1QJDA

Flavocytochrome c3 from shewanella frigidimarina
Total Genus 197
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
197
sequence length
568
structure length
568
Chain Sequence
b'ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FLAVOCYTOCHROME C3
publication title Structural and Mechanistic Mapping of a Unique Fumarate Reductase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 197
structure length 568
sequence length 568
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 1999-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1qjdA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1qjdA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1qjdA01
2W0HA 4C77A 2BK5A 4H4TA 1GREA 3LGQA 3B3RA 4JDRA 4UDQA 2NPXA 4CBQA 3AEEA 4AOXA 1PXAA 3ATRA 4JNQA 5JCMA 2C67A 1OJCA 1FECA 2VVMA 3LXDA 1BGJA 3UOZA 4USRA 4YKFA 3MMOA 1SP3A 3VQRA 1PXCA 3SCEA 4X9NA 4PAAA 3RHAA 2OLNA 1ZX9A 3DK9A 1FL2A 1KNPA 2R4EA 4P9SA 3GRSA 4ZN0A 1GT8A 3F8PA 1DJQA 1RSGA 1YQ4A 4B67A 2WOVA 1AOGA 2GF3A 3AEDA 3NH3X 2C66A 4A79A 4FK1A 4DNAA 5KVHA 5U1OA 1H6VA 4K22A 1NG3A 5M10A 1JOAA 2GMHA 1GRFA 2JB2A 3LADA 3I6DA 3L8KA 4NZHA 4BV6A 3BHFA 3AYJA 3Q9TA 4A5LA 4K5RA 1E1LA 4U2TA 2WBAA 3PS9A 2VOUA 1FEBA 1GTHA 2RGOA 1E7PA 1NHSA 1XDIA 3UOVA 3OWMA 3GSIA 1GU6A 1FCDA 5TR3A 3OC4A 2RGJA 2LFCA 5HY5A 4BK1A 3PO7A 2R0CA 3ICRA 2C64A 3H8IA 1ZK7A 2QAEA 4Q1OA 1KFYA 3ISHA 1GETA 3GM6A 2DKHA 1LVLA 4NTEA 2CULA 2GR1A 2WHDA 1E1KA 5LV9A 2XFPA 1RP0A 4UDRA 1BVBA 2V61A 1K4QA 4K5SA 2ZZ0A 2YM2A 4B68A 1BZLA 3QSEA 2YLXA 4IVMB 3NGCX 4Z24A 2WESA 5KVIA 1TDEA 4B1BA 1MXTA 5U63A 1DODA 3Q6JA 1P2EA 4OPUA 2ZZCA 5J60A 2GAGB 3G5SA 4Q17A 1N4VA 3KKJA 1L0VA 3AD9B 2B9YA 1D4EA 4LIIA 3GYIA 1F6MA 2GR3A 4GRTA 2V3BA 3DH9A 2RF7A 2B76A 2YVJA 3AE7A 1DXLA 3NG7X 2E4GA 2WPEA 3CGBA 5GSNA 3KLJA 4H4WA 4O5UA 2VRLA 1KF6A 1FT5A 4J33A 2YG4A 3UKFA 2B7SA 2XVIA 4YSXA 1BF3A 4USQA 4YTMA 1B8SA 4APNA 4H4XA 4EMIA 4CCRA 3CGDA 2UZZA 3CNDA 3H8LA 3AE8A 3F29A 1JNZA 2R4JA 5M0ZA 1B37A 1MOKA 3NK2X 3UKAA 3BI2A 2C7GA 4CCQA 4FX9A 5GRTA 3S7WA 4NEWA 5DBJA 4AP3A 2BS4A 1TDNA 4TM1A 3NK0X 4GF7A 2K3VA 3UTFA 4Q5CA 1L9CA 3UKLA 2TMDA 3CPJG 2AQJA 1PBCA 3S5WA 2A89A 4J36A 4B63A 3TTBA 1PN0A 3P4RA 1PS9A 4CY8A 2YG7A 3QSSA 2C70A 3AEGA 3ALMA 2YQUA 3FG2P 1IUTA 4GDEA 2WP6A 4U2SA 1M64A 1GV4A 2WS3A 1TRBA 2XLSA 3R9UA 4A99A 3RP8A 2YWLA 1K0JA 5KRQA 2GH5A 4YSYA 1ZOVA 1M1RA 2WETA 1F3PA 4BK2A 1H83A 4YSHA 1GALA 1Q1RA 1H7XA 2A87A 3AECA 1CJ3A 4C3YA 2OLOA 1N1PA 3URHA 1LJ1A 2IVEA 4L3XA 4A6NA 1EBDA 2GR2A 1EL7A 4FDCB 3K30A 3RKHA 1LQUA 5ER0A 1LQTA 3VR8A 3T37A 3QFAA 1OJDA 3LG1A 5FS6A 4A9WA 3SGLA 2Q0LA 2BK4A 2CDUA 2FJDA 2YLZA 5IQ1A 4NTDA 1PBFA 1DJNA 3UKQA 3GD4A 4JY3A 3LB8A 1F8WA 1JEHA 1XPQA 1GOSA 1F8SA 3FBSA 1OJAA 3UTEA 3WE0A 1D7LA 2X99A 4U8MA 1E6EA 4C3XA 1EL5A 3DA1A 1CJ2A 2XLTA 3IF9A 3QJ4A 4AT0A 1M6IA 4DSGA 3AE4A 5BVAA 2AAQA 1Y0PA 1B4VA 1X31B 3AWIA 1TYTA 1LTXR 2GV8A 2RABA 2TPRA 1ELIA 3GWFA 1GERA 4L3ZA 2GRTA 3DK8A 4IA5A 4H2PA 4Y4LA 3K7MX 2YG5A 2JB1A 2ZZBA 1OAHA 3ADAB 3FIMB 4H4SA 1L9DA 1S3EA 1YQ3A 3CNSA 1CF3A 1CJCA 3AE5A 1XHCA 4TM3A 2E1MA 1IJHA 1VRQB 3P9UA 4B66A 5BRTA 3EANA 2YLWA 2YLTA 1Q1WA 1JRYA 3SFEA 2GVCA 2WOWA 4AP1A 3UBRA 3I3LA 2E80A 2CFYA 4XWRA 4H4VA 2VQBA 4Z2RA 2B7RA 4Y4NA 4A6NB 4TLZA 4J57A 4H2QA 3ZDNA 1PXBA 2ZBWA 2YR4A 2XVFA 2BCGG 2C76A 2GB0A 2VRMA 2XLRA 5KXJA 2RDZA 2B9WA 3GDPA 2BA9A 4I58A 4YWOA 3RP7A 4OPIA 2YR5A 1XANA 2WPCA 4H4RA 4GCMA 2XVHA 3CNTA 3LZWA 2R9ZA 3F8DA 5HHFA 4Z25A 2R0GA 2WOIA 1KNRA 2FJBA 3P1WA 1GRTA 1E39A 2ACZA 4AOSA 3UTGA 5JCKA 1UKVG 1PJ7A 1PBBA 3COXA 3EAOA 1D4DA 3AYIA 3UP5A 4BJZA 3D8XA 4RG3A 3SFDA 1H82A 4IA6A 5C3JA 3GYXA 3DGHA 4WJYA 1H7WA 3HZLA 3NLCA 4Z43A 3QSMA 2YAUA 2XDOA 2YR6A 4C5OA 4OVIA 1L9EA 2EQ6A 5FMHA 1QLBA 2JAEA 2BC1A 3KA7A 1O94A 2JB3A 1FS9A 2YLSA 3AD7B 3UP4A 1DNCA 1GEUA 3CNPA 2C73A 1IUXA 3AE6A 4RSLA 2VR0A 3FO3A 3UOYA 1F8RA 3GMBA 1YKJA 4NTCA 4YSZA 3BI4A 1JRXA 1CC4A 4BURA 2GQFA 4Z44A 1LV0A 3DJDA 3BNHA 2R0PA 2C75A 4EM4A 4OCGA 3AE9A 4EM3A 1FS7A 1GESA 1OJTA 1ONFA 2GMJA 2OAMA 3IHMA 4U8OA 2XFOA 2J3NA 2YLRA 3IWAA 4K7ZA 3ALLA 2WP5A 3IC9A 2BYBA 4DSHA 1H81A 3P4SA 4H2RA 2APGA 3GDNA 4D04A 4Q4UA 3ABVA 4H2NA 4O5QA 3DMEA 3FMWA 3EPTA 1IUWA 1JNRA 3V3NA 4Y4MA 1FOHA 2QA2A 2XYOA 3NYFA 1TDOA 2GAHB 2C3CA 1NENA 4U8PA 5EB5A 3UKPA 1Y56A 1ZMCA 3UTHA 1SEZA 2V5ZA 2WU5A 3NRNA 2F5ZA 1YQZA 2V6OA 2WP9A 4GDPA 2XCGA 4J31A 2YM1A 3VRBA 1GPEA 4JNAA 2V3AA 3CNJA 3K7TA 2EQ9A 2XVEA 3P4PA 4UP3A 4BK3A 3L1RA 3O0HA 2EQ8A 3M12A 3VRDB 1CJ4A 1D7YA 3B6DA 4Q5BA 3DGZA 1GRHA 5L46A 4J2WA 1M1QA 2WU2A 1N4UA 2FBWA 3LOVA 5FS8A 3P4QA 4N9XA 3PVCA 4U8KA 2R45A 2X8HA 3AXBA 3CPHG 3F8RA 3NIXA 3UKKA 1VG0A 1LPFA 4FK1C 3OZ2A 1EL9A 1NEKA 3D1CA 3E1TA 4YT0A 3DJEA 3BNFA 4ICYA 2XLPA 2IVDA 5HXIA 2Z5YA 4CNJA 1GTEA 4OPCA 4EQRA 3BHKA 3AD8B 3AEAA 2OT4A 2Y6RA 1S2YA 1CC6A 3CGCA 4YTPA 5KOXA 3BNJA 2BXRA 3BNUA 3GWDA 2V60A 2GEWA 4OPDA 4GR1A 4EQXA 4YKGA 1E1MA 3EF6A 1Y56B 1ZKQA 3G5RA 4CRTA 2BCPA 5U25A 2I0ZA 1K0LA 4H4ZA 1JU2A 4LU6A 3SQPA 1H86A 4MJWA 2BS2A 2Q7VA 2XVJA 1S2QA 3NTAA 1IUSA 1S3BA 4HB9A 4TLXA 1ZMDA 1DOCA 1BGNA 3AE1A 1NG4A 2YG3A 3CIRA 3CN8A 3LJPA 3QVPA 4B65A 4H50A 2XFNA 3C96A 3ICSA 4A7AA 5HYMA 2GR0A 3KU9A 2HQMA 1PDHA 1EL8A 2E5VA 4YXDA 1VQWA 1KSUA 2OA1A 2R46A 1DOBA 2XFUA 2YVFA 4I59A 4IVOB 3S61A 4KX6A 3CPIG 1NDAA 3NKSA 4Z2UA 4WCTA 3CGEA 2BABA 1ZY8A 2YG6A 1NAAA 1P2HA 2VVLG 3QFBA 3BNGA 2BK3A 3C4NA 3NYCA 4H4YA 2A8XA 3KD9A 1GRGA 1RYIA 4K8DA 3RNMA 3SM8A 4ADWA 2PYXA 4WX1A 1FT6A 1Q9IA 4Z26A 2JKCA 4HA6A 3DJGX 1Z6LA 2JK6A 1FEAA 1GSNA 2Q0KA 5IQ4A 4H4UA 1BWCA 1PBEA 4U8JA 1REOA 2ARDA 5KWFA 3L1TA 3ZYXA 1GNDA 1PBDA 1ZDLA 1CC2A 4OPTA 3ITJA 4U2LA 1GXFA 2BS3A 3CTYA 1N4WA 3UKHA 4B69A 5JCNA 4EIPA 2H88A 4LA1A 5EB4A 2VVLA 1KDGA 4JY2A 2C65A 4OPGA 2FJAA 5EBKA 4CNKA 3NTDA 1NHQA 2RGHA 3UOXA 1B5QA 1HYUA 1W4XA 4BJYA 5BULA 2B9XA 3D1IA 1KSSA 1COYA 3QVRA 4U8NA 5FS9A 1CHUA 2WPFA 4OPLA 3ALJA 3NK1X 2WDVA 4TM0A 3V76A 4ZCCA 4CY6A 4L3YA 1QO8A 4RG4A 3M13A 1CL0A 2XFQA 4J34A 4JN9A 4Q0TA 1VDCA 1K0IA 2AR8A 3GYJA 4AT2A 2VZ2A 3K7QX 2C3DA 3AB1A 2IIDA 4XXGA 1NHPA 1NPXA 1IUVA 2WQYA 3G5QA 5CQFA 2JBVA 3ICTA 1TDFA 3DK4A 4A65A 2VQ7A 1QDBA 4KPRA 3ATQA 3LZXA 1TDKA 4NEVA 4GUVA 4EQWA 5KOWA 1VG9A 3KVEA 2ZO5A 1GRBA 4YTNA 3SXQA 1H84A 3NN0X 2H89A 4H4QA 3VR9A 1O95A 1O5WA 2E81A 2DKIA 4TM4A 1GRAA 3BNMA 4M52A 5CKUA 2J7AA 3GMCA 1PHHA 1PJ5A 1ZP0A 2BC0A 2X50A 4D03A 4EIQA 2Y6QA 4ZCDA 4JQ9A 2OALA 4XWZA 3REDA 3UCLA 4ECHA 5BUKA 4EMWA 1V59A 3VRAA 2GQWA 1DOEA 2X3NA 1OJ9A 3AEBA 3FPZA 4H7UA 2BXSA 1IUUA 2YVGA 3BI5A 3GD3A 3NNEA 3V3OA 4U8LA 4REKA 4C74A 5IPYA 1JNIA 1CBOA 2QCUA 3II4A 3M0OA 4H4PA 3NYEA 3NT6A 1JRZA 1TYPA 1PJ6A 2Q6UA 4UDPA 1D4CA 4J56A 5JCIA 2BACA 1MO9A 4IV9A 3JSKA 4L38A 4E0VA 4EMJA 5EOWA 2WDRA 4X4JA 3UU9A 2X8CA 2QA1A 3NHOX 2FJEA 2NVKX 1M1PA 5J7XA 4K2XA 1QJDA 4Z2TA 1NHRA 1E1NA 2C72A 1YY5A 3C4AA 2Z5XA 2CVJA 5FS7A 3IHGA 3AE2A 4X9MA 4PABA 1ZOYA 4B64A 3GRTA 3KPFA 2O9ZA 4U8IA 2EQ7A 2PHHA 2X8GA 3H4KA 4EQSA 5JCLA 1D5TA 4DGKA 3NN6X 1BKWA 1FS8A 2WEUA 2WDQA 3AE3A 3DJJA 2XLUA 3TORA 3AYLA 3AEFA 3RP6A 5C2TA
chains in the Genus database with same CATH superfamily
2W0HA 4C77A 2BK5A 4H4TA 1GREA 4G9KA 3LGQA 3B3RA 4JDRA 4UDQA 2NPXA 4CBQA 3AEEA 4AOXA 1PXAA 3ATRA 4JNQA 5JCMA 2C67A 1OJCA 1FECA 2VVMA 3LXDA 1BGJA 3UOZA 4USRA 4YKFA 3MMOA 1SP3A 3VQRA 1PXCA 3SCEA 4X9NA 4PAAA 3RHAA 2OLNA 1ZX9A 3DK9A 1FL2A 1KNPA 2R4EA 4P9SA 3GRSA 4ZN0A 1GT8A 3F8PA 1DJQA 1RSGA 1YQ4A 4B67A 2WOVA 1AOGA 2GF3A 3AEDA 3NH3X 2C66A 4A79A 4FK1A 4DNAA 5KVHA 5U1OA 1H6VA 4K22A 1NG3A 5M10A 1JOAA 2GMHA 1GRFA 2C4CA 2JB2A 3I6DA 3L8KA 3LADA 4NZHA 3BHFA 3AYJA 3Q9TA 4A5LA 4K5RA 4BV6A 1E1LA 4U2TA 2WBAA 4GAPA 3PS9A 2VOUA 1FEBA 1GTHA 2RGOA 1E7PA 1NHSA 1XDIA 3UOVA 3OWMA 3GSIA 1GU6A 1FCDA 5TR3A 3OC4A 2RGJA 2LFCA 2BRAA 5HY5A 4BK1A 3PO7A 3T14A 2R0CA 3ICRA 2C64A 3H8IA 1ZK7A 2QAEA 4Q1OA 1KFYA 3ISHA 5KMQA 1GETA 3GM6A 2DKHA 1LVLA 4NTEA 2CULA 2GR1A 2WHDA 1E1KA 5KMSA 5LV9A 2XFPA 1RP0A 4UDRA 1BVBA 2V61A 1K4QA 4K5SA 2ZZ0A 2YM2A 4B68A 1BZLA 3QSEA 2YLXA 4IVMB 3NGCX 4Z24A 2WESA 5KVIA 1TDEA 4B1BA 1MXTA 5U63A 1DODA 3Q6JA 1P2EA 4OPUA 2ZZCA 5J60A 2GAGB 3G5SA 4Q17A 1N4VA 3KKJA 1L0VA 3AD9B 2B9YA 1D4EA 4LIIA 3GYIA 1F6MA 2GR3A 4GRTA 2V3BA 3DH9A 2RF7A 2B76A 2YVJA 3AE7A 1DXLA 3NG7X 2E4GA 2WPEA 3CGBA 5GSNA 3KLJA 4H4WA 4O5UA 2VRLA 1KF6A 1FT5A 4J33A 2YG4A 3UKFA 2B7SA 4GAVA 2XVIA 4YSXA 1BF3A 4USQA 4YTMA 1B8SA 4APNA 4H4XA 4EMIA 4CCRA 3CGDA 2UZZA 3CNDA 3H8LA 3AE8A 3F29A 1JNZA 2R4JA 5M0ZA 1B37A 1MOKA 3NK2X 3UKAA 3BI2A 2C7GA 4CCQA 4FX9A 5GRTA 3S7WA 4NEWA 5DBJA 4AP3A 2BS4A 1TDNA 3KPKA 3NK0X 4TM1A 4GF7A 2K3VA 3UTFA 4Q5CA 1L9CA 3UKLA 2TMDA 3CPJG 2AQJA 1PBCA 4G74A 2A89A 4J36A 3S5WA 4B63A 3TTBA 1PN0A 3P4RA 1PS9A 4CY8A 2YG7A 3QSSA 2C70A 3AEGA 3ALMA 2YQUA 3FG2P 1IUTA 4GDEA 2WP6A 4U2SA 1M64A 1GV4A 2WS3A 1TRBA 2XLSA 3R9UA 4A99A 3RP8A 2YWLA 1K0JA 5KRQA 2GH5A 4YSYA 1ZOVA 1M1RA 2WETA 1F3PA 4BK2A 1H83A 4YSHA 1GALA 1Q1RA 1H7XA 2A87A 3AECA 1CJ3A 4C3YA 2OLOA 1N1PA 3URHA 1LJ1A 2IVEA 4L3XA 4A6NA 1EBDA 2GR2A 1EL7A 4FDCB 3K30A 3RKHA 1LQUA 5ER0A 1LQTA 3VR8A 3T37A 3QFAA 1OJDA 3LG1A 5FS6A 4A9WA 3SGLA 2Q0LA 2BK4A 2CDUA 2FJDA 2YLZA 5IQ1A 4NTDA 1PBFA 1DJNA 4G6HA 3GD4A 4JY3A 3LB8A 3UKQA 1F8WA 1JEHA 1XPQA 1GOSA 1F8SA 3FBSA 1OJAA 3UTEA 3WE0A 1D7LA 2X99A 4U8MA 1E6EA 4C3XA 3SZWA 1EL5A 3DA1A 1CJ2A 2XLTA 3IF9A 3QJ4A 4AT0A 1M6IA 4DSGA 3AE4A 5BVAA 2AAQA 1Y0PA 1B4VA 1X31B 3AWIA 1TYTA 1LTXR 2GV8A 2RABA 2TPRA 1ELIA 3GWFA 3SYIA 1GERA 4L3ZA 2GRTA 3DK8A 4IA5A 4H2PA 4Y4LA 3K7MX 2YG5A 2JB1A 2ZZBA 1OAHA 3ADAB 3FIMB 4H4SA 1L9DA 1S3EA 1YQ3A 3CNSA 3SZ0A 1CF3A 1CJCA 3AE5A 1XHCA 4TM3A 2E1MA 1IJHA 1VRQB 3P9UA 4B66A 5BRTA 3EANA 2YLWA 2YLTA 1Q1WA 1JRYA 3SFEA 2GVCA 2WOWA 4AP1A 3UBRA 3I3LA 2E80A 2CFYA 4XWRA 4H4VA 2VQBA 3T2ZA 4Z2RA 2B7RA 4Y4NA 4A6NB 4TLZA 4J57A 3HYXA 4H2QA 3ZDNA 1PXBA 2ZBWA 2YR4A 2XVFA 2BCGG 2C76A 2GB0A 2VRMA 2XLRA 5KXJA 2RDZA 2B9WA 3GDPA 2BA9A 4I58A 4YWOA 3RP7A 4OPIA 2YR5A 1XANA 2WPCA 4H4RA 4GCMA 2XVHA 3CNTA 3LZWA 2R9ZA 3F8DA 5HHFA 4Z25A 2R0GA 2WOIA 1KNRA 2FJBA 3P1WA 1GRTA 1E39A 2ACZA 4AOSA 3UTGA 5JCKA 1UKVG 1PJ7A 1PBBA 3COXA 3EAOA 1D4DA 3AYIA 3T2YA 3UP5A 3D8XA 4RG3A 4BJZA 3SFDA 1H82A 4IA6A 3GYXA 5C3JA 3DGHA 4WJYA 1H7WA 3HZLA 3NLCA 4Z43A 3QSMA 2YAUA 2XDOA 2YR6A 4C5OA 4OVIA 1L9EA 2EQ6A 5FMHA 1QLBA 2JAEA 2BC1A 3KA7A 1O94A 2JB3A 1FS9A 2YLSA 3AD7B 3UP4A 1DNCA 1GEUA 3CNPA 2C73A 3SY4A 1IUXA 3AE6A 4RSLA 2VR0A 3FO3A 3UOYA 1F8RA 3GMBA 1YKJA 4NTCA 4YSZA 3BI4A 1JRXA 1CC4A 4BURA 3SX6A 2GQFA 4Z44A 1LV0A 3DJDA 3BNHA 2R0PA 2C75A 4EM4A 4OCGA 3AE9A 4EM3A 1FS7A 1GESA 1OJTA 1ONFA 2GMJA 2OAMA 3IHMA 4U8OA 2XFOA 2J3NA 2YLRA 3IWAA 4II3A 4K7ZA 3ALLA 2WP5A 3IC9A 2BYBA 4DSHA 1H81A 3P4SA 4H2RA 2APGA 3GDNA 4D04A 4Q4UA 3ABVA 4H2NA 4O5QA 3DMEA 3FMWA 3EPTA 1IUWA 1JNRA 3V3NA 4Y4MA 1FOHA 2QA2A 2XYOA 3NYFA 1TDOA 2GAHB 2C3CA 1NENA 4U8PA 5EB5A 3UKPA 1Y56A 1ZMCA 3UTHA 1SEZA 2V5ZA 2WU5A 3NRNA 2F5ZA 1YQZA 2V6OA 2WP9A 4GDPA 2XCGA 4J31A 3CMMA 2YM1A 3VRBA 1GPEA 4JNAA 2V3AA 3CNJA 3K7TA 2EQ9A 2XVEA 3P4PA 4UP3A 4BK3A 3L1RA 3O0HA 2EQ8A 3M12A 3VRDB 1CJ4A 1D7YA 3B6DA 4Q5BA 3DGZA 1GRHA 5L46A 4J2WA 1M1QA 2WU2A 1N4UA 2FBWA 3LOVA 5FS8A 3P4QA 4N9XA 3PVCA 4U8KA 2R45A 2X8HA 3AXBA 3CPHG 3F8RA 3NIXA 3UKKA 1VG0A 1LPFA 4FK1C 3OZ2A 1EL9A 1NEKA 3D1CA 3E1TA 4YT0A 3DJEA 3BNFA 4ICYA 2XLPA 2IVDA 5HXIA 2Z5YA 4CNJA 1GTEA 3HYVA 4OPCA 4EQRA 3BHKA 3AD8B 3AEAA 2OT4A 2Y6RA 1S2YA 1CC6A 3CGCA 3SXIA 4YTPA 5KOXA 3T31A 3BNJA 2BXRA 3BNUA 3GWDA 2V60A 2GEWA 4OPDA 4GR1A 4EQXA 4YKGA 1E1MA 3EF6A 1Y56B 1ZKQA 3G5RA 4CRTA 2BCPA 5U25A 2I0ZA 1K0LA 4H4ZA 1JU2A 4LU6A 3SQPA 1H86A 4MJWA 2BS2A 2Q7VA 2XVJA 1S2QA 3NTAA 1IUSA 1S3BA 4HB9A 4TLXA 1ZMDA 1DOCA 1BGNA 3AE1A 1NG4A 2YG3A 3CIRA 3CN8A 3LJPA 3SZCA 3QVPA 4B65A 4H50A 2XFNA 3C96A 4II2A 3ICSA 4A7AA 5HYMA 2GR0A 3KU9A 2HQMA 4NWZA 1PDHA 1EL8A 2E5VA 4YXDA 1VQWA 2BRYA 1KSUA 2OA1A 2R46A 1DOBA 2CZSA 2XFUA 2YVFA 4I59A 4IVOB 3S61A 4KX6A 3CPIG 1NDAA 3NKSA 4Z2UA 4WCTA 3CGEA 2BABA 1ZY8A 2YG6A 1NAAA 1P2HA 2VVLG 3QFBA 3BNGA 2BK3A 3C4NA 3NYCA 4H4YA 2A8XA 3KD9A 1GRGA 1RYIA 4K8DA 3RNMA 3SM8A 4ADWA 2PYXA 3HYWA 4WX1A 1FT6A 1Q9IA 4Z26A 2JKCA 4HA6A 3DJGX 1Z6LA 2JK6A 1FEAA 1GSNA 2Q0KA 5IQ4A 4H4UA 1BWCA 1PBEA 4U8JA 1REOA 2ARDA 5KWFA 3L1TA 3ZYXA 1GNDA 1PBDA 1ZDLA 1CC2A 4OPTA 3ITJA 4U2LA 1GXFA 2BS3A 3CTYA 1N4WA 3UKHA 4B69A 5JCNA 4EIPA 2H88A 4LA1A 5EB4A 2VVLA 1KDGA 4JY2A 2C65A 4OPGA 5KMRA 2FJAA 5EBKA 4CNKA 3NTDA 1NHQA 2RGHA 3UOXA 1B5QA 1HYUA 1W4XA 4BJYA 5BULA 2B9XA 3D1IA 1KSSA 1COYA 3QVRA 4U8NA 5FS9A 1CHUA 2WPFA 4OPLA 3ALJA 3NK1X 2WDVA 4TM0A 3V76A 4ZCCA 4CY6A 4L3YA 1QO8A 4RG4A 3M13A 1CL0A 2XFQA 4J34A 4JN9A 4Q0TA 1VDCA 1K0IA 2AR8A 3GYJA 4AT2A 2VZ2A 3K7QX 2C3DA 3AB1A 2IIDA 4XXGA 1NHPA 1NPXA 1IUVA 2WQYA 3G5QA 4G73A 2JBVA 3ICTA 1TDFA 3DK4A 5CQFA 4A65A 2VQ7A 1QDBA 4KPRA 3ATQA 3LZXA 1TDKA 4NEVA 4GUVA 4EQWA 5KOWA 1VG9A 3KVEA 2ZO5A 1GRBA 4YTNA 3SXQA 1H84A 3NN0X 2H89A 4H4QA 3VR9A 1O95A 1O5WA 2E81A 2DKIA 4TM4A 1GRAA 3BNMA 4M52A 5CKUA 2J7AA 3GMCA 1PHHA 1PJ5A 1ZP0A 2BC0A 2X50A 4D03A 4EIQA 2Y6QA 4G6GA 4ZCDA 4JQ9A 2OALA 4XWZA 3REDA 3UCLA 4ECHA 5BUKA 4EMWA 1V59A 3VRAA 2GQWA 1DOEA 2X3NA 3T0KA 1OJ9A 3AEBA 3FPZA 4H7UA 2BXSA 1IUUA 2YVGA 3BI5A 3GD3A 3NNEA 3V3OA 4U8LA 4REKA 4C74A 5IPYA 1JNIA 1CBOA 2QCUA 3II4A 3M0OA 4NNJA 4H4PA 3NYEA 3NT6A 1JRZA 1TYPA 1PJ6A 2Q6UA 4UDPA 1D4CA 4J56A 5JCIA 2BACA 1MO9A 4IV9A 3JSKA 4L38A 4E0VA 4EMJA 5EOWA 2WDRA 5KNLA 4X4JA 3UU9A 2X8CA 2QA1A 3NHOX 2FJEA 2NVKX 1M1PA 5J7XA 4K2XA 1QJDA 4Z2TA 1NHRA 1E1NA 2C72A 1YY5A 3C4AA 2Z5XA 2CVJA 5FS7A 3IHGA 3AE2A 4X9MA 4PABA 1ZOYA 3SZFA 4B64A 3GRTA 3KPFA 2O9ZA 4U8IA 2EQ7A 2PHHA 2X8GA 3H4KA 4EQSA 5JCLA 1D5TA 4DGKA 3NN6X 5KMPA 1BKWA 1FS8A 2WEUA 2WDQA 3AE3A 3DJJA 2XLUA 3T2KA 3TORA 3AYLA 3AEFA 3RP6A 5C2TA
chains in the Genus database with same CATH topology
2W0HA 4C77A 2BK5A 4H4TA 1GREA 4G9KA 3LGQA 3B3RA 4JDRA 4UDQA 2NPXA 4CBQA 3AEEA 4AOXA 1PXAA 3ATRA 4JNQA 5JCMA 2C67A 1OJCA 1FECA 2VVMA 3LXDA 1BGJA 3UOZA 4USRA 4YKFA 3MMOA 1SP3A 3VQRA 1PXCA 3SCEA 4X9NA 4PAAA 3RHAA 2OLNA 1ZX9A 3DK9A 1FL2A 1KNPA 2R4EA 4P9SA 3GRSA 4ZN0A 1GT8A 3F8PA 1DJQA 1RSGA 1YQ4A 4B67A 2WOVA 1AOGA 2GF3A 3AEDA 3NH3X 2C66A 4A79A 4FK1A 4DNAA 5KVHA 5U1OA 1H6VA 4K22A 1NG3A 5M10A 1JOAA 2GMHA 1GRFA 2C4CA 2JB2A 3I6DA 3L8KA 3LADA 4NZHA 3BHFA 3AYJA 3Q9TA 4A5LA 4K5RA 4BV6A 1E1LA 4U2TA 2WBAA 4GAPA 3PS9A 2VOUA 1FEBA 1GTHA 2RGOA 1E7PA 1NHSA 1XDIA 3UOVA 3OWMA 3GSIA 1GU6A 1FCDA 5TR3A 3OC4A 2RGJA 2LFCA 2BRAA 5HY5A 4BK1A 3PO7A 3T14A 2R0CA 3ICRA 2C64A 3H8IA 1ZK7A 2QAEA 4Q1OA 1KFYA 3ISHA 5KMQA 1GETA 3GM6A 2DKHA 1LVLA 4NTEA 2CULA 2GR1A 2WHDA 1E1KA 5KMSA 5LV9A 2XFPA 1RP0A 4UDRA 1BVBA 2V61A 1K4QA 4K5SA 2ZZ0A 2YM2A 4B68A 1BZLA 3QSEA 2YLXA 4IVMB 3NGCX 4Z24A 2WESA 5KVIA 1TDEA 4B1BA 1MXTA 5U63A 1DODA 3Q6JA 1P2EA 4OPUA 2ZZCA 5J60A 2GAGB 3G5SA 4Q17A 1N4VA 3KKJA 1L0VA 3AD9B 2B9YA 1D4EA 4LIIA 3GYIA 1F6MA 2GR3A 4GRTA 2V3BA 3DH9A 2RF7A 2B76A 2YVJA 3AE7A 1DXLA 3NG7X 2E4GA 2WPEA 3CGBA 5GSNA 3KLJA 4H4WA 4O5UA 2VRLA 1KF6A 1FT5A 4J33A 2YG4A 3UKFA 2B7SA 4GAVA 2XVIA 4YSXA 1BF3A 4USQA 4YTMA 1B8SA 4APNA 4H4XA 4EMIA 4CCRA 3CGDA 2UZZA 3CNDA 3H8LA 3AE8A 3F29A 1JNZA 2R4JA 5M0ZA 1B37A 1MOKA 3NK2X 3UKAA 3BI2A 2C7GA 4CCQA 4FX9A 5GRTA 3S7WA 4NEWA 5DBJA 4AP3A 2BS4A 1TDNA 3KPKA 3NK0X 4TM1A 4GF7A 2K3VA 3UTFA 4Q5CA 1L9CA 3UKLA 2TMDA 3CPJG 2AQJA 1PBCA 4G74A 2A89A 4J36A 3S5WA 4B63A 3TTBA 1PN0A 3P4RA 1PS9A 4CY8A 2YG7A 3QSSA 2C70A 3AEGA 3ALMA 2YQUA 3FG2P 1IUTA 4GDEA 2WP6A 4U2SA 1M64A 1GV4A 2WS3A 1TRBA 2XLSA 3R9UA 4A99A 3RP8A 2YWLA 1K0JA 5KRQA 2GH5A 4YSYA 1ZOVA 1M1RA 2WETA 1F3PA 4BK2A 1H83A 4YSHA 1GALA 1Q1RA 1H7XA 2A87A 3AECA 1CJ3A 4C3YA 2OLOA 1N1PA 3URHA 1LJ1A 2IVEA 4L3XA 4A6NA 1EBDA 2GR2A 1EL7A 4FDCB 3K30A 3RKHA 1LQUA 5ER0A 1LQTA 3VR8A 3T37A 3QFAA 1OJDA 3LG1A 5FS6A 4A9WA 3SGLA 2Q0LA 2BK4A 2CDUA 2FJDA 2YLZA 5IQ1A 4NTDA 1PBFA 1DJNA 4G6HA 3GD4A 4JY3A 3LB8A 3UKQA 1F8WA 1JEHA 1XPQA 1GOSA 1F8SA 3FBSA 1OJAA 3UTEA 3WE0A 1D7LA 2X99A 4U8MA 1E6EA 4C3XA 3SZWA 1EL5A 3DA1A 1CJ2A 2XLTA 3IF9A 3QJ4A 4AT0A 1M6IA 4DSGA 3AE4A 5BVAA 2AAQA 1Y0PA 1B4VA 1X31B 3AWIA 1TYTA 1LTXR 2GV8A 2RABA 2TPRA 1ELIA 3GWFA 3SYIA 1GERA 4L3ZA 2GRTA 3DK8A 4IA5A 4H2PA 4Y4LA 3K7MX 2YG5A 2JB1A 2ZZBA 1OAHA 3ADAB 3FIMB 4H4SA 1L9DA 1S3EA 1YQ3A 3CNSA 3SZ0A 1CF3A 1CJCA 3AE5A 1XHCA 4TM3A 2E1MA 1IJHA 1VRQB 3P9UA 4B66A 5BRTA 3EANA 2YLWA 2YLTA 1Q1WA 1JRYA 3SFEA 2GVCA 2WOWA 4AP1A 3UBRA 3I3LA 2E80A 2CFYA 4XWRA 4H4VA 2VQBA 3T2ZA 4Z2RA 2B7RA 4Y4NA 4A6NB 4TLZA 4J57A 3HYXA 4H2QA 3ZDNA 1PXBA 2ZBWA 2YR4A 2XVFA 2BCGG 2C76A 2GB0A 2VRMA 2XLRA 5KXJA 2RDZA 2B9WA 3GDPA 2BA9A 4I58A 4YWOA 3RP7A 4OPIA 2YR5A 1XANA 2WPCA 4H4RA 4GCMA 2XVHA 3CNTA 3LZWA 2R9ZA 3F8DA 5HHFA 4Z25A 2R0GA 2WOIA 1KNRA 2FJBA 3P1WA 1GRTA 1E39A 2ACZA 4AOSA 3UTGA 5JCKA 1UKVG 1PJ7A 1PBBA 3COXA 3EAOA 1D4DA 3AYIA 3T2YA 3UP5A 3D8XA 4RG3A 4BJZA 3SFDA 1H82A 4IA6A 3GYXA 5C3JA 3DGHA 4WJYA 1H7WA 3HZLA 3NLCA 4Z43A 3QSMA 2YAUA 2XDOA 2YR6A 4C5OA 4OVIA 1L9EA 2EQ6A 5FMHA 1QLBA 2JAEA 2BC1A 3KA7A 1O94A 2JB3A 1FS9A 2YLSA 3AD7B 3UP4A 1DNCA 1GEUA 3CNPA 2C73A 3SY4A 1IUXA 3AE6A 4RSLA 2VR0A 3FO3A 3UOYA 1F8RA 3GMBA 1YKJA 4NTCA 4YSZA 3BI4A 1JRXA 1CC4A 4BURA 3SX6A 2GQFA 4Z44A 1LV0A 3DJDA 3BNHA 2R0PA 2C75A 4EM4A 4OCGA 3AE9A 4EM3A 1FS7A 1GESA 1OJTA 1ONFA 2GMJA 2OAMA 3IHMA 4U8OA 2XFOA 2J3NA 2YLRA 3IWAA 4II3A 4K7ZA 3ALLA 2WP5A 3IC9A 2BYBA 4DSHA 1H81A 3P4SA 4H2RA 2APGA 3GDNA 4D04A 4Q4UA 3ABVA 4H2NA 4O5QA 3DMEA 3FMWA 3EPTA 1IUWA 1JNRA 3V3NA 4Y4MA 1FOHA 2QA2A 2XYOA 3NYFA 1TDOA 2GAHB 2C3CA 1NENA 4U8PA 5EB5A 3UKPA 1Y56A 1ZMCA 3UTHA 1SEZA 2V5ZA 2WU5A 3NRNA 2F5ZA 1YQZA 2V6OA 2WP9A 4GDPA 2XCGA 4J31A 3CMMA 2YM1A 3VRBA 1GPEA 4JNAA 2V3AA 3CNJA 3K7TA 2EQ9A 2XVEA 3P4PA 4UP3A 4BK3A 3L1RA 3O0HA 2EQ8A 3M12A 3VRDB 1CJ4A 1D7YA 3B6DA 4Q5BA 3DGZA 1GRHA 5L46A 4J2WA 1M1QA 2WU2A 1N4UA 2FBWA 3LOVA 5FS8A 3P4QA 4N9XA 3PVCA 4U8KA 2R45A 2X8HA 3AXBA 3CPHG 3F8RA 3NIXA 3UKKA 1VG0A 1LPFA 4FK1C 3OZ2A 1EL9A 1NEKA 3D1CA 3E1TA 4YT0A 3DJEA 3BNFA 4ICYA 2XLPA 2IVDA 5HXIA 2Z5YA 4CNJA 1GTEA 3HYVA 4OPCA 4EQRA 3BHKA 3AD8B 3AEAA 2OT4A 2Y6RA 1S2YA 1CC6A 3CGCA 3SXIA 4YTPA 5KOXA 3T31A 3BNJA 2BXRA 3BNUA 3GWDA 2V60A 2GEWA 4OPDA 4GR1A 4EQXA 4YKGA 1E1MA 3EF6A 1Y56B 1ZKQA 3G5RA 4CRTA 2BCPA 5U25A 2I0ZA 1K0LA 4H4ZA 1JU2A 4LU6A 3SQPA 1H86A 4MJWA 2BS2A 2Q7VA 2XVJA 1S2QA 3NTAA 1IUSA 1S3BA 4HB9A 4TLXA 1ZMDA 1DOCA 1BGNA 3AE1A 1NG4A 2YG3A 3CIRA 3CN8A 3LJPA 3SZCA 3QVPA 4B65A 4H50A 2XFNA 3C96A 4II2A 3ICSA 4A7AA 5HYMA 2GR0A 3KU9A 2HQMA 4NWZA 1PDHA 1EL8A 2E5VA 4YXDA 1VQWA 2BRYA 1KSUA 2OA1A 2R46A 1DOBA 2XFUA 2YVFA 4I59A 4IVOB 3S61A 4KX6A 3CPIG 1NDAA 3NKSA 4Z2UA 4WCTA 3CGEA 2BABA 1ZY8A 2YG6A 1NAAA 1P2HA 2VVLG 3QFBA 3BNGA 2BK3A 3C4NA 3NYCA 4H4YA 2A8XA 3KD9A 1GRGA 1RYIA 4K8DA 3RNMA 3SM8A 4ADWA 2PYXA 3HYWA 4WX1A 1FT6A 1Q9IA 4Z26A 2JKCA 4HA6A 3DJGX 1Z6LA 2JK6A 1FEAA 1GSNA 2Q0KA 5IQ4A 4H4UA 1BWCA 1PBEA 4U8JA 1REOA 2ARDA 5KWFA 3L1TA 3ZYXA 1GNDA 1PBDA 1ZDLA 1CC2A 4OPTA 3ITJA 4U2LA 1GXFA 2BS3A 3CTYA 1N4WA 3UKHA 4B69A 5JCNA 4EIPA 2H88A 4LA1A 5EB4A 2VVLA 1KDGA 4JY2A 2C65A 4OPGA 5KMRA 2FJAA 5EBKA 4CNKA 3NTDA 1NHQA 2RGHA 3UOXA 1B5QA 1HYUA 1W4XA 4BJYA 5BULA 2B9XA 3D1IA 1KSSA 1COYA 3QVRA 4U8NA 5FS9A 1CHUA 2WPFA 4OPLA 3ALJA 3NK1X 2WDVA 4TM0A 3V76A 4ZCCA 4CY6A 4L3YA 1QO8A 4RG4A 3M13A 1CL0A 2XFQA 4J34A 4JN9A 4Q0TA 1VDCA 1K0IA 2AR8A 3GYJA 4AT2A 2VZ2A 3K7QX 2C3DA 3AB1A 2IIDA 4XXGA 1NHPA 1NPXA 1IUVA 2WQYA 3G5QA 4G73A 2JBVA 3ICTA 1TDFA 3DK4A 5CQFA 4A65A 2VQ7A 1QDBA 4KPRA 3ATQA 3LZXA 1TDKA 4NEVA 4GUVA 4EQWA 5KOWA 1VG9A 3KVEA 2ZO5A 1GRBA 4YTNA 3SXQA 1H84A 3NN0X 2H89A 4H4QA 3VR9A 1O95A 1O5WA 2E81A 2DKIA 4TM4A 1GRAA 3BNMA 4M52A 5CKUA 2J7AA 3GMCA 1PHHA 1PJ5A 1ZP0A 2BC0A 2X50A 4D03A 4EIQA 2Y6QA 4G6GA 4ZCDA 4JQ9A 2OALA 4XWZA 3REDA 3UCLA 4ECHA 5BUKA 4EMWA 1V59A 3VRAA 2GQWA 1DOEA 2X3NA 3T0KA 1OJ9A 3AEBA 3FPZA 4H7UA 2BXSA 1IUUA 2YVGA 3BI5A 3GD3A 3NNEA 3V3OA 4U8LA 4REKA 4C74A 5IPYA 1JNIA 1CBOA 2QCUA 3II4A 3M0OA 4NNJA 4H4PA 3NYEA 3NT6A 1JRZA 1TYPA 1PJ6A 2Q6UA 4UDPA 1D4CA 4J56A 5JCIA 2BACA 1MO9A 4IV9A 3JSKA 4L38A 4E0VA 4EMJA 5EOWA 2WDRA 5KNLA 4X4JA 3UU9A 2X8CA 2QA1A 3NHOX 2FJEA 2NVKX 1M1PA 5J7XA 4K2XA 1QJDA 4Z2TA 1NHRA 1E1NA 2C72A 1YY5A 3C4AA 2Z5XA 2CVJA 5FS7A 3IHGA 3AE2A 4X9MA 4PABA 1ZOYA 3SZFA 4B64A 3GRTA 3KPFA 2O9ZA 4U8IA 2EQ7A 2PHHA 2X8GA 3H4KA 4EQSA 5JCLA 1D5TA 4DGKA 3NN6X 5KMPA 1BKWA 1FS8A 2WEUA 2WDQA 3AE3A 3DJJA 2XLUA 3T2KA 3TORA 3AYLA 3AEFA 3RP6A 5C2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0H A;  4C77 A;  2BK5 A;  4H4T A;  1GRE A;  3LGQ A;  3B3R A;  4JDR A;  4UDQ A;  2NPX A;  4CBQ A;  3AEE A;  4AOX A;  1PXA A;  3ATR A;  4JNQ A;  5JCM A;  2C67 A;  1OJC A;  1FEC A;  2VVM A;  3LXD A;  1BGJ A;  3UOZ A;  4USR A;  4YKF A;  3MMO A;  1SP3 A;  3VQR A;  1PXC A;  3SCE A;  4X9N A;  4PAA A;  3RHA A;  2OLN A;  1ZX9 A;  3DK9 A;  1FL2 A;  1KNP A;  2R4E A;  4P9S A;  3GRS A;  4ZN0 A;  1GT8 A;  3F8P A;  1DJQ A;  1RSG A;  1YQ4 A;  4B67 A;  2WOV A;  1AOG A;  2GF3 A;  3AED A;  3NH3 X;  2C66 A;  4A79 A;  4FK1 A;  4DNA A;  5KVH A;  5U1O A;  1H6V A;  4K22 A;  1NG3 A;  5M10 A;  1JOA A;  2GMH A;  1GRF A;  2JB2 A;  3LAD A;  3I6D A;  3L8K A;  4NZH A;  4BV6 A;  3BHF A;  3AYJ A;  3Q9T A;  4A5L A;  4K5R A;  1E1L A;  4U2T A;  2WBA A;  3PS9 A;  2VOU A;  1FEB A;  1GTH A;  2RGO A;  1E7P A;  1NHS A;  1XDI A;  3UOV A;  3OWM A;  3GSI A;  1GU6 A;  1FCD A;  5TR3 A;  3OC4 A;  2RGJ A;  2LFC A;  5HY5 A;  4BK1 A;  3PO7 A;  2R0C A;  3ICR A;  2C64 A;  3H8I A;  1ZK7 A;  2QAE A;  4Q1O A;  1KFY A;  3ISH A;  1GET A;  3GM6 A;  2DKH A;  1LVL A;  4NTE A;  2CUL A;  2GR1 A;  2WHD A;  1E1K A;  5LV9 A;  2XFP A;  1RP0 A;  4UDR A;  1BVB A;  2V61 A;  1K4Q A;  4K5S A;  2ZZ0 A;  2YM2 A;  4B68 A;  1BZL A;  3QSE A;  2YLX A;  4IVM B;  3NGC X;  4Z24 A;  2WES A;  5KVI A;  1TDE A;  4B1B A;  1MXT A;  5U63 A;  1DOD A;  3Q6J A;  1P2E A;  4OPU A;  2ZZC A;  5J60 A;  2GAG B;  3G5S A;  4Q17 A;  1N4V A;  3KKJ A;  1L0V A;  3AD9 B;  2B9Y A;  1D4E A;  4LII A;  3GYI A;  1F6M A;  2GR3 A;  4GRT A;  2V3B A;  3DH9 A;  2RF7 A;  2B76 A;  2YVJ A;  3AE7 A;  1DXL A;  3NG7 X;  2E4G A;  2WPE A;  3CGB A;  5GSN A;  3KLJ A;  4H4W A;  4O5U A;  2VRL A;  1KF6 A;  1FT5 A;  4J33 A;  2YG4 A;  3UKF A;  2B7S A;  2XVI A;  4YSX A;  1BF3 A;  4USQ A;  4YTM A;  1B8S A;  4APN A;  4H4X A;  4EMI A;  4CCR A;  3CGD A;  2UZZ A;  3CND A;  3H8L A;  3AE8 A;  3F29 A;  1JNZ A;  2R4J A;  5M0Z A;  1B37 A;  1MOK A;  3NK2 X;  3UKA A;  3BI2 A;  2C7G A;  4CCQ A;  4FX9 A;  5GRT A;  3S7W A;  4NEW A;  5DBJ A;  4AP3 A;  2BS4 A;  1TDN A;  4TM1 A;  3NK0 X;  4GF7 A;  2K3V A;  3UTF A;  4Q5C A;  1L9C A;  3UKL A;  2TMD A;  3CPJ G;  2AQJ A;  1PBC A;  3S5W A;  2A89 A;  4J36 A;  4B63 A;  3TTB A;  1PN0 A;  3P4R A;  1PS9 A;  4CY8 A;  2YG7 A;  3QSS A;  2C70 A;  3AEG A;  3ALM A;  2YQU A;  3FG2 P;  1IUT A;  4GDE A;  2WP6 A;  4U2S A;  1M64 A;  1GV4 A;  2WS3 A;  1TRB A;  2XLS A;  3R9U A;  4A99 A;  3RP8 A;  2YWL A;  1K0J A;  5KRQ A;  2GH5 A;  4YSY A;  1ZOV A;  1M1R A;  2WET A;  1F3P A;  4BK2 A;  1H83 A;  4YSH A;  1GAL A;  1Q1R A;  1H7X A;  2A87 A;  3AEC A;  1CJ3 A;  4C3Y A;  2OLO A;  1N1P A;  3URH A;  1LJ1 A;  2IVE A;  4L3X A;  4A6N A;  1EBD A;  2GR2 A;  1EL7 A;  4FDC B;  3K30 A;  3RKH A;  1LQU A;  5ER0 A;  1LQT A;  3VR8 A;  3T37 A;  3QFA A;  1OJD A;  3LG1 A;  5FS6 A;  4A9W A;  3SGL A;  2Q0L A;  2BK4 A;  2CDU A;  2FJD A;  2YLZ A;  5IQ1 A;  4NTD A;  1PBF A;  1DJN A;  3UKQ A;  3GD4 A;  4JY3 A;  3LB8 A;  1F8W A;  1JEH A;  1XPQ A;  1GOS A;  1F8S A;  3FBS A;  1OJA A;  3UTE A;  3WE0 A;  1D7L A;  2X99 A;  4U8M A;  1E6E A;  4C3X A;  1EL5 A;  3DA1 A;  1CJ2 A;  2XLT A;  3IF9 A;  3QJ4 A;  4AT0 A;  1M6I A;  4DSG A;  3AE4 A;  5BVA A;  2AAQ A;  1Y0P A;  1B4V A;  1X31 B;  3AWI A;  1TYT A;  1LTX R;  2GV8 A;  2RAB A;  2TPR A;  1ELI A;  3GWF A;  1GER A;  4L3Z A;  2GRT A;  3DK8 A;  4IA5 A;  4H2P A;  4Y4L A;  3K7M X;  2YG5 A;  2JB1 A;  2ZZB A;  1OAH A;  3ADA B;  3FIM B;  4H4S A;  1L9D A;  1S3E A;  1YQ3 A;  3CNS A;  1CF3 A;  1CJC A;  3AE5 A;  1XHC A;  4TM3 A;  2E1M A;  1IJH A;  1VRQ B;  3P9U A;  4B66 A;  5BRT A;  3EAN A;  2YLW A;  2YLT A;  1Q1W A;  1JRY A;  3SFE A;  2GVC A;  2WOW A;  4AP1 A;  3UBR A;  3I3L A;  2E80 A;  2CFY A;  4XWR A;  4H4V A;  2VQB A;  4Z2R A;  2B7R A;  4Y4N A;  4A6N B;  4TLZ A;  4J57 A;  4H2Q A;  3ZDN A;  1PXB A;  2ZBW A;  2YR4 A;  2XVF A;  2BCG G;  2C76 A;  2GB0 A;  2VRM A;  2XLR A;  5KXJ A;  2RDZ A;  2B9W A;  3GDP A;  2BA9 A;  4I58 A;  4YWO A;  3RP7 A;  4OPI A;  2YR5 A;  1XAN A;  2WPC A;  4H4R A;  4GCM A;  2XVH A;  3CNT A;  3LZW A;  2R9Z A;  3F8D A;  5HHF A;  4Z25 A;  2R0G A;  2WOI A;  1KNR A;  2FJB A;  3P1W A;  1GRT A;  1E39 A;  2ACZ A;  4AOS A;  3UTG A;  5JCK A;  1UKV G;  1PJ7 A;  1PBB A;  3COX A;  3EAO A;  1D4D A;  3AYI A;  3UP5 A;  4BJZ A;  3D8X A;  4RG3 A;  3SFD A;  1H82 A;  4IA6 A;  5C3J A;  3GYX A;  3DGH A;  4WJY A;  1H7W A;  3HZL A;  3NLC A;  4Z43 A;  3QSM A;  2YAU A;  2XDO A;  2YR6 A;  4C5O A;  4OVI A;  1L9E A;  2EQ6 A;  5FMH A;  1QLB A;  2JAE A;  2BC1 A;  3KA7 A;  1O94 A;  2JB3 A;  1FS9 A;  2YLS A;  3AD7 B;  3UP4 A;  1DNC A;  1GEU A;  3CNP A;  2C73 A;  1IUX A;  3AE6 A;  4RSL A;  2VR0 A;  3FO3 A;  3UOY A;  1F8R A;  3GMB A;  1YKJ A;  4NTC A;  4YSZ A;  3BI4 A;  1JRX A;  1CC4 A;  4BUR A;  2GQF A;  4Z44 A;  1LV0 A;  3DJD A;  3BNH A;  2R0P A;  2C75 A;  4EM4 A;  4OCG A;  3AE9 A;  4EM3 A;  1FS7 A;  1GES A;  1OJT A;  1ONF A;  2GMJ A;  2OAM A;  3IHM A;  4U8O A;  2XFO A;  2J3N A;  2YLR A;  3IWA A;  4K7Z A;  3ALL A;  2WP5 A;  3IC9 A;  2BYB A;  4DSH A;  1H81 A;  3P4S A;  4H2R A;  2APG A;  3GDN A;  4D04 A;  4Q4U A;  3ABV A;  4H2N A;  4O5Q A;  3DME A;  3FMW A;  3EPT A;  1IUW A;  1JNR A;  3V3N A;  4Y4M A;  1FOH A;  2QA2 A;  2XYO A;  3NYF A;  1TDO A;  2GAH B;  2C3C A;  1NEN A;  4U8P A;  5EB5 A;  3UKP A;  1Y56 A;  1ZMC A;  3UTH A;  1SEZ A;  2V5Z A;  2WU5 A;  3NRN A;  2F5Z A;  1YQZ A;  2V6O A;  2WP9 A;  4GDP A;  2XCG A;  4J31 A;  2YM1 A;  3VRB A;  1GPE A;  4JNA A;  2V3A A;  3CNJ A;  3K7T A;  2EQ9 A;  2XVE A;  3P4P A;  4UP3 A;  4BK3 A;  3L1R A;  3O0H A;  2EQ8 A;  3M12 A;  3VRD B;  1CJ4 A;  1D7Y A;  3B6D A;  4Q5B A;  3DGZ A;  1GRH A;  5L46 A;  4J2W A;  1M1Q A;  2WU2 A;  1N4U A;  2FBW A;  3LOV A;  5FS8 A;  3P4Q A;  4N9X A;  3PVC A;  4U8K A;  2R45 A;  2X8H A;  3AXB A;  3CPH G;  3F8R A;  3NIX A;  3UKK A;  1VG0 A;  1LPF A;  4FK1 C;  3OZ2 A;  1EL9 A;  1NEK A;  3D1C A;  3E1T A;  4YT0 A;  3DJE A;  3BNF A;  4ICY A;  2XLP A;  2IVD A;  5HXI A;  2Z5Y A;  4CNJ A;  1GTE A;  4OPC A;  4EQR A;  3BHK A;  3AD8 B;  3AEA A;  2OT4 A;  2Y6R A;  1S2Y A;  1CC6 A;  3CGC A;  4YTP A;  5KOX A;  3BNJ A;  2BXR A;  3BNU A;  3GWD A;  2V60 A;  2GEW A;  4OPD A;  4GR1 A;  4EQX A;  4YKG A;  1E1M A;  3EF6 A;  1Y56 B;  1ZKQ A;  3G5R A;  4CRT A;  2BCP A;  5U25 A;  2I0Z A;  1K0L A;  4H4Z A;  1JU2 A;  4LU6 A;  3SQP A;  1H86 A;  4MJW A;  2BS2 A;  2Q7V A;  2XVJ A;  1S2Q A;  3NTA A;  1IUS A;  1S3B A;  4HB9 A;  4TLX A;  1ZMD A;  1DOC A;  1BGN A;  3AE1 A;  1NG4 A;  2YG3 A;  3CIR A;  3CN8 A;  3LJP A;  3QVP A;  4B65 A;  4H50 A;  2XFN A;  3C96 A;  3ICS A;  4A7A A;  5HYM A;  2GR0 A;  3KU9 A;  2HQM A;  1PDH A;  1EL8 A;  2E5V A;  4YXD A;  1VQW A;  1KSU A;  2OA1 A;  2R46 A;  1DOB A;  2XFU A;  2YVF A;  4I59 A;  4IVO B;  3S61 A;  4KX6 A;  3CPI G;  1NDA A;  3NKS A;  4Z2U A;  4WCT A;  3CGE A;  2BAB A;  1ZY8 A;  2YG6 A;  1NAA A;  1P2H A;  2VVL G;  3QFB A;  3BNG A;  2BK3 A;  3C4N A;  3NYC A;  4H4Y A;  2A8X A;  3KD9 A;  1GRG A;  1RYI A;  4K8D A;  3RNM A;  3SM8 A;  4ADW A;  2PYX A;  4WX1 A;  1FT6 A;  1Q9I A;  4Z26 A;  2JKC A;  4HA6 A;  3DJG X;  1Z6L A;  2JK6 A;  1FEA A;  1GSN A;  2Q0K A;  5IQ4 A;  4H4U A;  1BWC A;  1PBE A;  4U8J A;  1REO A;  2ARD A;  5KWF A;  3L1T A;  3ZYX A;  1GND A;  1PBD A;  1ZDL A;  1CC2 A;  4OPT A;  3ITJ A;  4U2L A;  1GXF A;  2BS3 A;  3CTY A;  1N4W A;  3UKH A;  4B69 A;  5JCN A;  4EIP A;  2H88 A;  4LA1 A;  5EB4 A;  2VVL A;  1KDG A;  4JY2 A;  2C65 A;  4OPG A;  2FJA A;  5EBK A;  4CNK A;  3NTD A;  1NHQ A;  2RGH A;  3UOX A;  1B5Q A;  1HYU A;  1W4X A;  4BJY A;  5BUL A;  2B9X A;  3D1I A;  1KSS A;  1COY A;  3QVR A;  4U8N A;  5FS9 A;  1CHU A;  2WPF A;  4OPL A;  3ALJ A;  3NK1 X;  2WDV A;  4TM0 A;  3V76 A;  4ZCC A;  4CY6 A;  4L3Y A;  1QO8 A;  4RG4 A;  3M13 A;  1CL0 A;  2XFQ A;  4J34 A;  4JN9 A;  4Q0T A;  1VDC A;  1K0I A;  2AR8 A;  3GYJ A;  4AT2 A;  2VZ2 A;  3K7Q X;  2C3D A;  3AB1 A;  2IID A;  4XXG A;  1NHP A;  1NPX A;  1IUV A;  2WQY A;  3G5Q A;  5CQF A;  2JBV A;  3ICT A;  1TDF A;  3DK4 A;  4A65 A;  2VQ7 A;  1QDB A;  4KPR A;  3ATQ A;  3LZX A;  1TDK A;  4NEV A;  4GUV A;  4EQW A;  5KOW A;  1VG9 A;  3KVE A;  2ZO5 A;  1GRB A;  4YTN A;  3SXQ A;  1H84 A;  3NN0 X;  2H89 A;  4H4Q A;  3VR9 A;  1O95 A;  1O5W A;  2E81 A;  2DKI A;  4TM4 A;  1GRA A;  3BNM A;  4M52 A;  5CKU A;  2J7A A;  3GMC A;  1PHH A;  1PJ5 A;  1ZP0 A;  2BC0 A;  2X50 A;  4D03 A;  4EIQ A;  2Y6Q A;  4ZCD A;  4JQ9 A;  2OAL A;  4XWZ A;  3RED A;  3UCL A;  4ECH A;  5BUK A;  4EMW A;  1V59 A;  3VRA A;  2GQW A;  1DOE A;  2X3N A;  1OJ9 A;  3AEB A;  3FPZ A;  4H7U A;  2BXS A;  1IUU A;  2YVG A;  3BI5 A;  3GD3 A;  3NNE A;  3V3O A;  4U8L A;  4REK A;  4C74 A;  5IPY A;  1JNI A;  1CBO A;  2QCU A;  3II4 A;  3M0O A;  4H4P A;  3NYE A;  3NT6 A;  1JRZ A;  1TYP A;  1PJ6 A;  2Q6U A;  4UDP A;  1D4C A;  4J56 A;  5JCI A;  2BAC A;  1MO9 A;  4IV9 A;  3JSK A;  4L38 A;  4E0V A;  4EMJ A;  5EOW A;  2WDR A;  4X4J A;  3UU9 A;  2X8C A;  2QA1 A;  3NHO X;  2FJE A;  2NVK X;  1M1P A;  5J7X A;  4K2X A;  1QJD A;  4Z2T A;  1NHR A;  1E1N A;  2C72 A;  1YY5 A;  3C4A A;  2Z5X A;  2CVJ A;  5FS7 A;  3IHG A;  3AE2 A;  4X9M A;  4PAB A;  1ZOY A;  4B64 A;  3GRT A;  3KPF A;  2O9Z A;  4U8I A;  2EQ7 A;  2PHH A;  2X8G A;  3H4K A;  4EQS A;  5JCL A;  1D5T A;  4DGK A;  3NN6 X;  1BKW A;  1FS8 A;  2WEU A;  2WDQ A;  3AE3 A;  3DJJ A;  2XLU A;  3TOR A;  3AYL A;  3AEF A;  3RP6 A;  5C2T A; 
#chains in the Genus database with same CATH topology
 2W0H A;  4C77 A;  2BK5 A;  4H4T A;  1GRE A;  4G9K A;  3LGQ A;  3B3R A;  4JDR A;  4UDQ A;  2NPX A;  4CBQ A;  3AEE A;  4AOX A;  1PXA A;  3ATR A;  4JNQ A;  5JCM A;  2C67 A;  1OJC A;  1FEC A;  2VVM A;  3LXD A;  1BGJ A;  3UOZ A;  4USR A;  4YKF A;  3MMO A;  1SP3 A;  3VQR A;  1PXC A;  3SCE A;  4X9N A;  4PAA A;  3RHA A;  2OLN A;  1ZX9 A;  3DK9 A;  1FL2 A;  1KNP A;  2R4E A;  4P9S A;  3GRS A;  4ZN0 A;  1GT8 A;  3F8P A;  1DJQ A;  1RSG A;  1YQ4 A;  4B67 A;  2WOV A;  1AOG A;  2GF3 A;  3AED A;  3NH3 X;  2C66 A;  4A79 A;  4FK1 A;  4DNA A;  5KVH A;  5U1O A;  1H6V A;  4K22 A;  1NG3 A;  5M10 A;  1JOA A;  2GMH A;  1GRF A;  2C4C A;  2JB2 A;  3I6D A;  3L8K A;  3LAD A;  4NZH A;  3BHF A;  3AYJ A;  3Q9T A;  4A5L A;  4K5R A;  4BV6 A;  1E1L A;  4U2T A;  2WBA A;  4GAP A;  3PS9 A;  2VOU A;  1FEB A;  1GTH A;  2RGO A;  1E7P A;  1NHS A;  1XDI A;  3UOV A;  3OWM A;  3GSI A;  1GU6 A;  1FCD A;  5TR3 A;  3OC4 A;  2RGJ A;  2LFC A;  2BRA A;  5HY5 A;  4BK1 A;  3PO7 A;  3T14 A;  2R0C A;  3ICR A;  2C64 A;  3H8I A;  1ZK7 A;  2QAE A;  4Q1O A;  1KFY A;  3ISH A;  5KMQ A;  1GET A;  3GM6 A;  2DKH A;  1LVL A;  4NTE A;  2CUL A;  2GR1 A;  2WHD A;  1E1K A;  5KMS A;  5LV9 A;  2XFP A;  1RP0 A;  4UDR A;  1BVB A;  2V61 A;  1K4Q A;  4K5S A;  2ZZ0 A;  2YM2 A;  4B68 A;  1BZL A;  3QSE A;  2YLX A;  4IVM B;  3NGC X;  4Z24 A;  2WES A;  5KVI A;  1TDE A;  4B1B A;  1MXT A;  5U63 A;  1DOD A;  3Q6J A;  1P2E A;  4OPU A;  2ZZC A;  5J60 A;  2GAG B;  3G5S A;  4Q17 A;  1N4V A;  3KKJ A;  1L0V A;  3AD9 B;  2B9Y A;  1D4E A;  4LII A;  3GYI A;  1F6M A;  2GR3 A;  4GRT A;  2V3B A;  3DH9 A;  2RF7 A;  2B76 A;  2YVJ A;  3AE7 A;  1DXL A;  3NG7 X;  2E4G A;  2WPE A;  3CGB A;  5GSN A;  3KLJ A;  4H4W A;  4O5U A;  2VRL A;  1KF6 A;  1FT5 A;  4J33 A;  2YG4 A;  3UKF A;  2B7S A;  4GAV A;  2XVI A;  4YSX A;  1BF3 A;  4USQ A;  4YTM A;  1B8S A;  4APN A;  4H4X A;  4EMI A;  4CCR A;  3CGD A;  2UZZ A;  3CND A;  3H8L A;  3AE8 A;  3F29 A;  1JNZ A;  2R4J A;  5M0Z A;  1B37 A;  1MOK A;  3NK2 X;  3UKA A;  3BI2 A;  2C7G A;  4CCQ A;  4FX9 A;  5GRT A;  3S7W A;  4NEW A;  5DBJ A;  4AP3 A;  2BS4 A;  1TDN A;  3KPK A;  3NK0 X;  4TM1 A;  4GF7 A;  2K3V A;  3UTF A;  4Q5C A;  1L9C A;  3UKL A;  2TMD A;  3CPJ G;  2AQJ A;  1PBC A;  4G74 A;  2A89 A;  4J36 A;  3S5W A;  4B63 A;  3TTB A;  1PN0 A;  3P4R A;  1PS9 A;  4CY8 A;  2YG7 A;  3QSS A;  2C70 A;  3AEG A;  3ALM A;  2YQU A;  3FG2 P;  1IUT A;  4GDE A;  2WP6 A;  4U2S A;  1M64 A;  1GV4 A;  2WS3 A;  1TRB A;  2XLS A;  3R9U A;  4A99 A;  3RP8 A;  2YWL A;  1K0J A;  5KRQ A;  2GH5 A;  4YSY A;  1ZOV A;  1M1R A;  2WET A;  1F3P A;  4BK2 A;  1H83 A;  4YSH A;  1GAL A;  1Q1R A;  1H7X A;  2A87 A;  3AEC A;  1CJ3 A;  4C3Y A;  2OLO A;  1N1P A;  3URH A;  1LJ1 A;  2IVE A;  4L3X A;  4A6N A;  1EBD A;  2GR2 A;  1EL7 A;  4FDC B;  3K30 A;  3RKH A;  1LQU A;  5ER0 A;  1LQT A;  3VR8 A;  3T37 A;  3QFA A;  1OJD A;  3LG1 A;  5FS6 A;  4A9W A;  3SGL A;  2Q0L A;  2BK4 A;  2CDU A;  2FJD A;  2YLZ A;  5IQ1 A;  4NTD A;  1PBF A;  1DJN A;  4G6H A;  3GD4 A;  4JY3 A;  3LB8 A;  3UKQ A;  1F8W A;  1JEH A;  1XPQ A;  1GOS A;  1F8S A;  3FBS A;  1OJA A;  3UTE A;  3WE0 A;  1D7L A;  2X99 A;  4U8M A;  1E6E A;  4C3X A;  3SZW A;  1EL5 A;  3DA1 A;  1CJ2 A;  2XLT A;  3IF9 A;  3QJ4 A;  4AT0 A;  1M6I A;  4DSG A;  3AE4 A;  5BVA A;  2AAQ A;  1Y0P A;  1B4V A;  1X31 B;  3AWI A;  1TYT A;  1LTX R;  2GV8 A;  2RAB A;  2TPR A;  1ELI A;  3GWF A;  3SYI A;  1GER A;  4L3Z A;  2GRT A;  3DK8 A;  4IA5 A;  4H2P A;  4Y4L A;  3K7M X;  2YG5 A;  2JB1 A;  2ZZB A;  1OAH A;  3ADA B;  3FIM B;  4H4S A;  1L9D A;  1S3E A;  1YQ3 A;  3CNS A;  3SZ0 A;  1CF3 A;  1CJC A;  3AE5 A;  1XHC A;  4TM3 A;  2E1M A;  1IJH A;  1VRQ B;  3P9U A;  4B66 A;  5BRT A;  3EAN A;  2YLW A;  2YLT A;  1Q1W A;  1JRY A;  3SFE A;  2GVC A;  2WOW A;  4AP1 A;  3UBR A;  3I3L A;  2E80 A;  2CFY A;  4XWR A;  4H4V A;  2VQB A;  3T2Z A;  4Z2R A;  2B7R A;  4Y4N A;  4A6N B;  4TLZ A;  4J57 A;  3HYX A;  4H2Q A;  3ZDN A;  1PXB A;  2ZBW A;  2YR4 A;  2XVF A;  2BCG G;  2C76 A;  2GB0 A;  2VRM A;  2XLR A;  5KXJ A;  2RDZ A;  2B9W A;  3GDP A;  2BA9 A;  4I58 A;  4YWO A;  3RP7 A;  4OPI A;  2YR5 A;  1XAN A;  2WPC A;  4H4R A;  4GCM A;  2XVH A;  3CNT A;  3LZW A;  2R9Z A;  3F8D A;  5HHF A;  4Z25 A;  2R0G A;  2WOI A;  1KNR A;  2FJB A;  3P1W A;  1GRT A;  1E39 A;  2ACZ A;  4AOS A;  3UTG A;  5JCK A;  1UKV G;  1PJ7 A;  1PBB A;  3COX A;  3EAO A;  1D4D A;  3AYI A;  3T2Y A;  3UP5 A;  3D8X A;  4RG3 A;  4BJZ A;  3SFD A;  1H82 A;  4IA6 A;  3GYX A;  5C3J A;  3DGH A;  4WJY A;  1H7W A;  3HZL A;  3NLC A;  4Z43 A;  3QSM A;  2YAU A;  2XDO A;  2YR6 A;  4C5O A;  4OVI A;  1L9E A;  2EQ6 A;  5FMH A;  1QLB A;  2JAE A;  2BC1 A;  3KA7 A;  1O94 A;  2JB3 A;  1FS9 A;  2YLS A;  3AD7 B;  3UP4 A;  1DNC A;  1GEU A;  3CNP A;  2C73 A;  3SY4 A;  1IUX A;  3AE6 A;  4RSL A;  2VR0 A;  3FO3 A;  3UOY A;  1F8R A;  3GMB A;  1YKJ A;  4NTC A;  4YSZ A;  3BI4 A;  1JRX A;  1CC4 A;  4BUR A;  3SX6 A;  2GQF A;  4Z44 A;  1LV0 A;  3DJD A;  3BNH A;  2R0P A;  2C75 A;  4EM4 A;  4OCG A;  3AE9 A;  4EM3 A;  1FS7 A;  1GES A;  1OJT A;  1ONF A;  2GMJ A;  2OAM A;  3IHM A;  4U8O A;  2XFO A;  2J3N A;  2YLR A;  3IWA A;  4II3 A;  4K7Z A;  3ALL A;  2WP5 A;  3IC9 A;  2BYB A;  4DSH A;  1H81 A;  3P4S A;  4H2R A;  2APG A;  3GDN A;  4D04 A;  4Q4U A;  3ABV A;  4H2N A;  4O5Q A;  3DME A;  3FMW A;  3EPT A;  1IUW A;  1JNR A;  3V3N A;  4Y4M A;  1FOH A;  2QA2 A;  2XYO A;  3NYF A;  1TDO A;  2GAH B;  2C3C A;  1NEN A;  4U8P A;  5EB5 A;  3UKP A;  1Y56 A;  1ZMC A;  3UTH A;  1SEZ A;  2V5Z A;  2WU5 A;  3NRN A;  2F5Z A;  1YQZ A;  2V6O A;  2WP9 A;  4GDP A;  2XCG A;  4J31 A;  3CMM A;  2YM1 A;  3VRB A;  1GPE A;  4JNA A;  2V3A A;  3CNJ A;  3K7T A;  2EQ9 A;  2XVE A;  3P4P A;  4UP3 A;  4BK3 A;  3L1R A;  3O0H A;  2EQ8 A;  3M12 A;  3VRD B;  1CJ4 A;  1D7Y A;  3B6D A;  4Q5B A;  3DGZ A;  1GRH A;  5L46 A;  4J2W A;  1M1Q A;  2WU2 A;  1N4U A;  2FBW A;  3LOV A;  5FS8 A;  3P4Q A;  4N9X A;  3PVC A;  4U8K A;  2R45 A;  2X8H A;  3AXB A;  3CPH G;  3F8R A;  3NIX A;  3UKK A;  1VG0 A;  1LPF A;  4FK1 C;  3OZ2 A;  1EL9 A;  1NEK A;  3D1C A;  3E1T A;  4YT0 A;  3DJE A;  3BNF A;  4ICY A;  2XLP A;  2IVD A;  5HXI A;  2Z5Y A;  4CNJ A;  1GTE A;  3HYV A;  4OPC A;  4EQR A;  3BHK A;  3AD8 B;  3AEA A;  2OT4 A;  2Y6R A;  1S2Y A;  1CC6 A;  3CGC A;  3SXI A;  4YTP A;  5KOX A;  3T31 A;  3BNJ A;  2BXR A;  3BNU A;  3GWD A;  2V60 A;  2GEW A;  4OPD A;  4GR1 A;  4EQX A;  4YKG A;  1E1M A;  3EF6 A;  1Y56 B;  1ZKQ A;  3G5R A;  4CRT A;  2BCP A;  5U25 A;  2I0Z A;  1K0L A;  4H4Z A;  1JU2 A;  4LU6 A;  3SQP A;  1H86 A;  4MJW A;  2BS2 A;  2Q7V A;  2XVJ A;  1S2Q A;  3NTA A;  1IUS A;  1S3B A;  4HB9 A;  4TLX A;  1ZMD A;  1DOC A;  1BGN A;  3AE1 A;  1NG4 A;  2YG3 A;  3CIR A;  3CN8 A;  3LJP A;  3SZC A;  3QVP A;  4B65 A;  4H50 A;  2XFN A;  3C96 A;  4II2 A;  3ICS A;  4A7A A;  5HYM A;  2GR0 A;  3KU9 A;  2HQM A;  4NWZ A;  1PDH A;  1EL8 A;  2E5V A;  4YXD A;  1VQW A;  2BRY A;  1KSU A;  2OA1 A;  2R46 A;  1DOB A;  2CZS A;  2XFU A;  2YVF A;  4I59 A;  4IVO B;  3S61 A;  4KX6 A;  3CPI G;  1NDA A;  3NKS A;  4Z2U A;  4WCT A;  3CGE A;  2BAB A;  1ZY8 A;  2YG6 A;  1NAA A;  1P2H A;  2VVL G;  3QFB A;  3BNG A;  2BK3 A;  3C4N A;  3NYC A;  4H4Y A;  2A8X A;  3KD9 A;  1GRG A;  1RYI A;  4K8D A;  3RNM A;  3SM8 A;  4ADW A;  2PYX A;  3HYW A;  4WX1 A;  1FT6 A;  1Q9I A;  4Z26 A;  2JKC A;  4HA6 A;  3DJG X;  1Z6L A;  2JK6 A;  1FEA A;  1GSN A;  2Q0K A;  5IQ4 A;  4H4U A;  1BWC A;  1PBE A;  4U8J A;  1REO A;  2ARD A;  5KWF A;  3L1T A;  3ZYX A;  1GND A;  1PBD A;  1ZDL A;  1CC2 A;  4OPT A;  3ITJ A;  4U2L A;  1GXF A;  2BS3 A;  3CTY A;  1N4W A;  3UKH A;  4B69 A;  5JCN A;  4EIP A;  2H88 A;  4LA1 A;  5EB4 A;  2VVL A;  1KDG A;  4JY2 A;  2C65 A;  4OPG A;  5KMR A;  2FJA A;  5EBK A;  4CNK A;  3NTD A;  1NHQ A;  2RGH A;  3UOX A;  1B5Q A;  1HYU A;  1W4X A;  4BJY A;  5BUL A;  2B9X A;  3D1I A;  1KSS A;  1COY A;  3QVR A;  4U8N A;  5FS9 A;  1CHU A;  2WPF A;  4OPL A;  3ALJ A;  3NK1 X;  2WDV A;  4TM0 A;  3V76 A;  4ZCC A;  4CY6 A;  4L3Y A;  1QO8 A;  4RG4 A;  3M13 A;  1CL0 A;  2XFQ A;  4J34 A;  4JN9 A;  4Q0T A;  1VDC A;  1K0I A;  2AR8 A;  3GYJ A;  4AT2 A;  2VZ2 A;  3K7Q X;  2C3D A;  3AB1 A;  2IID A;  4XXG A;  1NHP A;  1NPX A;  1IUV A;  2WQY A;  3G5Q A;  4G73 A;  2JBV A;  3ICT A;  1TDF A;  3DK4 A;  5CQF A;  4A65 A;  2VQ7 A;  1QDB A;  4KPR A;  3ATQ A;  3LZX A;  1TDK A;  4NEV A;  4GUV A;  4EQW A;  5KOW A;  1VG9 A;  3KVE A;  2ZO5 A;  1GRB A;  4YTN A;  3SXQ A;  1H84 A;  3NN0 X;  2H89 A;  4H4Q A;  3VR9 A;  1O95 A;  1O5W A;  2E81 A;  2DKI A;  4TM4 A;  1GRA A;  3BNM A;  4M52 A;  5CKU A;  2J7A A;  3GMC A;  1PHH A;  1PJ5 A;  1ZP0 A;  2BC0 A;  2X50 A;  4D03 A;  4EIQ A;  2Y6Q A;  4G6G A;  4ZCD A;  4JQ9 A;  2OAL A;  4XWZ A;  3RED A;  3UCL A;  4ECH A;  5BUK A;  4EMW A;  1V59 A;  3VRA A;  2GQW A;  1DOE A;  2X3N A;  3T0K A;  1OJ9 A;  3AEB A;  3FPZ A;  4H7U A;  2BXS A;  1IUU A;  2YVG A;  3BI5 A;  3GD3 A;  3NNE A;  3V3O A;  4U8L A;  4REK A;  4C74 A;  5IPY A;  1JNI A;  1CBO A;  2QCU A;  3II4 A;  3M0O A;  4NNJ A;  4H4P A;  3NYE A;  3NT6 A;  1JRZ A;  1TYP A;  1PJ6 A;  2Q6U A;  4UDP A;  1D4C A;  4J56 A;  5JCI A;  2BAC A;  1MO9 A;  4IV9 A;  3JSK A;  4L38 A;  4E0V A;  4EMJ A;  5EOW A;  2WDR A;  5KNL A;  4X4J A;  3UU9 A;  2X8C A;  2QA1 A;  3NHO X;  2FJE A;  2NVK X;  1M1P A;  5J7X A;  4K2X A;  1QJD A;  4Z2T A;  1NHR A;  1E1N A;  2C72 A;  1YY5 A;  3C4A A;  2Z5X A;  2CVJ A;  5FS7 A;  3IHG A;  3AE2 A;  4X9M A;  4PAB A;  1ZOY A;  3SZF A;  4B64 A;  3GRT A;  3KPF A;  2O9Z A;  4U8I A;  2EQ7 A;  2PHH A;  2X8G A;  3H4K A;  4EQS A;  5JCL A;  1D5T A;  4DGK A;  3NN6 X;  5KMP A;  1BKW A;  1FS8 A;  2WEU A;  2WDQ A;  3AE3 A;  3DJJ A;  2XLU A;  3T2K A;  3TOR A;  3AYL A;  3AEF A;  3RP6 A;  5C2T A; 
#chains in the Genus database with same CATH homology
 2W0H A;  4C77 A;  2BK5 A;  4H4T A;  1GRE A;  4G9K A;  3LGQ A;  3B3R A;  4JDR A;  4UDQ A;  2NPX A;  4CBQ A;  3AEE A;  4AOX A;  1PXA A;  3ATR A;  4JNQ A;  5JCM A;  2C67 A;  1OJC A;  1FEC A;  2VVM A;  3LXD A;  1BGJ A;  3UOZ A;  4USR A;  4YKF A;  3MMO A;  1SP3 A;  3VQR A;  1PXC A;  3SCE A;  4X9N A;  4PAA A;  3RHA A;  2OLN A;  1ZX9 A;  3DK9 A;  1FL2 A;  1KNP A;  2R4E A;  4P9S A;  3GRS A;  4ZN0 A;  1GT8 A;  3F8P A;  1DJQ A;  1RSG A;  1YQ4 A;  4B67 A;  2WOV A;  1AOG A;  2GF3 A;  3AED A;  3NH3 X;  2C66 A;  4A79 A;  4FK1 A;  4DNA A;  5KVH A;  5U1O A;  1H6V A;  4K22 A;  1NG3 A;  5M10 A;  1JOA A;  2GMH A;  1GRF A;  2C4C A;  2JB2 A;  3I6D A;  3L8K A;  3LAD A;  4NZH A;  3BHF A;  3AYJ A;  3Q9T A;  4A5L A;  4K5R A;  4BV6 A;  1E1L A;  4U2T A;  2WBA A;  4GAP A;  3PS9 A;  2VOU A;  1FEB A;  1GTH A;  2RGO A;  1E7P A;  1NHS A;  1XDI A;  3UOV A;  3OWM A;  3GSI A;  1GU6 A;  1FCD A;  5TR3 A;  3OC4 A;  2RGJ A;  2LFC A;  2BRA A;  5HY5 A;  4BK1 A;  3PO7 A;  3T14 A;  2R0C A;  3ICR A;  2C64 A;  3H8I A;  1ZK7 A;  2QAE A;  4Q1O A;  1KFY A;  3ISH A;  5KMQ A;  1GET A;  3GM6 A;  2DKH A;  1LVL A;  4NTE A;  2CUL A;  2GR1 A;  2WHD A;  1E1K A;  5KMS A;  5LV9 A;  2XFP A;  1RP0 A;  4UDR A;  1BVB A;  2V61 A;  1K4Q A;  4K5S A;  2ZZ0 A;  2YM2 A;  4B68 A;  1BZL A;  3QSE A;  2YLX A;  4IVM B;  3NGC X;  4Z24 A;  2WES A;  5KVI A;  1TDE A;  4B1B A;  1MXT A;  5U63 A;  1DOD A;  3Q6J A;  1P2E A;  4OPU A;  2ZZC A;  5J60 A;  2GAG B;  3G5S A;  4Q17 A;  1N4V A;  3KKJ A;  1L0V A;  3AD9 B;  2B9Y A;  1D4E A;  4LII A;  3GYI A;  1F6M A;  2GR3 A;  4GRT A;  2V3B A;  3DH9 A;  2RF7 A;  2B76 A;  2YVJ A;  3AE7 A;  1DXL A;  3NG7 X;  2E4G A;  2WPE A;  3CGB A;  5GSN A;  3KLJ A;  4H4W A;  4O5U A;  2VRL A;  1KF6 A;  1FT5 A;  4J33 A;  2YG4 A;  3UKF A;  2B7S A;  4GAV A;  2XVI A;  4YSX A;  1BF3 A;  4USQ A;  4YTM A;  1B8S A;  4APN A;  4H4X A;  4EMI A;  4CCR A;  3CGD A;  2UZZ A;  3CND A;  3H8L A;  3AE8 A;  3F29 A;  1JNZ A;  2R4J A;  5M0Z A;  1B37 A;  1MOK A;  3NK2 X;  3UKA A;  3BI2 A;  2C7G A;  4CCQ A;  4FX9 A;  5GRT A;  3S7W A;  4NEW A;  5DBJ A;  4AP3 A;  2BS4 A;  1TDN A;  3KPK A;  3NK0 X;  4TM1 A;  4GF7 A;  2K3V A;  3UTF A;  4Q5C A;  1L9C A;  3UKL A;  2TMD A;  3CPJ G;  2AQJ A;  1PBC A;  4G74 A;  2A89 A;  4J36 A;  3S5W A;  4B63 A;  3TTB A;  1PN0 A;  3P4R A;  1PS9 A;  4CY8 A;  2YG7 A;  3QSS A;  2C70 A;  3AEG A;  3ALM A;  2YQU A;  3FG2 P;  1IUT A;  4GDE A;  2WP6 A;  4U2S A;  1M64 A;  1GV4 A;  2WS3 A;  1TRB A;  2XLS A;  3R9U A;  4A99 A;  3RP8 A;  2YWL A;  1K0J A;  5KRQ A;  2GH5 A;  4YSY A;  1ZOV A;  1M1R A;  2WET A;  1F3P A;  4BK2 A;  1H83 A;  4YSH A;  1GAL A;  1Q1R A;  1H7X A;  2A87 A;  3AEC A;  1CJ3 A;  4C3Y A;  2OLO A;  1N1P A;  3URH A;  1LJ1 A;  2IVE A;  4L3X A;  4A6N A;  1EBD A;  2GR2 A;  1EL7 A;  4FDC B;  3K30 A;  3RKH A;  1LQU A;  5ER0 A;  1LQT A;  3VR8 A;  3T37 A;  3QFA A;  1OJD A;  3LG1 A;  5FS6 A;  4A9W A;  3SGL A;  2Q0L A;  2BK4 A;  2CDU A;  2FJD A;  2YLZ A;  5IQ1 A;  4NTD A;  1PBF A;  1DJN A;  4G6H A;  3GD4 A;  4JY3 A;  3LB8 A;  3UKQ A;  1F8W A;  1JEH A;  1XPQ A;  1GOS A;  1F8S A;  3FBS A;  1OJA A;  3UTE A;  3WE0 A;  1D7L A;  2X99 A;  4U8M A;  1E6E A;  4C3X A;  3SZW A;  1EL5 A;  3DA1 A;  1CJ2 A;  2XLT A;  3IF9 A;  3QJ4 A;  4AT0 A;  1M6I A;  4DSG A;  3AE4 A;  5BVA A;  2AAQ A;  1Y0P A;  1B4V A;  1X31 B;  3AWI A;  1TYT A;  1LTX R;  2GV8 A;  2RAB A;  2TPR A;  1ELI A;  3GWF A;  3SYI A;  1GER A;  4L3Z A;  2GRT A;  3DK8 A;  4IA5 A;  4H2P A;  4Y4L A;  3K7M X;  2YG5 A;  2JB1 A;  2ZZB A;  1OAH A;  3ADA B;  3FIM B;  4H4S A;  1L9D A;  1S3E A;  1YQ3 A;  3CNS A;  3SZ0 A;  1CF3 A;  1CJC A;  3AE5 A;  1XHC A;  4TM3 A;  2E1M A;  1IJH A;  1VRQ B;  3P9U A;  4B66 A;  5BRT A;  3EAN A;  2YLW A;  2YLT A;  1Q1W A;  1JRY A;  3SFE A;  2GVC A;  2WOW A;  4AP1 A;  3UBR A;  3I3L A;  2E80 A;  2CFY A;  4XWR A;  4H4V A;  2VQB A;  3T2Z A;  4Z2R A;  2B7R A;  4Y4N A;  4A6N B;  4TLZ A;  4J57 A;  3HYX A;  4H2Q A;  3ZDN A;  1PXB A;  2ZBW A;  2YR4 A;  2XVF A;  2BCG G;  2C76 A;  2GB0 A;  2VRM A;  2XLR A;  5KXJ A;  2RDZ A;  2B9W A;  3GDP A;  2BA9 A;  4I58 A;  4YWO A;  3RP7 A;  4OPI A;  2YR5 A;  1XAN A;  2WPC A;  4H4R A;  4GCM A;  2XVH A;  3CNT A;  3LZW A;  2R9Z A;  3F8D A;  5HHF A;  4Z25 A;  2R0G A;  2WOI A;  1KNR A;  2FJB A;  3P1W A;  1GRT A;  1E39 A;  2ACZ A;  4AOS A;  3UTG A;  5JCK A;  1UKV G;  1PJ7 A;  1PBB A;  3COX A;  3EAO A;  1D4D A;  3AYI A;  3T2Y A;  3UP5 A;  3D8X A;  4RG3 A;  4BJZ A;  3SFD A;  1H82 A;  4IA6 A;  3GYX A;  5C3J A;  3DGH A;  4WJY A;  1H7W A;  3HZL A;  3NLC A;  4Z43 A;  3QSM A;  2YAU A;  2XDO A;  2YR6 A;  4C5O A;  4OVI A;  1L9E A;  2EQ6 A;  5FMH A;  1QLB A;  2JAE A;  2BC1 A;  3KA7 A;  1O94 A;  2JB3 A;  1FS9 A;  2YLS A;  3AD7 B;  3UP4 A;  1DNC A;  1GEU A;  3CNP A;  2C73 A;  3SY4 A;  1IUX A;  3AE6 A;  4RSL A;  2VR0 A;  3FO3 A;  3UOY A;  1F8R A;  3GMB A;  1YKJ A;  4NTC A;  4YSZ A;  3BI4 A;  1JRX A;  1CC4 A;  4BUR A;  3SX6 A;  2GQF A;  4Z44 A;  1LV0 A;  3DJD A;  3BNH A;  2R0P A;  2C75 A;  4EM4 A;  4OCG A;  3AE9 A;  4EM3 A;  1FS7 A;  1GES A;  1OJT A;  1ONF A;  2GMJ A;  2OAM A;  3IHM A;  4U8O A;  2XFO A;  2J3N A;  2YLR A;  3IWA A;  4II3 A;  4K7Z A;  3ALL A;  2WP5 A;  3IC9 A;  2BYB A;  4DSH A;  1H81 A;  3P4S A;  4H2R A;  2APG A;  3GDN A;  4D04 A;  4Q4U A;  3ABV A;  4H2N A;  4O5Q A;  3DME A;  3FMW A;  3EPT A;  1IUW A;  1JNR A;  3V3N A;  4Y4M A;  1FOH A;  2QA2 A;  2XYO A;  3NYF A;  1TDO A;  2GAH B;  2C3C A;  1NEN A;  4U8P A;  5EB5 A;  3UKP A;  1Y56 A;  1ZMC A;  3UTH A;  1SEZ A;  2V5Z A;  2WU5 A;  3NRN A;  2F5Z A;  1YQZ A;  2V6O A;  2WP9 A;  4GDP A;  2XCG A;  4J31 A;  3CMM A;  2YM1 A;  3VRB A;  1GPE A;  4JNA A;  2V3A A;  3CNJ A;  3K7T A;  2EQ9 A;  2XVE A;  3P4P A;  4UP3 A;  4BK3 A;  3L1R A;  3O0H A;  2EQ8 A;  3M12 A;  3VRD B;  1CJ4 A;  1D7Y A;  3B6D A;  4Q5B A;  3DGZ A;  1GRH A;  5L46 A;  4J2W A;  1M1Q A;  2WU2 A;  1N4U A;  2FBW A;  3LOV A;  5FS8 A;  3P4Q A;  4N9X A;  3PVC A;  4U8K A;  2R45 A;  2X8H A;  3AXB A;  3CPH G;  3F8R A;  3NIX A;  3UKK A;  1VG0 A;  1LPF A;  4FK1 C;  3OZ2 A;  1EL9 A;  1NEK A;  3D1C A;  3E1T A;  4YT0 A;  3DJE A;  3BNF A;  4ICY A;  2XLP A;  2IVD A;  5HXI A;  2Z5Y A;  4CNJ A;  1GTE A;  3HYV A;  4OPC A;  4EQR A;  3BHK A;  3AD8 B;  3AEA A;  2OT4 A;  2Y6R A;  1S2Y A;  1CC6 A;  3CGC A;  3SXI A;  4YTP A;  5KOX A;  3T31 A;  3BNJ A;  2BXR A;  3BNU A;  3GWD A;  2V60 A;  2GEW A;  4OPD A;  4GR1 A;  4EQX A;  4YKG A;  1E1M A;  3EF6 A;  1Y56 B;  1ZKQ A;  3G5R A;  4CRT A;  2BCP A;  5U25 A;  2I0Z A;  1K0L A;  4H4Z A;  1JU2 A;  4LU6 A;  3SQP A;  1H86 A;  4MJW A;  2BS2 A;  2Q7V A;  2XVJ A;  1S2Q A;  3NTA A;  1IUS A;  1S3B A;  4HB9 A;  4TLX A;  1ZMD A;  1DOC A;  1BGN A;  3AE1 A;  1NG4 A;  2YG3 A;  3CIR A;  3CN8 A;  3LJP A;  3SZC A;  3QVP A;  4B65 A;  4H50 A;  2XFN A;  3C96 A;  4II2 A;  3ICS A;  4A7A A;  5HYM A;  2GR0 A;  3KU9 A;  2HQM A;  4NWZ A;  1PDH A;  1EL8 A;  2E5V A;  4YXD A;  1VQW A;  2BRY A;  1KSU A;  2OA1 A;  2R46 A;  1DOB A;  2XFU A;  2YVF A;  4I59 A;  4IVO B;  3S61 A;  4KX6 A;  3CPI G;  1NDA A;  3NKS A;  4Z2U A;  4WCT A;  3CGE A;  2BAB A;  1ZY8 A;  2YG6 A;  1NAA A;  1P2H A;  2VVL G;  3QFB A;  3BNG A;  2BK3 A;  3C4N A;  3NYC A;  4H4Y A;  2A8X A;  3KD9 A;  1GRG A;  1RYI A;  4K8D A;  3RNM A;  3SM8 A;  4ADW A;  2PYX A;  3HYW A;  4WX1 A;  1FT6 A;  1Q9I A;  4Z26 A;  2JKC A;  4HA6 A;  3DJG X;  1Z6L A;  2JK6 A;  1FEA A;  1GSN A;  2Q0K A;  5IQ4 A;  4H4U A;  1BWC A;  1PBE A;  4U8J A;  1REO A;  2ARD A;  5KWF A;  3L1T A;  3ZYX A;  1GND A;  1PBD A;  1ZDL A;  1CC2 A;  4OPT A;  3ITJ A;  4U2L A;  1GXF A;  2BS3 A;  3CTY A;  1N4W A;  3UKH A;  4B69 A;  5JCN A;  4EIP A;  2H88 A;  4LA1 A;  5EB4 A;  2VVL A;  1KDG A;  4JY2 A;  2C65 A;  4OPG A;  5KMR A;  2FJA A;  5EBK A;  4CNK A;  3NTD A;  1NHQ A;  2RGH A;  3UOX A;  1B5Q A;  1HYU A;  1W4X A;  4BJY A;  5BUL A;  2B9X A;  3D1I A;  1KSS A;  1COY A;  3QVR A;  4U8N A;  5FS9 A;  1CHU A;  2WPF A;  4OPL A;  3ALJ A;  3NK1 X;  2WDV A;  4TM0 A;  3V76 A;  4ZCC A;  4CY6 A;  4L3Y A;  1QO8 A;  4RG4 A;  3M13 A;  1CL0 A;  2XFQ A;  4J34 A;  4JN9 A;  4Q0T A;  1VDC A;  1K0I A;  2AR8 A;  3GYJ A;  4AT2 A;  2VZ2 A;  3K7Q X;  2C3D A;  3AB1 A;  2IID A;  4XXG A;  1NHP A;  1NPX A;  1IUV A;  2WQY A;  3G5Q A;  4G73 A;  2JBV A;  3ICT A;  1TDF A;  3DK4 A;  5CQF A;  4A65 A;  2VQ7 A;  1QDB A;  4KPR A;  3ATQ A;  3LZX A;  1TDK A;  4NEV A;  4GUV A;  4EQW A;  5KOW A;  1VG9 A;  3KVE A;  2ZO5 A;  1GRB A;  4YTN A;  3SXQ A;  1H84 A;  3NN0 X;  2H89 A;  4H4Q A;  3VR9 A;  1O95 A;  1O5W A;  2E81 A;  2DKI A;  4TM4 A;  1GRA A;  3BNM A;  4M52 A;  5CKU A;  2J7A A;  3GMC A;  1PHH A;  1PJ5 A;  1ZP0 A;  2BC0 A;  2X50 A;  4D03 A;  4EIQ A;  2Y6Q A;  4G6G A;  4ZCD A;  4JQ9 A;  2OAL A;  4XWZ A;  3RED A;  3UCL A;  4ECH A;  5BUK A;  4EMW A;  1V59 A;  3VRA A;  2GQW A;  1DOE A;  2X3N A;  3T0K A;  1OJ9 A;  3AEB A;  3FPZ A;  4H7U A;  2BXS A;  1IUU A;  2YVG A;  3BI5 A;  3GD3 A;  3NNE A;  3V3O A;  4U8L A;  4REK A;  4C74 A;  5IPY A;  1JNI A;  1CBO A;  2QCU A;  3II4 A;  3M0O A;  4NNJ A;  4H4P A;  3NYE A;  3NT6 A;  1JRZ A;  1TYP A;  1PJ6 A;  2Q6U A;  4UDP A;  1D4C A;  4J56 A;  5JCI A;  2BAC A;  1MO9 A;  4IV9 A;  3JSK A;  4L38 A;  4E0V A;  4EMJ A;  5EOW A;  2WDR A;  5KNL A;  4X4J A;  3UU9 A;  2X8C A;  2QA1 A;  3NHO X;  2FJE A;  2NVK X;  1M1P A;  5J7X A;  4K2X A;  1QJD A;  4Z2T A;  1NHR A;  1E1N A;  2C72 A;  1YY5 A;  3C4A A;  2Z5X A;  2CVJ A;  5FS7 A;  3IHG A;  3AE2 A;  4X9M A;  4PAB A;  1ZOY A;  3SZF A;  4B64 A;  3GRT A;  3KPF A;  2O9Z A;  4U8I A;  2EQ7 A;  2PHH A;  2X8G A;  3H4K A;  4EQS A;  5JCL A;  1D5T A;  4DGK A;  3NN6 X;  5KMP A;  1BKW A;  1FS8 A;  2WEU A;  2WDQ A;  3AE3 A;  3DJJ A;  2XLU A;  3T2K A;  3TOR A;  3AYL A;  3AEF A;  3RP6 A;  5C2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...