A;  1X31 B;  4U8L A;  3F8D A;  1H83 A;  4U8J A;  2YLS A;  5KVH A;  2QA2 A;  4C3X A;  4JQ9 A;  3AEB A;  2XLR A;  3KA7 A;  3BI4 A;  3K7T A;  3GDP A;  3NT6 A;  1FT5 A;  4TM0 A;  4NEW A;  4B67 A;  3EPT A;  3GWD A;  3EAN A;  1GRH A;  3GYX A;  1BKW A;  2FBW A;  4U2L A;  4OPI A;  2BC0 A;  2WOV A;  2YWL A;  1REO A;  3E1T A;  4JNA A;  4O5U A;  2XVJ A;  2WQY A;  3OWM A;  3SXI A;  5JCK A;  2WS3 A;  3PO7 A;  2J3N A;  3PVC A;  1F6M A;  2BS3 A;  3GYI A;  3QVR A;  4J31 A;  2XFQ A;  2JKC A;  3ABV A;  4X9M A;  3NIX A;  3AEG A;  3AD9 B;  1MOK A;  1Y0P A;  3UKK A;  3DME A;  3SM8 A;  5J60 A;  4OPD A;  4H4W A;  4TM1 A;  3AEC A;  3VR8 A;  3DK9 A;  3L1T A;  2K3V A;  1GPE A;  2WP6 A;  3BI5 A;  2OAL A;  4FX9 A;  3NK0 X;  5FS8 A;  2XYO A;  2WDR A;  4Y4M A;  1KDG A;  3BNF A;  2R4E A;  2XVE A;  1O5W A;  4OPL A;  3QFA A;  4EIP A;  4MJW A;  4ZCD A;  1GRB A;  4Q5C A;  3FPZ A;  4GAP A;  3EAO A;  1E1K A;  1K4Q A;  2UZZ A;  1S2Q A;  2ARD A;  2DKI A;  3AEF A;  1E6E A;  2Y6Q A;  4B68 A;  4YSX A;  5KWF A;  4GCM A;  1PXC A;  5BRT A;  4H4X A;  1N4U A;  1KNP A;  1SEZ A;  2Q0K A;  1GTE A;  4U8P A;  1VG9 A;  3O0H A;  4LII A;  1BGJ A;  5KMS A;  2H89 A;  3UKF A;  4JDR A;  4OPT A;  4TM4 A;  1OAH A;  1FCD A;  2VVL G;  1Y56 B;  2Q6U A;  2CUL A;  4O5Q A;  5U63 A;  1YQ3 A;  1PBF A;  2TPR A;  1AOG A;  3RP7 A;  4G9K A;  3T2Z A;  3UP5 A;  3UKA A;  1JNI A;  4FK1 C;  2W0H A;  5L46 A;  3KPK A;  3RKH A;  3LOV A;  1KF6 A;  5FS9 A;  2R0G A;  4IV9 A;  3BNU A;  3NRN A;  1GES A;  2WPC A;  4JN9 A;  2E5V A;  3RP8 A;  2E80 A;  1BZL A;  1CC2 A;  1N4V A;  2R4J A;  3ICS A;  1FT6 A;  4H4Q A;  4Z2U A;  2WP9 A;  4P9S A;  3GWF A;  5BVA A;  2BA9 A;  3LGQ A;  2YM2 A;  1H86 A;  3DK8 A;  2XVI A;  4XWR A;  2NPX A;  4NTD A;  2XFN A;  1JU2 A;  2ZZ0 A;  4EMJ A;  1N1P A;  3G5S A;  4B65 A;  2EQ7 A;  2FJB A;  3ATQ A;  4U8N A;  3UOY A;  1GRE A;  5HY5 A;  4Y4N A;  4Z2R A;  2IID A;  1CJ3 A;  1GV4 A;  2BK3 A;  4C3Y A;  3T2K A;  2GMH A;  1Z6L A;  2CVJ A;  1M64 A;  2ZZB A;  1H6V A;  3HYV A;  4H4S A;  4RG4 A;  3ZYX A;  1W4X A;  3B3R A;  2V61 A;  3QJ4 A;  2YLT A;  2E81 A;  4JNQ A;  3T0K A;  1Y56 A;  4ZN0 A;  2ACZ A;  5JCN A;  1S2Y A;  5HHF A;  4PAB A;  1M1R A;  1O94 A;  3C4A A;  4GF7 A;  2FJE A;  2GH5 A;  3S61 A;  3UOV A;  1L0V A;  4BK1 A;  4Q1O A;  2RGO A;  3NG7 X;  2B9Y A;  3AYJ A;  4B69 A;  3ITJ A;  3KD9 A;  1LTX R;  2XLT A;  4HA6 A;  2VOU A;  1MXT A;  1IUX A;  5U25 A;  1OJC A;  1NHQ A;  2C67 A;  2XCG A;  2C65 A;  1TDO A;  2RDZ A;  2IVD A;  3CNT A;  4B63 A;  2BRY A;  3BHK A;  1E1L A;  1PJ5 A;  3SFE A;  4BK3 A;  3AE2 A;  4C5O A;  1F8R A;  2NVK X;  3AE1 A;  3GMC A;  4K2X A;  4U2S A;  3UTF A;  4A9W A;  2PHH A;  3HZL A;  1COY A;  1NAA A;  4AP3 A;  2R46 A;  3AE4 A;  1GND A;  2WOW A;  4D03 A;  3H8L A;  5EB5 A;  2WU2 A;  4BK2 A;  4Z25 A;  3LB8 A;  2WPF A;  4UDQ A;  3GM6 A;  4A65 A;  4DSH A;  1N4W A;  2BC1 A;  4REK A;  5EOW A;  3ZDN A;  3ALM A;  4YTN A;  4B1B A;  4AOX A;  5JCI A;  4WJY A;  3NK2 X;  2QCU A;  1YQ4 A;  1IUW A;  2BRA A;  3VRA A;  2V5Z A;  1BGN A;  2WDQ A;  1ZKQ A;  3D1I A;  4G73 A;  5IQ1 A;  1E39 A;  3HYW A;  1D5T A;  3UKP A;  2LFC A;  3RP6 A;  5J7X A;  3UCL A;  4WX1 A;  4JY3 A;  4Q4U A;  3IC9 A;  3H4K A;  3CPJ G;  4M52 A;  4U8I A;  1GU6 A;  2A8X A;  3LJP A;  4GDE A;  4XXG A;  2GEW A;  4YTM A;  2Y6R A;  5M10 A;  2A87 A;  2YLZ A;  1OJ9 A;  1Q9I A;  4CY8 A;  3VRB A;  2XDO A;  1NHS A;  1DJN A;  4IVM B;  4ICY A;  2YLR A;  2YG5 A;  1M1P A;  1PBD A;  4BJZ A;  1K0J A;  2I0Z A;  2DKH A;  3AEA A;  2VRM A;  2YLX A;  1PXB A;  4K5R A;  3WE0 A;  3SCE A;  2Q7V A;  3P1W A;  2BK4 A;  4U8O A;  3QSE A;  3DK4 A;  1H7W A;  2XLS A;  4AP1 A;  4YT0 A;  1O95 A;  1DNC A;  2FJA A;  5JCM A;  1FL2 A;  3UKH A;  2GMJ A;  3DJE A;  1L9D A;  3FIM B;  1EBD A;  3CGD A;  1JEH A;  3ISH A;  4UP3 A;  1BVB A;  4H2Q A;  4J57 A;  2C70 A;  4IA6 A;  1TYT A;  3LXD A;  3AXB A;  4YSY A;  1EL8 A;  2B7R A;  2JB3 A;  3GSI A;  1LJ1 A;  1EL7 A;  3F8P A;  1EL9 A;  1IUT A;  1GEU A;  4XWZ A;  3AD7 B;  3SZF A;  3V3O A;  2QA1 A;  1ZY8 A;  2BAB A;  3CPI G;  5JCL A;  3QSS A;  4YXD A;  4Q5B A;  2HQM A;  4OPU A;  5EBK A;  4YTP A;  3ICR A;  4L38 A;  1D4D A;  4PAA A;  3AE5 A;  1KNR A;  4A6N A;  2BXR A;  4L3X A;  2ZO5 A;  3CGE A;  2APG A;  1LQT A;  2VVL A;  3RNM A;  3C96 A;  2V3B A;  1K0L A;  4EQR A;  4BV6 A;  5BUL A;  4U8M A;  4Z44 A;  4EQX A;  3DJG X;  1CHU A;  2VZ2 A;  1NHR A;  2BYB A;  2CDU A;  3KLJ A;  3NHO X;  3P4P A;  4I59 A;  5TR3 A;  4B64 A;  2R9Z A;  1F3P A;  2PYX A;  3S7W A;  4IA5 A;  4C74 A;  1E7P A;  3DJD A;  1NEN A;  3CIR A;  3IHG A;  1TYP A;  4DNA A;  3SYI A;  3F8R A;  2YM1 A;  1FEC A;  1GRT A;  1H7X A;  1LQU A;  2X50 A;  4UDR A;  5CQF A;  4ECH A;  1F8S A;  1FOH A;  1CBO A;  4H4Z A;  3FMW A;  1HYU A;  4GUV A;  1CC4 A;  4J36 A;  1GRG A;  3CNP A;  3GYJ A;  4CCR A;  1YKJ A;  1CJC A;  2GB0 A;  3ATR A;  5KRQ A;  3KU9 A;  2JBV A;  3AED A;  4FK1 A;  1PJ7 A;  5EB4 A;  5KOW A;  3L1R A;  1H84 A;  3NN0 X;  3FG2 P;  5KMR A;  3NYF A;  1ZDL A;  3AE7 A;  2WEU A;  2FJD A;  2C3D A;  1NDA A;  2YR6 A;  3AE6 A;  3CPH G;  1QLB A;  2BXS A;  3VRD B;  2OA1 A;  5C3J A;  3UU9 A;  1EL5 A;  2JK6 A;  1RYI A;  2BK5 A;  2AR8 A;  2YG6 A;  1QJD A;  4K7Z A;  2C73 A;  3KVE A;  1OJA A;  4APN A;  5KMQ A;  1NEK A;  3D1C A;  2CFY A;  3M13 A;  4DGK A;  2OT4 A;  3CN8 A;  3II4 A;  1NHP A;  4WCT A;  3SGL A;  2YLW A;  3CTY A;  4ADW A;  4AOS A;  1PN0 A;  3MMO A;  4NTE A;  4OPC A;  2R0P A;  4GR1 A;  3RED A;  1L9C A;  2A89 A;  1OJT A;  2WET A;  2X8C A;  1D4E A;  3QSM A;  2VRL A;  1B4V A;  2GR1 A;  3NN6 X;  4UDP A;  4J2W A;  3SX6 A;  2B9W A;  1TDE A;  2VQB A;  3CMM A;  1PS9 A;  3M0O A;  3AE9 A;  3V76 A;  1GOS A;  2C76 A;  2WBA A;  2C7G A;  3AE3 A;  3BI2 A;  4H4U A;  3D8X A;  4LU6 A;  4Z24 A;  3ICT A;  4C77 A;  4Z2T A;  2XVF A;  3AE8 A;  1VG0 A;  1ZP0 A;  4II2 A;  4X4J A;  3GRT A;  3V3N A;  1ZOY A;  4H4Y A;  4B66 A;  4G6H A;  1BF3 A;  1OJD A;  3UBR A;  4AT2 A;  4Y4L A;  2V6O A;  3JSK A;  1V59 A;  3KKJ A;  4H7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...