1QJDA

Flavocytochrome c3 from shewanella frigidimarina
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Mechanistic Mapping of a Unique Fumarate Reductase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FLAVOCYTOCHROME C3
total genus 197
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 1999-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1qjdA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1qjdA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1qjdA01
4K2XA 4Q1OA 1B5QA 2GAHB 3NK1X 1ZP0A 1GRHA 2R4JA 5U63A 2F5ZA 1K4QA 2B9YA 2TPRA 4A6NA 2WU2A 4A6NB 1TRBA 3I6DA 1M1QA 4OPUA 3IWAA 1OJCA 1ZX9A 3NT6A 2RGOA 4L3ZA 2A89A 3DH9A 3DJJA 4U8NA 3CNPA 5FMHA 2NVKX 3CNDA 4CRTA 3RP7A 2V6OA 3UKLA 3UOZA 4Z44A 2C3CA 5FS8A 1KSSA 2R46A 4Y4LA 2YR5A 4AP3A 1GTEA 4ZCDA 2RGJA 5HY5A 2B7SA 3QVPA 3CNJA 4REKA 4RSLA 4YSZA 3NKSA 2VQ7A 3AE7A 1N4VA 5FS9A 1GTHA 3NK2X 5FS6A 3DK8A 3FPZA 1B8SA 1LQTA 2BS2A 4GRTA 3BI5A 3AEBA 3SFDA 3UOYA 1S2QA 3AECA 1XPQA 3OZ2A 4WX1A 1V59A 3M13A 2YVGA 2FJBA 3K7MX 4EM3A 1PBFA 4H4SA 3QJ4A 5JCMA 1IJHA 1EL9A 2JBVA 3UOVA 3UBRA 1S3BA 4K22A 4MJWA 2Y6QA 1L9DA 2JB3A 2XVJA 1IUTA 4YTNA 2Q0LA 2YLRA 3SM8A 3AE3A 3GWDA 3QFAA 2VR0A 4Y4MA 3NH3X 2K3VA 3IHMA 1FS8A 4GF7A 2WQYA 1ELIA 3CPHG 2GR3A 4OCGA 4Z2UA 3GRTA 1YQZA 3AXBA 4OPIA 5GSNA 2W0HA 3UKAA 2DKIA 2R0GA 3URHA 4H4VA 3LGQA 1ZY8A 2YR6A 4H4RA 1PJ6A 4TLZA 2XFUA 1B37A 2E81A 1PBDA 2H88A 2WHDA 4TM0A 1OAHA 2BA9A 1PJ5A 2JKCA 3DK9A 3BI2A 4H4XA 1LVLA 3NN0X 3QSEA 3DGHA 2WOVA 4IA5A 4JY2A 4H4UA 3VR8A 3Q9TA 3S61A 4D03A 1PHHA 4IVOB 1RP0A 2GVCA 4H7UA 4EIPA 2GEWA 1Y56B 4J56A 2GH5A 3CPJG 2BK3A 1TDKA 1IUSA 3GD3A 3H8IA 3G5QA 1GPEA 4Q5BA 2YG4A 4A7AA 4JQ9A 4TM1A 3ALJA 3NLCA 4LIIA 4M52A 4NTDA 4C74A 5HXIA 3C4NA 4XWRA 2XLPA 1O5WA 2R4EA 3LJPA 1CC2A 2R45A 4J33A 4K8DA 3CNSA 3AE5A 1JNIA 1HYUA 3GYJA 2EQ8A 2JAEA 5KVHA 3F8DA 2WOWA 5CQFA 2I0ZA 2WESA 1YQ4A 1QDBA 3BHFA 3GRSA 4DNAA 3NNEA 1O95A 3C4AA 4AT2A 1PXCA 1F3PA 1Q1RA 1FL2A 3D1IA 2EQ7A 3CGBA 3KLJA 3RP8A 2ZBWA 3QSMA 2OA1A 4L38A 1JU2A 3KD9A 3WE0A 1BKWA 1TYTA 4Z26A 2BK5A 4H4PA 3ICTA 4B66A 3ATRA 2ACZA 3PVCA 1EL8A 2GAGB 3ZYXA 1ZMDA 2WPCA 3CIRA 3LZXA 2R0CA 5EB4A 3DMEA 5FS7A 3CGDA 1KNPA 2XLRA 1GRBA 2UZZA 3H4KA 3IC9A 4C77A 4DSHA 3VRDB 4EM4A 2BS4A 3KKJA 2VVLG 3E1TA 3AEAA 4UDQA 2YLXA 1LJ1A 2XFNA 2XFOA 2QCUA 5TR3A 3UKHA 1FT6A 1N4WA 4APNA 3ISHA 4ADWA 4D04A 4B1BA 1GRAA 1OJTA 2X3NA 2WPEA 3FIMB 1TDEA 4B68A 5BULA 4BK3A 1CHUA 1MXTA 4LU6A 4EQRA 2X8HA 4YTMA 2YWLA 3VR9A 4A65A 4YT0A 5KOWA 1P2HA 2BCPA 1O94A 2XYOA 3S5WA 3UTEA 3OWMA 2JB1A 2V3AA 3D1CA 2R9ZA 1GREA 2YVJA 1DOCA 2X99A 1XHCA 3AE6A 1NDAA 3OC4A 3NTAA 2Z5XA 1NHQA 4YKGA 4H50A 4J31A 1SP3A 1S2YA 1EL7A 4A99A 3NYFA 2YR4A 1ZKQA 3LOVA 4O5UA 3RKHA 4IV9A 5KXJA 3UTFA 1M1RA 4Z2TA 3ICSA 3MMOA 2GRTA 5DBJA 2ZZBA 1GU6A 1OJ9A 1GRFA 1FS7A 2YM1A 3P4PA 3T37A 4CY8A 2X50A 3UU9A 2VRMA 4AOSA 1OJDA 1H6VA 1PXBA 4FK1A 3EANA 3V3NA 2A8XA 2E5VA 3CTYA 4USQA 4CBQA 2OLNA 2VQBA 3NN6X 4PAAA 3UP4A 1TDFA 2OLOA 4H4QA 2CFYA 1NPXA 2WEUA 1CC4A 2FJEA 4EQSA 4TLXA 2GR2A 1PJ7A 4J34A 2RGHA 5J7XA 4H2NA 3NYEA 3ITJA 2Q7VA 2GQWA 3ALMA 4YTPA 1ONFA 1N4UA 2QAEA 3BNUA 4ZN0A 5M0ZA 3NK0X 1DODA 3UKKA 4A9WA 2YLTA 3AD8B 1AOGA 2B76A 3DJDA 1NHPA 4KPRA 3HZLA 1NEKA 3NIXA 2CVJA 2XLUA 1TDNA 4GCMA 3RHAA 4EQXA 3NHOX 4C3XA 1EL5A 4TM3A 1KNRA 3BNHA 1MO9A 4U8KA 2XVHA 1L9EA 1K0IA 2GR1A 4YXDA 4I58A 3Q6JA 1YQ3A 4RG3A 2AAQA 2XVFA 2BACA 1E6EA 3LXDA 3GWFA 2YLSA 2ARDA 1GETA 1H7XA 5EOWA 3K7TA 3ABVA 2BK4A 4CNJA 4U2LA 2WBAA 3ADAB 4JDRA 4NTCA 1TYPA 1E39A 3FMWA 3LADA 3BNMA 4A79A 1E1LA 3GM6A 3II4A 2GMJA 2Q6UA 1BF3A 3COXA 4WJYA 3BHKA 1E1NA 1CC6A 2VRLA 1W4XA 3CNTA 4B63A 2E4GA 2GQFA 3SXQA 1Z6LA 4FX9A 4IA6A 2APGA 4J36A 2XDOA 3DK4A 3H8LA 3GYXA 2A87A 4X9MA 4AT0A 4DGKA 2DKHA 4GDEA 4OPCA 3BI4A 3BNGA 4KX6A 2FJDA 4CY6A 1H84A 2WU5A 2V3BA 2J3NA 3ATQA 5JCLA 1GALA 2IIDA 4O5QA 3LG1A 1NHRA 3AYJA 1EBDA 3ICRA 2YG7A 1CF3A 5BVAA 4U8JA 4UDPA 1PBCA 4OPTA 3M12A 4USRA 3UTHA 3DA1A 5KOXA 1GXFA 3P9UA 3V76A 1ZOYA 1KDGA 3AB1A 5EB5A 3CN8A 5JCKA 3P4SA 1F8SA 3M0OA 4NZHA 2GB0A 1B4VA 3L8KA 3G5RA 4FDCB 3I3LA 4N9XA 4J2WA 2E80A 1BGNA 1F8WA 1H7WA 3UTGA 1XANA 2V5ZA 4E0VA 2C3DA 3EAOA 4NEWA 3GDPA 1FOHA 3QSSA 4RG4A 4K7ZA 1QO8A 1D4EA 1REOA 4BJZA 2BXSA 4BK1A 4H2RA 3D8XA 3B3RA 1UKVG 1CJ3A 1NG4A 4UP3A 5BUKA 1BGJA 4WCTA 3ZDNA 2VVLA 3KU9A 4NEVA 3IF9A 4AP1A 4B65A 2XFQA 1COYA 2Q0KA 4YWOA 5GRTA 4BK2A 1FCDA 1F8RA 1JNZA 3P4QA 1KFYA 1LPFA 1JRXA 2BC1A 2IVEA 3NG7X 1VQWA 3IHGA 3UKPA 2J7AA 5CKUA 1P2EA 2C70A 5KRQA 3L1RA 3CPIG 1DJQA 4TM4A 4H4ZA 2VZ2A 2C65A 4BV6A 1PBEA 5HYMA 3FG2P 4ICYA 2WP9A 2XVEA 2B9XA 3NYCA 4FK1C 4YSHA 1M1PA 2YG3A 3ALLA 4P9SA 2C73A 3EPTA 3F8PA 3AYIA 2YG5A 4H2QA 3L1TA 1VDCA 2WOIA 1H83A 1QLBA 3NTDA 3REDA 3P1WA 1JEHA 1ZMCA 1JNRA 3S7WA 2B7RA 4L3YA 3AE8A 1GOSA 4PABA 1Q9IA 2GR0A 2QA2A 2X8GA 3JSKA 1GESA 1X31B 1CJCA 1LTXR 2C67A 1NHSA 5U1OA 1GV4A 2XLTA 1LV0A 2ZZ0A 1VG9A 3FO3A 2AR8A 2BABA 3R9UA 4Q4UA 3AEDA 5JCIA 1BVBA 1FT5A 4CCRA 4EMJA 2XLSA 2YLZA 2WP5A 4U8LA 3SFEA 2VOUA 1CBOA 2RF7A 3UOXA 5C3JA 1ZOVA 4A5LA 5LV9A 5BRTA 3KA7A 3AE2A 4GR1A 1YY5A 1NENA 3AD7B 1GNDA 1ZDLA 1H86A 3TORA 3KVEA 3LB8A 2XVIA 2BS3A 1BWCA 2C7GA 2YVFA 4U2TA 5JCNA 1L9CA 4CNKA 2AQJA 5EBKA 1RSGA 2Z5YA 3LZWA 1SEZA 2ZO5A 1E1MA 2OALA 4BURA 4K5RA 5U25A 5HHFA 5ER0A 3QVRA 1L0VA 2BC0A 3AE4A 3O0HA 1VG0A 2X8CA 3V3OA 1QJDA 1IUXA 1VRQB 1NAAA 2BCGG 2FJAA 4J57A 4B64A 2RABA 3GMCA 3QFBA 4H4TA 4C3YA 5KWFA 4ECHA 3GDNA 4LA1A 1M64A 2BXRA 2OT4A 1PN0A 2WDVA 3AEEA 1JRYA 4HA6A 1TDOA 1PBBA 4YSYA 1D7YA 4EMIA 2LFCA 3P4RA 1GERA 1GRTA 1GEUA 2YG6A 2C75A 1BZLA 1H81A 2CULA 2O9ZA 2XCGA 3AEGA 4U8IA 4U8MA 4U8PA 2C72A 3UKFA 3GD4A 1D7LA 2E1MA 4H4WA 4H2PA 1H82A 2B9WA 3EF6A 4U2SA 3SQPA 3AYLA 4K5SA 4OPGA 4UDRA 3DGZA 3KPFA 4GUVA 1KSUA 1K0JA 4HB9A 1CJ2A 4JN9A 1N1PA 5J60A 4XXGA 2FBWA 3K30A 4Y4NA 2QA1A 2WDQA 3CGCA 4B69A 3GSIA 2JK6A 1JOAA 5C2TA 3FBSA 1JRZA 3F8RA 3AEFA 3AWIA 4B67A 4XWZA 1K0LA 3AE9A 4X9NA 2CDUA 2WS3A 1LQUA 2Y6RA 2JB2A 4CCQA 1Y56A 4YSXA 4X4JA 4L3XA 2ZZCA 2OAMA 1D4DA 1FS9A 1DNCA 4Z43A 1CJ4A 1DOBA 1RYIA 2YLWA 1CL0A 3AE1A 3NRNA 4YKFA 5M10A 2PHHA 4Q5CA 1S3EA 1PS9A 4EQWA 2WP6A 1IUVA 1D4CA 1YKJA 1OJAA 2WETA 1IUUA 1NG3A 3DJEA 3NGCX 4GDPA 1GRGA 4NTEA 1KF6A 3G5SA 3BNFA 5L46A 3RP6A 1GSNA 2EQ6A 2WPFA 1ZK7A 1E1KA 4Q0TA 1Y0PA 2HQMA 2YQUA 1E7PA 2C66A 5IQ1A 2VVMA 3BNJA 3UKQA 4EIQA 5IQ4A 2GMHA 1XDIA 3F29A 2C76A 1PDHA 4I59A 2IVDA 2GF3A 2V60A 2C64A 4OPLA 3B6DA 2BYBA 3UCLA 3SCEA 1DXLA 4Z24A 1IUWA 1GT8A 4U8OA 3SGLA 3C96A 3GMBA 4DSGA 4AOXA 3AD9B 2XFPA 3VRBA 4ZCCA 3VRAA 5KVIA 4EMWA 3TTBA 1FECA 1Q1WA 2R0PA 2YM2A 4H4YA 4IVMB 2GV8A 1FEAA 2YAUA 2V61A 4Q17A 1DJNA 2WDRA 3VQRA 4C5OA 2TMDA 1DOEA 4JY3A 4OVIA 4Z25A 4OPDA 2H89A 2RDZA 2PYXA 3DJGX 1FEBA 4JNQA 1D5TA 1F6MA 4Z2RA 3CGEA 3PS9A 3RNMA 2EQ9A 3K7QX 3UP5A 1MOKA 3GYIA 4BJYA 1M6IA 5IPYA 2NPXA 1PXAA 4JNAA 3PO7A
chains in the Genus database with same CATH superfamily
4K2XA 4Q1OA 1B5QA 2GAHB 3NK1X 1ZP0A 1GRHA 2R4JA 5U63A 2F5ZA 1K4QA 2B9YA 2TPRA 4A6NA 2WU2A 4A6NB 1TRBA 3I6DA 3SZWA 1M1QA 4OPUA 3IWAA 1OJCA 1ZX9A 3NT6A 2RGOA 4L3ZA 2A89A 3DH9A 3DJJA 4U8NA 3CNPA 5FMHA 2NVKX 3CNDA 4CRTA 3RP7A 2V6OA 3UKLA 3UOZA 4Z44A 2C3CA 5FS8A 1KSSA 2R46A 4Y4LA 2YR5A 3SX6A 4AP3A 1GTEA 4ZCDA 2RGJA 5HY5A 2B7SA 3QVPA 3CNJA 4REKA 4RSLA 4YSZA 3NKSA 2VQ7A 3AE7A 1N4VA 5FS9A 1GTHA 3NK2X 5FS6A 3DK8A 3FPZA 1B8SA 1LQTA 2BS2A 4GRTA 3BI5A 3AEBA 3SFDA 3UOYA 1S2QA 4NWZA 3AECA 1XPQA 3OZ2A 4WX1A 1V59A 3M13A 2YVGA 2FJBA 3K7MX 4EM3A 3T2YA 1PBFA 4H4SA 3QJ4A 5JCMA 1IJHA 1EL9A 2JBVA 3UOVA 3UBRA 1S3BA 4K22A 4MJWA 2Y6QA 1L9DA 2JB3A 2XVJA 1IUTA 4YTNA 2Q0LA 2YLRA 3SM8A 3AE3A 3GWDA 3QFAA 2VR0A 4Y4MA 3NH3X 2K3VA 3IHMA 1FS8A 4GF7A 2WQYA 1ELIA 3CPHG 2GR3A 4OCGA 4Z2UA 3GRTA 1YQZA 3AXBA 4OPIA 5GSNA 2W0HA 3UKAA 2DKIA 2R0GA 3URHA 4H4VA 3LGQA 1ZY8A 2YR6A 4H4RA 1PJ6A 4TLZA 2XFUA 1B37A 2E81A 1PBDA 2H88A 2WHDA 4TM0A 1OAHA 2BA9A 1PJ5A 2JKCA 3DK9A 3BI2A 3HYWA 1LVLA 3NN0X 3QSEA 3DGHA 2WOVA 4IA5A 4JY2A 4H4UA 3VR8A 3Q9TA 3S61A 4D03A 1PHHA 4IVOB 1RP0A 2GVCA 4H7UA 4EIPA 2GEWA 1Y56B 4J56A 2GH5A 3CPJG 2BK3A 1TDKA 1IUSA 3GD3A 3H8IA 3G5QA 1GPEA 4Q5BA 2YG4A 4A7AA 4JQ9A 4TM1A 3ALJA 3NLCA 4LIIA 4M52A 4NTDA 4C74A 5HXIA 3C4NA 4XWRA 3SZFA 2XLPA 1O5WA 2R4EA 3LJPA 1CC2A 2R45A 4J33A 4K8DA 3CNSA 3AE5A 1JNIA 1HYUA 3GYJA 2EQ8A 2JAEA 5KVHA 3F8DA 2WOWA 5CQFA 5KMQA 2I0ZA 2WESA 1YQ4A 1QDBA 3BHFA 3GRSA 4DNAA 3NNEA 1O95A 3C4AA 4AT2A 1PXCA 1F3PA 1Q1RA 1FL2A 3D1IA 2EQ7A 3CGBA 3KLJA 3RP8A 2ZBWA 3QSMA 2OA1A 4L38A 1JU2A 3KD9A 3WE0A 1BKWA 1TYTA 4Z26A 2BK5A 4H4PA 3ICTA 4B66A 3SZ0A 3ATRA 2ACZA 3PVCA 1EL8A 2GAGB 3ZYXA 1ZMDA 2WPCA 3CIRA 3LZXA 3T0KA 2R0CA 5EB4A 3DMEA 5FS7A 3CGDA 1KNPA 2XLRA 1GRBA 2UZZA 3H4KA 3IC9A 4C77A 4DSHA 3VRDB 4EM4A 2BS4A 3KKJA 2VVLG 3E1TA 3AEAA 3T14A 4UDQA 2YLXA 1LJ1A 2XFNA 2XFOA 2QCUA 5TR3A 3UKHA 1FT6A 1N4WA 4APNA 3ISHA 4ADWA 4D04A 4B1BA 1GRAA 1OJTA 2X3NA 2WPEA 3FIMB 1TDEA 4B68A 5BULA 4BK3A 1CHUA 1MXTA 4LU6A 4EQRA 2X8HA 4YTMA 2YWLA 3VR9A 4A65A 4YT0A 5KOWA 1P2HA 2BCPA 1O94A 2XYOA 3S5WA 3UTEA 3OWMA 2JB1A 2V3AA 3D1CA 2R9ZA 1GREA 4NNJA 2YVJA 1DOCA 2X99A 1XHCA 3AE6A 1NDAA 3OC4A 3NTAA 2Z5XA 1NHQA 4YKGA 4H50A 4J31A 1SP3A 1S2YA 1EL7A 4A99A 3NYFA 2YR4A 4II3A 1ZKQA 3LOVA 4O5UA 3RKHA 4IV9A 5KXJA 3UTFA 1M1RA 4Z2TA 3ICSA 3MMOA 2GRTA 5DBJA 2ZZBA 1GU6A 3SZCA 1OJ9A 1GRFA 1FS7A 2YM1A 3P4PA 3T37A 4CY8A 2X50A 3UU9A 2VRMA 4AOSA 1OJDA 1H6VA 1PXBA 4FK1A 3EANA 3V3NA 2A8XA 2E5VA 3CTYA 4USQA 4CBQA 2OLNA 2VQBA 3NN6X 4PAAA 3UP4A 1TDFA 2OLOA 4H4QA 2CFYA 1NPXA 2WEUA 3HYVA 1CC4A 2FJEA 4EQSA 4TLXA 2GR2A 1PJ7A 4GAVA 4J34A 2RGHA 5J7XA 4H2NA 3NYEA 3ITJA 2Q7VA 2GQWA 3ALMA 4YTPA 1ONFA 1N4UA 2QAEA 3BNUA 4ZN0A 5M0ZA 3NK0X 1DODA 3UKKA 4A9WA 2YLTA 3AD8B 1AOGA 2B76A 3DJDA 1NHPA 2CZSA 3HZLA 1NEKA 3NIXA 2CVJA 2XLUA 1TDNA 4GCMA 3RHAA 4EQXA 3NHOX 4C3XA 1EL5A 4TM3A 1KNRA 3BNHA 1MO9A 4U8KA 2XVHA 1L9EA 1K0IA 2GR1A 4YXDA 4I58A 3Q6JA 1YQ3A 4RG3A 2AAQA 2XVFA 2BRYA 2BACA 1E6EA 3LXDA 3GWFA 2YLSA 2ARDA 1GETA 4G9KA 1H7XA 5EOWA 3K7TA 3ABVA 2BK4A 4CNJA 4U2LA 2WBAA 3ADAB 4JDRA 4NTCA 1TYPA 1E39A 3FMWA 3LADA 3BNMA 4A79A 1E1LA 3GM6A 3II4A 2GMJA 2Q6UA 1BF3A 3COXA 4WJYA 3BHKA 1E1NA 1CC6A 2VRLA 1W4XA 3CNTA 4B63A 2E4GA 2GQFA 3SXQA 1Z6LA 4FX9A 4KPRA 4IA6A 2APGA 4J36A 2XDOA 3DK4A 3H8LA 3GYXA 2A87A 4X9MA 4AT0A 4DGKA 2DKHA 4GDEA 4OPCA 3BI4A 3BNGA 4KX6A 2FJDA 4CY6A 1H84A 2WU5A 2V3BA 2J3NA 3ATQA 5JCLA 1GALA 2IIDA 4O5QA 3LG1A 1NHRA 3AYJA 1EBDA 3ICRA 2YG7A 1CF3A 5KMPA 4II2A 5BVAA 4U8JA 4UDPA 1PBCA 4OPTA 3M12A 4USRA 3UTHA 3DA1A 5KOXA 1GXFA 3P9UA 3V76A 1ZOYA 1KDGA 3AB1A 5EB5A 3CN8A 5JCKA 3P4SA 1F8SA 3M0OA 4NZHA 2GB0A 1B4VA 3L8KA 3G5RA 4FDCB 3SYIA 3I3LA 4N9XA 4J2WA 2E80A 1BGNA 1F8WA 1H7WA 3HYXA 1XANA 2V5ZA 3UTGA 2C3DA 3EAOA 4NEWA 3GDPA 1FOHA 3QSSA 4RG4A 4E0VA 4G73A 4K7ZA 1QO8A 1D4EA 1REOA 4BJZA 2BXSA 4BK1A 4H2RA 3D8XA 3B3RA 1UKVG 1CJ3A 1NG4A 4UP3A 5BUKA 1BGJA 4WCTA 3ZDNA 2VVLA 3KU9A 2C4CA 4NEVA 3IF9A 4AP1A 4B65A 2XFQA 1COYA 2Q0KA 4YWOA 5GRTA 4BK2A 1FCDA 1F8RA 1JNZA 3P4QA 1KFYA 1LPFA 1JRXA 2BC1A 2IVEA 3NG7X 1VQWA 3IHGA 3UKPA 2J7AA 5CKUA 1P2EA 2C70A 5KRQA 3L1RA 3CPIG 1DJQA 4TM4A 4H4ZA 2VZ2A 2C65A 4BV6A 1PBEA 5HYMA 3FG2P 4GAPA 4ICYA 2WP9A 2XVEA 2B9XA 3NYCA 4FK1C 4YSHA 1M1PA 2YG3A 3ALLA 4P9SA 2C73A 3EPTA 3F8PA 5KNLA 3AYIA 2YG5A 4H2QA 3L1TA 1VDCA 2WOIA 1H83A 1QLBA 3NTDA 3REDA 3P1WA 1JEHA 1ZMCA 4G74A 1JNRA 3S7WA 2B7RA 4L3YA 3AE8A 3T31A 5KMRA 1GOSA 4PABA 1Q9IA 2GR0A 2QA2A 2X8GA 3JSKA 5KMSA 1GESA 1X31B 1CJCA 1LTXR 2C67A 1NHSA 5U1OA 1GV4A 2XLTA 1LV0A 2ZZ0A 1VG9A 3FO3A 2AR8A 2BABA 3R9UA 4Q4UA 3AEDA 5JCIA 1BVBA 1FT5A 4CCRA 4EMJA 2XLSA 2YLZA 2WP5A 4U8LA 2BRAA 3SFEA 2VOUA 1CBOA 2RF7A 3UOXA 5C3JA 1ZOVA 4A5LA 5LV9A 5BRTA 3KA7A 3AE2A 4GR1A 1YY5A 1NENA 3AD7B 1GNDA 1ZDLA 1H86A 3TORA 3KVEA 3LB8A 2XVIA 2BS3A 1BWCA 2C7GA 3CMMA 2YVFA 4U2TA 5JCNA 1L9CA 4CNKA 2AQJA 5EBKA 1RSGA 2Z5YA 3LZWA 1SEZA 3T2ZA 4G6HA 2ZO5A 1E1MA 2OALA 4BURA 4K5RA 5U25A 5HHFA 5ER0A 3QVRA 1L0VA 2BC0A 3AE4A 3O0HA 1VG0A 2X8CA 3V3OA 1QJDA 1IUXA 1VRQB 1NAAA 2BCGG 2FJAA 4J57A 4B64A 2RABA 3GMCA 3QFBA 4H4TA 4C3YA 5KWFA 4ECHA 3GDNA 4LA1A 1M64A 2BXRA 2OT4A 1PN0A 2WDVA 3AEEA 1JRYA 4HA6A 1TDOA 1PBBA 4YSYA 1D7YA 4EMIA 2LFCA 3P4RA 1GERA 1GRTA 1GEUA 2YG6A 2C75A 1BZLA 1H81A 2CULA 2O9ZA 2XCGA 3AEGA 4U8IA 4U8MA 4U8PA 2C72A 3UKFA 3GD4A 1D7LA 2E1MA 4H4WA 4H2PA 1H82A 2B9WA 3EF6A 4U2SA 3SQPA 3AYLA 4K5SA 4OPGA 4UDRA 3DGZA 3KPFA 4GUVA 1KSUA 1K0JA 4HB9A 1CJ2A 4JN9A 1N1PA 5J60A 4XXGA 2FBWA 3K30A 4Y4NA 2QA1A 2WDQA 3CGCA 4B69A 3GSIA 2JK6A 1JOAA 5C2TA 3FBSA 1JRZA 3SY4A 3F8RA 3AEFA 3AWIA 4B67A 4XWZA 1K0LA 3AE9A 4X9NA 2CDUA 2WS3A 1LQUA 2Y6RA 2JB2A 4CCQA 1Y56A 4YSXA 4X4JA 3SXIA 4L3XA 2ZZCA 2OAMA 1D4DA 1FS9A 1DNCA 4Z43A 1CJ4A 1DOBA 1RYIA 2YLWA 1CL0A 3AE1A 3NRNA 4YKFA 5M10A 2PHHA 4Q5CA 1S3EA 1PS9A 4EQWA 2WP6A 1IUVA 1D4CA 1YKJA 1OJAA 2WETA 1IUUA 1NG3A 3DJEA 3NGCX 4GDPA 1GRGA 4NTEA 1KF6A 3G5SA 3BNFA 5L46A 3RP6A 1GSNA 2EQ6A 2WPFA 1ZK7A 1E1KA 4Q0TA 1Y0PA 2HQMA 2YQUA 1E7PA 2C66A 5IQ1A 2VVMA 3BNJA 3UKQA 4EIQA 5IQ4A 2GMHA 1XDIA 3F29A 2C76A 1PDHA 4I59A 2IVDA 2GF3A 2V60A 2C64A 4OPLA 3B6DA 2BYBA 3UCLA 3SCEA 1DXLA 4Z24A 1IUWA 1GT8A 4H4XA 4U8OA 3SGLA 3C96A 3GMBA 4DSGA 3T2KA 3AD9B 2XFPA 3VRBA 4AOXA 4ZCCA 3VRAA 5KVIA 4EMWA 3TTBA 1FECA 1Q1WA 2R0PA 2YM2A 3KPKA 4H4YA 4IVMB 2GV8A 1FEAA 2YAUA 2V61A 4Q17A 1DJNA 2WDRA 3VQRA 4C5OA 2TMDA 1DOEA 4JY3A 4OVIA 4Z25A 4OPDA 2H89A 2RDZA 2PYXA 3DJGX 1FEBA 4JNQA 1D5TA 1F6MA 4Z2RA 3CGEA 3PS9A 3RNMA 2EQ9A 3K7QX 3UP5A 1MOKA 3GYIA 4BJYA 1M6IA 5IPYA 2NPXA 1PXAA 4JNAA 4G6GA 3PO7A
chains in the Genus database with same CATH topology
4K2XA 4Q1OA 1B5QA 2GAHB 3NK1X 1ZP0A 1GRHA 2R4JA 5U63A 2F5ZA 1K4QA 2B9YA 2TPRA 4A6NA 2WU2A 4A6NB 1TRBA 3I6DA 3SZWA 1M1QA 4OPUA 3IWAA 1OJCA 1ZX9A 3NT6A 2RGOA 4L3ZA 2A89A 3DH9A 3DJJA 4U8NA 3CNPA 5FMHA 2NVKX 3CNDA 4CRTA 3RP7A 2V6OA 3UKLA 3UOZA 4Z44A 2C3CA 5FS8A 1KSSA 2R46A 4Y4LA 2YR5A 3SX6A 4AP3A 1GTEA 4ZCDA 2RGJA 5HY5A 2B7SA 3QVPA 3CNJA 4REKA 4RSLA 4YSZA 3NKSA 2VQ7A 3AE7A 1N4VA 5FS9A 1GTHA 3NK2X 5FS6A 3DK8A 3FPZA 1B8SA 1LQTA 2BS2A 4GRTA 3BI5A 3AEBA 3SFDA 3UOYA 1S2QA 4NWZA 3AECA 1XPQA 3OZ2A 4WX1A 1V59A 3M13A 2YVGA 2FJBA 3K7MX 4EM3A 3T2YA 1PBFA 4H4SA 3QJ4A 5JCMA 1IJHA 1EL9A 2JBVA 3UOVA 3UBRA 1S3BA 4K22A 4MJWA 2Y6QA 1L9DA 2JB3A 2XVJA 1IUTA 4YTNA 2Q0LA 2YLRA 3SM8A 3AE3A 3GWDA 3QFAA 2VR0A 4Y4MA 3NH3X 2K3VA 3IHMA 1FS8A 4GF7A 2WQYA 1ELIA 3CPHG 2GR3A 4OCGA 4Z2UA 3GRTA 1YQZA 3AXBA 4OPIA 5GSNA 2W0HA 3UKAA 2DKIA 2R0GA 3URHA 4H4VA 3LGQA 1ZY8A 2YR6A 4H4RA 1PJ6A 4TLZA 2XFUA 1B37A 2E81A 1PBDA 2H88A 2WHDA 4TM0A 1OAHA 2BA9A 1PJ5A 2JKCA 3DK9A 3BI2A 3HYWA 1LVLA 3NN0X 3QSEA 3DGHA 2WOVA 4IA5A 4JY2A 4H4UA 3VR8A 3Q9TA 3S61A 4D03A 1PHHA 4IVOB 1RP0A 2GVCA 4H7UA 4EIPA 2GEWA 1Y56B 4J56A 2GH5A 3CPJG 2BK3A 1TDKA 1IUSA 3GD3A 3H8IA 3G5QA 1GPEA 4Q5BA 2YG4A 4A7AA 4JQ9A 4TM1A 3ALJA 3NLCA 4LIIA 4M52A 4NTDA 4C74A 5HXIA 3C4NA 4XWRA 3SZFA 2XLPA 1O5WA 2R4EA 3LJPA 1CC2A 2R45A 4J33A 4K8DA 3CNSA 3AE5A 1JNIA 1HYUA 3GYJA 2EQ8A 2JAEA 5KVHA 3F8DA 2WOWA 5CQFA 5KMQA 2I0ZA 2WESA 1YQ4A 1QDBA 3BHFA 3GRSA 4DNAA 3NNEA 1O95A 3C4AA 4AT2A 1PXCA 1F3PA 1Q1RA 1FL2A 3D1IA 2EQ7A 3CGBA 3KLJA 3RP8A 2ZBWA 3QSMA 2OA1A 4L38A 1JU2A 3KD9A 3WE0A 1BKWA 1TYTA 4Z26A 2BK5A 4H4PA 3ICTA 4B66A 3SZ0A 3ATRA 2ACZA 3PVCA 1EL8A 2GAGB 3ZYXA 1ZMDA 2WPCA 3CIRA 3LZXA 3T0KA 2R0CA 5EB4A 3DMEA 5FS7A 3CGDA 1KNPA 2XLRA 1GRBA 2UZZA 3H4KA 3IC9A 4C77A 4DSHA 3VRDB 4EM4A 2BS4A 3KKJA 2VVLG 3E1TA 3AEAA 3T14A 4UDQA 2YLXA 1LJ1A 2XFNA 2XFOA 2QCUA 5TR3A 3UKHA 1FT6A 1N4WA 4APNA 3ISHA 4ADWA 4D04A 4B1BA 1GRAA 1OJTA 2X3NA 2WPEA 3FIMB 1TDEA 4B68A 5BULA 4BK3A 1CHUA 1MXTA 4LU6A 4EQRA 2X8HA 4YTMA 2YWLA 3VR9A 4A65A 4YT0A 5KOWA 1P2HA 2BCPA 1O94A 2XYOA 3S5WA 3UTEA 3OWMA 2JB1A 2V3AA 3D1CA 2R9ZA 1GREA 4NNJA 2YVJA 1DOCA 2X99A 1XHCA 3AE6A 1NDAA 3OC4A 3NTAA 2Z5XA 1NHQA 4YKGA 4H50A 4J31A 1SP3A 1S2YA 1EL7A 4A99A 3NYFA 2YR4A 4II3A 1ZKQA 3LOVA 4O5UA 3RKHA 4IV9A 5KXJA 3UTFA 1M1RA 4Z2TA 3ICSA 3MMOA 2GRTA 5DBJA 2ZZBA 1GU6A 3SZCA 1OJ9A 1GRFA 1FS7A 2YM1A 3P4PA 3T37A 4CY8A 2X50A 3UU9A 2VRMA 4AOSA 1OJDA 1H6VA 1PXBA 4FK1A 3EANA 3V3NA 2A8XA 2E5VA 3CTYA 4USQA 4CBQA 2OLNA 2VQBA 3NN6X 4PAAA 3UP4A 1TDFA 2OLOA 4H4QA 2CFYA 1NPXA 2WEUA 3HYVA 1CC4A 2FJEA 4EQSA 4TLXA 2GR2A 1PJ7A 4GAVA 4J34A 2RGHA 5J7XA 4H2NA 3NYEA 3ITJA 2Q7VA 2GQWA 3ALMA 4YTPA 1ONFA 1N4UA 2QAEA 3BNUA 4ZN0A 5M0ZA 3NK0X 1DODA 3UKKA 4A9WA 2YLTA 3AD8B 1AOGA 2B76A 3DJDA 1NHPA 4KPRA 3HZLA 1NEKA 3NIXA 2CVJA 2XLUA 1TDNA 4GCMA 3RHAA 4EQXA 3NHOX 4C3XA 1EL5A 4TM3A 1KNRA 3BNHA 1MO9A 4U8KA 2XVHA 1L9EA 1K0IA 2GR1A 4YXDA 4I58A 3Q6JA 1YQ3A 4RG3A 2AAQA 2XVFA 2BRYA 2BACA 1E6EA 3LXDA 3GWFA 2YLSA 2ARDA 1GETA 4G9KA 1H7XA 5EOWA 3K7TA 3ABVA 2BK4A 4CNJA 4U2LA 2WBAA 3ADAB 4JDRA 4NTCA 1TYPA 1E39A 3FMWA 3LADA 3BNMA 4A79A 1E1LA 3GM6A 3II4A 2GMJA 2Q6UA 1BF3A 3COXA 4WJYA 3BHKA 1E1NA 1CC6A 2VRLA 1W4XA 3CNTA 4B63A 2E4GA 2GQFA 3SXQA 1Z6LA 4FX9A 4IA6A 2APGA 4J36A 2XDOA 3DK4A 3H8LA 3GYXA 2A87A 4X9MA 4AT0A 4DGKA 2DKHA 4GDEA 4OPCA 3BI4A 3BNGA 4KX6A 2FJDA 4CY6A 1H84A 2WU5A 2V3BA 2J3NA 3ATQA 5JCLA 1GALA 2IIDA 4O5QA 3LG1A 1NHRA 3AYJA 1EBDA 3ICRA 2YG7A 1CF3A 5KMPA 4II2A 5BVAA 4U8JA 4UDPA 1PBCA 4OPTA 3M12A 4USRA 3UTHA 3DA1A 5KOXA 1GXFA 3P9UA 3V76A 1ZOYA 1KDGA 3AB1A 5EB5A 3CN8A 5JCKA 3P4SA 1F8SA 3M0OA 4NZHA 2GB0A 1B4VA 3L8KA 3G5RA 4FDCB 3SYIA 3I3LA 4N9XA 4J2WA 2E80A 1BGNA 1F8WA 1H7WA 3HYXA 1XANA 2V5ZA 3UTGA 2C3DA 3EAOA 4NEWA 3GDPA 1FOHA 3QSSA 4RG4A 4E0VA 4G73A 4K7ZA 1QO8A 1D4EA 1REOA 4BJZA 2BXSA 4BK1A 4H2RA 3D8XA 3B3RA 1UKVG 1CJ3A 1NG4A 4UP3A 5BUKA 1BGJA 4WCTA 3ZDNA 2VVLA 3KU9A 2C4CA 4NEVA 3IF9A 4AP1A 4B65A 2XFQA 1COYA 2Q0KA 4YWOA 5GRTA 4BK2A 1FCDA 1F8RA 1JNZA 3P4QA 1KFYA 1LPFA 1JRXA 2BC1A 2IVEA 3NG7X 1VQWA 3IHGA 3UKPA 2J7AA 5CKUA 1P2EA 2C70A 5KRQA 3L1RA 3CPIG 1DJQA 4TM4A 4H4ZA 2VZ2A 2C65A 4BV6A 1PBEA 5HYMA 3FG2P 4GAPA 4ICYA 2WP9A 2XVEA 2B9XA 3NYCA 4FK1C 4YSHA 1M1PA 2YG3A 3ALLA 4P9SA 2C73A 3EPTA 3F8PA 5KNLA 3AYIA 2YG5A 4H2QA 3L1TA 1VDCA 2WOIA 1H83A 1QLBA 3NTDA 3REDA 3P1WA 1JEHA 1ZMCA 4G74A 1JNRA 3S7WA 2B7RA 4L3YA 3AE8A 3T31A 5KMRA 1GOSA 4PABA 1Q9IA 2GR0A 2QA2A 2X8GA 3JSKA 5KMSA 1GESA 1X31B 1CJCA 1LTXR 2C67A 1NHSA 5U1OA 1GV4A 2XLTA 1LV0A 2ZZ0A 1VG9A 3FO3A 2AR8A 2BABA 3R9UA 4Q4UA 3AEDA 5JCIA 1BVBA 1FT5A 4CCRA 4EMJA 2XLSA 2YLZA 2WP5A 4U8LA 2BRAA 3SFEA 2VOUA 1CBOA 2RF7A 3UOXA 5C3JA 1ZOVA 4A5LA 5LV9A 5BRTA 3KA7A 3AE2A 4GR1A 1YY5A 1NENA 3AD7B 1GNDA 1ZDLA 1H86A 3TORA 3KVEA 3LB8A 2XVIA 2BS3A 1BWCA 2C7GA 3CMMA 2YVFA 4U2TA 5JCNA 1L9CA 4CNKA 2AQJA 5EBKA 1RSGA 2Z5YA 3LZWA 1SEZA 3T2ZA 4G6HA 2ZO5A 1E1MA 2OALA 4BURA 4K5RA 5U25A 5HHFA 5ER0A 3QVRA 1L0VA 2BC0A 3AE4A 3O0HA 1VG0A 2X8CA 3V3OA 1QJDA 1IUXA 1VRQB 1NAAA 2BCGG 2FJAA 4J57A 4B64A 2RABA 3GMCA 3QFBA 4H4TA 4C3YA 5KWFA 4ECHA 3GDNA 4LA1A 1M64A 2BXRA 2OT4A 1PN0A 2WDVA 3AEEA 1JRYA 4HA6A 1TDOA 1PBBA 4YSYA 1D7YA 4EMIA 2LFCA 3P4RA 1GERA 1GRTA 1GEUA 2YG6A 2C75A 1BZLA 1H81A 2CULA 2O9ZA 2XCGA 3AEGA 4U8IA 4U8MA 4U8PA 2C72A 3UKFA 3GD4A 1D7LA 2E1MA 4H4WA 4H2PA 1H82A 2B9WA 3EF6A 4U2SA 3SQPA 3AYLA 4K5SA 4OPGA 4UDRA 3DGZA 3KPFA 4GUVA 1KSUA 1K0JA 4HB9A 1CJ2A 4JN9A 1N1PA 5J60A 4XXGA 2FBWA 3K30A 4Y4NA 2QA1A 2WDQA 3CGCA 4B69A 3GSIA 2JK6A 1JOAA 5C2TA 3FBSA 1JRZA 3SY4A 3F8RA 3AEFA 3AWIA 4B67A 4XWZA 1K0LA 3AE9A 4X9NA 2CDUA 2WS3A 1LQUA 2Y6RA 2JB2A 4CCQA 1Y56A 4YSXA 4X4JA 3SXIA 4L3XA 2ZZCA 2OAMA 1D4DA 1FS9A 1DNCA 4Z43A 1CJ4A 1DOBA 1RYIA 2YLWA 1CL0A 3AE1A 3NRNA 4YKFA 5M10A 2PHHA 4Q5CA 1S3EA 1PS9A 4EQWA 2WP6A 1IUVA 1D4CA 1YKJA 1OJAA 2WETA 1IUUA 1NG3A 3DJEA 3NGCX 4GDPA 1GRGA 4NTEA 1KF6A 3G5SA 3BNFA 5L46A 3RP6A 1GSNA 2EQ6A 2WPFA 1ZK7A 1E1KA 4Q0TA 1Y0PA 2HQMA 2YQUA 1E7PA 2C66A 5IQ1A 2VVMA 3BNJA 3UKQA 4EIQA 5IQ4A 2GMHA 1XDIA 3F29A 2C76A 1PDHA 4I59A 2IVDA 2GF3A 2V60A 2C64A 4OPLA 3B6DA 2BYBA 3UCLA 3SCEA 1DXLA 4Z24A 1IUWA 1GT8A 4H4XA 4U8OA 3SGLA 3C96A 3GMBA 4DSGA 3T2KA 3AD9B 2XFPA 3VRBA 4AOXA 4ZCCA 3VRAA 5KVIA 4EMWA 3TTBA 1FECA 1Q1WA 2R0PA 2YM2A 3KPKA 4H4YA 4IVMB 2GV8A 1FEAA 2YAUA 2V61A 4Q17A 1DJNA 2WDRA 3VQRA 4C5OA 2TMDA 1DOEA 4JY3A 4OVIA 4Z25A 4OPDA 2H89A 2RDZA 2PYXA 3DJGX 1FEBA 4JNQA 1D5TA 1F6MA 4Z2RA 3CGEA 3PS9A 3RNMA 2EQ9A 3K7QX 3UP5A 1MOKA 3GYIA 4BJYA 1M6IA 5IPYA 2NPXA 1PXAA 4JNAA 4G6GA 3PO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2X A;  4Q1O A;  1B5Q A;  2GAH B;  3NK1 X;  1ZP0 A;  1GRH A;  2R4J A;  5U63 A;  2F5Z A;  1K4Q A;  2B9Y A;  2TPR A;  4A6N A;  2WU2 A;  4A6N B;  1TRB A;  3I6D A;  1M1Q A;  4OPU A;  3IWA A;  1OJC A;  1ZX9 A;  3NT6 A;  2RGO A;  4L3Z A;  2A89 A;  3DH9 A;  3DJJ A;  4U8N A;  3CNP A;  5FMH A;  2NVK X;  3CND A;  4CRT A;  3RP7 A;  2V6O A;  3UKL A;  3UOZ A;  4Z44 A;  2C3C A;  5FS8 A;  1KSS A;  2R46 A;  4Y4L A;  2YR5 A;  4AP3 A;  1GTE A;  4ZCD A;  2RGJ A;  5HY5 A;  2B7S A;  3QVP A;  3CNJ A;  4REK A;  4RSL A;  4YSZ A;  3NKS A;  2VQ7 A;  3AE7 A;  1N4V A;  5FS9 A;  1GTH A;  3NK2 X;  5FS6 A;  3DK8 A;  3FPZ A;  1B8S A;  1LQT A;  2BS2 A;  4GRT A;  3BI5 A;  3AEB A;  3SFD A;  3UOY A;  1S2Q A;  3AEC A;  1XPQ A;  3OZ2 A;  4WX1 A;  1V59 A;  3M13 A;  2YVG A;  2FJB A;  3K7M X;  4EM3 A;  1PBF A;  4H4S A;  3QJ4 A;  5JCM A;  1IJH A;  1EL9 A;  2JBV A;  3UOV A;  3UBR A;  1S3B A;  4K22 A;  4MJW A;  2Y6Q A;  1L9D A;  2JB3 A;  2XVJ A;  1IUT A;  4YTN A;  2Q0L A;  2YLR A;  3SM8 A;  3AE3 A;  3GWD A;  3QFA A;  2VR0 A;  4Y4M A;  3NH3 X;  2K3V A;  3IHM A;  1FS8 A;  4GF7 A;  2WQY A;  1ELI A;  3CPH G;  2GR3 A;  4OCG A;  4Z2U A;  3GRT A;  1YQZ A;  3AXB A;  4OPI A;  5GSN A;  2W0H A;  3UKA A;  2DKI A;  2R0G A;  3URH A;  4H4V A;  3LGQ A;  1ZY8 A;  2YR6 A;  4H4R A;  1PJ6 A;  4TLZ A;  2XFU A;  1B37 A;  2E81 A;  1PBD A;  2H88 A;  2WHD A;  4TM0 A;  1OAH A;  2BA9 A;  1PJ5 A;  2JKC A;  3DK9 A;  3BI2 A;  4H4X A;  1LVL A;  3NN0 X;  3QSE A;  3DGH A;  2WOV A;  4IA5 A;  4JY2 A;  4H4U A;  3VR8 A;  3Q9T A;  3S61 A;  4D03 A;  1PHH A;  4IVO B;  1RP0 A;  2GVC A;  4H7U A;  4EIP A;  2GEW A;  1Y56 B;  4J56 A;  2GH5 A;  3CPJ G;  2BK3 A;  1TDK A;  1IUS A;  3GD3 A;  3H8I A;  3G5Q A;  1GPE A;  4Q5B A;  2YG4 A;  4A7A A;  4JQ9 A;  4TM1 A;  3ALJ A;  3NLC A;  4LII A;  4M52 A;  4NTD A;  4C74 A;  5HXI A;  3C4N A;  4XWR A;  2XLP A;  1O5W A;  2R4E A;  3LJP A;  1CC2 A;  2R45 A;  4J33 A;  4K8D A;  3CNS A;  3AE5 A;  1JNI A;  1HYU A;  3GYJ A;  2EQ8 A;  2JAE A;  5KVH A;  3F8D A;  2WOW A;  5CQF A;  2I0Z A;  2WES A;  1YQ4 A;  1QDB A;  3BHF A;  3GRS A;  4DNA A;  3NNE A;  1O95 A;  3C4A A;  4AT2 A;  1PXC A;  1F3P A;  1Q1R A;  1FL2 A;  3D1I A;  2EQ7 A;  3CGB A;  3KLJ A;  3RP8 A;  2ZBW A;  3QSM A;  2OA1 A;  4L38 A;  1JU2 A;  3KD9 A;  3WE0 A;  1BKW A;  1TYT A;  4Z26 A;  2BK5 A;  4H4P A;  3ICT A;  4B66 A;  3ATR A;  2ACZ A;  3PVC A;  1EL8 A;  2GAG B;  3ZYX A;  1ZMD A;  2WPC A;  3CIR A;  3LZX A;  2R0C A;  5EB4 A;  3DME A;  5FS7 A;  3CGD A;  1KNP A;  2XLR A;  1GRB A;  2UZZ A;  3H4K A;  3IC9 A;  4C77 A;  4DSH A;  3VRD B;  4EM4 A;  2BS4 A;  3KKJ A;  2VVL G;  3E1T A;  3AEA A;  4UDQ A;  2YLX A;  1LJ1 A;  2XFN A;  2XFO A;  2QCU A;  5TR3 A;  3UKH A;  1FT6 A;  1N4W A;  4APN A;  3ISH A;  4ADW A;  4D04 A;  4B1B A;  1GRA A;  1OJT A;  2X3N A;  2WPE A;  3FIM B;  1TDE A;  4B68 A;  5BUL A;  4BK3 A;  1CHU A;  1MXT A;  4LU6 A;  4EQR A;  2X8H A;  4YTM A;  2YWL A;  3VR9 A;  4A65 A;  4YT0 A;  5KOW A;  1P2H A;  2BCP A;  1O94 A;  2XYO A;  3S5W A;  3UTE A;  3OWM A;  2JB1 A;  2V3A A;  3D1C A;  2R9Z A;  1GRE A;  2YVJ A;  1DOC A;  2X99 A;  1XHC A;  3AE6 A;  1NDA A;  3OC4 A;  3NTA A;  2Z5X A;  1NHQ A;  4YKG A;  4H50 A;  4J31 A;  1SP3 A;  1S2Y A;  1EL7 A;  4A99 A;  3NYF A;  2YR4 A;  1ZKQ A;  3LOV A;  4O5U A;  3RKH A;  4IV9 A;  5KXJ A;  3UTF A;  1M1R A;  4Z2T A;  3ICS A;  3MMO A;  2GRT A;  5DBJ A;  2ZZB A;  1GU6 A;  1OJ9 A;  1GRF A;  1FS7 A;  2YM1 A;  3P4P A;  3T37 A;  4CY8 A;  2X50 A;  3UU9 A;  2VRM A;  4AOS A;  1OJD A;  1H6V A;  1PXB A;  4FK1 A;  3EAN A;  3V3N A;  2A8X A;  2E5V A;  3CTY A;  4USQ A;  4CBQ A;  2OLN A;  2VQB A;  3NN6 X;  4PAA A;  3UP4 A;  1TDF A;  2OLO A;  4H4Q A;  2CFY A;  1NPX A;  2WEU A;  1CC4 A;  2FJE A;  4EQS A;  4TLX A;  2GR2 A;  1PJ7 A;  4J34 A;  2RGH A;  5J7X A;  4H2N A;  3NYE A;  3ITJ A;  2Q7V A;  2GQW A;  3ALM A;  4YTP A;  1ONF A;  1N4U A;  2QAE A;  3BNU A;  4ZN0 A;  5M0Z A;  3NK0 X;  1DOD A;  3UKK A;  4A9W A;  2YLT A;  3AD8 B;  1AOG A;  2B76 A;  3DJD A;  1NHP A;  4KPR A;  3HZL A;  1NEK A;  3NIX A;  2CVJ A;  2XLU A;  1TDN A;  4GCM A;  3RHA A;  4EQX A;  3NHO X;  4C3X A;  1EL5 A;  4TM3 A;  1KNR A;  3BNH A;  1MO9 A;  4U8K A;  2XVH A;  1L9E A;  1K0I A;  2GR1 A;  4YXD A;  4I58 A;  3Q6J A;  1YQ3 A;  4RG3 A;  2AAQ A;  2XVF A;  2BAC A;  1E6E A;  3LXD A;  3GWF A;  2YLS A;  2ARD A;  1GET A;  1H7X A;  5EOW A;  3K7T A;  3ABV A;  2BK4 A;  4CNJ A;  4U2L A;  2WBA A;  3ADA B;  4JDR A;  4NTC A;  1TYP A;  1E39 A;  3FMW A;  3LAD A;  3BNM A;  4A79 A;  1E1L A;  3GM6 A;  3II4 A;  2GMJ A;  2Q6U A;  1BF3 A;  3COX A;  4WJY A;  3BHK A;  1E1N A;  1CC6 A;  2VRL A;  1W4X A;  3CNT A;  4B63 A;  2E4G A;  2GQF A;  3SXQ A;  1Z6L A;  4FX9 A;  4IA6 A;  2APG A;  4J36 A;  2XDO A;  3DK4 A;  3H8L A;  3GYX A;  2A87 A;  4X9M A;  4AT0 A;  4DGK A;  2DKH A;  4GDE A;  4OPC A;  3BI4 A;  3BNG A;  4KX6 A;  2FJD A;  4CY6 A;  1H84 A;  2WU5 A;  2V3B A;  2J3N A;  3ATQ A;  5JCL A;  1GAL A;  2IID A;  4O5Q A;  3LG1 A;  1NHR A;  3AYJ A;  1EBD A;  3ICR A;  2YG7 A;  1CF3 A;  5BVA A;  4U8J A;  4UDP A;  1PBC A;  4OPT A;  3M12 A;  4USR A;  3UTH A;  3DA1 A;  5KOX A;  1GXF A;  3P9U A;  3V76 A;  1ZOY A;  1KDG A;  3AB1 A;  5EB5 A;  3CN8 A;  5JCK A;  3P4S A;  1F8S A;  3M0O A;  4NZH A;  2GB0 A;  1B4V A;  3L8K A;  3G5R A;  4FDC B;  3I3L A;  4N9X A;  4J2W A;  2E80 A;  1BGN A;  1F8W A;  1H7W A;  3UTG A;  1XAN A;  2V5Z A;  4E0V A;  2C3D A;  3EAO A;  4NEW A;  3GDP A;  1FOH A;  3QSS A;  4RG4 A;  4K7Z A;  1QO8 A;  1D4E A;  1REO A;  4BJZ A;  2BXS A;  4BK1 A;  4H2R A;  3D8X A;  3B3R A;  1UKV G;  1CJ3 A;  1NG4 A;  4UP3 A;  5BUK A;  1BGJ A;  4WCT A;  3ZDN A;  2VVL A;  3KU9 A;  4NEV A;  3IF9 A;  4AP1 A;  4B65 A;  2XFQ A;  1COY A;  2Q0K A;  4YWO A;  5GRT A;  4BK2 A;  1FCD A;  1F8R A;  1JNZ A;  3P4Q A;  1KFY A;  1LPF A;  1JRX A;  2BC1 A;  2IVE A;  3NG7 X;  1VQW A;  3IHG A;  3UKP A;  2J7A A;  5CKU A;  1P2E A;  2C70 A;  5KRQ A;  3L1R A;  3CPI G;  1DJQ A;  4TM4 A;  4H4Z A;  2VZ2 A;  2C65 A;  4BV6 A;  1PBE A;  5HYM A;  3FG2 P;  4ICY A;  2WP9 A;  2XVE A;  2B9X A;  3NYC A;  4FK1 C;  4YSH A;  1M1P A;  2YG3 A;  3ALL A;  4P9S A;  2C73 A;  3EPT A;  3F8P A;  3AYI A;  2YG5 A;  4H2Q A;  3L1T A;  1VDC A;  2WOI A;  1H83 A;  1QLB A;  3NTD A;  3RED A;  3P1W A;  1JEH A;  1ZMC A;  1JNR A;  3S7W A;  2B7R A;  4L3Y A;  3AE8 A;  1GOS A;  4PAB A;  1Q9I A;  2GR0 A;  2QA2 A;  2X8G A;  3JSK A;  1GES A;  1X31 B;  1CJC A;  1LTX R;  2C67 A;  1NHS A;  5U1O A;  1GV4 A;  2XLT A;  1LV0 A;  2ZZ0 A;  1VG9 A;  3FO3 A;  2AR8 A;  2BAB A;  3R9U A;  4Q4U A;  3AED A;  5JCI A;  1BVB A;  1FT5 A;  4CCR A;  4EMJ A;  2XLS A;  2YLZ A;  2WP5 A;  4U8L A;  3SFE A;  2VOU A;  1CBO A;  2RF7 A;  3UOX A;  5C3J A;  1ZOV A;  4A5L A;  5LV9 A;  5BRT A;  3KA7 A;  3AE2 A;  4GR1 A;  1YY5 A;  1NEN A;  3AD7 B;  1GND A;  1ZDL A;  1H86 A;  3TOR A;  3KVE A;  3LB8 A;  2XVI A;  2BS3 A;  1BWC A;  2C7G A;  2YVF A;  4U2T A;  5JCN A;  1L9C A;  4CNK A;  2AQJ A;  5EBK A;  1RSG A;  2Z5Y A;  3LZW A;  1SEZ A;  2ZO5 A;  1E1M A;  2OAL A;  4BUR A;  4K5R A;  5U25 A;  5HHF A;  5ER0 A;  3QVR A;  1L0V A;  2BC0 A;  3AE4 A;  3O0H A;  1VG0 A;  2X8C A;  3V3O A;  1QJD A;  1IUX A;  1VRQ B;  1NAA A;  2BCG G;  2FJA A;  4J57 A;  4B64 A;  2RAB A;  3GMC A;  3QFB A;  4H4T A;  4C3Y A;  5KWF A;  4ECH A;  3GDN A;  4LA1 A;  1M64 A;  2BXR A;  2OT4 A;  1PN0 A;  2WDV A;  3AEE A;  1JRY A;  4HA6 A;  1TDO A;  1PBB A;  4YSY A;  1D7Y A;  4EMI A;  2LFC A;  3P4R A;  1GER A;  1GRT A;  1GEU A;  2YG6 A;  2C75 A;  1BZL A;  1H81 A;  2CUL A;  2O9Z A;  2XCG A;  3AEG A;  4U8I A;  4U8M A;  4U8P A;  2C72 A;  3UKF A;  3GD4 A;  1D7L A;  2E1M A;  4H4W A;  4H2P A;  1H82 A;  2B9W A;  3EF6 A;  4U2S A;  3SQP A;  3AYL A;  4K5S A;  4OPG A;  4UDR A;  3DGZ A;  3KPF A;  4GUV A;  1KSU A;  1K0J A;  4HB9 A;  1CJ2 A;  4JN9 A;  1N1P A;  5J60 A;  4XXG A;  2FBW A;  3K30 A;  4Y4N A;  2QA1 A;  2WDQ A;  3CGC A;  4B69 A;  3GSI A;  2JK6 A;  1JOA A;  5C2T A;  3FBS A;  1JRZ A;  3F8R A;  3AEF A;  3AWI A;  4B67 A;  4XWZ A;  1K0L A;  3AE9 A;  4X9N A;  2CDU A;  2WS3 A;  1LQU A;  2Y6R A;  2JB2 A;  4CCQ A;  1Y56 A;  4YSX A;  4X4J A;  4L3X A;  2ZZC A;  2OAM A;  1D4D A;  1FS9 A;  1DNC A;  4Z43 A;  1CJ4 A;  1DOB A;  1RYI A;  2YLW A;  1CL0 A;  3AE1 A;  3NRN A;  4YKF A;  5M10 A;  2PHH A;  4Q5C A;  1S3E A;  1PS9 A;  4EQW A;  2WP6 A;  1IUV A;  1D4C A;  1YKJ A;  1OJA A;  2WET A;  1IUU A;  1NG3 A;  3DJE A;  3NGC X;  4GDP A;  1GRG A;  4NTE A;  1KF6 A;  3G5S A;  3BNF A;  5L46 A;  3RP6 A;  1GSN A;  2EQ6 A;  2WPF A;  1ZK7 A;  1E1K A;  4Q0T A;  1Y0P A;  2HQM A;  2YQU A;  1E7P A;  2C66 A;  5IQ1 A;  2VVM A;  3BNJ A;  3UKQ A;  4EIQ A;  5IQ4 A;  2GMH A;  1XDI A;  3F29 A;  2C76 A;  1PDH A;  4I59 A;  2IVD A;  2GF3 A;  2V60 A;  2C64 A;  4OPL A;  3B6D A;  2BYB A;  3UCL A;  3SCE A;  1DXL A;  4Z24 A;  1IUW A;  1GT8 A;  4U8O A;  3SGL A;  3C96 A;  3GMB A;  4DSG A;  4AOX A;  3AD9 B;  2XFP A;  3VRB A;  4ZCC A;  3VRA A;  5KVI A;  4EMW A;  3TTB A;  1FEC A;  1Q1W A;  2R0P A;  2YM2 A;  4H4Y A;  4IVM B;  2GV8 A;  1FEA A;  2YAU A;  2V61 A;  4Q17 A;  1DJN A;  2WDR A;  3VQR A;  4C5O A;  2TMD A;  1DOE A;  4JY3 A;  4OVI A;  4Z25 A;  4OPD A;  2H89 A;  2RDZ A;  2PYX A;  3DJG X;  1FEB A;  4JNQ A;  1D5T A;  1F6M A;  4Z2R A;  3CGE A;  3PS9 A;  3RNM A;  2EQ9 A;  3K7Q X;  3UP5 A;  1MOK A;  3GYI A;  4BJY A;  1M6I A;  5IPY A;  2NPX A;  1PXA A;  4JNA A;  3PO7 A; 
#chains in the Genus database with same CATH topology
 4K2X A;  4Q1O A;  1B5Q A;  2GAH B;  3NK1 X;  1ZP0 A;  1GRH A;  2R4J A;  5U63 A;  2F5Z A;  1K4Q A;  2B9Y A;  2TPR A;  4A6N A;  2WU2 A;  4A6N B;  1TRB A;  3I6D A;  3SZW A;  1M1Q A;  4OPU A;  3IWA A;  1OJC A;  1ZX9 A;  3NT6 A;  2RGO A;  4L3Z A;  2A89 A;  3DH9 A;  3DJJ A;  4U8N A;  3CNP A;  5FMH A;  2NVK X;  3CND A;  4CRT A;  3RP7 A;  2V6O A;  3UKL A;  3UOZ A;  4Z44 A;  2C3C A;  5FS8 A;  1KSS A;  2R46 A;  4Y4L A;  2YR5 A;  3SX6 A;  4AP3 A;  1GTE A;  4ZCD A;  2RGJ A;  5HY5 A;  2B7S A;  3QVP A;  3CNJ A;  4REK A;  4RSL A;  4YSZ A;  3NKS A;  2VQ7 A;  3AE7 A;  1N4V A;  5FS9 A;  1GTH A;  3NK2 X;  5FS6 A;  3DK8 A;  3FPZ A;  1B8S A;  1LQT A;  2BS2 A;  4GRT A;  3BI5 A;  3AEB A;  3SFD A;  3UOY A;  1S2Q A;  4NWZ A;  3AEC A;  1XPQ A;  3OZ2 A;  4WX1 A;  1V59 A;  3M13 A;  2YVG A;  2FJB A;  3K7M X;  4EM3 A;  3T2Y A;  1PBF A;  4H4S A;  3QJ4 A;  5JCM A;  1IJH A;  1EL9 A;  2JBV A;  3UOV A;  3UBR A;  1S3B A;  4K22 A;  4MJW A;  2Y6Q A;  1L9D A;  2JB3 A;  2XVJ A;  1IUT A;  4YTN A;  2Q0L A;  2YLR A;  3SM8 A;  3AE3 A;  3GWD A;  3QFA A;  2VR0 A;  4Y4M A;  3NH3 X;  2K3V A;  3IHM A;  1FS8 A;  4GF7 A;  2WQY A;  1ELI A;  3CPH G;  2GR3 A;  4OCG A;  4Z2U A;  3GRT A;  1YQZ A;  3AXB A;  4OPI A;  5GSN A;  2W0H A;  3UKA A;  2DKI A;  2R0G A;  3URH A;  4H4V A;  3LGQ A;  1ZY8 A;  2YR6 A;  4H4R A;  1PJ6 A;  4TLZ A;  2XFU A;  1B37 A;  2E81 A;  1PBD A;  2H88 A;  2WHD A;  4TM0 A;  1OAH A;  2BA9 A;  1PJ5 A;  2JKC A;  3DK9 A;  3BI2 A;  3HYW A;  1LVL A;  3NN0 X;  3QSE A;  3DGH A;  2WOV A;  4IA5 A;  4JY2 A;  4H4U A;  3VR8 A;  3Q9T A;  3S61 A;  4D03 A;  1PHH A;  4IVO B;  1RP0 A;  2GVC A;  4H7U A;  4EIP A;  2GEW A;  1Y56 B;  4J56 A;  2GH5 A;  3CPJ G;  2BK3 A;  1TDK A;  1IUS A;  3GD3 A;  3H8I A;  3G5Q A;  1GPE A;  4Q5B A;  2YG4 A;  4A7A A;  4JQ9 A;  4TM1 A;  3ALJ A;  3NLC A;  4LII A;  4M52 A;  4NTD A;  4C74 A;  5HXI A;  3C4N A;  4XWR A;  3SZF A;  2XLP A;  1O5W A;  2R4E A;  3LJP A;  1CC2 A;  2R45 A;  4J33 A;  4K8D A;  3CNS A;  3AE5 A;  1JNI A;  1HYU A;  3GYJ A;  2EQ8 A;  2JAE A;  5KVH A;  3F8D A;  2WOW A;  5CQF A;  5KMQ A;  2I0Z A;  2WES A;  1YQ4 A;  1QDB A;  3BHF A;  3GRS A;  4DNA A;  3NNE A;  1O95 A;  3C4A A;  4AT2 A;  1PXC A;  1F3P A;  1Q1R A;  1FL2 A;  3D1I A;  2EQ7 A;  3CGB A;  3KLJ A;  3RP8 A;  2ZBW A;  3QSM A;  2OA1 A;  4L38 A;  1JU2 A;  3KD9 A;  3WE0 A;  1BKW A;  1TYT A;  4Z26 A;  2BK5 A;  4H4P A;  3ICT A;  4B66 A;  3SZ0 A;  3ATR A;  2ACZ A;  3PVC A;  1EL8 A;  2GAG B;  3ZYX A;  1ZMD A;  2WPC A;  3CIR A;  3LZX A;  3T0K A;  2R0C A;  5EB4 A;  3DME A;  5FS7 A;  3CGD A;  1KNP A;  2XLR A;  1GRB A;  2UZZ A;  3H4K A;  3IC9 A;  4C77 A;  4DSH A;  3VRD B;  4EM4 A;  2BS4 A;  3KKJ A;  2VVL G;  3E1T A;  3AEA A;  3T14 A;  4UDQ A;  2YLX A;  1LJ1 A;  2XFN A;  2XFO A;  2QCU A;  5TR3 A;  3UKH A;  1FT6 A;  1N4W A;  4APN A;  3ISH A;  4ADW A;  4D04 A;  4B1B A;  1GRA A;  1OJT A;  2X3N A;  2WPE A;  3FIM B;  1TDE A;  4B68 A;  5BUL A;  4BK3 A;  1CHU A;  1MXT A;  4LU6 A;  4EQR A;  2X8H A;  4YTM A;  2YWL A;  3VR9 A;  4A65 A;  4YT0 A;  5KOW A;  1P2H A;  2BCP A;  1O94 A;  2XYO A;  3S5W A;  3UTE A;  3OWM A;  2JB1 A;  2V3A A;  3D1C A;  2R9Z A;  1GRE A;  4NNJ A;  2YVJ A;  1DOC A;  2X99 A;  1XHC A;  3AE6 A;  1NDA A;  3OC4 A;  3NTA A;  2Z5X A;  1NHQ A;  4YKG A;  4H50 A;  4J31 A;  1SP3 A;  1S2Y A;  1EL7 A;  4A99 A;  3NYF A;  2YR4 A;  4II3 A;  1ZKQ A;  3LOV A;  4O5U A;  3RKH A;  4IV9 A;  5KXJ A;  3UTF A;  1M1R A;  4Z2T A;  3ICS A;  3MMO A;  2GRT A;  5DBJ A;  2ZZB A;  1GU6 A;  3SZC A;  1OJ9 A;  1GRF A;  1FS7 A;  2YM1 A;  3P4P A;  3T37 A;  4CY8 A;  2X50 A;  3UU9 A;  2VRM A;  4AOS A;  1OJD A;  1H6V A;  1PXB A;  4FK1 A;  3EAN A;  3V3N A;  2A8X A;  2E5V A;  3CTY A;  4USQ A;  4CBQ A;  2OLN A;  2VQB A;  3NN6 X;  4PAA A;  3UP4 A;  1TDF A;  2OLO A;  4H4Q A;  2CFY A;  1NPX A;  2WEU A;  3HYV A;  1CC4 A;  2FJE A;  4EQS A;  4TLX A;  2GR2 A;  1PJ7 A;  4GAV A;  4J34 A;  2RGH A;  5J7X A;  4H2N A;  3NYE A;  3ITJ A;  2Q7V A;  2GQW A;  3ALM A;  4YTP A;  1ONF A;  1N4U A;  2QAE A;  3BNU A;  4ZN0 A;  5M0Z A;  3NK0 X;  1DOD A;  3UKK A;  4A9W A;  2YLT A;  3AD8 B;  1AOG A;  2B76 A;  3DJD A;  1NHP A;  2CZS A;  3HZL A;  1NEK A;  3NIX A;  2CVJ A;  2XLU A;  1TDN A;  4GCM A;  3RHA A;  4EQX A;  3NHO X;  4C3X A;  1EL5 A;  4TM3 A;  1KNR A;  3BNH A;  1MO9 A;  4U8K A;  2XVH A;  1L9E A;  1K0I A;  2GR1 A;  4YXD A;  4I58 A;  3Q6J A;  1YQ3 A;  4RG3 A;  2AAQ A;  2XVF A;  2BRY A;  2BAC A;  1E6E A;  3LXD A;  3GWF A;  2YLS A;  2ARD A;  1GET A;  4G9K A;  1H7X A;  5EOW A;  3K7T A;  3ABV A;  2BK4 A;  4CNJ A;  4U2L A;  2WBA A;  3ADA B;  4JDR A;  4NTC A;  1TYP A;  1E39 A;  3FMW A;  3LAD A;  3BNM A;  4A79 A;  1E1L A;  3GM6 A;  3II4 A;  2GMJ A;  2Q6U A;  1BF3 A;  3COX A;  4WJY A;  3BHK A;  1E1N A;  1CC6 A;  2VRL A;  1W4X A;  3CNT A;  4B63 A;  2E4G A;  2GQF A;  3SXQ A;  1Z6L A;  4FX9 A;  4KPR A;  4IA6 A;  2APG A;  4J36 A;  2XDO A;  3DK4 A;  3H8L A;  3GYX A;  2A87 A;  4X9M A;  4AT0 A;  4DGK A;  2DKH A;  4GDE A;  4OPC A;  3BI4 A;  3BNG A;  4KX6 A;  2FJD A;  4CY6 A;  1H84 A;  2WU5 A;  2V3B A;  2J3N A;  3ATQ A;  5JCL A;  1GAL A;  2IID A;  4O5Q A;  3LG1 A;  1NHR A;  3AYJ A;  1EBD A;  3ICR A;  2YG7 A;  1CF3 A;  5KMP A;  4II2 A;  5BVA A;  4U8J A;  4UDP A;  1PBC A;  4OPT A;  3M12 A;  4USR A;  3UTH A;  3DA1 A;  5KOX A;  1GXF A;  3P9U A;  3V76 A;  1ZOY A;  1KDG A;  3AB1 A;  5EB5 A;  3CN8 A;  5JCK A;  3P4S A;  1F8S A;  3M0O A;  4NZH A;  2GB0 A;  1B4V A;  3L8K A;  3G5R A;  4FDC B;  3SYI A;  3I3L A;  4N9X A;  4J2W A;  2E80 A;  1BGN A;  1F8W A;  1H7W A;  3HYX A;  1XAN A;  2V5Z A;  3UTG A;  2C3D A;  3EAO A;  4NEW A;  3GDP A;  1FOH A;  3QSS A;  4RG4 A;  4E0V A;  4G73 A;  4K7Z A;  1QO8 A;  1D4E A;  1REO A;  4BJZ A;  2BXS A;  4BK1 A;  4H2R A;  3D8X A;  3B3R A;  1UKV G;  1CJ3 A;  1NG4 A;  4UP3 A;  5BUK A;  1BGJ A;  4WCT A;  3ZDN A;  2VVL A;  3KU9 A;  2C4C A;  4NEV A;  3IF9 A;  4AP1 A;  4B65 A;  2XFQ A;  1COY A;  2Q0K A;  4YWO A;  5GRT A;  4BK2 A;  1FCD A;  1F8R A;  1JNZ A;  3P4Q A;  1KFY A;  1LPF A;  1JRX A;  2BC1 A;  2IVE A;  3NG7 X;  1VQW A;  3IHG A;  3UKP A;  2J7A A;  5CKU A;  1P2E A;  2C70 A;  5KRQ A;  3L1R A;  3CPI G;  1DJQ A;  4TM4 A;  4H4Z A;  2VZ2 A;  2C65 A;  4BV6 A;  1PBE A;  5HYM A;  3FG2 P;  4GAP A;  4ICY A;  2WP9 A;  2XVE A;  2B9X A;  3NYC A;  4FK1 C;  4YSH A;  1M1P A;  2YG3 A;  3ALL A;  4P9S A;  2C73 A;  3EPT A;  3F8P A;  5KNL A;  3AYI A;  2YG5 A;  4H2Q A;  3L1T A;  1VDC A;  2WOI A;  1H83 A;  1QLB A;  3NTD A;  3RED A;  3P1W A;  1JEH A;  1ZMC A;  4G74 A;  1JNR A;  3S7W A;  2B7R A;  4L3Y A;  3AE8 A;  3T31 A;  5KMR A;  1GOS A;  4PAB A;  1Q9I A;  2GR0 A;  2QA2 A;  2X8G A;  3JSK A;  5KMS A;  1GES A;  1X31 B;  1CJC A;  1LTX R;  2C67 A;  1NHS A;  5U1O A;  1GV4 A;  2XLT A;  1LV0 A;  2ZZ0 A;  1VG9 A;  3FO3 A;  2AR8 A;  2BAB A;  3R9U A;  4Q4U A;  3AED A;  5JCI A;  1BVB A;  1FT5 A;  4CCR A;  4EMJ A;  2XLS A;  2YLZ A;  2WP5 A;  4U8L A;  2BRA A;  3SFE A;  2VOU A;  1CBO A;  2RF7 A;  3UOX A;  5C3J A;  1ZOV A;  4A5L A;  5LV9 A;  5BRT A;  3KA7 A;  3AE2 A;  4GR1 A;  1YY5 A;  1NEN A;  3AD7 B;  1GND A;  1ZDL A;  1H86 A;  3TOR A;  3KVE A;  3LB8 A;  2XVI A;  2BS3 A;  1BWC A;  2C7G A;  3CMM A;  2YVF A;  4U2T A;  5JCN A;  1L9C A;  4CNK A;  2AQJ A;  5EBK A;  1RSG A;  2Z5Y A;  3LZW A;  1SEZ A;  3T2Z A;  4G6H A;  2ZO5 A;  1E1M A;  2OAL A;  4BUR A;  4K5R A;  5U25 A;  5HHF A;  5ER0 A;  3QVR A;  1L0V A;  2BC0 A;  3AE4 A;  3O0H A;  1VG0 A;  2X8C A;  3V3O A;  1QJD A;  1IUX A;  1VRQ B;  1NAA A;  2BCG G;  2FJA A;  4J57 A;  4B64 A;  2RAB A;  3GMC A;  3QFB A;  4H4T A;  4C3Y A;  5KWF A;  4ECH A;  3GDN A;  4LA1 A;  1M64 A;  2BXR A;  2OT4 A;  1PN0 A;  2WDV A;  3AEE A;  1JRY A;  4HA6 A;  1TDO A;  1PBB A;  4YSY A;  1D7Y A;  4EMI A;  2LFC A;  3P4R A;  1GER A;  1GRT A;  1GEU A;  2YG6 A;  2C75 A;  1BZL A;  1H81 A;  2CUL A;  2O9Z A;  2XCG A;  3AEG A;  4U8I A;  4U8M A;  4U8P A;  2C72 A;  3UKF A;  3GD4 A;  1D7L A;  2E1M A;  4H4W A;  4H2P A;  1H82 A;  2B9W A;  3EF6 A;  4U2S A;  3SQP A;  3AYL A;  4K5S A;  4OPG A;  4UDR A;  3DGZ A;  3KPF A;  4GUV A;  1KSU A;  1K0J A;  4HB9 A;  1CJ2 A;  4JN9 A;  1N1P A;  5J60 A;  4XXG A;  2FBW A;  3K30 A;  4Y4N A;  2QA1 A;  2WDQ A;  3CGC A;  4B69 A;  3GSI A;  2JK6 A;  1JOA A;  5C2T A;  3FBS A;  1JRZ A;  3SY4 A;  3F8R A;  3AEF A;  3AWI A;  4B67 A;  4XWZ A;  1K0L A;  3AE9 A;  4X9N A;  2CDU A;  2WS3 A;  1LQU A;  2Y6R A;  2JB2 A;  4CCQ A;  1Y56 A;  4YSX A;  4X4J A;  3SXI A;  4L3X A;  2ZZC A;  2OAM A;  1D4D A;  1FS9 A;  1DNC A;  4Z43 A;  1CJ4 A;  1DOB A;  1RYI A;  2YLW A;  1CL0 A;  3AE1 A;  3NRN A;  4YKF A;  5M10 A;  2PHH A;  4Q5C A;  1S3E A;  1PS9 A;  4EQW A;  2WP6 A;  1IUV A;  1D4C A;  1YKJ A;  1OJA A;  2WET A;  1IUU A;  1NG3 A;  3DJE A;  3NGC X;  4GDP A;  1GRG A;  4NTE A;  1KF6 A;  3G5S A;  3BNF A;  5L46 A;  3RP6 A;  1GSN A;  2EQ6 A;  2WPF A;  1ZK7 A;  1E1K A;  4Q0T A;  1Y0P A;  2HQM A;  2YQU A;  1E7P A;  2C66 A;  5IQ1 A;  2VVM A;  3BNJ A;  3UKQ A;  4EIQ A;  5IQ4 A;  2GMH A;  1XDI A;  3F29 A;  2C76 A;  1PDH A;  4I59 A;  2IVD A;  2GF3 A;  2V60 A;  2C64 A;  4OPL A;  3B6D A;  2BYB A;  3UCL A;  3SCE A;  1DXL A;  4Z24 A;  1IUW A;  1GT8 A;  4H4X A;  4U8O A;  3SGL A;  3C96 A;  3GMB A;  4DSG A;  3T2K A;  3AD9 B;  2XFP A;  3VRB A;  4AOX A;  4ZCC A;  3VRA A;  5KVI A;  4EMW A;  3TTB A;  1FEC A;  1Q1W A;  2R0P A;  2YM2 A;  3KPK A;  4H4Y A;  4IVM B;  2GV8 A;  1FEA A;  2YAU A;  2V61 A;  4Q17 A;  1DJN A;  2WDR A;  3VQR A;  4C5O A;  2TMD A;  1DOE A;  4JY3 A;  4OVI A;  4Z25 A;  4OPD A;  2H89 A;  2RDZ A;  2PYX A;  3DJG X;  1FEB A;  4JNQ A;  1D5T A;  1F6M A;  4Z2R A;  3CGE A;  3PS9 A;  3RNM A;  2EQ9 A;  3K7Q X;  3UP5 A;  1MOK A;  3GYI A;  4BJY A;  1M6I A;  5IPY A;  2NPX A;  1PXA A;  4JNA A;  4G6G A;  3PO7 A; 
#chains in the Genus database with same CATH homology
 4K2X A;  4Q1O A;  1B5Q A;  2GAH B;  3NK1 X;  1ZP0 A;  1GRH A;  2R4J A;  5U63 A;  2F5Z A;  1K4Q A;  2B9Y A;  2TPR A;  4A6N A;  2WU2 A;  4A6N B;  1TRB A;  3I6D A;  3SZW A;  1M1Q A;  4OPU A;  3IWA A;  1OJC A;  1ZX9 A;  3NT6 A;  2RGO A;  4L3Z A;  2A89 A;  3DH9 A;  3DJJ A;  4U8N A;  3CNP A;  5FMH A;  2NVK X;  3CND A;  4CRT A;  3RP7 A;  2V6O A;  3UKL A;  3UOZ A;  4Z44 A;  2C3C A;  5FS8 A;  1KSS A;  2R46 A;  4Y4L A;  2YR5 A;  3SX6 A;  4AP3 A;  1GTE A;  4ZCD A;  2RGJ A;  5HY5 A;  2B7S A;  3QVP A;  3CNJ A;  4REK A;  4RSL A;  4YSZ A;  3NKS A;  2VQ7 A;  3AE7 A;  1N4V A;  5FS9 A;  1GTH A;  3NK2 X;  5FS6 A;  3DK8 A;  3FPZ A;  1B8S A;  1LQT A;  2BS2 A;  4GRT A;  3BI5 A;  3AEB A;  3SFD A;  3UOY A;  1S2Q A;  4NWZ A;  3AEC A;  1XPQ A;  3OZ2 A;  4WX1 A;  1V59 A;  3M13 A;  2YVG A;  2FJB A;  3K7M X;  4EM3 A;  3T2Y A;  1PBF A;  4H4S A;  3QJ4 A;  5JCM A;  1IJH A;  1EL9 A;  2JBV A;  3UOV A;  3UBR A;  1S3B A;  4K22 A;  4MJW A;  2Y6Q A;  1L9D A;  2JB3 A;  2XVJ A;  1IUT A;  4YTN A;  2Q0L A;  2YLR A;  3SM8 A;  3AE3 A;  3GWD A;  3QFA A;  2VR0 A;  4Y4M A;  3NH3 X;  2K3V A;  3IHM A;  1FS8 A;  4GF7 A;  2WQY A;  1ELI A;  3CPH G;  2GR3 A;  4OCG A;  4Z2U A;  3GRT A;  1YQZ A;  3AXB A;  4OPI A;  5GSN A;  2W0H A;  3UKA A;  2DKI A;  2R0G A;  3URH A;  4H4V A;  3LGQ A;  1ZY8 A;  2YR6 A;  4H4R A;  1PJ6 A;  4TLZ A;  2XFU A;  1B37 A;  2E81 A;  1PBD A;  2H88 A;  2WHD A;  4TM0 A;  1OAH A;  2BA9 A;  1PJ5 A;  2JKC A;  3DK9 A;  3BI2 A;  3HYW A;  1LVL A;  3NN0 X;  3QSE A;  3DGH A;  2WOV A;  4IA5 A;  4JY2 A;  4H4U A;  3VR8 A;  3Q9T A;  3S61 A;  4D03 A;  1PHH A;  4IVO B;  1RP0 A;  2GVC A;  4H7U A;  4EIP A;  2GEW A;  1Y56 B;  4J56 A;  2GH5 A;  3CPJ G;  2BK3 A;  1TDK A;  1IUS A;  3GD3 A;  3H8I A;  3G5Q A;  1GPE A;  4Q5B A;  2YG4 A;  4A7A A;  4JQ9 A;  4TM1 A;  3ALJ A;  3NLC A;  4LII A;  4M52 A;  4NTD A;  4C74 A;  5HXI A;  3C4N A;  4XWR A;  3SZF A;  2XLP A;  1O5W A;  2R4E A;  3LJP A;  1CC2 A;  2R45 A;  4J33 A;  4K8D A;  3CNS A;  3AE5 A;  1JNI A;  1HYU A;  3GYJ A;  2EQ8 A;  2JAE A;  5KVH A;  3F8D A;  2WOW A;  5CQF A;  5KMQ A;  2I0Z A;  2WES A;  1YQ4 A;  1QDB A;  3BHF A;  3GRS A;  4DNA A;  3NNE A;  1O95 A;  3C4A A;  4AT2 A;  1PXC A;  1F3P A;  1Q1R A;  1FL2 A;  3D1I A;  2EQ7 A;  3CGB A;  3KLJ A;  3RP8 A;  2ZBW A;  3QSM A;  2OA1 A;  4L38 A;  1JU2 A;  3KD9 A;  3WE0 A;  1BKW A;  1TYT A;  4Z26 A;  2BK5 A;  4H4P A;  3ICT A;  4B66 A;  3SZ0 A;  3ATR A;  2ACZ A;  3PVC A;  1EL8 A;  2GAG B;  3ZYX A;  1ZMD A;  2WPC A;  3CIR A;  3LZX A;  3T0K A;  2R0C A;  5EB4 A;  3DME A;  5FS7 A;  3CGD A;  1KNP A;  2XLR A;  1GRB A;  2UZZ A;  3H4K A;  3IC9 A;  4C77 A;  4DSH A;  3VRD B;  4EM4 A;  2BS4 A;  3KKJ A;  2VVL G;  3E1T A;  3AEA A;  3T14 A;  4UDQ A;  2YLX A;  1LJ1 A;  2XFN A;  2XFO A;  2QCU A;  5TR3 A;  3UKH A;  1FT6 A;  1N4W A;  4APN A;  3ISH A;  4ADW A;  4D04 A;  4B1B A;  1GRA A;  1OJT A;  2X3N A;  2WPE A;  3FIM B;  1TDE A;  4B68 A;  5BUL A;  4BK3 A;  1CHU A;  1MXT A;  4LU6 A;  4EQR A;  2X8H A;  4YTM A;  2YWL A;  3VR9 A;  4A65 A;  4YT0 A;  5KOW A;  1P2H A;  2BCP A;  1O94 A;  2XYO A;  3S5W A;  3UTE A;  3OWM A;  2JB1 A;  2V3A A;  3D1C A;  2R9Z A;  1GRE A;  4NNJ A;  2YVJ A;  1DOC A;  2X99 A;  1XHC A;  3AE6 A;  1NDA A;  3OC4 A;  3NTA A;  2Z5X A;  1NHQ A;  4YKG A;  4H50 A;  4J31 A;  1SP3 A;  1S2Y A;  1EL7 A;  4A99 A;  3NYF A;  2YR4 A;  4II3 A;  1ZKQ A;  3LOV A;  4O5U A;  3RKH A;  4IV9 A;  5KXJ A;  3UTF A;  1M1R A;  4Z2T A;  3ICS A;  3MMO A;  2GRT A;  5DBJ A;  2ZZB A;  1GU6 A;  3SZC A;  1OJ9 A;  1GRF A;  1FS7 A;  2YM1 A;  3P4P A;  3T37 A;  4CY8 A;  2X50 A;  3UU9 A;  2VRM A;  4AOS A;  1OJD A;  1H6V A;  1PXB A;  4FK1 A;  3EAN A;  3V3N A;  2A8X A;  2E5V A;  3CTY A;  4USQ A;  4CBQ A;  2OLN A;  2VQB A;  3NN6 X;  4PAA A;  3UP4 A;  1TDF A;  2OLO A;  4H4Q A;  2CFY A;  1NPX A;  2WEU A;  3HYV A;  1CC4 A;  2FJE A;  4EQS A;  4TLX A;  2GR2 A;  1PJ7 A;  4GAV A;  4J34 A;  2RGH A;  5J7X A;  4H2N A;  3NYE A;  3ITJ A;  2Q7V A;  2GQW A;  3ALM A;  4YTP A;  1ONF A;  1N4U A;  2QAE A;  3BNU A;  4ZN0 A;  5M0Z A;  3NK0 X;  1DOD A;  3UKK A;  4A9W A;  2YLT A;  3AD8 B;  1AOG A;  2B76 A;  3DJD A;  1NHP A;  4KPR A;  3HZL A;  1NEK A;  3NIX A;  2CVJ A;  2XLU A;  1TDN A;  4GCM A;  3RHA A;  4EQX A;  3NHO X;  4C3X A;  1EL5 A;  4TM3 A;  1KNR A;  3BNH A;  1MO9 A;  4U8K A;  2XVH A;  1L9E A;  1K0I A;  2GR1 A;  4YXD A;  4I58 A;  3Q6J A;  1YQ3 A;  4RG3 A;  2AAQ A;  2XVF A;  2BRY A;  2BAC A;  1E6E A;  3LXD A;  3GWF A;  2YLS A;  2ARD A;  1GET A;  4G9K A;  1H7X A;  5EOW A;  3K7T A;  3ABV A;  2BK4 A;  4CNJ A;  4U2L A;  2WBA A;  3ADA B;  4JDR A;  4NTC A;  1TYP A;  1E39 A;  3FMW A;  3LAD A;  3BNM A;  4A79 A;  1E1L A;  3GM6 A;  3II4 A;  2GMJ A;  2Q6U A;  1BF3 A;  3COX A;  4WJY A;  3BHK A;  1E1N A;  1CC6 A;  2VRL A;  1W4X A;  3CNT A;  4B63 A;  2E4G A;  2GQF A;  3SXQ A;  1Z6L A;  4FX9 A;  4IA6 A;  2APG A;  4J36 A;  2XDO A;  3DK4 A;  3H8L A;  3GYX A;  2A87 A;  4X9M A;  4AT0 A;  4DGK A;  2DKH A;  4GDE A;  4OPC A;  3BI4 A;  3BNG A;  4KX6 A;  2FJD A;  4CY6 A;  1H84 A;  2WU5 A;  2V3B A;  2J3N A;  3ATQ A;  5JCL A;  1GAL A;  2IID A;  4O5Q A;  3LG1 A;  1NHR A;  3AYJ A;  1EBD A;  3ICR A;  2YG7 A;  1CF3 A;  5KMP A;  4II2 A;  5BVA A;  4U8J A;  4UDP A;  1PBC A;  4OPT A;  3M12 A;  4USR A;  3UTH A;  3DA1 A;  5KOX A;  1GXF A;  3P9U A;  3V76 A;  1ZOY A;  1KDG A;  3AB1 A;  5EB5 A;  3CN8 A;  5JCK A;  3P4S A;  1F8S A;  3M0O A;  4NZH A;  2GB0 A;  1B4V A;  3L8K A;  3G5R A;  4FDC B;  3SYI A;  3I3L A;  4N9X A;  4J2W A;  2E80 A;  1BGN A;  1F8W A;  1H7W A;  3HYX A;  1XAN A;  2V5Z A;  3UTG A;  2C3D A;  3EAO A;  4NEW A;  3GDP A;  1FOH A;  3QSS A;  4RG4 A;  4E0V A;  4G73 A;  4K7Z A;  1QO8 A;  1D4E A;  1REO A;  4BJZ A;  2BXS A;  4BK1 A;  4H2R A;  3D8X A;  3B3R A;  1UKV G;  1CJ3 A;  1NG4 A;  4UP3 A;  5BUK A;  1BGJ A;  4WCT A;  3ZDN A;  2VVL A;  3KU9 A;  2C4C A;  4NEV A;  3IF9 A;  4AP1 A;  4B65 A;  2XFQ A;  1COY A;  2Q0K A;  4YWO A;  5GRT A;  4BK2 A;  1FCD A;  1F8R A;  1JNZ A;  3P4Q A;  1KFY A;  1LPF A;  1JRX A;  2BC1 A;  2IVE A;  3NG7 X;  1VQW A;  3IHG A;  3UKP A;  2J7A A;  5CKU A;  1P2E A;  2C70 A;  5KRQ A;  3L1R A;  3CPI G;  1DJQ A;  4TM4 A;  4H4Z A;  2VZ2 A;  2C65 A;  4BV6 A;  1PBE A;  5HYM A;  3FG2 P;  4GAP A;  4ICY A;  2WP9 A;  2XVE A;  2B9X A;  3NYC A;  4FK1 C;  4YSH A;  1M1P A;  2YG3 A;  3ALL A;  4P9S A;  2C73 A;  3EPT A;  3F8P A;  5KNL A;  3AYI A;  2YG5 A;  4H2Q A;  3L1T A;  1VDC A;  2WOI A;  1H83 A;  1QLB A;  3NTD A;  3RED A;  3P1W A;  1JEH A;  1ZMC A;  4G74 A;  1JNR A;  3S7W A;  2B7R A;  4L3Y A;  3AE8 A;  3T31 A;  5KMR A;  1GOS A;  4PAB A;  1Q9I A;  2GR0 A;  2QA2 A;  2X8G A;  3JSK A;  5KMS A;  1GES A;  1X31 B;  1CJC A;  1LTX R;  2C67 A;  1NHS A;  5U1O A;  1GV4 A;  2XLT A;  1LV0 A;  2ZZ0 A;  1VG9 A;  3FO3 A;  2AR8 A;  2BAB A;  3R9U A;  4Q4U A;  3AED A;  5JCI A;  1BVB A;  1FT5 A;  4CCR A;  4EMJ A;  2XLS A;  2YLZ A;  2WP5 A;  4U8L A;  2BRA A;  3SFE A;  2VOU A;  1CBO A;  2RF7 A;  3UOX A;  5C3J A;  1ZOV A;  4A5L A;  5LV9 A;  5BRT A;  3KA7 A;  3AE2 A;  4GR1 A;  1YY5 A;  1NEN A;  3AD7 B;  1GND A;  1ZDL A;  1H86 A;  3TOR A;  3KVE A;  3LB8 A;  2XVI A;  2BS3 A;  1BWC A;  2C7G A;  3CMM A;  2YVF A;  4U2T A;  5JCN A;  1L9C A;  4CNK A;  2AQJ A;  5EBK A;  1RSG A;  2Z5Y A;  3LZW A;  1SEZ A;  3T2Z A;  4G6H A;  2ZO5 A;  1E1M A;  2OAL A;  4BUR A;  4K5R A;  5U25 A;  5HHF A;  5ER0 A;  3QVR A;  1L0V A;  2BC0 A;  3AE4 A;  3O0H A;  1VG0 A;  2X8C A;  3V3O A;  1QJD A;  1IUX A;  1VRQ B;  1NAA A;  2BCG G;  2FJA A;  4J57 A;  4B64 A;  2RAB A;  3GMC A;  3QFB A;  4H4T A;  4C3Y A;  5KWF A;  4ECH A;  3GDN A;  4LA1 A;  1M64 A;  2BXR A;  2OT4 A;  1PN0 A;  2WDV A;  3AEE A;  1JRY A;  4HA6 A;  1TDO A;  1PBB A;  4YSY A;  1D7Y A;  4EMI A;  2LFC A;  3P4R A;  1GER A;  1GRT A;  1GEU A;  2YG6 A;  2C75 A;  1BZL A;  1H81 A;  2CUL A;  2O9Z A;  2XCG A;  3AEG A;  4U8I A;  4U8M A;  4U8P A;  2C72 A;  3UKF A;  3GD4 A;  1D7L A;  2E1M A;  4H4W A;  4H2P A;  1H82 A;  2B9W A;  3EF6 A;  4U2S A;  3SQP A;  3AYL A;  4K5S A;  4OPG A;  4UDR A;  3DGZ A;  3KPF A;  4GUV A;  1KSU A;  1K0J A;  4HB9 A;  1CJ2 A;  4JN9 A;  1N1P A;  5J60 A;  4XXG A;  2FBW A;  3K30 A;  4Y4N A;  2QA1 A;  2WDQ A;  3CGC A;  4B69 A;  3GSI A;  2JK6 A;  1JOA A;  5C2T A;  3FBS A;  1JRZ A;  3SY4 A;  3F8R A;  3AEF A;  3AWI A;  4B67 A;  4XWZ A;  1K0L A;  3AE9 A;  4X9N A;  2CDU A;  2WS3 A;  1LQU A;  2Y6R A;  2JB2 A;  4CCQ A;  1Y56 A;  4YSX A;  4X4J A;  3SXI A;  4L3X A;  2ZZC A;  2OAM A;  1D4D A;  1FS9 A;  1DNC A;  4Z43 A;  1CJ4 A;  1DOB A;  1RYI A;  2YLW A;  1CL0 A;  3AE1 A;  3NRN A;  4YKF A;  5M10 A;  2PHH A;  4Q5C A;  1S3E A;  1PS9 A;  4EQW A;  2WP6 A;  1IUV A;  1D4C A;  1YKJ A;  1OJA A;  2WET A;  1IUU A;  1NG3 A;  3DJE A;  3NGC X;  4GDP A;  1GRG A;  4NTE A;  1KF6 A;  3G5S A;  3BNF A;  5L46 A;  3RP6 A;  1GSN A;  2EQ6 A;  2WPF A;  1ZK7 A;  1E1K A;  4Q0T A;  1Y0P A;  2HQM A;  2YQU A;  1E7P A;  2C66 A;  5IQ1 A;  2VVM A;  3BNJ A;  3UKQ A;  4EIQ A;  5IQ4 A;  2GMH A;  1XDI A;  3F29 A;  2C76 A;  1PDH A;  4I59 A;  2IVD A;  2GF3 A;  2V60 A;  2C64 A;  4OPL A;  3B6D A;  2BYB A;  3UCL A;  3SCE A;  1DXL A;  4Z24 A;  1IUW A;  1GT8 A;  4H4X A;  4U8O A;  3SGL A;  3C96 A;  3GMB A;  4DSG A;  3T2K A;  3AD9 B;  2XFP A;  3VRB A;  4AOX A;  4ZCC A;  3VRA A;  5KVI A;  4EMW A;  3TTB A;  1FEC A;  1Q1W A;  2R0P A;  2YM2 A;  3KPK A;  4H4Y A;  4IVM B;  2GV8 A;  1FEA A;  2YAU A;  2V61 A;  4Q17 A;  1DJN A;  2WDR A;  3VQR A;  4C5O A;  2TMD A;  1DOE A;  4JY3 A;  4OVI A;  4Z25 A;  4OPD A;  2H89 A;  2RDZ A;  2PYX A;  3DJG X;  1FEB A;  4JNQ A;  1D5T A;  1F6M A;  4Z2R A;  3CGE A;  3PS9 A;  3RNM A;  2EQ9 A;  3K7Q X;  3UP5 A;  1MOK A;  3GYI A;  4BJY A;  1M6I A;  5IPY A;  2NPX A;  1PXA A;  4JNA A;  4G6G A;  3PO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...