1QJDA

Flavocytochrome c3 from shewanella frigidimarina
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FLAVOCYTOCHROME C3
publication title Structural and Mechanistic Mapping of a Unique Fumarate Reductase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 197
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 1999-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1qjdA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1qjdA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1qjdA01
3KA7A 4TLZA 4C3XA 3LJPA 4LIIA 4DGKA 2NPXA 5GSNA 3E1TA 1D4CA 2YLRA 2C7GA 1QJDA 1EBDA 1LQUA 4ZN0A 3BI5A 5BVAA 1KFYA 1GTHA 3GWDA 1VG0A 2BACA 2QCUA 1DOBA 4B65A 3M12A 1IUTA 3SM8A 2R0GA 4Q5BA 4U2TA 1PJ6A 4ECHA 3DA1A 4C74A 1LV0A 2QA2A 4K7ZA 3NRNA 4GR1A 1CJ3A 1YQZA 3Q9TA 3Q6JA 4X9MA 2PHHA 2A89A 2GB0A 4GRTA 1MXTA 3DMEA 3AYLA 2WESA 3GD3A 1F8WA 1EL5A 3GMCA 1GTEA 1KF6A 4J31A 3URHA 5HY5A 3GYXA 2X99A 1DNCA 4RG4A 1XDIA 3RP8A 2QA1A 3AE9A 5HXIA 2XVIA 3NG7X 2OLOA 4O5UA 3ALLA 1M1QA 2ZZ0A 1RP0A 2WS3A 4EQWA 2CULA 3ALMA 3JSKA 3NK2X 5JCKA 3NN6X 1TDFA 3BNFA 2WOVA 2ZBWA 3RHAA 3PO7A 3UKKA 1MOKA 1L9CA 1NAAA 2EQ8A 3NTDA 4PAAA 3IC9A 2JKCA 3OZ2A 3NKSA 1KDGA 4PABA 2ACZA 3IHMA 4H4TA 4OVIA 1F3PA 1JU2A 1CJCA 4K5SA 1BF3A 5BRTA 4ICYA 2QAEA 4ZCCA 3AEDA 2TPRA 3BI2A 3GRSA 4I59A 1CBOA 1V59A 3ABVA 2H88A 2Z5YA 3DK8A 1DODA 4YKFA 3LZWA 3UKHA 1K0IA 1PBDA 4H2PA 3AEFA 3AE7A 3DGZA 3KD9A 4H4YA 1KNPA 4J34A 5JCNA 5JCIA 1FCDA 2XYOA 4X4JA 1D4DA 1NG3A 1FS8A 4Z44A 4FK1A 2GMHA 1ZDLA 3D1CA 2BABA 3IWAA 2BXRA 2XFNA 3DJDA 3RP7A 4C77A 2WPCA 4H4RA 4O5QA 4D03A 1RSGA 2GAGB 2C64A 4AT0A 4ZCDA 2R4EA 1LPFA 1DJNA 3V3NA 1ZOYA 4H4SA 1JNIA 2VRLA 5KVIA 3UTFA 2AAQA 1GRTA 5CKUA 2E4GA 2Y6QA 5JCMA 1E1LA 3UKQA 2XFPA 1E1MA 4HB9A 3UKFA 3HZLA 1E6EA 2XLRA 2C70A 1GRAA 2WOIA 4YSYA 1VQWA 2X50A 3ITJA 2YG7A 3VRDB 2YLWA 2JB1A 3QVPA 2ARDA 1BZLA 3AEAA 2C72A 4Z26A 3CNDA 3EPTA 4H4XA 1N4UA 5BULA 2GR1A 1FS9A 1COYA 3CPIG 2AR8A 2WP9A 4IVMB 1ZKQA 4Z2TA 4Z2UA 1W4XA 2BS4A 2YR4A 3TTBA 3F8DA 4Q0TA 1N4VA 2B9YA 4K5RA 4CBQA 5ER0A 4AP1A 2R0CA 2VVLA 2YM1A 4YT0A 1KSUA 1ZOVA 4B64A 1FT6A 2J3NA 3AEGA 3NH3X 2Q6UA 1FT5A 1PBBA 2BK4A 1H84A 2YLSA 1L0VA 4BURA 4JQ9A 3P4PA 2OA1A 1Y56A 3KPFA 4BV6A 1PXBA 3P4RA 1LTXR 3K7TA 1GXFA 1REOA 4P9SA 1PDHA 4AOSA 3SFDA 2X3NA 2VOUA 1LQTA 1PXAA 1NDAA 2VVMA 2BA9A 3G5QA 5FS6A 3QSEA 1X31B 3SFEA 4NTEA 3GRTA 2IIDA 5HHFA 1TYPA 3QVRA 2YQUA 1CC4A 2CDUA 1S2QA 2LFCA 3D8XA 4K8DA 3UTHA 2BCGG 2B9WA 4EIQA 3ADAB 4X9NA 1H83A 1N1PA 4NEVA 4CCQA 5JCLA 4K22A 1FEAA 4YTNA 3GDPA 1ELIA 4RG3A 3WE0A 3SQPA 1DJQA 4OCGA 3AYJA 1JNZA 1GRBA 3OC4A 2YWLA 1GSNA 5M0ZA 1YY5A 1XANA 4Q17A 3ICTA 2WQYA 3OWMA 1E1NA 4A6NB 4A7AA 4CY6A 1NG4A 1OJTA 1Q1WA 4H2QA 1BWCA 2VQ7A 1HYUA 2A87A 4U8MA 4DSGA 3C96A 1DOCA 2C76A 4Z24A 4B66A 4OPTA 1XHCA 3LZXA 2BS2A 3FPZA 3G5RA 5EB5A 4L3YA 1E7PA 1PJ7A 1N4WA 1ZK7A 1JEHA 3VR9A 5L46A 2GQFA 1GOSA 3ICRA 3SGLA 4Y4LA 4I58A 5J7XA 3P1WA 5DBJA 1B4VA 5FS9A 2GF3A 1NEKA 3UBRA 1O95A 3VR8A 5IPYA 2AQJA 2XFQA 2XVEA 2YG3A 1EL7A 1K0LA 3QFBA 3UTGA 3ATRA 3DH9A 4GDEA 4EQRA 3ALJA 4BJZA 4UDQA 1H82A 2WU2A 1M1PA 2B7RA 4A5LA 4J33A 2YG6A 4IV9A 3LG1A 4TM4A 1CC2A 2XFUA 4J36A 3KKJA 3NT6A 3SCEA 3NLCA 4B67A 2A8XA 1PS9A 3AB1A 1JOAA 4XWZA 3CTYA 3NHOX 1GREA 4CY8A 1ZY8A 1S2YA 2WPFA 2WHDA 3AE4A 4YWOA 1PBCA 3UOZA 4USQA 3C4NA 1OJAA 1EL9A 3BHFA 1NHPA 3LXDA 2IVEA 1IJHA 3LADA 2WU5A 1FEBA 1GU6A 3BHKA 3IF9A 1O5WA 1Q1RA 3F8PA 4YSHA 2H89A 4U2SA 3KU9A 2RGJA 4J56A 3GD4A 2Z5XA 2YLTA 3LB8A 2GR2A 3AWIA 1B37A 1F8RA 3NIXA 4B68A 3ZDNA 1RYIA 3NK0X 3BNMA 3DGHA 3FO3A 1H81A 4IA5A 1S3BA 2XFOA 3F8RA 1L9EA 4K2XA 2DKIA 1GNDA 5BUKA 1GETA 2V60A 2YR5A 3CNPA 1H7WA 3RP6A 3AE1A 3ISHA 4B1BA 4CNJA 3AE6A 3L1RA 1ZMDA 1PJ5A 3BI4A 4JNAA 3NN0X 3KLJA 4Q4UA 1NHRA 2XLTA 1P2EA 2OT4A 3BNHA 3AD9B 1LVLA 4WX1A 3AE2A 3DK4A 4TM0A 3TORA 4YKGA 4YXDA 2B7SA 1H86A 2UZZA 3LGQA 4H2NA 2XDOA 1K4QA 1H7XA 3FG2P 4EMIA 4Q5CA 1DOEA 1VDCA 2YVGA 3RNMA 3BNUA 2GVCA 1JNRA 2PYXA 1F8SA 2DKHA 3NYCA 2RF7A 1DXLA 5HYMA 4U8NA 2OAMA 3PVCA 4U8PA 4Z2RA 4GF7A 4KX6A 5EBKA 3NK1X 4EQXA 3EANA 4HA6A 2OLNA 5FMHA 3BNJA 2X8HA 2FJAA 4CRTA 4JNQA 4OPCA 2WEUA 4AT2A 2RDZA 1K0JA 2WETA 4NZHA 4Y4NA 1QLBA 3I6DA 2Y6RA 5U63A 3GYIA 2YLXA 3UOXA 2VZ2A 3S7WA 3M0OA 3L1TA 1YQ4A 2Q0KA 2W0HA 4FK1C 4B69A 4JN9A 4J57A 2BYBA 3IHGA 4YSZA 2HQMA 3UOVA 4H4PA 2B9XA 1BGJA 4JY2A 4WCTA 3S5WA 3FBSA 4L3XA 1D7YA 2C67A 3NYEA 3ATQA 2WOWA 1CJ4A 1TYTA 5C3JA 1CHUA 2YG5A 2RGOA 3K7MX 4TM3A 3AXBA 5U1OA 4H4WA 1BGNA 2C75A 3MMOA 1JRYA 1B8SA 1GEUA 4A65A 4APNA 4JY3A 2E1MA 4YTPA 3UTEA 1VG9A 2YAUA 1BKWA 4U8IA 2C73A 4YSXA 4GUVA 4U2LA 2BC1A 1YQ3A 3H4KA 3PS9A 1TDOA 3H8LA 4H50A 1JRZA 4Y4MA 3C4AA 4XXGA 4AP3A 4BJYA 4BK3A 1IUXA 5C2TA 4BK1A 1Y0PA 2XVJA 4A99A 1GV4A 4A79A 2YG4A 1CC6A 3AD8B 4ADWA 2BK5A 2GMJA 2C3DA 2GAHB 2Q0LA 2VQBA 4EIPA 4EQSA 3UKLA 5IQ1A 1NPXA 1UKVG 2FBWA 2V5ZA 2APGA 2XLPA 3COXA 2WBAA 2BK3A 2YLZA 1BVBA 5IQ4A 2E80A 2R9ZA 2B76A 4U8LA 2V61A 4C3YA 1NHQA 2FJEA 2BS3A 1FOHA 1IUVA 4OPUA 1FS7A 3CIRA 2NVKX 3EF6A 4H4QA 5EOWA 2GV8A 2VRMA 3CPHG 4Z43A 4C5OA 2CVJA 1AOGA 1ONFA 1Y56B 2F5ZA 3UKPA 2YR6A 3FMWA 4REKA 2R46A 2GR0A 5LV9A 3T37A 5EB4A 2C66A 2GRTA 4LA1A 4UDPA 3V3OA 3DJGX 4FX9A 2JBVA 3P4QA 2FJDA 2XVFA 3DJJA 4M52A 2J7AA 1ZMCA 2WDRA 5FS7A 1PHHA 3CN8A 2WP6A 3DJEA 1QDBA 1GERA 4B63A 3GDNA 1SP3A 1OJ9A 4H7UA 2GEWA 4U8JA 3ICSA 1IUSA 4EM4A 5KVHA 3VQRA 2X8CA 1M1RA 3ZYXA 4EM3A 2OALA 4U8OA 2R0PA 3I3LA 2C3CA 1M6IA 4GDPA 3AYIA 1E39A 3D1IA 3QSMA 3NYFA 4NTDA 2WDVA 3EAOA 1GRGA 2RABA 4OPLA 3UCLA 3H8IA 1QO8A 2JAEA 4Q1OA 1IUUA 2BXSA 1MO9A 2V6OA 3G5SA 3RKHA 1OJDA 2JK6A 3GWFA 4KPRA 2GR3A 1OAHA 2JB2A 2WP5A 4BK2A 2YVJA 3UP4A 1PXCA 2GH5A 4E0VA 2I0ZA 3UKAA 4NTCA 2E5VA 3P4SA 2K3VA 4EMJA 5M10A 2JB3A 3AE5A 3CNTA 4UP3A 4IA6A 4OPDA 1P2HA 2VR0A 4H4UA 2X8GA 5KRQA 1D4EA 1D7LA 5FS8A 2ZO5A 2EQ9A 4UDRA 1TDEA 1ZX9A 2XCGA 3CNSA 5KXJA 3GYJA 3REDA 3SXQA 1XPQA 3KVEA 5KWFA 3CPJG 4CCRA 2EQ6A 3V76A 3CGEA 5KOWA 4A6NA 4IVOB 3B3RA 2IVDA 1PBEA 1YKJA 3II4A 5GRTA 4AOXA 1D5TA 4DSHA 5U25A 3UP5A 2R4JA 1GRFA 1NENA 1TDNA 2EQ7A 3QJ4A 4RSLA 4Z25A 4FDCB 2Q7VA 3AEBA 2YVFA 3BNGA 3CNJA 2GQWA 3LOVA 1ZP0A 1O94A 3GSIA 1JRXA 4L3ZA 1L9DA 3O0HA 3CGCA 3AEEA 4OPIA 3VRAA 1KNRA 3NGCX 1TDKA 2R45A 2BC0A 4H4ZA 1EL8A 1FECA 3UOYA 3UU9A 1NHSA 1OJCA 3NNEA 1GT8A 3P9UA 3S61A 1GRHA 1Z6LA 2VVLG 2XLSA 3AECA 3DK9A 4D04A 4TLXA 1CL0A 4LU6A 2TMDA 3CGDA 4N9XA 1B5QA 5CQFA 4TM1A 1LJ1A 1E1KA 2RGHA 3FIMB 4J2WA 2WPEA 3VRBA 1KSSA 5KOXA 3F29A 1PBFA 1FL2A 3AE3A 2XLUA 3CGBA 4NEWA 1CJ2A 1Q9IA 1VRQB 3K30A 1M64A 2O9ZA 2WDQA 4XWRA 4DNAA 2C65A 2V3AA 3AD7B 1CF3A 2CFYA 1S3EA 3M13A 3QSSA 2ZZCA 4MJWA 2E81A 4WJYA 3GM6A 4EMWA 4L38A 5TR3A 3QFAA 2BCPA 3K7QX 3R9UA 2FJBA 4H4VA 4JDRA 1H6VA 1TRBA 4U8KA 5J60A 4USRA 4H2RA 4GCMA 1SEZA 2ZZBA 4CNKA 3GMBA 3L8KA 1GESA 1IUWA 1PN0A 2YM2A 2XVHA 4OPGA 1GPEA 1F6MA 4YTMA 2V3BA 1GALA 3B6DA 3NTAA 3AE8A 4A9WA
chains in the Genus database with same CATH superfamily
3KA7A 4TLZA 4C3XA 3LJPA 4LIIA 4DGKA 2NPXA 5GSNA 3E1TA 1D4CA 2YLRA 2C7GA 1QJDA 1EBDA 1LQUA 4ZN0A 3BI5A 5BVAA 1KFYA 1GTHA 3GWDA 1VG0A 2BACA 2QCUA 1DOBA 4B65A 3M12A 1IUTA 3SM8A 2R0GA 4Q5BA 4U2TA 1PJ6A 4ECHA 3DA1A 4C74A 1LV0A 2QA2A 4K7ZA 3NRNA 4GR1A 1CJ3A 1YQZA 3Q9TA 3Q6JA 4X9MA 2PHHA 2A89A 2GB0A 4GRTA 1MXTA 3DMEA 3AYLA 2WESA 3GD3A 1F8WA 1EL5A 3GMCA 1GTEA 1KF6A 4J31A 3URHA 5HY5A 3GYXA 2X99A 1DNCA 4RG4A 5KMSA 1XDIA 3RP8A 2QA1A 3AE9A 5HXIA 2XVIA 3NG7X 2OLOA 4O5UA 3ALLA 1M1QA 2ZZ0A 1RP0A 2WS3A 4EQWA 2CULA 3ALMA 3JSKA 3NK2X 5JCKA 3SYIA 3NN6X 1TDFA 3BNFA 2WOVA 2ZBWA 3RHAA 3PO7A 3UKKA 1MOKA 1L9CA 1NAAA 2EQ8A 3NTDA 4PAAA 3IC9A 2JKCA 3OZ2A 3NKSA 1KDGA 4PABA 2ACZA 3IHMA 4H4TA 4OVIA 1F3PA 1JU2A 1CJCA 4K5SA 1BF3A 5BRTA 4ICYA 2QAEA 4ZCCA 3AEDA 2TPRA 3BI2A 3GRSA 4I59A 1CBOA 1V59A 3KPKA 3ABVA 2H88A 2Z5YA 3DK8A 1DODA 4YKFA 3LZWA 3UKHA 1K0IA 1PBDA 4H2PA 3AEFA 3AE7A 3DGZA 3KD9A 4H4YA 1KNPA 4J34A 5JCNA 5JCIA 1FCDA 2XYOA 4X4JA 1D4DA 1NG3A 1FS8A 4Z44A 4FK1A 2GMHA 1ZDLA 3D1CA 2BABA 3IWAA 2BXRA 3SZFA 2XFNA 3DJDA 3RP7A 4C77A 2WPCA 4H4RA 4O5QA 4D03A 1RSGA 2GAGB 2C64A 3T31A 4AT0A 4ZCDA 2R4EA 1LPFA 1DJNA 3V3NA 1ZOYA 4H4SA 1JNIA 2VRLA 5KVIA 3UTFA 2AAQA 1GRTA 5CKUA 2E4GA 2Y6QA 5JCMA 1E1LA 3UKQA 2XFPA 1E1MA 4HB9A 3UKFA 3HZLA 1E6EA 2XLRA 2C70A 1GRAA 2WOIA 4YSYA 1VQWA 2X50A 3ITJA 2YG7A 3VRDB 2YLWA 2JB1A 3QVPA 2ARDA 1BZLA 3AEAA 2C72A 4Z26A 3CNDA 3EPTA 4H4XA 1N4UA 5BULA 2GR1A 1FS9A 1COYA 3CPIG 2AR8A 2WP9A 4IVMB 1ZKQA 4Z2TA 4Z2UA 1W4XA 2BS4A 2YR4A 3TTBA 3F8DA 4Q0TA 1N4VA 2B9YA 4K5RA 4CBQA 5ER0A 4AP1A 2R0CA 2VVLA 2YM1A 4YT0A 1KSUA 1ZOVA 4B64A 1FT6A 2J3NA 3AEGA 3NH3X 2Q6UA 1FT5A 1PBBA 2BK4A 1H84A 2YLSA 1L0VA 4BURA 4JQ9A 3P4PA 2OA1A 1Y56A 3KPFA 3SZWA 4BV6A 1PXBA 3P4RA 1LTXR 3K7TA 1GXFA 1REOA 4P9SA 1PDHA 4AOSA 3SFDA 2X3NA 2VOUA 1LQTA 1PXAA 1NDAA 2VVMA 2BA9A 3G5QA 5FS6A 3QSEA 1X31B 3SFEA 4NTEA 3GRTA 2IIDA 5HHFA 1TYPA 3QVRA 3T2YA 2YQUA 1CC4A 2CDUA 3T0KA 1S2QA 2LFCA 3D8XA 4K8DA 3UTHA 2BCGG 2B9WA 4EIQA 3ADAB 4X9NA 1H83A 1N1PA 4NEVA 4CCQA 5JCLA 4K22A 1FEAA 4YTNA 3GDPA 1ELIA 4RG3A 3WE0A 3SQPA 1DJQA 4OCGA 3AYJA 1JNZA 1GRBA 3OC4A 4GAPA 2YWLA 1GSNA 5M0ZA 4CY6A 1YY5A 1XANA 4Q17A 3HYXA 2WQYA 3OWMA 1E1NA 3ICTA 4G74A 4A6NB 1NG4A 1OJTA 1Q1WA 4H2QA 1BWCA 2VQ7A 1HYUA 2A87A 4U8MA 4DSGA 3C96A 1DOCA 2C76A 4Z24A 4B66A 4OPTA 1XHCA 3LZXA 2BS2A 3FPZA 5KMRA 3G5RA 5EB5A 4L3YA 1E7PA 1PJ7A 1N4WA 5HYMA 1ZK7A 1JEHA 3VR9A 3T2KA 5L46A 2GQFA 1GOSA 3ICRA 4G6HA 3SGLA 4Y4LA 4I58A 5J7XA 3P1WA 5DBJA 1B4VA 3T14A 5FS9A 2GF3A 1NEKA 3UBRA 1O95A 3VR8A 5IPYA 2AQJA 2XFQA 2XVEA 2YG3A 1EL7A 1K0LA 3QFBA 3UTGA 3ATRA 3DH9A 4GDEA 4EQRA 3ALJA 4BJZA 4UDQA 1H82A 2WU2A 1M1PA 2B7RA 4A5LA 4J33A 2YG6A 4IV9A 3LG1A 4TM4A 1CC2A 2XFUA 4J36A 3KKJA 3NT6A 3SCEA 3NLCA 4B67A 2A8XA 5KMPA 1PS9A 3AB1A 1JOAA 4XWZA 3CTYA 3NHOX 1GREA 4CY8A 1ZY8A 1S2YA 2WPFA 2WHDA 3AE4A 4YWOA 4G6GA 1PBCA 3UOZA 4USQA 3C4NA 3T2ZA 1OJAA 1EL9A 3BHFA 1NHPA 3LXDA 2IVEA 1IJHA 3LADA 2WU5A 1FEBA 3SX6A 1GU6A 3BHKA 3IF9A 1O5WA 1Q1RA 3F8PA 4YSHA 2H89A 4U2SA 3KU9A 2RGJA 4J56A 3GD4A 2BRAA 2Z5XA 2YLTA 3LB8A 2GR2A 3AWIA 1B37A 1F8RA 3NIXA 4B68A 3ZDNA 1RYIA 3NK0X 3BNMA 3DGHA 3FO3A 1H81A 4A7AA 4IA5A 1S3BA 2XFOA 3F8RA 1L9EA 4K2XA 2DKIA 1GNDA 5BUKA 1GETA 2V60A 2YR5A 3CNPA 1H7WA 3RP6A 3AE1A 3ISHA 4B1BA 4CNJA 3AE6A 3L1RA 1ZMDA 1PJ5A 3BI4A 4JNAA 3NN0X 3KLJA 4Q4UA 1NHRA 2XLTA 1P2EA 2OT4A 3BNHA 3AD9B 1LVLA 4WX1A 3AE2A 3DK4A 4TM0A 3TORA 4YKGA 4YXDA 2B7SA 1H86A 2UZZA 4NWZA 3LGQA 4H2NA 2XDOA 1K4QA 1H7XA 3FG2P 4GAVA 4EMIA 4Q5CA 1DOEA 1VDCA 2YVGA 3RNMA 3BNUA 2BRYA 1JNRA 2GVCA 1F8SA 2DKHA 2PYXA 2RF7A 1DXLA 3NYCA 4U8NA 2OAMA 3PVCA 4U8PA 4Z2RA 4GF7A 4KX6A 5EBKA 3NK1X 4EQXA 3EANA 4HA6A 2OLNA 5FMHA 3BNJA 2X8HA 2FJAA 4CRTA 4JNQA 4OPCA 2WEUA 4AT2A 2RDZA 1K0JA 2WETA 4NZHA 4Y4NA 1QLBA 3I6DA 2Y6RA 5U63A 3GYIA 2YLXA 3UOXA 2VZ2A 3S7WA 3M0OA 3L1TA 1YQ4A 2Q0KA 2W0HA 4FK1C 3SZCA 4B69A 3SY4A 4JN9A 4J57A 2BYBA 3IHGA 4YSZA 2HQMA 3UOVA 4H4PA 2B9XA 1BGJA 4JY2A 4WCTA 3S5WA 3FBSA 3HYVA 4L3XA 1D7YA 2C67A 3NYEA 3ATQA 2WOWA 1CJ4A 1TYTA 5C3JA 1CHUA 2YG5A 2RGOA 3K7MX 4TM3A 3AXBA 5U1OA 3SXIA 4H4WA 1BGNA 2C75A 3MMOA 1JRYA 1B8SA 1GEUA 4A65A 4APNA 4JY3A 2E1MA 4YTPA 3UTEA 1VG9A 2YAUA 1BKWA 4G9KA 2C73A 4U8IA 4YSXA 4GUVA 4U2LA 2BC1A 1YQ3A 3H4KA 3PS9A 1TDOA 3H8LA 4H50A 1JRZA 4Y4MA 3C4AA 4XXGA 4AP3A 4BJYA 4BK3A 1IUXA 5C2TA 4BK1A 1Y0PA 2XVJA 4A99A 1GV4A 4A79A 2YG4A 1CC6A 3AD8B 4ADWA 2BK5A 2GMJA 2C3DA 2GAHB 2Q0LA 2VQBA 4EIPA 4EQSA 3UKLA 4II2A 5IQ1A 1NPXA 1UKVG 2FBWA 2V5ZA 2APGA 2XLPA 3COXA 2WBAA 2BK3A 2YLZA 1BVBA 5IQ4A 2E80A 2R9ZA 2B76A 4U8LA 2V61A 4C3YA 1NHQA 2FJEA 2BS3A 1FOHA 1IUVA 4OPUA 1FS7A 3CIRA 2NVKX 3EF6A 4H4QA 5EOWA 2GV8A 2VRMA 3CPHG 4Z43A 4C5OA 4II3A 2CVJA 1AOGA 1ONFA 1Y56B 2F5ZA 3UKPA 2YR6A 3FMWA 4REKA 2R46A 2GR0A 5LV9A 4G73A 3T37A 5EB4A 2C66A 2GRTA 4LA1A 4UDPA 3V3OA 3DJGX 4FX9A 2JBVA 3P4QA 2FJDA 2XVFA 3DJJA 4M52A 2J7AA 1ZMCA 2WDRA 5FS7A 1PHHA 3CN8A 2WP6A 3DJEA 1QDBA 1GERA 4B63A 3GDNA 1SP3A 1OJ9A 3SZ0A 4H7UA 2GEWA 4U8JA 2CZSA 3ICSA 1IUSA 4EM4A 5KVHA 3VQRA 5KMQA 2X8CA 1M1RA 3ZYXA 4EM3A 2OALA 4U8OA 2R0PA 3I3LA 2C3CA 1M6IA 4GDPA 3AYIA 1E39A 3D1IA 3QSMA 3NYFA 4NTDA 2WDVA 3EAOA 1GRGA 2RABA 4OPLA 3UCLA 3H8IA 1QO8A 2JAEA 4Q1OA 1IUUA 2BXSA 1MO9A 2V6OA 3G5SA 3RKHA 1OJDA 2JK6A 3GWFA 4KPRA 2GR3A 3CMMA 1OAHA 3HYWA 2JB2A 2WP5A 4BK2A 2YVJA 3UP4A 1PXCA 2GH5A 4E0VA 2I0ZA 3UKAA 4NTCA 2E5VA 3P4SA 2K3VA 4EMJA 5M10A 2JB3A 3AE5A 3CNTA 4UP3A 4IA6A 4OPDA 1P2HA 2VR0A 4H4UA 2X8GA 5KRQA 1D4EA 1D7LA 5FS8A 2ZO5A 2EQ9A 4UDRA 1TDEA 5KNLA 1ZX9A 2XCGA 3CNSA 5KXJA 3GYJA 3REDA 3SXQA 1XPQA 3KVEA 5KWFA 3CPJG 4CCRA 2EQ6A 3V76A 3CGEA 5KOWA 4A6NA 4IVOB 3B3RA 2IVDA 1PBEA 1YKJA 3II4A 5GRTA 4AOXA 1D5TA 4DSHA 5U25A 3UP5A 2R4JA 1GRFA 1NENA 1TDNA 2EQ7A 3QJ4A 4RSLA 4Z25A 4FDCB 2Q7VA 3AEBA 2YVFA 3BNGA 3CNJA 2GQWA 3LOVA 1ZP0A 1O94A 3GSIA 1JRXA 4L3ZA 1L9DA 3O0HA 3CGCA 3AEEA 4OPIA 3VRAA 1KNRA 3NGCX 1TDKA 2R45A 2BC0A 4H4ZA 1EL8A 1FECA 3UOYA 3UU9A 1NHSA 1OJCA 3NNEA 1GT8A 3P9UA 3S61A 1GRHA 1Z6LA 2VVLG 2XLSA 3AECA 3DK9A 4D04A 4TLXA 1CL0A 4LU6A 2TMDA 3CGDA 4N9XA 1B5QA 5CQFA 4TM1A 1LJ1A 1E1KA 2RGHA 3FIMB 4J2WA 2WPEA 3VRBA 1KSSA 5KOXA 3F29A 1PBFA 1FL2A 3AE3A 2XLUA 3CGBA 4NEWA 1CJ2A 1Q9IA 1VRQB 3K30A 1M64A 2O9ZA 2WDQA 4XWRA 4DNAA 2C65A 2V3AA 3AD7B 1CF3A 2CFYA 1S3EA 3M13A 3QSSA 2ZZCA 4MJWA 2E81A 4WJYA 3GM6A 4EMWA 4L38A 5TR3A 3QFAA 2BCPA 3K7QX 3R9UA 2FJBA 4H4VA 4JDRA 1H6VA 1TRBA 4U8KA 5J60A 4USRA 4H2RA 4GCMA 1SEZA 2ZZBA 4CNKA 3GMBA 3L8KA 1GESA 1IUWA 1PN0A 2C4CA 2YM2A 2XVHA 4OPGA 1GPEA 1F6MA 4YTMA 2V3BA 1GALA 3B6DA 3NTAA 3AE8A 4A9WA 4NNJA
chains in the Genus database with same CATH topology
3KA7A 4TLZA 4C3XA 3LJPA 4LIIA 4DGKA 2NPXA 5GSNA 3E1TA 1D4CA 2YLRA 2C7GA 1QJDA 1EBDA 1LQUA 4ZN0A 3BI5A 5BVAA 1KFYA 1GTHA 3GWDA 1VG0A 2BACA 2QCUA 1DOBA 4B65A 3M12A 1IUTA 3SM8A 2R0GA 4Q5BA 4U2TA 1PJ6A 4ECHA 3DA1A 4C74A 1LV0A 2QA2A 4K7ZA 3NRNA 4GR1A 1CJ3A 1YQZA 3Q9TA 3Q6JA 4X9MA 2PHHA 2A89A 2GB0A 4GRTA 1MXTA 3DMEA 3AYLA 2WESA 3GD3A 1F8WA 1EL5A 3GMCA 1GTEA 1KF6A 4J31A 3URHA 5HY5A 3GYXA 2X99A 1DNCA 4RG4A 5KMSA 1XDIA 3RP8A 2QA1A 3AE9A 5HXIA 2XVIA 3NG7X 2OLOA 4O5UA 3ALLA 1M1QA 2ZZ0A 1RP0A 2WS3A 4EQWA 2CULA 3ALMA 3JSKA 3NK2X 5JCKA 3SYIA 3NN6X 1TDFA 3BNFA 2WOVA 2ZBWA 3RHAA 3PO7A 3UKKA 1MOKA 1L9CA 1NAAA 2EQ8A 3NTDA 4PAAA 3IC9A 2JKCA 3OZ2A 3NKSA 1KDGA 4PABA 2ACZA 3IHMA 4H4TA 4OVIA 1F3PA 1JU2A 1CJCA 4K5SA 1BF3A 5BRTA 4ICYA 2QAEA 4ZCCA 3AEDA 2TPRA 3BI2A 3GRSA 4I59A 1CBOA 1V59A 3KPKA 3ABVA 2H88A 2Z5YA 3DK8A 1DODA 4YKFA 3LZWA 3UKHA 1K0IA 1PBDA 4H2PA 3AEFA 3AE7A 3DGZA 3KD9A 4H4YA 1KNPA 4J34A 5JCNA 5JCIA 1FCDA 2XYOA 4X4JA 1D4DA 1NG3A 1FS8A 4Z44A 4FK1A 2GMHA 1ZDLA 3D1CA 2BABA 3IWAA 2BXRA 3SZFA 2XFNA 3DJDA 3RP7A 4C77A 2WPCA 4H4RA 4O5QA 4D03A 1RSGA 2GAGB 2C64A 3T31A 4AT0A 4ZCDA 2R4EA 1LPFA 1DJNA 3V3NA 1ZOYA 4H4SA 1JNIA 2VRLA 5KVIA 3UTFA 2AAQA 1GRTA 5CKUA 2E4GA 2Y6QA 5JCMA 1E1LA 3UKQA 2XFPA 1E1MA 4HB9A 3UKFA 3HZLA 1E6EA 2XLRA 2C70A 1GRAA 2WOIA 4YSYA 1VQWA 2X50A 3ITJA 2YG7A 3VRDB 2YLWA 2JB1A 3QVPA 2ARDA 1BZLA 3AEAA 2C72A 4Z26A 3CNDA 3EPTA 4H4XA 1N4UA 5BULA 2GR1A 1FS9A 1COYA 3CPIG 2AR8A 2WP9A 4IVMB 1ZKQA 4Z2TA 4Z2UA 1W4XA 2BS4A 2YR4A 3TTBA 3F8DA 4Q0TA 1N4VA 2B9YA 4K5RA 4CBQA 5ER0A 4AP1A 2R0CA 2VVLA 2YM1A 4YT0A 1KSUA 1ZOVA 4B64A 1FT6A 2J3NA 3AEGA 3NH3X 2Q6UA 1FT5A 1PBBA 2BK4A 1H84A 2YLSA 1L0VA 4BURA 4JQ9A 3P4PA 2OA1A 1Y56A 3KPFA 3SZWA 4BV6A 1PXBA 3P4RA 1LTXR 3K7TA 1GXFA 1REOA 4P9SA 1PDHA 4AOSA 3SFDA 2X3NA 2VOUA 1LQTA 1PXAA 1NDAA 2VVMA 2BA9A 3G5QA 5FS6A 3QSEA 1X31B 3SFEA 4NTEA 3GRTA 2IIDA 5HHFA 1TYPA 3QVRA 3T2YA 2YQUA 1CC4A 2CDUA 3T0KA 1S2QA 2LFCA 3D8XA 4K8DA 3UTHA 2BCGG 2B9WA 4EIQA 3ADAB 4X9NA 1H83A 1N1PA 4NEVA 4CCQA 5JCLA 4K22A 1FEAA 4YTNA 3GDPA 1ELIA 4RG3A 3WE0A 3SQPA 1DJQA 4OCGA 3AYJA 1JNZA 1GRBA 3OC4A 4GAPA 2YWLA 1GSNA 5M0ZA 4CY6A 1YY5A 1XANA 4Q17A 3HYXA 2WQYA 3OWMA 1E1NA 3ICTA 4G74A 4A6NB 1NG4A 1OJTA 1Q1WA 4H2QA 1BWCA 2VQ7A 1HYUA 2A87A 4U8MA 4DSGA 3C96A 1DOCA 2C76A 4Z24A 4B66A 4OPTA 1XHCA 3LZXA 2BS2A 3FPZA 5KMRA 3G5RA 5EB5A 4L3YA 1E7PA 1PJ7A 1N4WA 5HYMA 1ZK7A 1JEHA 3VR9A 3T2KA 5L46A 2GQFA 1GOSA 3ICRA 4G6HA 3SGLA 4Y4LA 4I58A 5J7XA 3P1WA 5DBJA 1B4VA 3T14A 5FS9A 2GF3A 1NEKA 3UBRA 1O95A 3VR8A 5IPYA 2AQJA 2XFQA 2XVEA 2YG3A 1EL7A 1K0LA 3QFBA 3UTGA 3ATRA 3DH9A 4GDEA 4EQRA 3ALJA 4BJZA 4UDQA 1H82A 2WU2A 1M1PA 2B7RA 4A5LA 4J33A 2YG6A 4IV9A 3LG1A 4TM4A 1CC2A 2XFUA 4J36A 3KKJA 3NT6A 3SCEA 3NLCA 4B67A 2A8XA 5KMPA 1PS9A 3AB1A 1JOAA 4XWZA 3CTYA 3NHOX 1GREA 4CY8A 1ZY8A 1S2YA 2WPFA 2WHDA 3AE4A 4YWOA 4G6GA 1PBCA 3UOZA 4USQA 3C4NA 3T2ZA 1OJAA 1EL9A 3BHFA 1NHPA 3LXDA 2IVEA 1IJHA 3LADA 2WU5A 1FEBA 3SX6A 1GU6A 3BHKA 3IF9A 1O5WA 1Q1RA 3F8PA 4YSHA 2H89A 4U2SA 3KU9A 2RGJA 4J56A 3GD4A 2BRAA 2Z5XA 2YLTA 3LB8A 2GR2A 3AWIA 1B37A 1F8RA 3NIXA 4B68A 3ZDNA 1RYIA 3NK0X 3BNMA 3DGHA 3FO3A 1H81A 4A7AA 4IA5A 1S3BA 2XFOA 3F8RA 1L9EA 4K2XA 2DKIA 1GNDA 5BUKA 1GETA 2V60A 2YR5A 3CNPA 1H7WA 3RP6A 3AE1A 3ISHA 4B1BA 4CNJA 3AE6A 3L1RA 1ZMDA 1PJ5A 3BI4A 4JNAA 3NN0X 3KLJA 4Q4UA 1NHRA 2XLTA 1P2EA 2OT4A 3BNHA 3AD9B 1LVLA 4WX1A 3AE2A 3DK4A 4TM0A 3TORA 4YKGA 4YXDA 2B7SA 1H86A 2UZZA 4NWZA 3LGQA 4H2NA 2XDOA 1K4QA 1H7XA 3FG2P 4GAVA 4EMIA 4Q5CA 1DOEA 1VDCA 2YVGA 3RNMA 3BNUA 2BRYA 1JNRA 2GVCA 1F8SA 2DKHA 2PYXA 2RF7A 1DXLA 3NYCA 4U8NA 2OAMA 3PVCA 4U8PA 4Z2RA 4GF7A 4KX6A 5EBKA 3NK1X 4EQXA 3EANA 4HA6A 2OLNA 5FMHA 3BNJA 2X8HA 2FJAA 4CRTA 4JNQA 4OPCA 2WEUA 4AT2A 2RDZA 1K0JA 2WETA 4NZHA 4Y4NA 1QLBA 3I6DA 2Y6RA 5U63A 3GYIA 2YLXA 3UOXA 2VZ2A 3S7WA 3M0OA 3L1TA 1YQ4A 2Q0KA 2W0HA 4FK1C 3SZCA 4B69A 3SY4A 4JN9A 4J57A 2BYBA 3IHGA 4YSZA 2HQMA 3UOVA 4H4PA 2B9XA 1BGJA 4JY2A 4WCTA 3S5WA 3FBSA 3HYVA 4L3XA 1D7YA 2C67A 3NYEA 3ATQA 2WOWA 1CJ4A 1TYTA 5C3JA 1CHUA 2YG5A 2RGOA 3K7MX 4TM3A 3AXBA 5U1OA 3SXIA 4H4WA 1BGNA 2C75A 3MMOA 1JRYA 1B8SA 1GEUA 4A65A 4APNA 4JY3A 2E1MA 4YTPA 3UTEA 1VG9A 2YAUA 1BKWA 4G9KA 2C73A 4U8IA 4YSXA 4GUVA 4U2LA 2BC1A 1YQ3A 3H4KA 3PS9A 1TDOA 3H8LA 4H50A 1JRZA 4Y4MA 3C4AA 4XXGA 4AP3A 4BJYA 4BK3A 1IUXA 5C2TA 4BK1A 1Y0PA 2XVJA 4A99A 1GV4A 4A79A 2YG4A 1CC6A 3AD8B 4ADWA 2BK5A 2GMJA 2C3DA 2GAHB 2Q0LA 2VQBA 4EIPA 4EQSA 3UKLA 4II2A 5IQ1A 1NPXA 1UKVG 2FBWA 2V5ZA 2APGA 2XLPA 3COXA 2WBAA 2BK3A 2YLZA 1BVBA 5IQ4A 2E80A 2R9ZA 2B76A 4U8LA 2V61A 4C3YA 1NHQA 2FJEA 2BS3A 1FOHA 1IUVA 4OPUA 1FS7A 3CIRA 2NVKX 3EF6A 4H4QA 5EOWA 2GV8A 2VRMA 3CPHG 4Z43A 4C5OA 4II3A 2CVJA 1AOGA 1ONFA 1Y56B 2F5ZA 3UKPA 2YR6A 3FMWA 4REKA 2R46A 2GR0A 5LV9A 4G73A 3T37A 5EB4A 2C66A 2GRTA 4LA1A 4UDPA 3V3OA 3DJGX 4FX9A 2JBVA 3P4QA 2FJDA 2XVFA 3DJJA 4M52A 2J7AA 1ZMCA 2WDRA 5FS7A 1PHHA 3CN8A 2WP6A 3DJEA 1QDBA 1GERA 4B63A 3GDNA 1SP3A 1OJ9A 3SZ0A 4H7UA 2GEWA 4U8JA 3ICSA 1IUSA 4EM4A 5KVHA 3VQRA 5KMQA 2X8CA 1M1RA 3ZYXA 4EM3A 2OALA 4U8OA 2R0PA 3I3LA 2C3CA 1M6IA 4GDPA 3AYIA 1E39A 3D1IA 3QSMA 3NYFA 4NTDA 2WDVA 3EAOA 1GRGA 2RABA 4OPLA 3UCLA 3H8IA 1QO8A 2JAEA 4Q1OA 1IUUA 2BXSA 1MO9A 2V6OA 3G5SA 3RKHA 1OJDA 2JK6A 3GWFA 4KPRA 2GR3A 3CMMA 1OAHA 3HYWA 2JB2A 2WP5A 4BK2A 2YVJA 3UP4A 1PXCA 2GH5A 4E0VA 2I0ZA 3UKAA 4NTCA 2E5VA 3P4SA 2K3VA 4EMJA 5M10A 2JB3A 3AE5A 3CNTA 4UP3A 4IA6A 4OPDA 1P2HA 2VR0A 4H4UA 2X8GA 5KRQA 1D4EA 1D7LA 5FS8A 2ZO5A 2EQ9A 4UDRA 1TDEA 5KNLA 1ZX9A 2XCGA 3CNSA 5KXJA 3GYJA 3REDA 3SXQA 1XPQA 3KVEA 5KWFA 3CPJG 4CCRA 2EQ6A 3V76A 3CGEA 5KOWA 4A6NA 4IVOB 3B3RA 2IVDA 1PBEA 1YKJA 3II4A 5GRTA 4AOXA 1D5TA 4DSHA 5U25A 3UP5A 2R4JA 1GRFA 1NENA 1TDNA 2EQ7A 3QJ4A 4RSLA 4Z25A 4FDCB 2Q7VA 3AEBA 2YVFA 3BNGA 3CNJA 2GQWA 3LOVA 1ZP0A 1O94A 3GSIA 1JRXA 4L3ZA 1L9DA 3O0HA 3CGCA 3AEEA 4OPIA 3VRAA 1KNRA 3NGCX 1TDKA 2R45A 2BC0A 4H4ZA 1EL8A 1FECA 3UOYA 3UU9A 1NHSA 1OJCA 3NNEA 1GT8A 3P9UA 3S61A 1GRHA 1Z6LA 2VVLG 2XLSA 3AECA 3DK9A 4D04A 4TLXA 1CL0A 4LU6A 2TMDA 3CGDA 4N9XA 1B5QA 5CQFA 4TM1A 1LJ1A 1E1KA 2RGHA 3FIMB 4J2WA 2WPEA 3VRBA 1KSSA 5KOXA 3F29A 1PBFA 1FL2A 3AE3A 2XLUA 3CGBA 4NEWA 1CJ2A 1Q9IA 1VRQB 3K30A 1M64A 2O9ZA 2WDQA 4XWRA 4DNAA 2C65A 2V3AA 3AD7B 1CF3A 2CFYA 1S3EA 3M13A 3QSSA 2ZZCA 4MJWA 2E81A 4WJYA 3GM6A 4EMWA 4L38A 5TR3A 3QFAA 2BCPA 3K7QX 3R9UA 2FJBA 4H4VA 4JDRA 1H6VA 1TRBA 4U8KA 5J60A 4USRA 4H2RA 4GCMA 1SEZA 2ZZBA 4CNKA 3GMBA 3L8KA 1GESA 1IUWA 1PN0A 2C4CA 2YM2A 2XVHA 4OPGA 1GPEA 1F6MA 4YTMA 2V3BA 1GALA 3B6DA 3NTAA 3AE8A 4A9WA 4NNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KA7 A;  4TLZ A;  4C3X A;  3LJP A;  4LII A;  4DGK A;  2NPX A;  5GSN A;  3E1T A;  1D4C A;  2YLR A;  2C7G A;  1QJD A;  1EBD A;  1LQU A;  4ZN0 A;  3BI5 A;  5BVA A;  1KFY A;  1GTH A;  3GWD A;  1VG0 A;  2BAC A;  2QCU A;  1DOB A;  4B65 A;  3M12 A;  1IUT A;  3SM8 A;  2R0G A;  4Q5B A;  4U2T A;  1PJ6 A;  4ECH A;  3DA1 A;  4C74 A;  1LV0 A;  2QA2 A;  4K7Z A;  3NRN A;  4GR1 A;  1CJ3 A;  1YQZ A;  3Q9T A;  3Q6J A;  4X9M A;  2PHH A;  2A89 A;  2GB0 A;  4GRT A;  1MXT A;  3DME A;  3AYL A;  2WES A;  3GD3 A;  1F8W A;  1EL5 A;  3GMC A;  1GTE A;  1KF6 A;  4J31 A;  3URH A;  5HY5 A;  3GYX A;  2X99 A;  1DNC A;  4RG4 A;  1XDI A;  3RP8 A;  2QA1 A;  3AE9 A;  5HXI A;  2XVI A;  3NG7 X;  2OLO A;  4O5U A;  3ALL A;  1M1Q A;  2ZZ0 A;  1RP0 A;  2WS3 A;  4EQW A;  2CUL A;  3ALM A;  3JSK A;  3NK2 X;  5JCK A;  3NN6 X;  1TDF A;  3BNF A;  2WOV A;  2ZBW A;  3RHA A;  3PO7 A;  3UKK A;  1MOK A;  1L9C A;  1NAA A;  2EQ8 A;  3NTD A;  4PAA A;  3IC9 A;  2JKC A;  3OZ2 A;  3NKS A;  1KDG A;  4PAB A;  2ACZ A;  3IHM A;  4H4T A;  4OVI A;  1F3P A;  1JU2 A;  1CJC A;  4K5S A;  1BF3 A;  5BRT A;  4ICY A;  2QAE A;  4ZCC A;  3AED A;  2TPR A;  3BI2 A;  3GRS A;  4I59 A;  1CBO A;  1V59 A;  3ABV A;  2H88 A;  2Z5Y A;  3DK8 A;  1DOD A;  4YKF A;  3LZW A;  3UKH A;  1K0I A;  1PBD A;  4H2P A;  3AEF A;  3AE7 A;  3DGZ A;  3KD9 A;  4H4Y A;  1KNP A;  4J34 A;  5JCN A;  5JCI A;  1FCD A;  2XYO A;  4X4J A;  1D4D A;  1NG3 A;  1FS8 A;  4Z44 A;  4FK1 A;  2GMH A;  1ZDL A;  3D1C A;  2BAB A;  3IWA A;  2BXR A;  2XFN A;  3DJD A;  3RP7 A;  4C77 A;  2WPC A;  4H4R A;  4O5Q A;  4D03 A;  1RSG A;  2GAG B;  2C64 A;  4AT0 A;  4ZCD A;  2R4E A;  1LPF A;  1DJN A;  3V3N A;  1ZOY A;  4H4S A;  1JNI A;  2VRL A;  5KVI A;  3UTF A;  2AAQ A;  1GRT A;  5CKU A;  2E4G A;  2Y6Q A;  5JCM A;  1E1L A;  3UKQ A;  2XFP A;  1E1M A;  4HB9 A;  3UKF A;  3HZL A;  1E6E A;  2XLR A;  2C70 A;  1GRA A;  2WOI A;  4YSY A;  1VQW A;  2X50 A;  3ITJ A;  2YG7 A;  3VRD B;  2YLW A;  2JB1 A;  3QVP A;  2ARD A;  1BZL A;  3AEA A;  2C72 A;  4Z26 A;  3CND A;  3EPT A;  4H4X A;  1N4U A;  5BUL A;  2GR1 A;  1FS9 A;  1COY A;  3CPI G;  2AR8 A;  2WP9 A;  4IVM B;  1ZKQ A;  4Z2T A;  4Z2U A;  1W4X A;  2BS4 A;  2YR4 A;  3TTB A;  3F8D A;  4Q0T A;  1N4V A;  2B9Y A;  4K5R A;  4CBQ A;  5ER0 A;  4AP1 A;  2R0C A;  2VVL A;  2YM1 A;  4YT0 A;  1KSU A;  1ZOV A;  4B64 A;  1FT6 A;  2J3N A;  3AEG A;  3NH3 X;  2Q6U A;  1FT5 A;  1PBB A;  2BK4 A;  1H84 A;  2YLS A;  1L0V A;  4BUR A;  4JQ9 A;  3P4P A;  2OA1 A;  1Y56 A;  3KPF A;  4BV6 A;  1PXB A;  3P4R A;  1LTX R;  3K7T A;  1GXF A;  1REO A;  4P9S A;  1PDH A;  4AOS A;  3SFD A;  2X3N A;  2VOU A;  1LQT A;  1PXA A;  1NDA A;  2VVM A;  2BA9 A;  3G5Q A;  5FS6 A;  3QSE A;  1X31 B;  3SFE A;  4NTE A;  3GRT A;  2IID A;  5HHF A;  1TYP A;  3QVR A;  2YQU A;  1CC4 A;  2CDU A;  1S2Q A;  2LFC A;  3D8X A;  4K8D A;  3UTH A;  2BCG G;  2B9W A;  4EIQ A;  3ADA B;  4X9N A;  1H83 A;  1N1P A;  4NEV A;  4CCQ A;  5JCL A;  4K22 A;  1FEA A;  4YTN A;  3GDP A;  1ELI A;  4RG3 A;  3WE0 A;  3SQP A;  1DJQ A;  4OCG A;  3AYJ A;  1JNZ A;  1GRB A;  3OC4 A;  2YWL A;  1GSN A;  5M0Z A;  1YY5 A;  1XAN A;  4Q17 A;  3ICT A;  2WQY A;  3OWM A;  1E1N A;  4A6N B;  4A7A A;  4CY6 A;  1NG4 A;  1OJT A;  1Q1W A;  4H2Q A;  1BWC A;  2VQ7 A;  1HYU A;  2A87 A;  4U8M A;  4DSG A;  3C96 A;  1DOC A;  2C76 A;  4Z24 A;  4B66 A;  4OPT A;  1XHC A;  3LZX A;  2BS2 A;  3FPZ A;  3G5R A;  5EB5 A;  4L3Y A;  1E7P A;  1PJ7 A;  1N4W A;  1ZK7 A;  1JEH A;  3VR9 A;  5L46 A;  2GQF A;  1GOS A;  3ICR A;  3SGL A;  4Y4L A;  4I58 A;  5J7X A;  3P1W A;  5DBJ A;  1B4V A;  5FS9 A;  2GF3 A;  1NEK A;  3UBR A;  1O95 A;  3VR8 A;  5IPY A;  2AQJ A;  2XFQ A;  2XVE A;  2YG3 A;  1EL7 A;  1K0L A;  3QFB A;  3UTG A;  3ATR A;  3DH9 A;  4GDE A;  4EQR A;  3ALJ A;  4BJZ A;  4UDQ A;  1H82 A;  2WU2 A;  1M1P A;  2B7R A;  4A5L A;  4J33 A;  2YG6 A;  4IV9 A;  3LG1 A;  4TM4 A;  1CC2 A;  2XFU A;  4J36 A;  3KKJ A;  3NT6 A;  3SCE A;  3NLC A;  4B67 A;  2A8X A;  1PS9 A;  3AB1 A;  1JOA A;  4XWZ A;  3CTY A;  3NHO X;  1GRE A;  4CY8 A;  1ZY8 A;  1S2Y A;  2WPF A;  2WHD A;  3AE4 A;  4YWO A;  1PBC A;  3UOZ A;  4USQ A;  3C4N A;  1OJA A;  1EL9 A;  3BHF A;  1NHP A;  3LXD A;  2IVE A;  1IJH A;  3LAD A;  2WU5 A;  1FEB A;  1GU6 A;  3BHK A;  3IF9 A;  1O5W A;  1Q1R A;  3F8P A;  4YSH A;  2H89 A;  4U2S A;  3KU9 A;  2RGJ A;  4J56 A;  3GD4 A;  2Z5X A;  2YLT A;  3LB8 A;  2GR2 A;  3AWI A;  1B37 A;  1F8R A;  3NIX A;  4B68 A;  3ZDN A;  1RYI A;  3NK0 X;  3BNM A;  3DGH A;  3FO3 A;  1H81 A;  4IA5 A;  1S3B A;  2XFO A;  3F8R A;  1L9E A;  4K2X A;  2DKI A;  1GND A;  5BUK A;  1GET A;  2V60 A;  2YR5 A;  3CNP A;  1H7W A;  3RP6 A;  3AE1 A;  3ISH A;  4B1B A;  4CNJ A;  3AE6 A;  3L1R A;  1ZMD A;  1PJ5 A;  3BI4 A;  4JNA A;  3NN0 X;  3KLJ A;  4Q4U A;  1NHR A;  2XLT A;  1P2E A;  2OT4 A;  3BNH A;  3AD9 B;  1LVL A;  4WX1 A;  3AE2 A;  3DK4 A;  4TM0 A;  3TOR A;  4YKG A;  4YXD A;  2B7S A;  1H86 A;  2UZZ A;  3LGQ A;  4H2N A;  2XDO A;  1K4Q A;  1H7X A;  3FG2 P;  4EMI A;  4Q5C A;  1DOE A;  1VDC A;  2YVG A;  3RNM A;  3BNU A;  2GVC A;  1JNR A;  2PYX A;  1F8S A;  2DKH A;  3NYC A;  2RF7 A;  1DXL A;  5HYM A;  4U8N A;  2OAM A;  3PVC A;  4U8P A;  4Z2R A;  4GF7 A;  4KX6 A;  5EBK A;  3NK1 X;  4EQX A;  3EAN A;  4HA6 A;  2OLN A;  5FMH A;  3BNJ A;  2X8H A;  2FJA A;  4CRT A;  4JNQ A;  4OPC A;  2WEU A;  4AT2 A;  2RDZ A;  1K0J A;  2WET A;  4NZH A;  4Y4N A;  1QLB A;  3I6D A;  2Y6R A;  5U63 A;  3GYI A;  2YLX A;  3UOX A;  2VZ2 A;  3S7W A;  3M0O A;  3L1T A;  1YQ4 A;  2Q0K A;  2W0H A;  4FK1 C;  4B69 A;  4JN9 A;  4J57 A;  2BYB A;  3IHG A;  4YSZ A;  2HQM A;  3UOV A;  4H4P A;  2B9X A;  1BGJ A;  4JY2 A;  4WCT A;  3S5W A;  3FBS A;  4L3X A;  1D7Y A;  2C67 A;  3NYE A;  3ATQ A;  2WOW A;  1CJ4 A;  1TYT A;  5C3J A;  1CHU A;  2YG5 A;  2RGO A;  3K7M X;  4TM3 A;  3AXB A;  5U1O A;  4H4W A;  1BGN A;  2C75 A;  3MMO A;  1JRY A;  1B8S A;  1GEU A;  4A65 A;  4APN A;  4JY3 A;  2E1M A;  4YTP A;  3UTE A;  1VG9 A;  2YAU A;  1BKW A;  4U8I A;  2C73 A;  4YSX A;  4GUV A;  4U2L A;  2BC1 A;  1YQ3 A;  3H4K A;  3PS9 A;  1TDO A;  3H8L A;  4H50 A;  1JRZ A;  4Y4M A;  3C4A A;  4XXG A;  4AP3 A;  4BJY A;  4BK3 A;  1IUX A;  5C2T A;  4BK1 A;  1Y0P A;  2XVJ A;  4A99 A;  1GV4 A;  4A79 A;  2YG4 A;  1CC6 A;  3AD8 B;  4ADW A;  2BK5 A;  2GMJ A;  2C3D A;  2GAH B;  2Q0L A;  2VQB A;  4EIP A;  4EQS A;  3UKL A;  5IQ1 A;  1NPX A;  1UKV G;  2FBW A;  2V5Z A;  2APG A;  2XLP A;  3COX A;  2WBA A;  2BK3 A;  2YLZ A;  1BVB A;  5IQ4 A;  2E80 A;  2R9Z A;  2B76 A;  4U8L A;  2V61 A;  4C3Y A;  1NHQ A;  2FJE A;  2BS3 A;  1FOH A;  1IUV A;  4OPU A;  1FS7 A;  3CIR A;  2NVK X;  3EF6 A;  4H4Q A;  5EOW A;  2GV8 A;  2VRM A;  3CPH G;  4Z43 A;  4C5O A;  2CVJ A;  1AOG A;  1ONF A;  1Y56 B;  2F5Z A;  3UKP A;  2YR6 A;  3FMW A;  4REK A;  2R46 A;  2GR0 A;  5LV9 A;  3T37 A;  5EB4 A;  2C66 A;  2GRT A;  4LA1 A;  4UDP A;  3V3O A;  3DJG X;  4FX9 A;  2JBV A;  3P4Q A;  2FJD A;  2XVF A;  3DJJ A;  4M52 A;  2J7A A;  1ZMC A;  2WDR A;  5FS7 A;  1PHH A;  3CN8 A;  2WP6 A;  3DJE A;  1QDB A;  1GER A;  4B63 A;  3GDN A;  1SP3 A;  1OJ9 A;  4H7U A;  2GEW A;  4U8J A;  3ICS A;  1IUS A;  4EM4 A;  5KVH A;  3VQR A;  2X8C A;  1M1R A;  3ZYX A;  4EM3 A;  2OAL A;  4U8O A;  2R0P A;  3I3L A;  2C3C A;  1M6I A;  4GDP A;  3AYI A;  1E39 A;  3D1I A;  3QSM A;  3NYF A;  4NTD A;  2WDV A;  3EAO A;  1GRG A;  2RAB A;  4OPL A;  3UCL A;  3H8I A;  1QO8 A;  2JAE A;  4Q1O A;  1IUU A;  2BXS A;  1MO9 A;  2V6O A;  3G5S A;  3RKH A;  1OJD A;  2JK6 A;  3GWF A;  4KPR A;  2GR3 A;  1OAH A;  2JB2 A;  2WP5 A;  4BK2 A;  2YVJ A;  3UP4 A;  1PXC A;  2GH5 A;  4E0V A;  2I0Z A;  3UKA A;  4NTC A;  2E5V A;  3P4S A;  2K3V A;  4EMJ A;  5M10 A;  2JB3 A;  3AE5 A;  3CNT A;  4UP3 A;  4IA6 A;  4OPD A;  1P2H A;  2VR0 A;  4H4U A;  2X8G A;  5KRQ A;  1D4E A;  1D7L A;  5FS8 A;  2ZO5 A;  2EQ9 A;  4UDR A;  1TDE A;  1ZX9 A;  2XCG A;  3CNS A;  5KXJ A;  3GYJ A;  3RED A;  3SXQ A;  1XPQ A;  3KVE A;  5KWF A;  3CPJ G;  4CCR A;  2EQ6 A;  3V76 A;  3CGE A;  5KOW A;  4A6N A;  4IVO B;  3B3R A;  2IVD A;  1PBE A;  1YKJ A;  3II4 A;  5GRT A;  4AOX A;  1D5T A;  4DSH A;  5U25 A;  3UP5 A;  2R4J A;  1GRF A;  1NEN A;  1TDN A;  2EQ7 A;  3QJ4 A;  4RSL A;  4Z25 A;  4FDC B;  2Q7V A;  3AEB A;  2YVF A;  3BNG A;  3CNJ A;  2GQW A;  3LOV A;  1ZP0 A;  1O94 A;  3GSI A;  1JRX A;  4L3Z A;  1L9D A;  3O0H A;  3CGC A;  3AEE A;  4OPI A;  3VRA A;  1KNR A;  3NGC X;  1TDK A;  2R45 A;  2BC0 A;  4H4Z A;  1EL8 A;  1FEC A;  3UOY A;  3UU9 A;  1NHS A;  1OJC A;  3NNE A;  1GT8 A;  3P9U A;  3S61 A;  1GRH A;  1Z6L A;  2VVL G;  2XLS A;  3AEC A;  3DK9 A;  4D04 A;  4TLX A;  1CL0 A;  4LU6 A;  2TMD A;  3CGD A;  4N9X A;  1B5Q A;  5CQF A;  4TM1 A;  1LJ1 A;  1E1K A;  2RGH A;  3FIM B;  4J2W A;  2WPE A;  3VRB A;  1KSS A;  5KOX A;  3F29 A;  1PBF A;  1FL2 A;  3AE3 A;  2XLU A;  3CGB A;  4NEW A;  1CJ2 A;  1Q9I A;  1VRQ B;  3K30 A;  1M64 A;  2O9Z A;  2WDQ A;  4XWR A;  4DNA A;  2C65 A;  2V3A A;  3AD7 B;  1CF3 A;  2CFY A;  1S3E A;  3M13 A;  3QSS A;  2ZZC A;  4MJW A;  2E81 A;  4WJY A;  3GM6 A;  4EMW A;  4L38 A;  5TR3 A;  3QFA A;  2BCP A;  3K7Q X;  3R9U A;  2FJB A;  4H4V A;  4JDR A;  1H6V A;  1TRB A;  4U8K A;  5J60 A;  4USR A;  4H2R A;  4GCM A;  1SEZ A;  2ZZB A;  4CNK A;  3GMB A;  3L8K A;  1GES A;  1IUW A;  1PN0 A;  2YM2 A;  2XVH A;  4OPG A;  1GPE A;  1F6M A;  4YTM A;  2V3B A;  1GAL A;  3B6D A;  3NTA A;  3AE8 A;  4A9W A; 
#chains in the Genus database with same CATH topology
 3KA7 A;  4TLZ A;  4C3X A;  3LJP A;  4LII A;  4DGK A;  2NPX A;  5GSN A;  3E1T A;  1D4C A;  2YLR A;  2C7G A;  1QJD A;  1EBD A;  1LQU A;  4ZN0 A;  3BI5 A;  5BVA A;  1KFY A;  1GTH A;  3GWD A;  1VG0 A;  2BAC A;  2QCU A;  1DOB A;  4B65 A;  3M12 A;  1IUT A;  3SM8 A;  2R0G A;  4Q5B A;  4U2T A;  1PJ6 A;  4ECH A;  3DA1 A;  4C74 A;  1LV0 A;  2QA2 A;  4K7Z A;  3NRN A;  4GR1 A;  1CJ3 A;  1YQZ A;  3Q9T A;  3Q6J A;  4X9M A;  2PHH A;  2A89 A;  2GB0 A;  4GRT A;  1MXT A;  3DME A;  3AYL A;  2WES A;  3GD3 A;  1F8W A;  1EL5 A;  3GMC A;  1GTE A;  1KF6 A;  4J31 A;  3URH A;  5HY5 A;  3GYX A;  2X99 A;  1DNC A;  4RG4 A;  5KMS A;  1XDI A;  3RP8 A;  2QA1 A;  3AE9 A;  5HXI A;  2XVI A;  3NG7 X;  2OLO A;  4O5U A;  3ALL A;  1M1Q A;  2ZZ0 A;  1RP0 A;  2WS3 A;  4EQW A;  2CUL A;  3ALM A;  3JSK A;  3NK2 X;  5JCK A;  3SYI A;  3NN6 X;  1TDF A;  3BNF A;  2WOV A;  2ZBW A;  3RHA A;  3PO7 A;  3UKK A;  1MOK A;  1L9C A;  1NAA A;  2EQ8 A;  3NTD A;  4PAA A;  3IC9 A;  2JKC A;  3OZ2 A;  3NKS A;  1KDG A;  4PAB A;  2ACZ A;  3IHM A;  4H4T A;  4OVI A;  1F3P A;  1JU2 A;  1CJC A;  4K5S A;  1BF3 A;  5BRT A;  4ICY A;  2QAE A;  4ZCC A;  3AED A;  2TPR A;  3BI2 A;  3GRS A;  4I59 A;  1CBO A;  1V59 A;  3KPK A;  3ABV A;  2H88 A;  2Z5Y A;  3DK8 A;  1DOD A;  4YKF A;  3LZW A;  3UKH A;  1K0I A;  1PBD A;  4H2P A;  3AEF A;  3AE7 A;  3DGZ A;  3KD9 A;  4H4Y A;  1KNP A;  4J34 A;  5JCN A;  5JCI A;  1FCD A;  2XYO A;  4X4J A;  1D4D A;  1NG3 A;  1FS8 A;  4Z44 A;  4FK1 A;  2GMH A;  1ZDL A;  3D1C A;  2BAB A;  3IWA A;  2BXR A;  3SZF A;  2XFN A;  3DJD A;  3RP7 A;  4C77 A;  2WPC A;  4H4R A;  4O5Q A;  4D03 A;  1RSG A;  2GAG B;  2C64 A;  3T31 A;  4AT0 A;  4ZCD A;  2R4E A;  1LPF A;  1DJN A;  3V3N A;  1ZOY A;  4H4S A;  1JNI A;  2VRL A;  5KVI A;  3UTF A;  2AAQ A;  1GRT A;  5CKU A;  2E4G A;  2Y6Q A;  5JCM A;  1E1L A;  3UKQ A;  2XFP A;  1E1M A;  4HB9 A;  3UKF A;  3HZL A;  1E6E A;  2XLR A;  2C70 A;  1GRA A;  2WOI A;  4YSY A;  1VQW A;  2X50 A;  3ITJ A;  2YG7 A;  3VRD B;  2YLW A;  2JB1 A;  3QVP A;  2ARD A;  1BZL A;  3AEA A;  2C72 A;  4Z26 A;  3CND A;  3EPT A;  4H4X A;  1N4U A;  5BUL A;  2GR1 A;  1FS9 A;  1COY A;  3CPI G;  2AR8 A;  2WP9 A;  4IVM B;  1ZKQ A;  4Z2T A;  4Z2U A;  1W4X A;  2BS4 A;  2YR4 A;  3TTB A;  3F8D A;  4Q0T A;  1N4V A;  2B9Y A;  4K5R A;  4CBQ A;  5ER0 A;  4AP1 A;  2R0C A;  2VVL A;  2YM1 A;  4YT0 A;  1KSU A;  1ZOV A;  4B64 A;  1FT6 A;  2J3N A;  3AEG A;  3NH3 X;  2Q6U A;  1FT5 A;  1PBB A;  2BK4 A;  1H84 A;  2YLS A;  1L0V A;  4BUR A;  4JQ9 A;  3P4P A;  2OA1 A;  1Y56 A;  3KPF A;  3SZW A;  4BV6 A;  1PXB A;  3P4R A;  1LTX R;  3K7T A;  1GXF A;  1REO A;  4P9S A;  1PDH A;  4AOS A;  3SFD A;  2X3N A;  2VOU A;  1LQT A;  1PXA A;  1NDA A;  2VVM A;  2BA9 A;  3G5Q A;  5FS6 A;  3QSE A;  1X31 B;  3SFE A;  4NTE A;  3GRT A;  2IID A;  5HHF A;  1TYP A;  3QVR A;  3T2Y A;  2YQU A;  1CC4 A;  2CDU A;  3T0K A;  1S2Q A;  2LFC A;  3D8X A;  4K8D A;  3UTH A;  2BCG G;  2B9W A;  4EIQ A;  3ADA B;  4X9N A;  1H83 A;  1N1P A;  4NEV A;  4CCQ A;  5JCL A;  4K22 A;  1FEA A;  4YTN A;  3GDP A;  1ELI A;  4RG3 A;  3WE0 A;  3SQP A;  1DJQ A;  4OCG A;  3AYJ A;  1JNZ A;  1GRB A;  3OC4 A;  4GAP A;  2YWL A;  1GSN A;  5M0Z A;  4CY6 A;  1YY5 A;  1XAN A;  4Q17 A;  3HYX A;  2WQY A;  3OWM A;  1E1N A;  3ICT A;  4G74 A;  4A6N B;  1NG4 A;  1OJT A;  1Q1W A;  4H2Q A;  1BWC A;  2VQ7 A;  1HYU A;  2A87 A;  4U8M A;  4DSG A;  3C96 A;  1DOC A;  2C76 A;  4Z24 A;  4B66 A;  4OPT A;  1XHC A;  3LZX A;  2BS2 A;  3FPZ A;  5KMR A;  3G5R A;  5EB5 A;  4L3Y A;  1E7P A;  1PJ7 A;  1N4W A;  5HYM A;  1ZK7 A;  1JEH A;  3VR9 A;  3T2K A;  5L46 A;  2GQF A;  1GOS A;  3ICR A;  4G6H A;  3SGL A;  4Y4L A;  4I58 A;  5J7X A;  3P1W A;  5DBJ A;  1B4V A;  3T14 A;  5FS9 A;  2GF3 A;  1NEK A;  3UBR A;  1O95 A;  3VR8 A;  5IPY A;  2AQJ A;  2XFQ A;  2XVE A;  2YG3 A;  1EL7 A;  1K0L A;  3QFB A;  3UTG A;  3ATR A;  3DH9 A;  4GDE A;  4EQR A;  3ALJ A;  4BJZ A;  4UDQ A;  1H82 A;  2WU2 A;  1M1P A;  2B7R A;  4A5L A;  4J33 A;  2YG6 A;  4IV9 A;  3LG1 A;  4TM4 A;  1CC2 A;  2XFU A;  4J36 A;  3KKJ A;  3NT6 A;  3SCE A;  3NLC A;  4B67 A;  2A8X A;  5KMP A;  1PS9 A;  3AB1 A;  1JOA A;  4XWZ A;  3CTY A;  3NHO X;  1GRE A;  4CY8 A;  1ZY8 A;  1S2Y A;  2WPF A;  2WHD A;  3AE4 A;  4YWO A;  4G6G A;  1PBC A;  3UOZ A;  4USQ A;  3C4N A;  3T2Z A;  1OJA A;  1EL9 A;  3BHF A;  1NHP A;  3LXD A;  2IVE A;  1IJH A;  3LAD A;  2WU5 A;  1FEB A;  3SX6 A;  1GU6 A;  3BHK A;  3IF9 A;  1O5W A;  1Q1R A;  3F8P A;  4YSH A;  2H89 A;  4U2S A;  3KU9 A;  2RGJ A;  4J56 A;  3GD4 A;  2BRA A;  2Z5X A;  2YLT A;  3LB8 A;  2GR2 A;  3AWI A;  1B37 A;  1F8R A;  3NIX A;  4B68 A;  3ZDN A;  1RYI A;  3NK0 X;  3BNM A;  3DGH A;  3FO3 A;  1H81 A;  4A7A A;  4IA5 A;  1S3B A;  2XFO A;  3F8R A;  1L9E A;  4K2X A;  2DKI A;  1GND A;  5BUK A;  1GET A;  2V60 A;  2YR5 A;  3CNP A;  1H7W A;  3RP6 A;  3AE1 A;  3ISH A;  4B1B A;  4CNJ A;  3AE6 A;  3L1R A;  1ZMD A;  1PJ5 A;  3BI4 A;  4JNA A;  3NN0 X;  3KLJ A;  4Q4U A;  1NHR A;  2XLT A;  1P2E A;  2OT4 A;  3BNH A;  3AD9 B;  1LVL A;  4WX1 A;  3AE2 A;  3DK4 A;  4TM0 A;  3TOR A;  4YKG A;  4YXD A;  2B7S A;  1H86 A;  2UZZ A;  4NWZ A;  3LGQ A;  4H2N A;  2XDO A;  1K4Q A;  1H7X A;  3FG2 P;  4GAV A;  4EMI A;  4Q5C A;  1DOE A;  1VDC A;  2YVG A;  3RNM A;  3BNU A;  2BRY A;  1JNR A;  2GVC A;  1F8S A;  2DKH A;  2PYX A;  2RF7 A;  1DXL A;  3NYC A;  4U8N A;  2OAM A;  3PVC A;  4U8P A;  4Z2R A;  4GF7 A;  4KX6 A;  5EBK A;  3NK1 X;  4EQX A;  3EAN A;  4HA6 A;  2OLN A;  5FMH A;  3BNJ A;  2X8H A;  2FJA A;  4CRT A;  4JNQ A;  4OPC A;  2WEU A;  4AT2 A;  2RDZ A;  1K0J A;  2WET A;  4NZH A;  4Y4N A;  1QLB A;  3I6D A;  2Y6R A;  5U63 A;  3GYI A;  2YLX A;  3UOX A;  2VZ2 A;  3S7W A;  3M0O A;  3L1T A;  1YQ4 A;  2Q0K A;  2W0H A;  4FK1 C;  3SZC A;  4B69 A;  3SY4 A;  4JN9 A;  4J57 A;  2BYB A;  3IHG A;  4YSZ A;  2HQM A;  3UOV A;  4H4P A;  2B9X A;  1BGJ A;  4JY2 A;  4WCT A;  3S5W A;  3FBS A;  3HYV A;  4L3X A;  1D7Y A;  2C67 A;  3NYE A;  3ATQ A;  2WOW A;  1CJ4 A;  1TYT A;  5C3J A;  1CHU A;  2YG5 A;  2RGO A;  3K7M X;  4TM3 A;  3AXB A;  5U1O A;  3SXI A;  4H4W A;  1BGN A;  2C75 A;  3MMO A;  1JRY A;  1B8S A;  1GEU A;  4A65 A;  4APN A;  4JY3 A;  2E1M A;  4YTP A;  3UTE A;  1VG9 A;  2YAU A;  1BKW A;  4G9K A;  2C73 A;  4U8I A;  4YSX A;  4GUV A;  4U2L A;  2BC1 A;  1YQ3 A;  3H4K A;  3PS9 A;  1TDO A;  3H8L A;  4H50 A;  1JRZ A;  4Y4M A;  3C4A A;  4XXG A;  4AP3 A;  4BJY A;  4BK3 A;  1IUX A;  5C2T A;  4BK1 A;  1Y0P A;  2XVJ A;  4A99 A;  1GV4 A;  4A79 A;  2YG4 A;  1CC6 A;  3AD8 B;  4ADW A;  2BK5 A;  2GMJ A;  2C3D A;  2GAH B;  2Q0L A;  2VQB A;  4EIP A;  4EQS A;  3UKL A;  4II2 A;  5IQ1 A;  1NPX A;  1UKV G;  2FBW A;  2V5Z A;  2APG A;  2XLP A;  3COX A;  2WBA A;  2BK3 A;  2YLZ A;  1BVB A;  5IQ4 A;  2E80 A;  2R9Z A;  2B76 A;  4U8L A;  2V61 A;  4C3Y A;  1NHQ A;  2FJE A;  2BS3 A;  1FOH A;  1IUV A;  4OPU A;  1FS7 A;  3CIR A;  2NVK X;  3EF6 A;  4H4Q A;  5EOW A;  2GV8 A;  2VRM A;  3CPH G;  4Z43 A;  4C5O A;  4II3 A;  2CVJ A;  1AOG A;  1ONF A;  1Y56 B;  2F5Z A;  3UKP A;  2YR6 A;  3FMW A;  4REK A;  2R46 A;  2GR0 A;  5LV9 A;  4G73 A;  3T37 A;  5EB4 A;  2C66 A;  2GRT A;  4LA1 A;  4UDP A;  3V3O A;  3DJG X;  4FX9 A;  2JBV A;  3P4Q A;  2FJD A;  2XVF A;  3DJJ A;  4M52 A;  2J7A A;  1ZMC A;  2WDR A;  5FS7 A;  1PHH A;  3CN8 A;  2WP6 A;  3DJE A;  1QDB A;  1GER A;  4B63 A;  3GDN A;  1SP3 A;  1OJ9 A;  3SZ0 A;  4H7U A;  2GEW A;  4U8J A;  2CZS A;  3ICS A;  1IUS A;  4EM4 A;  5KVH A;  3VQR A;  5KMQ A;  2X8C A;  1M1R A;  3ZYX A;  4EM3 A;  2OAL A;  4U8O A;  2R0P A;  3I3L A;  2C3C A;  1M6I A;  4GDP A;  3AYI A;  1E39 A;  3D1I A;  3QSM A;  3NYF A;  4NTD A;  2WDV A;  3EAO A;  1GRG A;  2RAB A;  4OPL A;  3UCL A;  3H8I A;  1QO8 A;  2JAE A;  4Q1O A;  1IUU A;  2BXS A;  1MO9 A;  2V6O A;  3G5S A;  3RKH A;  1OJD A;  2JK6 A;  3GWF A;  4KPR A;  2GR3 A;  3CMM A;  1OAH A;  3HYW A;  2JB2 A;  2WP5 A;  4BK2 A;  2YVJ A;  3UP4 A;  1PXC A;  2GH5 A;  4E0V A;  2I0Z A;  3UKA A;  4NTC A;  2E5V A;  3P4S A;  2K3V A;  4EMJ A;  5M10 A;  2JB3 A;  3AE5 A;  3CNT A;  4UP3 A;  4IA6 A;  4OPD A;  1P2H A;  2VR0 A;  4H4U A;  2X8G A;  5KRQ A;  1D4E A;  1D7L A;  5FS8 A;  2ZO5 A;  2EQ9 A;  4UDR A;  1TDE A;  5KNL A;  1ZX9 A;  2XCG A;  3CNS A;  5KXJ A;  3GYJ A;  3RED A;  3SXQ A;  1XPQ A;  3KVE A;  5KWF A;  3CPJ G;  4CCR A;  2EQ6 A;  3V76 A;  3CGE A;  5KOW A;  4A6N A;  4IVO B;  3B3R A;  2IVD A;  1PBE A;  1YKJ A;  3II4 A;  5GRT A;  4AOX A;  1D5T A;  4DSH A;  5U25 A;  3UP5 A;  2R4J A;  1GRF A;  1NEN A;  1TDN A;  2EQ7 A;  3QJ4 A;  4RSL A;  4Z25 A;  4FDC B;  2Q7V A;  3AEB A;  2YVF A;  3BNG A;  3CNJ A;  2GQW A;  3LOV A;  1ZP0 A;  1O94 A;  3GSI A;  1JRX A;  4L3Z A;  1L9D A;  3O0H A;  3CGC A;  3AEE A;  4OPI A;  3VRA A;  1KNR A;  3NGC X;  1TDK A;  2R45 A;  2BC0 A;  4H4Z A;  1EL8 A;  1FEC A;  3UOY A;  3UU9 A;  1NHS A;  1OJC A;  3NNE A;  1GT8 A;  3P9U A;  3S61 A;  1GRH A;  1Z6L A;  2VVL G;  2XLS A;  3AEC A;  3DK9 A;  4D04 A;  4TLX A;  1CL0 A;  4LU6 A;  2TMD A;  3CGD A;  4N9X A;  1B5Q A;  5CQF A;  4TM1 A;  1LJ1 A;  1E1K A;  2RGH A;  3FIM B;  4J2W A;  2WPE A;  3VRB A;  1KSS A;  5KOX A;  3F29 A;  1PBF A;  1FL2 A;  3AE3 A;  2XLU A;  3CGB A;  4NEW A;  1CJ2 A;  1Q9I A;  1VRQ B;  3K30 A;  1M64 A;  2O9Z A;  2WDQ A;  4XWR A;  4DNA A;  2C65 A;  2V3A A;  3AD7 B;  1CF3 A;  2CFY A;  1S3E A;  3M13 A;  3QSS A;  2ZZC A;  4MJW A;  2E81 A;  4WJY A;  3GM6 A;  4EMW A;  4L38 A;  5TR3 A;  3QFA A;  2BCP A;  3K7Q X;  3R9U A;  2FJB A;  4H4V A;  4JDR A;  1H6V A;  1TRB A;  4U8K A;  5J60 A;  4USR A;  4H2R A;  4GCM A;  1SEZ A;  2ZZB A;  4CNK A;  3GMB A;  3L8K A;  1GES A;  1IUW A;  1PN0 A;  2C4C A;  2YM2 A;  2XVH A;  4OPG A;  1GPE A;  1F6M A;  4YTM A;  2V3B A;  1GAL A;  3B6D A;  3NTA A;  3AE8 A;  4A9W A;  4NNJ A; 
#chains in the Genus database with same CATH homology
 3KA7 A;  4TLZ A;  4C3X A;  3LJP A;  4LII A;  4DGK A;  2NPX A;  5GSN A;  3E1T A;  1D4C A;  2YLR A;  2C7G A;  1QJD A;  1EBD A;  1LQU A;  4ZN0 A;  3BI5 A;  5BVA A;  1KFY A;  1GTH A;  3GWD A;  1VG0 A;  2BAC A;  2QCU A;  1DOB A;  4B65 A;  3M12 A;  1IUT A;  3SM8 A;  2R0G A;  4Q5B A;  4U2T A;  1PJ6 A;  4ECH A;  3DA1 A;  4C74 A;  1LV0 A;  2QA2 A;  4K7Z A;  3NRN A;  4GR1 A;  1CJ3 A;  1YQZ A;  3Q9T A;  3Q6J A;  4X9M A;  2PHH A;  2A89 A;  2GB0 A;  4GRT A;  1MXT A;  3DME A;  3AYL A;  2WES A;  3GD3 A;  1F8W A;  1EL5 A;  3GMC A;  1GTE A;  1KF6 A;  4J31 A;  3URH A;  5HY5 A;  3GYX A;  2X99 A;  1DNC A;  4RG4 A;  5KMS A;  1XDI A;  3RP8 A;  2QA1 A;  3AE9 A;  5HXI A;  2XVI A;  3NG7 X;  2OLO A;  4O5U A;  3ALL A;  1M1Q A;  2ZZ0 A;  1RP0 A;  2WS3 A;  4EQW A;  2CUL A;  3ALM A;  3JSK A;  3NK2 X;  5JCK A;  3SYI A;  3NN6 X;  1TDF A;  3BNF A;  2WOV A;  2ZBW A;  3RHA A;  3PO7 A;  3UKK A;  1MOK A;  1L9C A;  1NAA A;  2EQ8 A;  3NTD A;  4PAA A;  3IC9 A;  2JKC A;  3OZ2 A;  3NKS A;  1KDG A;  4PAB A;  2ACZ A;  3IHM A;  4H4T A;  4OVI A;  1F3P A;  1JU2 A;  1CJC A;  4K5S A;  1BF3 A;  5BRT A;  4ICY A;  2QAE A;  4ZCC A;  3AED A;  2TPR A;  3BI2 A;  3GRS A;  4I59 A;  1CBO A;  1V59 A;  3KPK A;  3ABV A;  2H88 A;  2Z5Y A;  3DK8 A;  1DOD A;  4YKF A;  3LZW A;  3UKH A;  1K0I A;  1PBD A;  4H2P A;  3AEF A;  3AE7 A;  3DGZ A;  3KD9 A;  4H4Y A;  1KNP A;  4J34 A;  5JCN A;  5JCI A;  1FCD A;  2XYO A;  4X4J A;  1D4D A;  1NG3 A;  1FS8 A;  4Z44 A;  4FK1 A;  2GMH A;  1ZDL A;  3D1C A;  2BAB A;  3IWA A;  2BXR A;  3SZF A;  2XFN A;  3DJD A;  3RP7 A;  4C77 A;  2WPC A;  4H4R A;  4O5Q A;  4D03 A;  1RSG A;  2GAG B;  2C64 A;  3T31 A;  4AT0 A;  4ZCD A;  2R4E A;  1LPF A;  1DJN A;  3V3N A;  1ZOY A;  4H4S A;  1JNI A;  2VRL A;  5KVI A;  3UTF A;  2AAQ A;  1GRT A;  5CKU A;  2E4G A;  2Y6Q A;  5JCM A;  1E1L A;  3UKQ A;  2XFP A;  1E1M A;  4HB9 A;  3UKF A;  3HZL A;  1E6E A;  2XLR A;  2C70 A;  1GRA A;  2WOI A;  4YSY A;  1VQW A;  2X50 A;  3ITJ A;  2YG7 A;  3VRD B;  2YLW A;  2JB1 A;  3QVP A;  2ARD A;  1BZL A;  3AEA A;  2C72 A;  4Z26 A;  3CND A;  3EPT A;  4H4X A;  1N4U A;  5BUL A;  2GR1 A;  1FS9 A;  1COY A;  3CPI G;  2AR8 A;  2WP9 A;  4IVM B;  1ZKQ A;  4Z2T A;  4Z2U A;  1W4X A;  2BS4 A;  2YR4 A;  3TTB A;  3F8D A;  4Q0T A;  1N4V A;  2B9Y A;  4K5R A;  4CBQ A;  5ER0 A;  4AP1 A;  2R0C A;  2VVL A;  2YM1 A;  4YT0 A;  1KSU A;  1ZOV A;  4B64 A;  1FT6 A;  2J3N A;  3AEG A;  3NH3 X;  2Q6U A;  1FT5 A;  1PBB A;  2BK4 A;  1H84 A;  2YLS A;  1L0V A;  4BUR A;  4JQ9 A;  3P4P A;  2OA1 A;  1Y56 A;  3KPF A;  3SZW A;  4BV6 A;  1PXB A;  3P4R A;  1LTX R;  3K7T A;  1GXF A;  1REO A;  4P9S A;  1PDH A;  4AOS A;  3SFD A;  2X3N A;  2VOU A;  1LQT A;  1PXA A;  1NDA A;  2VVM A;  2BA9 A;  3G5Q A;  5FS6 A;  3QSE A;  1X31 B;  3SFE A;  4NTE A;  3GRT A;  2IID A;  5HHF A;  1TYP A;  3QVR A;  3T2Y A;  2YQU A;  1CC4 A;  2CDU A;  3T0K A;  1S2Q A;  2LFC A;  3D8X A;  4K8D A;  3UTH A;  2BCG G;  2B9W A;  4EIQ A;  3ADA B;  4X9N A;  1H83 A;  1N1P A;  4NEV A;  4CCQ A;  5JCL A;  4K22 A;  1FEA A;  4YTN A;  3GDP A;  1ELI A;  4RG3 A;  3WE0 A;  3SQP A;  1DJQ A;  4OCG A;  3AYJ A;  1JNZ A;  1GRB A;  3OC4 A;  4GAP A;  2YWL A;  1GSN A;  5M0Z A;  4CY6 A;  1YY5 A;  1XAN A;  4Q17 A;  3HYX A;  2WQY A;  3OWM A;  1E1N A;  3ICT A;  4G74 A;  4A6N B;  1NG4 A;  1OJT A;  1Q1W A;  4H2Q A;  1BWC A;  2VQ7 A;  1HYU A;  2A87 A;  4U8M A;  4DSG A;  3C96 A;  1DOC A;  2C76 A;  4Z24 A;  4B66 A;  4OPT A;  1XHC A;  3LZX A;  2BS2 A;  3FPZ A;  5KMR A;  3G5R A;  5EB5 A;  4L3Y A;  1E7P A;  1PJ7 A;  1N4W A;  5HYM A;  1ZK7 A;  1JEH A;  3VR9 A;  3T2K A;  5L46 A;  2GQF A;  1GOS A;  3ICR A;  4G6H A;  3SGL A;  4Y4L A;  4I58 A;  5J7X A;  3P1W A;  5DBJ A;  1B4V A;  3T14 A;  5FS9 A;  2GF3 A;  1NEK A;  3UBR A;  1O95 A;  3VR8 A;  5IPY A;  2AQJ A;  2XFQ A;  2XVE A;  2YG3 A;  1EL7 A;  1K0L A;  3QFB A;  3UTG A;  3ATR A;  3DH9 A;  4GDE A;  4EQR A;  3ALJ A;  4BJZ A;  4UDQ A;  1H82 A;  2WU2 A;  1M1P A;  2B7R A;  4A5L A;  4J33 A;  2YG6 A;  4IV9 A;  3LG1 A;  4TM4 A;  1CC2 A;  2XFU A;  4J36 A;  3KKJ A;  3NT6 A;  3SCE A;  3NLC A;  4B67 A;  2A8X A;  5KMP A;  1PS9 A;  3AB1 A;  1JOA A;  4XWZ A;  3CTY A;  3NHO X;  1GRE A;  4CY8 A;  1ZY8 A;  1S2Y A;  2WPF A;  2WHD A;  3AE4 A;  4YWO A;  4G6G A;  1PBC A;  3UOZ A;  4USQ A;  3C4N A;  3T2Z A;  1OJA A;  1EL9 A;  3BHF A;  1NHP A;  3LXD A;  2IVE A;  1IJH A;  3LAD A;  2WU5 A;  1FEB A;  3SX6 A;  1GU6 A;  3BHK A;  3IF9 A;  1O5W A;  1Q1R A;  3F8P A;  4YSH A;  2H89 A;  4U2S A;  3KU9 A;  2RGJ A;  4J56 A;  3GD4 A;  2BRA A;  2Z5X A;  2YLT A;  3LB8 A;  2GR2 A;  3AWI A;  1B37 A;  1F8R A;  3NIX A;  4B68 A;  3ZDN A;  1RYI A;  3NK0 X;  3BNM A;  3DGH A;  3FO3 A;  1H81 A;  4A7A A;  4IA5 A;  1S3B A;  2XFO A;  3F8R A;  1L9E A;  4K2X A;  2DKI A;  1GND A;  5BUK A;  1GET A;  2V60 A;  2YR5 A;  3CNP A;  1H7W A;  3RP6 A;  3AE1 A;  3ISH A;  4B1B A;  4CNJ A;  3AE6 A;  3L1R A;  1ZMD A;  1PJ5 A;  3BI4 A;  4JNA A;  3NN0 X;  3KLJ A;  4Q4U A;  1NHR A;  2XLT A;  1P2E A;  2OT4 A;  3BNH A;  3AD9 B;  1LVL A;  4WX1 A;  3AE2 A;  3DK4 A;  4TM0 A;  3TOR A;  4YKG A;  4YXD A;  2B7S A;  1H86 A;  2UZZ A;  4NWZ A;  3LGQ A;  4H2N A;  2XDO A;  1K4Q A;  1H7X A;  3FG2 P;  4GAV A;  4EMI A;  4Q5C A;  1DOE A;  1VDC A;  2YVG A;  3RNM A;  3BNU A;  2BRY A;  1JNR A;  2GVC A;  1F8S A;  2DKH A;  2PYX A;  2RF7 A;  1DXL A;  3NYC A;  4U8N A;  2OAM A;  3PVC A;  4U8P A;  4Z2R A;  4GF7 A;  4KX6 A;  5EBK A;  3NK1 X;  4EQX A;  3EAN A;  4HA6 A;  2OLN A;  5FMH A;  3BNJ A;  2X8H A;  2FJA A;  4CRT A;  4JNQ A;  4OPC A;  2WEU A;  4AT2 A;  2RDZ A;  1K0J A;  2WET A;  4NZH A;  4Y4N A;  1QLB A;  3I6D A;  2Y6R A;  5U63 A;  3GYI A;  2YLX A;  3UOX A;  2VZ2 A;  3S7W A;  3M0O A;  3L1T A;  1YQ4 A;  2Q0K A;  2W0H A;  4FK1 C;  3SZC A;  4B69 A;  3SY4 A;  4JN9 A;  4J57 A;  2BYB A;  3IHG A;  4YSZ A;  2HQM A;  3UOV A;  4H4P A;  2B9X A;  1BGJ A;  4JY2 A;  4WCT A;  3S5W A;  3FBS A;  3HYV A;  4L3X A;  1D7Y A;  2C67 A;  3NYE A;  3ATQ A;  2WOW A;  1CJ4 A;  1TYT A;  5C3J A;  1CHU A;  2YG5 A;  2RGO A;  3K7M X;  4TM3 A;  3AXB A;  5U1O A;  3SXI A;  4H4W A;  1BGN A;  2C75 A;  3MMO A;  1JRY A;  1B8S A;  1GEU A;  4A65 A;  4APN A;  4JY3 A;  2E1M A;  4YTP A;  3UTE A;  1VG9 A;  2YAU A;  1BKW A;  4G9K A;  2C73 A;  4U8I A;  4YSX A;  4GUV A;  4U2L A;  2BC1 A;  1YQ3 A;  3H4K A;  3PS9 A;  1TDO A;  3H8L A;  4H50 A;  1JRZ A;  4Y4M A;  3C4A A;  4XXG A;  4AP3 A;  4BJY A;  4BK3 A;  1IUX A;  5C2T A;  4BK1 A;  1Y0P A;  2XVJ A;  4A99 A;  1GV4 A;  4A79 A;  2YG4 A;  1CC6 A;  3AD8 B;  4ADW A;  2BK5 A;  2GMJ A;  2C3D A;  2GAH B;  2Q0L A;  2VQB A;  4EIP A;  4EQS A;  3UKL A;  4II2 A;  5IQ1 A;  1NPX A;  1UKV G;  2FBW A;  2V5Z A;  2APG A;  2XLP A;  3COX A;  2WBA A;  2BK3 A;  2YLZ A;  1BVB A;  5IQ4 A;  2E80 A;  2R9Z A;  2B76 A;  4U8L A;  2V61 A;  4C3Y A;  1NHQ A;  2FJE A;  2BS3 A;  1FOH A;  1IUV A;  4OPU A;  1FS7 A;  3CIR A;  2NVK X;  3EF6 A;  4H4Q A;  5EOW A;  2GV8 A;  2VRM A;  3CPH G;  4Z43 A;  4C5O A;  4II3 A;  2CVJ A;  1AOG A;  1ONF A;  1Y56 B;  2F5Z A;  3UKP A;  2YR6 A;  3FMW A;  4REK A;  2R46 A;  2GR0 A;  5LV9 A;  4G73 A;  3T37 A;  5EB4 A;  2C66 A;  2GRT A;  4LA1 A;  4UDP A;  3V3O A;  3DJG X;  4FX9 A;  2JBV A;  3P4Q A;  2FJD A;  2XVF A;  3DJJ A;  4M52 A;  2J7A A;  1ZMC A;  2WDR A;  5FS7 A;  1PHH A;  3CN8 A;  2WP6 A;  3DJE A;  1QDB A;  1GER A;  4B63 A;  3GDN A;  1SP3 A;  1OJ9 A;  3SZ0 A;  4H7U A;  2GEW A;  4U8J A;  3ICS A;  1IUS A;  4EM4 A;  5KVH A;  3VQR A;  5KMQ A;  2X8C A;  1M1R A;  3ZYX A;  4EM3 A;  2OAL A;  4U8O A;  2R0P A;  3I3L A;  2C3C A;  1M6I A;  4GDP A;  3AYI A;  1E39 A;  3D1I A;  3QSM A;  3NYF A;  4NTD A;  2WDV A;  3EAO A;  1GRG A;  2RAB A;  4OPL A;  3UCL A;  3H8I A;  1QO8 A;  2JAE A;  4Q1O A;  1IUU A;  2BXS A;  1MO9 A;  2V6O A;  3G5S A;  3RKH A;  1OJD A;  2JK6 A;  3GWF A;  4KPR A;  2GR3 A;  3CMM A;  1OAH A;  3HYW A;  2JB2 A;  2WP5 A;  4BK2 A;  2YVJ A;  3UP4 A;  1PXC A;  2GH5 A;  4E0V A;  2I0Z A;  3UKA A;  4NTC A;  2E5V A;  3P4S A;  2K3V A;  4EMJ A;  5M10 A;  2JB3 A;  3AE5 A;  3CNT A;  4UP3 A;  4IA6 A;  4OPD A;  1P2H A;  2VR0 A;  4H4U A;  2X8G A;  5KRQ A;  1D4E A;  1D7L A;  5FS8 A;  2ZO5 A;  2EQ9 A;  4UDR A;  1TDE A;  5KNL A;  1ZX9 A;  2XCG A;  3CNS A;  5KXJ A;  3GYJ A;  3RED A;  3SXQ A;  1XPQ A;  3KVE A;  5KWF A;  3CPJ G;  4CCR A;  2EQ6 A;  3V76 A;  3CGE A;  5KOW A;  4A6N A;  4IVO B;  3B3R A;  2IVD A;  1PBE A;  1YKJ A;  3II4 A;  5GRT A;  4AOX A;  1D5T A;  4DSH A;  5U25 A;  3UP5 A;  2R4J A;  1GRF A;  1NEN A;  1TDN A;  2EQ7 A;  3QJ4 A;  4RSL A;  4Z25 A;  4FDC B;  2Q7V A;  3AEB A;  2YVF A;  3BNG A;  3CNJ A;  2GQW A;  3LOV A;  1ZP0 A;  1O94 A;  3GSI A;  1JRX A;  4L3Z A;  1L9D A;  3O0H A;  3CGC A;  3AEE A;  4OPI A;  3VRA A;  1KNR A;  3NGC X;  1TDK A;  2R45 A;  2BC0 A;  4H4Z A;  1EL8 A;  1FEC A;  3UOY A;  3UU9 A;  1NHS A;  1OJC A;  3NNE A;  1GT8 A;  3P9U A;  3S61 A;  1GRH A;  1Z6L A;  2VVL G;  2XLS A;  3AEC A;  3DK9 A;  4D04 A;  4TLX A;  1CL0 A;  4LU6 A;  2TMD A;  3CGD A;  4N9X A;  1B5Q A;  5CQF A;  4TM1 A;  1LJ1 A;  1E1K A;  2RGH A;  3FIM B;  4J2W A;  2WPE A;  3VRB A;  1KSS A;  5KOX A;  3F29 A;  1PBF A;  1FL2 A;  3AE3 A;  2XLU A;  3CGB A;  4NEW A;  1CJ2 A;  1Q9I A;  1VRQ B;  3K30 A;  1M64 A;  2O9Z A;  2WDQ A;  4XWR A;  4DNA A;  2C65 A;  2V3A A;  3AD7 B;  1CF3 A;  2CFY A;  1S3E A;  3M13 A;  3QSS A;  2ZZC A;  4MJW A;  2E81 A;  4WJY A;  3GM6 A;  4EMW A;  4L38 A;  5TR3 A;  3QFA A;  2BCP A;  3K7Q X;  3R9U A;  2FJB A;  4H4V A;  4JDR A;  1H6V A;  1TRB A;  4U8K A;  5J60 A;  4USR A;  4H2R A;  4GCM A;  1SEZ A;  2ZZB A;  4CNK A;  3GMB A;  3L8K A;  1GES A;  1IUW A;  1PN0 A;  2C4C A;  2YM2 A;  2XVH A;  4OPG A;  1GPE A;  1F6M A;  4YTM A;  2V3B A;  1GAL A;  3B6D A;  3NTA A;  3AE8 A;  4A9W A;  4NNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...