1QJOA

Innermost lipoyl domain of the pyruvate dehydrogenase from escherichia coli
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
80
structure length
80
Chain Sequence
MVKEVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Restricted motion of the lipoyl-lysine swinging arm in the pyruvate dehydrogenase complex of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Dihydrolipoamide acetyltransferase
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE
total genus 7
structure length 80
sequence length 80
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1999-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qjoA00
3AB9A 1IW7D 1O78A 1GUNA 3QG1A 5KNCA 2JEAI 2D62A 3FMCA 1OXXK 1BDOA 2LMCB 3T56B 3ND9A 1O7LA 3L7ZC 1T5EA 1FYCA 1Y8PB 2BE5C 3PUZA 5K36G 1H9JA 4OO1G 2L5TA 3M7NA 1GUOA 1DXMA 5KNDA 4BA1I 2JE6I 2E76C 3BG3A 3VR5A 1GHKA 4DNTB 5C0XG 4DK1A 2ZT9C 1IYUA 3OW7A 1H9KA 4I7ZC 4KKTA 1YNJC 2K32A 2V4DA 1I6VC 1QJOA 3I73A 1OXSC 4IFDH 3A8JE 2NN6H 4JK1C 3P20A 3RLFA 3SE0A 2KCCA 1YNNC 4L8JA 4KKUA 4KN7C 1CI3M 3T51B 4KI0A 1Q1EA 2R6GA 1TU2B 2EVBA 2IT1A 2Q8IB 5KNBA 3M85A 1GHJA 2B8FA 3CRKC 2O5IC 1Q90A 1IW7C 4G7ZC 2A68C 1B9MA 1V43A 2A6HC 5JEAH 4TQUS 2K7VA 3PUVA 2AUJD 1Y69U 1Y8OB 2A68D 1VF5C 3PV0A 4PV1C 3A7LA 3GQBA 2AUKA 3A8KE 4OGQC 2EJGC 2CW0C 4TKOB 2QF7A 2BA1A 3VR6A 2K33A 3M4YA 1Q12A 1B9NA 5K36H 3D4RA 1V8QA 1CTMA 3OPOA 1CFMA 4G7OC 3FPPA 1IYVA 1H9SB 4H0LC 5BN5A 2EJMA 4HR7B 1LACA 1DD2A 2D5DA 3I72A 2B8GA 1Z7TA 2A69D 2AWOA 4KN4C 1OXUA 3PUWA 2DNCA 3PUXA 4LK1C 5C0XH 3A8IE 2EDGA 3DXJC 1HPCA 3A7AB 4KMUC 1FR3A 1ZYRC 1A6XA 1E2WA 4JBWA 5JEAG 2JEBI 2EJFC 1DCZA 2BE5D 2PNRC 3IKJA 3TZUA 4OO1H 1GJXA 2F1MA 2A6HD 4IQZA 3PUYA 1GUGA 1ZKOA 2BDOA 2KA7A 2E75C 3VR4A 3MXUA 4XTCS 1GUSA 3MFYA 2D2CC 2PPBC 3D31A 3H94A 1VCIA 3HGBA 3IFTA 3OOCA 4H44C 4G7HC 3CRLC 3N6RA 3T53B 2BA0A 3LNNA 3KLRA 3ND8A 2A6ED 3VR2A 1HQMC 2A69C 2DNEA 1K8MA 1Q1BA 2YYZA 3BDOA 1PMRA 3QJYA 4KKSA 3SDZA 3QIAA 5BN4A 1G291 4DNRB 1HTPA 5A35A 1LABA 1K8OA 3W3AA 1E2ZA 1H9MA 3WDNA 1E2VA 4BA2I 4LJZC 1TKWB 3EQLC 1ONLA 3NE5B 4H13C 2A6EC 1VDZA 1VF7A 4DK0A 4GZYC 4XIGS 1H9SA 2NN6I 1GUTA 3I4LA 1Y8NB 3LWUA 1HCZA 4IFDG 3U9SA 2DN8A 2E74C 4RCNA 5BN3A 3VA7A 1EWHA 3VR3A 1OXTA 4KHZA 1Z6HA 2PCFB 2O5JC 2NN6G 1SMYC 2JXMB 1OXVA 1H9RA 3GD7A
chains in the Genus database with same CATH superfamily
5I2XA 1IL2A 1SMYD 1S4ZA 1EQQA 1X3PA 4KHVA 4OWTB 2UXCQ 1NSNS 2JA9A 1B8AA 3SR1A 2IHEA 2EY2A 1I6HB 4DV7L 2WV6D 5IP9H 3I4MB 3HOUH 3NENA 3BVGA 2JA5G 4A3MH 1B7YB 2KENA 1II3A 3MA2B 2RF4A 4G57A 3I4NH 4JI4Q 2N78A 3MHBA 3SE0A 2KQ3A 4NXNQ 2JA7H 2L55A 3GTLH 1VQFA 5LMNW 1EFWA 1VQIA 4B3ML 4EVOA 2KECA 1PV4A 3U4VA 1EYAA 4JI1Q 3GO5A 2LXJA 1EY4A 2AUKA 4OGQC 4HMIA 4OHJA 5FJ8G 1QVGA 2UXDL 5M3FH 2K33A 3TRZA 1DYQA 1V8QA 4PZ6A 3OPOA 5DEHA 3H0GB 1F2YA 2P5ZX 4LF5Q 3NBHB 3SEBA 4A3BH 2XTIA 4KHPQ 1FNWA 1L1OC 3R8BA 2B8GA 2HT1A 3KBXA 4LK1C 1K3RA 1PRTD 1DZ1A 2J7ZA 2KCMA 1FR3A 2TSSA 1E2WA 2ICIA 4IUQA 3CCUA 2EIFA 3UE1A 2BH8A 3NTHA 1JR0D 4AYBG 3BYTB 4OWXB 1A3TA 4ZKBB 4BY1G 2JYOA 1GD7A 3C46A 3D31A 1FNUA 1GOZA 5JPNC 2MFIA 1EIGA 1MHWC 3VYTA 1HR0Q 4LMQD 3BDOA 2QGQA 5BN4A 1Q81C 1G8ZD 4A3GB 1BKBA 1VQHA 3ZJYC 4LJZC 1FL0A 1VDZA 1KLGD 2YV5A 5NUCA 1BQQT 2NVTB 1DOMA 3EROA 3DLLA 2VZAA 4ALPA 1DGSA 1HXYD 4X64L 2QA4A 1X9NA 4RCOA 1TWGB 1F9PA 4P2CB 4BY1H 2MHVA 4M8AA 3NWTA 2I07B 2JN4A 5C3XA 4F87A 3ICEA 4UP7A 5T1GA 4DAMA 3HOZG 1HZAA 4IURA 3OHXC 1EU3A 3SK8A 3M4QA 4IFDH 1IBLL 3W5OA 4HJ5A 5CMDA 1SNMA 1AP0A 5E4WC 4GLAC 4JI3L 1CZGA 1TU2B 4DUZQ 2NZHA 1G6PA 1Z47A 3S1NH 2IWHA 4Y7NB 1RL2A 4NXML 3L3OC 4DR7Q 2QKIC 1C8CA 2K05A 1Y1WH 4NXMQ 1PVOA 4IUVA 2JA6H 2F52A 3AU7A 1PHJA 2X69A 2F3IA 3MXNB 2F4VQ 2F3VA 1BF4A 4CDDC 2F0MA 1JJCB 3V2TA 4DPGA 2VUMG 1PH1A 1Q82C 4OO1I 1EIFA 2EJMA 4NP5A 3TBIB 3I4NG 1DD2A 2JA8B 2A69D 1I3QB 1EFID 4IPGA 4MIUA 3TREA 4B3SQ 2I5LX 3HKZE 2ICEC 1LUZA 4PG3A 3HOUG 1STHA 1K83H 2I0QA 3I55A 4DAYA 5IIFA 3WOEA 3NHHA 4PMCA 2MO1A 1HA6A 3HOVG 1NNXA 3D3RA 4IJHA 2SOBA 3K7AH 4DV7Q 4EGVA 5COYA 1TVXA 3CPFA 4C2MH 3S1MH 4FXKC 2PNHA 3LNNA 1HQMC 4KKSA 1IBKQ 1EYDA 1LTBD 3UI2A 2CFMA 1K8OA 4JI1L 3NEMA 4FXDA 3NTKA 2WAQB 1VF7A 1A2TA 1HFNA 1TIID 3QWNA 2RSNA 2UUCL 2PW7A 1PH8A 2A5HA 2Z4HA 3DWAA 3W1BA 1EWHA 4NB3A 4L5QA 4ME3A 2CQAA 2EXDA 4Q0FA 2K5VA 3FRPB 3CC7A 2NBFA 3P1HA 4DV4L 1BDOA 2F0WA 5IYBH 4DV4Q 1XNRL 3ITPA 3RLNA 3M3YB 2BH2A 2OWOA 5K36G 2HD3A 4R1JA 2N8NA 2Y0SG 2PZUA 5JJKA 3JC66 3LWEA 3L0OA 5IYBG 4YY3L 2NVYH 2R93H 3J80c 4EQPA 1WTRA 1AH9A 3URYA 4LF8Q 4C3JH 2N55A 4GS3A 3EBEA 5LL6S 1B3QA 3NBIA 1TWGH 1SNPA 2B2UC 2WFWA 4GKKQ 3M85A 1DJRD 3E6ZX 4OEMB 4QIWE 4BXXH 2EZVA 3VYUA 1SLJA 2DY7A 3PUVA 2NVQB 4V190 3F2CA 5J1ZA 3TS2A 4A3FG 2I46A 4IFDJ 1S3OA 1KAWA 2PQAB 3S16H 1CHQD 1TWCB 4R9WA 1Q12A 4C1NI 3L2PA 3D4RA 2CH4W 3CU7A 2B2VA 3I91A 4JI8L 4DV6L 2FMCA 1UNSA 5EKKA 1PDQA 1Z7TA 2KVMA 4KY7A 1D5MC 2N3SA 5GAGC 3CC2A 4NPSA 2NVXH 2JEBI 4I7AA 5ISRA 4GKJQ 4IALA 5G3LD 2LKVA 2OQ0A 1GUSA 3MFYA 1E22A 4LF4L 2EQSA 4KLKA 5J39A 3N6RA 2XN9C 3VR2A 1XWEA 2Z8LA 3TP7A 1LTGD 3DWQA 1PYSB 4K5WA 5FLXc 1MBYA 1LABA 2XWJB 1IBMQ 1EWCA 3SXHA 3KUPA 2K5NA 4LF6L 4L5RC 1SRUA 4DF7A 2A6EC 1VQDA 2K52A 2NN6I 1U5KA 2EYOA 5BN3A 3PSIA 1TY2A 1RCVD 2HDLA 4X65L 2KHSA 1SR3A 4KD4A 4C2MB 1EUJA 1H9RA 1VMPA 2G9HD 3K0YA 4XXEA 1IW7D 4A3KB 2FJ2A 3IFDA 4A3LH 3I3CA 1UE5A 2LMCB 3TP6A 1AEXA 1T9HA 2A1AA 3J81L 3GTOH 1V1QA 1QNKA 1S5BD 1B50A 4ZLTF 5ELOA 2N88A 1H9JA 1QUQA 3U4ZA 1VQ7A 2O4XA 1Y1VH 1PFBA 4BA1I 2JE6I 1CZWA 1YVCA 1YJNA 2E2JB 3EIVA 1A8VA 2D0OA 5D14A 1I6VC 5JVG3 1BBXC 5EPLA 4R4IA 2NN6H 4CKBA 2K75A 2JP1A 2F0EA 2Z6BA 2ZXPA 2ES2A 1YBYA 3M4OH 1N32Q 5HURA 4XT1B 5IT9L 2UUAL 4JYAQ 5CBEE 1B9MA 1RODA 1WTPA 1PYBA 3DEPA 1Y8OB 2A68D 1ZYRD 1PFSA 2R93B 1PH4A 3GQBA 5BR8Q 2EJGC 5K5PA 1I4XA 3OSOA 3NXWA 2JA5H 2PMZE 2K01A 5C0XJ 3MVVA 2F0DA 2RQXA 4JV5Q 1B9NA 2OXPA 5JEAJ 3VDYA 1M4VA 4WRDA 2QDLA 1PTOD 3GTMB 2F0TA 5C5MA 2D5DA 2IW3A 1CQFA 2NUCA 4KN4C 1ENCA 2DNCA 3KF8A 1D6EC 1TR5A 3FHWA 3EVQA 1X56A 3TP8A 4A3BG 1CT1D 1VQEA 1GUGA 4JI7Q 4BBRH 4DUZL 4XTCS 4POFA 3S16B 1PZKD 2HQEA 1N34L 1TWCH 3IFTA 5I4DA 3CMAA 4X62L 5FO8B 4XDXA 1SYGA 4O1NA 1WVLA 2WKCA 3W3AA 1B2TA 4KY6A 3HFZB 3FDTA 5CBAE 3A5UA 2IY5B 3Q0AA 4DV1L 4NMZA 2LS01 4JG2A 5KEEA 5C4XH 4RAUC 3I4LA 3U9SA 1L0YB 3NQIA 2FMMA 4A3IB 1J5EQ 1GXDC 1VQOA 1KLUD 2F0FA 3GP7A 1WD0A 2OF1A 4IUTA 4ABNA 2RSOA 2UXCL 3UDXA 3J7AF 4GKJL 3KOJA 3HP3A 3HOVH 3NSWA 2BE5C 2DGYA 1TWAH 3PUZA 1TY0A 2E2IB 1PYWD 1N9WA 1GUOA 3AMUA 3T1HQ 1NR2A 4ZUJA 4B9WA 4HJ9A 4DNTB 1QG7A 1NY4A 1EY8A 1KABA 1B44D 1EZ6A 1X55A 2Z0SA 3A8JE 2MP1A 3F1ZA 5IE8A 5FO9B 4A3KH 4KKUA 2F03A 1EYGA 2R6GA 4K2LA 1SMXA 3RLOA 3K80C 5IT9c 4LFCL 1BBUA 1TWHB 1Y1WG 4TQUS 1IKLA 2K03A 1JOOA 3QB3A 2NYZD 4DR5L 1F9QA 1LTID 4HEDA 3A8KE 3OW2A 2E5LL 1G2TA 3IRBA 4LUZA 4N9TA 3M4OB 1JT8A 4LF7L 1K8AC 3BDCA 1B3AA 3B6YA 2CHBD 4RWSC 4CJ1B 3QOJA 1OXUA 5ELDA 1FGUA 3TMEA 3PIO3 4U673 4LNQA 2R92B 5LMUQ 4R4CA 2G9DA 5LMNL 2ALYB 1K3BC 1NAPA 4IO9A 1PLFA 1XNRQ 3W2DA 5M5YB 2A6HD 2M9VA 4YCWA 1MD2D 4RHSA 5EKLA 4GNXA 1XNQL 4EX5A 3K58A 4YIJA 1RTNA 2ZTEA 2SNMA 1YI2A 2MJ8A 3D0FA 3UDIA 4CKEA 3R93A 4YY3Q 1S5ED 1QE6A 4JI6Q 4P73A 3QIAA 4C3HG 3GTMH 5A35A 1G51A 4K0KL 2VUMB 5I6WA 5FLXL 4IOAA 1MKHA 4WJ4A 3M4PA 2CWPA 4B3TL 3RZDB 3O13A 3PO3B 1ML0D 2NVYB 3K5NA 4LF4Q 2EXZA 3VR3A 5EBCA 3K59A 4HIDA 4C3JB 2NN6G 1SMYC 2JJQA 1X32A 1KL9A 3PUXA 4DV2L 3D4DA 2MNAA 2CVRA 2PO4A 4A93G 5GQOA 1A0IA 4DR4Q 4QY7A 3RNUA 4YCUA 3RZOH 3C1FA 2VQEQ 5D3DA 2EYHA 3E0EA 2VQEL 3CC4A 3CQZB 1UEAB 5CGKA 2LSSA 3C1EA 1I4PA 1DONA 1SYEA 5CV5A 1AW7A 5IGBA 1ET9A 3ULPA 5ELBA 4A3DB 2F0GA 4L5SA 4DV1Q 2QEJC 4H7BA 4Z9CB 4L8JA 4MNOA 4ULLA 1EY0A 5FOBB 2AHOB 1DM0B 1ILQA 2I5MX 3PO2G 1V43A 5JEAH 3HOUB 1J6QA 3AFPA 4GLVB 4O42A 4KJOA 5FLMG 1A3UA 1F2MA 2RBMA 5L37A 1I4RA 3I4NB 2CWAA 4FYDA 4TKOB 1KQSA 4UPAA 4PMWA 2AQ1B 5M5WH 2HCCA 2H5XA 2HIXA 1TS2A 3KF6A 1BXTA 2SEBD 2A8VA 5KRUA 5GAHC 2WACA 3PUWA 1EIYB 1YNXA 1HPCA 3OIPA 4AQYQ 4BBSG 5IP9G 1XX8A 4KJNA 5EKIA 5C4HA 2X6LA 4C3IH 2EY5A 2R7FA 2UUAQ 2K1BA 2PW5A 1GVPA 4CKCA 4GOPA 2HHHQ 3RN2A 4GN4B 5CV7A 1LTAD 3RD4A 5IGEA 3H0GH 3G6EA 1I94L 3SDZA 1KDAA 2F0HA 2UUBQ 4KK7A 1K8GA 4JOIA 4UDUC 2EYPA 4FNFA 4TVAB 4LFAQ 4HJ8A 5C6AA 1JC7A 2Q2IA 4JV5L 4RGMA 3ER0A 1SJED 2B2WC 3TQYA 2E2JH 3JAMi 5A2QE 1A2UA 5EJWA 4JI0L 1J5EL 1HZ9A 1STGA 4JVZA 5JJIA 1EOTA 2B2VC 3K5LA 1VQ9A 1CKOA 2F0LA 1VQAA 5CR3A 1WI5A 3QO2A 3Q6SA 3FMCA 3IL8A 4FF3A 1EQRA 2R93G 4RKBA 3DM3A 5IGDA 3J81c 3BS1A 1Q8IA 4YWLA 4DFAA 1EEID 2QCPX 1KRTA 4GOPB 5C3WA 3GDEA 4E6IA 5M9OA 3PIPA 5CV4A 3PO3H 1JOKA 4DK1A 3VA5A 4N8FA 1LT4D 4H02A 4KY5A 2JA5B 1R4QB 2J0TD 3FVQA 3I4MG 3R2TA 5JJLA 3HOXB 1R4PB 5F2DA 2EVBA 4EQ5A 1GHJA 1S72A 3KJPA 1NCVA 1R9TB 4HSVA 4P74A 4ZRZA 4JI4L 4FP5D 1RF2D 2CW0C 4UY8C 4X66L 3CCVA 3S1RH 1O80A 3S2HB 2WB1B 1NMFA 5M3MG 5M5XB 2E2HH 3Q24A 5BN5A 4R4TA 3VYSA 5AFWA 1YNND 4UHVA 4N9PA 3HS0C 2KJXA 4LUVA 3H91A 4LF9Q 2X6GA 5IYDG 3OYYA 4WJWA 3HG9A 2XGTA 2LXKA 1CA6A 2K04A 4DR4L 3EN2A 2R3ZA 1XMOQ 5C44B 2UXBQ 4DV3L 2GVAA 1U0LA 2UXBL 2D2CC 1VCIA 4ZKCB 1JOQA 1WTQA 4RH6A 2A69C 1BBWA 2SNSA 2YYZA 4N8X1 3S9WA 3KLWA 1ZEQX 1TS5A 1G6ZA 1E2ZA 1YZ6A 1ESRA 1STNA 3WDNA 2OEOA 2HQLA 2PZTA 3KDFB 1EWIA 1H95A 3HOYG 3NBHA 4RGTA 1Y8NB 3LWUA 4C3IB 2PI2A 4A3MB 2B39A 4DAPA 1VQPA 1UE6A 4OXPA 1PH5A 5EAYA 5IGCA 2KEEA 4J1MA 5ELCA 1AN8A 2L9HA 1HR0L 3PO3G 4GLXA 1GUNA 1PFNA 4A3IG 2EPBA 2VQFQ 1KIXA 1JQYD 1CSQA 4K2KA 3CP0A 4HSPA 3HRZC 2R7ZG 1AE3A 3CD6A 1XTDA 3KFUA 1B1ZA 1BVSA 4DV6Q 2L5TA 4A3EH 2KUMA 1PH9A 1STYA 3UDFA 2E76C 5IP7H 1HUNA 3A0JA 3OW7A 1A63A 1UE1A 3N52A 1NUCA 2KCNA 4JPBW 3WWVA 2CH4A 1YHBA 3KJOA 1IBLQ 4KN7C 3GTQH 5JAVA 3MZ5A 1TWFB 3J7ZC 1XMQQ 4IPCA 1X54A 5IYCH 2R92H 3M3YH 1CM9A 3GTJH 1MIUA 4OIJA 3HOWG 1E7ZA 2LY7A 2I5HA 4O2DA 5DAUA 2J4XA 1SFOB 1S40A 2XIWA 3KBGA 4ODGA 4AH6A 1SE2A 1SYFA 3MTSA 4TSSA 1W2BA 2XSCA 1V1OA 1LACA 4L5TA 3GV6A 1WD1A 3TEHB 3A8IE 2BOSA 5DM63 3HOWB 1C0AA 2NVQH 1PRTF 3IKJA 1DCZA 2BE5D 1KTKA 1STAA 1JORA 2NVTH 3NPPA 3TSSA 2DUDA 1IZ6A 1DOKA 1KNEA 4O0AA 1PRTB 4A3GG 4CBVA 1ILPA 4G7HC 4IFDI 5FK9C 3ND8A 5FJ8H 3PIOA 5JEAG 3MXGA 4BY1B 1LO5D 3PO2H 2G5DA 4AYBB 4BA2I 5CC4A 1RD9D 1WTWA 1PTOB 1HHVA 4NXNL 2NVXB 4JI2Q 1RIPA 2DN8A 3U50C 4RCNA 4LFCQ 3R3OA 2JA7G 1HUMA 4DR6L 4KHPL 1UUPA 4F7XA 1ASZA 4LW1A 1OXXK 1X3FA 4ZK9B 1C9OA 1KAAA 3FP9A 5E3FA 3I56A 4RHRA 1VQJA 3RR5A 3NQTA 2B2UA 4JBMA 1F9RA 3HOYB 3NELA 2K4KA 4DXGA 1PFMA 3MEHA 2JA6B 3VR5A 1OO9B 1C7YA 3S2DB 1IYUA 5E7NA 4IOCA 5D65A 1VQGA 1PH7A 4L6TB 3RLFA 4A3JB 5IYCG 1YNNC 3Q22A 2JA8H 5KNBA 5C44G 2WB1E 4G7ZC 2HDMA 1S5CD 2A68C 3S1QH 1SE3A 1CUKA 4C3HH 2A6HC 3PF4A 1BCPC 2UUBL 1SDFA 1K83B 1V1PB 4DU9A 2WAQE 3SVMA 1SYDA 4X64Q 3PIP3 1BCPB 1EY5A 1Q46A 2Z4IA 4C1NK 3PMFA 1M8AA 3V05A 4RGNA 3M4YA 3DUZA 3S14B 1CFMA 2VL6A 4OWWB 2L4NA 2RHSB 2R7ZH 3S15H 1TXYA 3CF5A 4HR7B 1E24A 1G2SA 2NZ1D 2WAQG 5EBDA 1FD7D 3HKZG 2Z1CA 1LTRD 4LUOA 5T1IA 4K0KQ 2H4OA 1Q3LA 2ZJQA 4DR2L 4OO1H 5I2YA 5CV6A 1L1OA 3IAYA 3U9OA 4HMJA 1J9OA 3FPUB 1PA6A 2RVLA 4JI3Q 4BBSB 1I4HA 3CRLC 4JBKA 3DM1A 1ICFB 1K8MA 4FDBA 1G291 1H9MA 1QOHA 4OELB 1HZBA 2B63G 1RHPA 4R4OA 1XPUA 5KIXA 4A3KG 4CJ2C 4DA2A 1H9SA 1XTCD 1F9SA 1B70B 1HCZA 4XQJA 5IGGA 1NJIC 4LFBQ 2B63H 1OXTA 3A5ZB 4BBRB 4K6DA 4DK3C 5C4JB 2RDFA 4P71A 1SNOA 4APVA 1WCMG 1KRSA 2JXMB 1JWSD 3AB9A 3I70A 3NP8A 1UEBA 3QG1A 4DUYQ 2AMCB 2JEAI 3FKIH 4ZAIA 1SYCA 2OQKA 3ND9A 4X3UA 3VYRA 4GN5A 2RCNA 3L7ZC 2F0VA 4HN7A 4I65A 4B3RL 4A3DG 1BUVT 4B3RQ 2VB3X 2IX1A 2YTYA 3ZYYX 2KEDA 2B3GA 4YWMA 1TS4A 1X3GA 3J80i 1M1KC 3BG3A 3CCQA 1GUWA 4LF9L 5IWAL 4OX9Q 4KKTA 4A3JG 2K32A 1IKMA 3J7YW 1YEZA 2L12A 4XT3B 4A3CH 3H15A 4AIMA 2VY3A 5C0XI 2RA4A 1SE8A 5M5XH 2E2HB 1D1KA 4XYOA 3H6MA 3PCOB 4R4QA 1PRTC 3LGJA 2B8FA 2UUCQ 2O5IC 2K50A 3HZXA 1FJGL 2KOLA 1I6HH 1C4QA 2K7VA 3D6WA 1Y69U 3I4MH 1EY6A 2QILA 4A76A 1JE4A 2LFNA 2B2YC 1PXUA 1FGBD 2B2TA 3PV0A 1HR0W 3I2ZA 3S2DH 5A2QL 4RFBA 4BY7H 5C44H 3BZCA 1KD1C 2XNAC 1PTOC 4Y52H 3CAMA 4JI2L 1RDPD 4KD3A 1QNUA 5EPJA 2TMPA 1CKNB 4B08A 4JI5Q 1FVIA 1SN8A 1UAPA 1W6JA 1BCPD 2ASBA 5C0XH 1SROA 1KC8C 3R2IA 1TWHH 1ZYRC 1A6XA 3RUZA 3G48A 1RTOA 2K5QA 4IQZA 1MJEA 4IPDA 2N49A 1HH2P 3GTKH 1A3VA 2HHHL 4JI7L 2PPBC 1DOLA 3MWYW 4DNIA 2K5WA 1HNXQ 1LT3D 1F77A 1PMRA 1HNWQ 3HKZB 1U4PA 2ZTCA 1GO3E 3GTOB 2EYMA 2A73B 1ONLA 3TN2A 2OT2A 1HQRD 1CKNA 2CW0D 5DNFA 2FINB 2JK8A 1IYJB 3KF8B 1Z6HA 4CGYB 4BBSH 1WCMB 1WFQA 2EYJA 3GTQB 1TQOA 2PQEA 5GROA 3J80L 4QGUA 1EZ8A 2KHJA 5H1SE 1YITA 4POGA 3MEFA 1SNDA 1ET6A 3A56A 2F0PA 4AYBE 2VS1A 4A3LG 3ERSX 3GTPB 2JSOA 3RN5A 1VMCA 1SNQA 5LHY1 1SFOH 5C3EG 1WTVA 1EEFD 2MUYA 2YTVA 4FF1A 4QB4A 1N36Q 3I73A 2FXQA 3TZDA 4DR2Q 1JB7A 4QF4A 1X6OA 1EY9A 3EA6A 1Q1EA 1XPOA 1HTLD 3Q8DA 2K28A 4NDXA 3BU2A 1MI2A 1D1IA 1CA5A 3HOWH 1Q7YC 1Q8KA 2L15A 5LL6X 4JC0A 4DUYL 1EYCA 3CHBD 4P72A 5GADC 3C2PA 2C5CA 3TP5A 2F0IA 5D3IB 3VR6A 1XMOL 4V0BA 1WOCA 3CCJA 4A3DH 1D2BA 4QCLA 1H9SB 4H0LC 1E0BA 4DR6Q 4JI0Q 3LX0A 4RG1A 2O2LD 3SK5A 1P8LA 5FKAC 4J15A 4KMUC 3BDLA 1WYDA 2IL8A 2JQOA 4A3EG 5IOCA 3X3NA 3BVZA 2YTXA 3BZDB 4BY7B 2E2DC 1X65A 4GKKL 1XNQQ 2V1CC 5IT9E 3I7FA 1HZCA 3JAML 1VQLA 2VW9A 5M5WB 2MO0A 3QJYA 4K6LA 4CDFC 4DNRB 1HTPA 3JAME 4BXXG 2QDBA 1WTXA 2VQFL 3K5MA 2Q8RE 5KYIA 4UP9A 2E2IH 2PI2E 3BZKA 3KYHC 3E9HA 3KK7A 4GZYC 4J8QA 1UWVA 1XMQL 3F8TA 1KDCA 4DR1Q 1BCPF 4CDEC 4DR1L 4DV0L 3GTKB 4A3CG 4CDCC 1B4OA 4QUFA 2MGSA 4IUNA 3M7GA 1KHIA 1L0XB 2JA7B 2XRSD 2C9OA 1FNVA 4GNXB 1JWUD 1N33L 3HEJA 3E3XA 1P16A 2F0SA 4GNXC 3MXNA 2K14A 3MXPA 4KTAA 4MHEA 4K5XA 1PZID 5KNDA 5EPKA 4PQXA 4M1UB 5IYDH 4IUUA 4DV5L 1HNXL 3FKIG 1CKMA 2GA4B 1N8RC 1HNWL 3E0JA 3S14H 3DWPA 2IX3A 2AQ3B 3NTIA 1CI3M 1LTLA 3X3MA 3S15B 3SK4A 1S5FD 1LLRD 1O7ZA 2WKDA 3CXCA 5GAEC 1E1OA 4A75A 3EFXD 5IGFA 3QR8A 2L11A 3WOFA 1VQ6A 3TDQA 4X6AH 3J81i 1QVFA 1YJ9A 1QUQB 3J80E 4C3IG 1JB3A 1EIHA 2UU9Q 1SYBA 1CSPA 1RKNA 4LFBL 3CW2C 3I72A 4LAAA 1EOVA 5C3EH 2K5HA 3D8GA 1G91A 1M90C 2PYKA 3BVMA 4JBWA 1O7YA 2EJFC 2KCTA 1GJXA 5ELNA 3J81E 3FEWX 3CPWA 1QZGA 3E5SA 3HOZB 2E75C 1YIJA 5HGTA 4PZ8A 2JA6G 3HGBA 1E1TA 4QMGA 4H44C 3T53B 2BA0A 4U68A 2DNEA 5CV8A 3D6CA 3STBC 5EGTA 3DMUA 1O7IA 3NE5B 4H13C 4HTHA 4DK0A 4JYAL 1Y14B 4XIGS 4BBRG 1L1OB 4K8IA 3T16A 4KHZA 4HJ7A 3ULLA 1SNCA 1D7QA 3OMCA 1OXVA 4TRDA 1J8IA 5LMUL 5BR8L 1F2ZA 2FFKB 4YWKA 3I4OA 3V96A 4YCVA 4A93H 2IJ0A 1JE5A 1IXRA 4Y7NH 3DEOA 4HIKA 4FVMA 1KNAA 1Y1WB 1EQTA 4X62Q 5C0XG 5CV9A 3AEVA 4DR5Q 2V4DA 1QJOA 3P7JA 1YNJD 4GOPC 3K7UC 1L0WA 1CQVA 3NK9A 5DM73 2B29A 3T51B 5E1FA 2IT1A 3F2BA 1I3QH 3HKSA 2D0PA 4HIMA 3OWFA 1PH6A 1AFPA 5FLMH 3Q23A 2E8GA 3UDGA 2AWNA 4DAYB 4PZ7A 1A15A 2QW7A 4PV1C 2H1EA 2VXWA 3A7LA 4UAIA 5JJZA 1SJHD 2WB1G 1ZXTA 2EE1A 5DLQE 3T4AC 3S17B 3K7AB 2F0NA 4ID6A 3UE0A 3G71A 1WJJA 4X66Q 4QIWB 2NWGA 4OONA 1IYVA 1A62A 1LV9A 1MGSA 1XJVA 2WINB 1PTOF 1SBBB 3K5OA 4DV5Q 3CCRA 1JJGA 2EDGA 3DXJC 3GTJB 3CCEA 2SDFA 1JCKB 1TS3A 1VQ4A 1VQ5A 5AJ3L 3SGIA 1SEBD 1EY7A 1MSHA 3AYHB 1ICWA 4DV3Q 3OMGA 3I90A 3G4SA 1PH2A 5TSSA 1QCBD 1GKHA 2EY1A 1YHQA 4LF6Q 1E2VA 4HCSA 2K5DA 4MZ9A 3KLSX 2PMZB 5FO7B 2R92G 1I50B 3J81j 3JAMc 2OTLA 2Y0SB 3OIQA 4F8MA 1QB5D 4IUPA 4X65Q 4OL7A 1QZHA 2E74C 3H3VH 4QUCA 4LF5L 4YHHL 2ENBA 2F0OA 2M00A 1OTCA 5IWAQ 4A3MG 4OX9L 2ZM6L 2AKWB 3A54A 4P75A 4B9XA 5IP7G 2Y0SE 4FO2A 3PO2B 1YJWA 2YU9H 1N32L 1O7LA 5M3MH 3F2DA 2DY8A 4WFN3 1T5EA 1FYCA 2IX0A 1PTOH 2D9UA 2AQ2B 4LF7Q 3M7NA 4XYQA 4OO1G 1R9TH 5C4ZA 5C4XB 2HCIA 4RKLA 3H09A 2C35B 5JPMC 3GTGH 4K14A 2ZXOA 5IY0A 3KF6B 4A3IH 2Z6KC 4I7ZC 4HJAA 4DV2Q 5LMNQ 1LTSD 3KDFA 4JK1C 3S1RB 1WTOA 1U4LA 1CK1A 1PZJD 4B3TQ 3H3VI 3S2HH 3A74A 5C4XG 1VS0A 3SHLA 3T1YQ 4K8JA 3HOVB 4HAEA 1VQKA 1IW7C 4A93B 1NE3A 4DXFA 4JI6L 4FF4A 1BOSA 1I94Q 1VF5C 3CMEA 2VB2X 4OIKA 3A55A 1JMCA 4ILWA 1XXGA 4WORA 1QWYA 3OTOL 2EYLA 1VQ8A 5K36H 5KGUA 1ENAA 4JCVE 3E9IA 4G7OC 3FPPA 1LTTD 1SE4A 3S24A 3K0XA 1U4RA 1MJCA 4DV0Q 5KYLA 2Q2HA 3GTLB 4ZUIA 4QJFA 3S1QB 3PF5A 4C3HB 4X3TA 1I4QA 3A7AB 3G7LA 4PMBA 1EQVA 3HOXG 2F1MA 4DGZA 1I5FA 1ZKOA 1NTGA 2R61A 2KA7A 3L9AX 3MXUA 1F2LA 1VQNA 2NZOA 4RMFA 2KHIA 2F3WA 3H94A 3U58A 2WIIB 2Q8TA 2NTSA 1Q1BA 1ENFA 4GN3B 4A3BB 3CCMA 1K0RA 2EYFA 1YHAA 1STEA 2IPKD 2MQHA 1W3SA 3EQLC 4A3EB 1BNZA 1TT2A 1Y1VB 4DKAC 1NMGA 4QQBX 5M5YH 4R8NA 3K8AA 3OWEB 2Z9HA 1K9MC 1EU4A 5J22A 1Y1VG 3CCSA 5KNCA 4DK6C 4HCEA 2VNUD 1TWFH 4A3GH 3T56B 2VUMH 1UE7A 3RMHA 1K0SA 4XQQA 5C5LA 3RZDH 1I50H 1DXMA 2F4IA 3NUCA 4RGOS 1JWMD 1IBKL 1MSGA 2ZT9C 1D5ZC 1GM5A 1XYIA 1D8LA 1N36L 5HGQA 5E4XA 3M9BA 4K5VA 2ZTDA 1SAPA 2KCCA 1AZPA 1HNZL 2E5LQ 3FKIB 3J7A5 4J6HA 4KI0A 2OCEA 2XWBB 2Q8IB 4B3MQ 2YU9B 2Z6KA 5M3MB 5C3EB 1Q90A 2IHFA 3RZOB 2RCFA 3MAQA 4XQNA 2F0UA 4ZYSA 3CQZH 3TS0A 1AZQA 4MTKA 1L2FA 2F0KA 2L0CA 3GTGB 4ZCKA 1SXTA 3HOZH 2UXDQ 3J7AV 3ERQA 2QF7A 2BA1A 1IHZA 5IODA 1VQBA 1CTMA 3K6OA 2F0JA 4YHHQ 1K73C 3S1NB 3KLSA 2DJFC 3AQQA 2CCZA 1KXLA 3T13A 2HIVA 2MPMA 1X3EA 3AFQA 4WJ3M 3TZUA 2PNRC 1LT5D 4NW2A 3DHQA 2ATWA 1N33Q 4C56C 1QILA 2BDOA 3VR4A 1LT6D 1U4MA 4A3FH 4RA8A 2ZJRA 4FF2A 4R8IA 4JI8Q 4EQNA 2GVBA 2KBNA 1V1PA 2ZXRA 3KLRA 2A6ED 1SSOA 4BY7G 4DAVA 4DR3L 2BDNA 4DR3Q 1T5XD 1V9PA 5ELFA 2FHTA 1ASYA 1IBML 1TWAB 4IZ8A 4MTNA 3HOYH 1HRJA 5ELEA 3OTOQ 2HUGA 5JOBA 5FLXE 4C3JG 5JVH3 4EQOA 3VA7A 2F0QA 1S5DD 3I8ZA 4A4IA 2PCFB 4DR7L 3S1MB 2DJGC 4UP8A 3GD7A 4A3JH 1O78A 4B3SL 4HIOA 2D62A 3ONAB 1JICA 1STBA 1XPRA 4X3KA 2CQOA 2ID0A 4PNYA 2RDGA 1Y8PB 2UU9L 2XRQD 5M3FG 4IPHA 2RDHA 2WP8J 1N34Q 5I9PA 4MN3A 1W6KA 2EY6A 1GHKA 3P75A 2Q2TA 1HA5A 1H9KA 1HJPA 2ZM6Q 1YNJC 3S17H 5M3FB 1OXSC 2A74C 1WCMH 2F4VL 4X3SA 2OTJA 1IL8A 3P20A 1CHPD 4JW0A 1WTHA 1NBWA 2R7ZB 5AJ3Q 3PQIA 2ZJPA 3MC0B 3G6JB 3CCLA 3CRKC 2QEXA 1RJTA 3NWSA 1VQCA 1QVCA 4KV6A 1Z9FA 2AUJD 3GTPH 4CHTB 1AE2A 4JOIC 4DN4M 1BR9A 2B2YA 4G4KA 4JBJA 2XVSA 3ULJA 4ME5A 5I9OA 2K6AA 4QL5A 1K28A 2RKSA 5J3BA 2PZWA 4LWCA 4CJ0B 3HOXH 4IN3A 5HY6A 3C3LA 1NR4A 3D4WA 1FJGQ 4JI5L 3T1HL 3MFGA 5EQ0A 2AWOA 4FXGC 4S3SA 4AQYL 5I6YA 4LF8L 2RHQB 2A19A 4IJLA 1U9RA 1LM0A 2R7DA 1X3QA 1I4GA 3PUYA 4BS9A 1D5XC 2B2WA 3K57A 1HNZQ 2B63B 3T1YL 5C4JH 3PGZA 4Q5VA 2PQAA 3SK6A 2Q2UA 3OOCA 2L1BA 3CKIB 1Q86C 1LYLA 2EOTA 3QOLA 2GN5A 2B2TC 5CORA 1PH3A 2BCOA 4BWGB 4LFAL 1EL0A 1TKWB 1C48A 3F2UA 3W1GA 1ESFA 3GV3A 2NTTA 1JJ2A 5G3LF 1BO0A 1GUTA 3BJUA 2JA8G 2M2LA 1HFGA 1E3PA 1B53A 3K81C 3STBD 4IFDG 5CYUA 4F88A 4NKLA 4ZQ3A 3H3VC 4A3FB 3BYYB 1VQMA 1KDBA 2O5JC 2NB0A 2CKZB 3H0GG 4L63B 3EJIA
chains in the Genus database with same CATH topology
5I2XA 1SMYD 1S4ZA 1X3PA 4KHVA 1NSNS 3SR1A 2EY2A 1I6HB 2WV6D 3I4MB 3BVGA 1II3A 3MA2B 4G57A 3MHBA 3SE0A 2KQ3A 2L55A 4EVOA 2KECA 1EYAA 3GO5A 1EY4A 2AUKA 4OGQC 4HMIA 4OHJA 2K33A 1DYQA 1V8QA 3OPOA 5DEHA 3H0GB 1F2YA 3SEBA 1FNWA 3R8BA 2B8GA 3KBXA 4LK1C 1PRTD 1DZ1A 2J7ZA 1FR3A 2TSSA 1E2WA 2ICIA 4IUQA 3NTHA 1JR0D 3BYTB 1A3TA 4ZKBB 2JYOA 3C46A 3D31A 1FNUA 1GOZA 5JPNC 1EIGA 3VYTA 4LMQD 3BDOA 5BN4A 1G8ZD 4A3GB 4LJZC 1VDZA 1KLGD 5NUCA 1BQQT 2NVTB 1DOMA 3EROA 1HXYD 4RCOA 1TWGB 1F9PA 4P2CB 2MHVA 4M8AA 3NWTA 2I07B 5C3XA 4F87A 5T1GA 4IURA 3OHXC 1EU3A 3SK8A 4IFDH 5CMDA 1SNMA 1AP0A 5E4WC 1CZGA 1TU2B 1Z47A 2IWHA 4Y7NB 3L3OC 2QKIC 1C8CA 2K05A 4IUVA 3AU7A 2X69A 2F3VA 1BF4A 2F0MA 3V2TA 4OO1I 2EJMA 4NP5A 3TBIB 1DD2A 2JA8B 2A69D 1I3QB 1EFID 4MIUA 2ICEC 1STHA 4DAYA 5IIFA 3WOEA 3NHHA 4PMCA 1HA6A 3D3RA 2SOBA 4EGVA 5COYA 1TVXA 4FXKC 3LNNA 1HQMC 4KKSA 1EYDA 1LTBD 3UI2A 1K8OA 4FXDA 3NTKA 2WAQB 1VF7A 1A2TA 1HFNA 1TIID 3QWNA 2RSNA 2PW7A 2A5HA 2Z4HA 3DWAA 1EWHA 2CQAA 4Q0FA 3FRPB 2NBFA 3P1HA 1BDOA 2F0WA 3ITPA 3M3YB 5K36G 2PZUA 3LWEA 4EQPA 1WTRA 3URYA 2N55A 5LL6S 3NBIA 1SNPA 2B2UC 3M85A 1DJRD 3E6ZX 2EZVA 3VYUA 2DY7A 3PUVA 2NVQB 4V190 5J1ZA 2I46A 4IFDJ 1CHQD 1TWCB 4R9WA 1Q12A 4C1NI 3D4RA 3CU7A 2B2VA 3I91A 2FMCA 1UNSA 5EKKA 1PDQA 1Z7TA 2KVMA 4KY7A 1D5MC 2JEBI 5ISRA 4IALA 5G3LD 2LKVA 1GUSA 3MFYA 5J39A 3N6RA 2XN9C 3VR2A 1XWEA 2Z8LA 3TP7A 1LTGD 3DWQA 4K5WA 1MBYA 1LABA 2XWJB 1EWCA 3SXHA 3KUPA 4DF7A 2A6EC 2NN6I 2EYOA 5BN3A 1TY2A 1RCVD 2HDLA 2KHSA 4KD4A 4C2MB 1H9RA 1VMPA 2G9HD 3K0YA 4XXEA 1IW7D 4A3KB 2FJ2A 3IFDA 3I3CA 2LMCB 3TP6A 1AEXA 3J81L 1QNKA 1S5BD 1B50A 4ZLTF 2N88A 1H9JA 2O4XA 1PFBA 4BA1I 2JE6I 1CZWA 2E2JB 5D14A 1I6VC 5JVG3 1BBXC 5EPLA 2NN6H 4CKBA 2JP1A 2F0EA 2ZXPA 5HURA 4XT1B 5IT9L 5CBEE 1B9MA 1RODA 1WTPA 3DEPA 1Y8OB 2A68D 1ZYRD 2R93B 3GQBA 2EJGC 5K5PA 1I4XA 3OSOA 3NXWA 5C0XJ 2K01A 3MVVA 2F0DA 2RQXA 1B9NA 2OXPA 5JEAJ 1M4VA 4WRDA 1PTOD 3GTMB 2F0TA 5C5MA 2D5DA 2IW3A 1CQFA 2NUCA 4KN4C 1ENCA 2DNCA 3KF8A 1D6EC 1TR5A 3EVQA 3TP8A 1CT1D 1GUGA 4XTCS 3S16B 1PZKD 2HQEA 3IFTA 5I4DA 5FO8B 4XDXA 1SYGA 4O1NA 1WVLA 2WKCA 3W3AA 1B2TA 4KY6A 3FDTA 5CBAE 3Q0AA 4NMZA 2LS01 5KEEA 4RAUC 3I4LA 3U9SA 1L0YB 3NQIA 2FMMA 4A3IB 1GXDC 1KLUD 2F0FA 3GP7A 1WD0A 2OF1A 4IUTA 4ABNA 2RSOA 3J7AF 3HP3A 3NSWA 2BE5C 3PUZA 1TY0A 2E2IB 1PYWD 1GUOA 3AMUA 1NR2A 4ZUJA 4B9WA 4DNTB 1QG7A 1EY8A 1KABA 1B44D 1EZ6A 3A8JE 2MP1A 5FO9B 4KKUA 2F03A 2R6GA 4K2LA 1TWHB 4TQUS 1IKLA 2K03A 1JOOA 3QB3A 2NYZD 1F9QA 1LTID 4HEDA 3A8KE 1G2TA 4N9TA 3M4OB 3BDCA 1B3AA 2CHBD 4RWSC 4CJ1B 3QOJA 5ELDA 1OXUA 3TMEA 2R92B 3PIO3 4U673 2G9DA 1NAPA 1PLFA 5M5YB 3W2DA 2A6HD 2M9VA 1MD2D 4RHSA 5EKLA 3K58A 4YIJA 1RTNA 2SNMA 2MJ8A 4CKEA 3R93A 1S5ED 1QE6A 3QIAA 4C3HG 5A35A 2VUMB 5I6WA 5FLXL 3RZDB 3O13A 3PO3B 1ML0D 2NVYB 3K5NA 2EXZA 3VR3A 5EBCA 3K59A 4C3JB 2NN6G 1SMYC 1X32A 3PUXA 3D4DA 2CVRA 2PO4A 3C1FA 5D3DA 2EYHA 3CQZB 1UEAB 5CGKA 3C1EA 1I4PA 1DONA 1SYEA 5CV5A 1AW7A 5IGBA 1ET9A 5ELBA 4A3DB 2F0GA 2QEJC 4H7BA 4Z9CB 4L8JA 4ULLA 1EY0A 5FOBB 1DM0B 1ILQA 1V43A 5JEAH 3HOUB 4O42A 4KJOA 1A3UA 1F2MA 2RBMA 1I4RA 3I4NB 4FYDA 4TKOB 4PMWA 2AQ1B 2HCCA 1TS2A 1BXTA 2SEBD 5KRUA 2WACA 3PUWA 1HPCA 3OIPA 1XX8A 4KJNA 5EKIA 5C4HA 2X6LA 2EY5A 2K1BA 2PW5A 4CKCA 5CV7A 1LTAD 3RD4A 5IGEA 3SDZA 1KDAA 2F0HA 4KK7A 4UDUC 2EYPA 4FNFA 5C6AA 1JC7A 4RGMA 1SJED 2B2WC 5A2QE 1A2UA 5EJWA 1STGA 1EOTA 2B2VC 3K5LA 2F0LA 5CR3A 3QO2A 3Q6SA 3FMCA 3IL8A 4FF3A 4RKBA 5IGDA 3BS1A 1Q8IA 4DFAA 1EEID 2QCPX 5C3WA 4E6IA 5M9OA 5CV4A 1JOKA 4DK1A 3VA5A 1LT4D 4KY5A 2JA5B 1R4QB 2J0TD 3FVQA 3R2TA 3HOXB 1R4PB 5F2DA 2EVBA 1GHJA 1NCVA 1R9TB 4HSVA 4ZRZA 4FP5D 1RF2D 2CW0C 1O80A 3S2HB 2WB1B 5M5XB 3Q24A 5BN5A 3VYSA 5AFWA 1YNND 4N9PA 3HS0C 2KJXA 3H91A 2X6GA 4WJWA 3HG9A 1CA6A 2K04A 2R3ZA 5C44B 2D2CC 1VCIA 4ZKCB 1JOQA 1WTQA 4RH6A 2A69C 2YYZA 2SNSA 3S9WA 1ZEQX 1TS5A 1G6ZA 1E2ZA 1ESRA 1STNA 3WDNA 2OEOA 2PZTA 3NBHA 4RGTA 1Y8NB 3LWUA 4C3IB 4A3MB 2B39A 4DAPA 5IGCA 2KEEA 4J1MA 5ELCA 1AN8A 2L9HA 1GUNA 1PFNA 2EPBA 1JQYD 4K2KA 4HSPA 3HRZC 1B1ZA 2L5TA 2KUMA 1STYA 2E76C 1HUNA 3OW7A 3N52A 1NUCA 2KCNA 4KN7C 5JAVA 3MZ5A 1TWFB 1CM9A 4OIJA 2LY7A 5DAUA 2J4XA 1SFOB 2XIWA 3KBGA 4ODGA 1SE2A 1SYFA 3MTSA 4TSSA 2XSCA 1V1OA 1LACA 3GV6A 1WD1A 3A8IE 2BOSA 5DM63 3HOWB 1PRTF 1DCZA 2BE5D 3IKJA 1KTKA 1STAA 1JORA 3NPPA 3TSSA 1DOKA 1KNEA 1PRTB 1ILPA 4CBVA 4G7HC 4IFDI 5FK9C 3ND8A 5JEAG 3MXGA 4BY1B 1LO5D 4AYBB 4BA2I 5CC4A 1RD9D 1WTWA 1PTOB 1HHVA 2NVXB 2DN8A 4RCNA 3R3OA 1HUMA 4F7XA 1UUPA 1OXXK 4ZK9B 1KAAA 5E3FA 4RHRA 3NQTA 2B2UA 1F9RA 3HOYB 4DXGA 1PFMA 3MEHA 2JA6B 3VR5A 1OO9B 3S2DB 1IYUA 5D65A 4L6TB 3RLFA 4A3JB 1YNNC 3Q22A 5KNBA 4G7ZC 2HDMA 1S5CD 2A68C 1SE3A 2A6HC 1BCPC 1SDFA 1K83B 1V1PB 4DU9A 3SVMA 1SYDA 3PIP3 1BCPB 1EY5A 2Z4IA 4C1NK 3PMFA 1M8AA 3V05A 4RGNA 3M4YA 3DUZA 3S14B 1CFMA 2L4NA 1G2SA 4HR7B 2NZ1D 5EBDA 1FD7D 2Z1CA 1LTRD 5T1IA 2H4OA 1Q3LA 4OO1H 5I2YA 5CV6A 3IAYA 3U9OA 4HMJA 1J9OA 3FPUB 2RVLA 4BBSB 1I4HA 3CRLC 3DM1A 1K8MA 1G291 1H9MA 1QOHA 1RHPA 5KIXA 4CJ2C 4DA2A 1H9SA 1XTCD 1F9SA 1HCZA 4XQJA 5IGGA 1OXTA 4BBRB 4K6DA 5C4JB 2RDFA 1SNOA 2JXMB 1JWSD 3AB9A 3I70A 3NP8A 3QG1A 2JEAI 4ZAIA 1SYCA 3ND9A 4X3UA 3VYRA 3L7ZC 2F0VA 4HN7A 4I65A 1BUVT 2VB3X 2IX1A 3ZYYX 2KEDA 1TS4A 3BG3A 1GUWA 4KKTA 2K32A 1IKMA 3J7YW 2L12A 4XT3B 5C0XI 2RA4A 2E2HB 1D1KA 4XYOA 3H6MA 1PRTC 2B8FA 2O5IC 3HZXA 2KOLA 1C4QA 2K7VA 3D6WA 1Y69U 1EY6A 2QILA 1JE4A 2LFNA 2B2YC 1PXUA 1FGBD 2B2TA 3PV0A 5A2QL 4RFBA 2XNAC 1PTOC 1RDPD 4KD3A 1QNUA 5EPJA 2TMPA 4B08A 1UAPA 1W6JA 1BCPD 5C0XH 3R2IA 1ZYRC 1A6XA 3RUZA 1RTOA 2K5QA 4IQZA 1A3VA 2PPBC 1DOLA 3MWYW 2K5WA 1LT3D 1F77A 1PMRA 3HKZB 1U4PA 3GTOB 2EYMA 2A73B 1ONLA 3TN2A 2OT2A 1HQRD 2CW0D 5DNFA 2FINB 1Z6HA 4CGYB 1WCMB 2EYJA 3GTQB 1TQOA 2PQEA 3J80L 1EZ8A 1SNDA 1ET6A 3A56A 2F0PA 3GTPB 2JSOA 1VMCA 1SNQA 5LHY1 1WTVA 1EEFD 2MUYA 4FF1A 4QB4A 3I73A 3TZDA 4QF4A 1EY9A 3EA6A 1Q1EA 1HTLD 2K28A 4NDXA 1MI2A 1D1IA 1CA5A 5LL6X 1EYCA 3CHBD 3C2PA 2C5CA 3TP5A 2F0IA 5D3IB 3VR6A 4V0BA 1D2BA 4QCLA 1H9SB 4H0LC 1E0BA 3LX0A 2O2LD 3SK5A 5FKAC 4KMUC 3BDLA 2IL8A 5IOCA 3X3NA 3BVZA 3BZDB 4BY7B 2E2DC 5IT9E 3JAML 5M5WB 3QJYA 4K6LA 4DNRB 1HTPA 3JAME 2QDBA 1WTXA 3K5MA 2Q8RE 5KYIA 3KK7A 4GZYC 4J8QA 1KDCA 1BCPF 3GTKB 1B4OA 4QUFA 2MGSA 4IUNA 3M7GA 1L0XB 2JA7B 2XRSD 2C9OA 1FNVA 1JWUD 3HEJA 2F0SA 3MXNA 3MXPA 4KTAA 4MHEA 4K5XA 1PZID 5KNDA 5EPKA 4PQXA 4M1UB 4IUUA 2GA4B 3E0JA 3DWPA 2IX3A 2AQ3B 3NTIA 1CI3M 3X3MA 3S15B 3SK4A 1S5FD 1LLRD 1O7ZA 2WKDA 3EFXD 5IGFA 2L11A 3WOFA 3TDQA 3J80E 4C3IG 1JB3A 1EIHA 1SYBA 1RKNA 3I72A 4LAAA 3D8GA 1G91A 2PYKA 3BVMA 4JBWA 1O7YA 2EJFC 1GJXA 3J81E 3FEWX 3E5SA 3HOZB 2E75C 5HGTA 3HGBA 4QMGA 4H44C 3T53B 2BA0A 4U68A 2DNEA 5CV8A 3D6CA 5EGTA 3DMUA 3NE5B 4H13C 4HTHA 4DK0A 4XIGS 4K8IA 3T16A 4KHZA 1SNCA 3OMCA 1OXVA 4TRDA 1J8IA 1F2ZA 2FFKB 3V96A 2IJ0A 3DEOA 4FVMA 1KNAA 1Y1WB 1EQTA 5C0XG 5CV9A 2V4DA 1QJOA 3P7JA 1YNJD 1CQVA 3NK9A 5DM73 3T51B 5E1FA 2IT1A 3OWFA 1AFPA 3Q23A 2AWNA 1A15A 4PV1C 2H1EA 2VXWA 3A7LA 4UAIA 5JJZA 1SJHD 1ZXTA 2EE1A 3T4AC 3S17B 3K7AB 2F0NA 4ID6A 4QIWB 2NWGA 1IYVA 1LV9A 1MGSA 2WINB 1PTOF 1SBBB 3K5OA 2EDGA 3DXJC 3GTJB 2SDFA 1JCKB 1TS3A 1SEBD 1EY7A 1MSHA 1ICWA 3OMGA 3I90A 5TSSA 1QCBD 2EY1A 1E2VA 4HCSA 2K5DA 3KLSX 2PMZB 5FO7B 1I50B 2Y0SB 3OIQA 4F8MA 1QB5D 4IUPA 4OL7A 2E74C 4QUCA 2ENBA 2F0OA 2M00A 3A54A 4B9XA 4FO2A 3PO2B 1O7LA 2DY8A 4WFN3 1T5EA 1FYCA 2IX0A 1PTOH 2D9UA 2AQ2B 4OO1G 3M7NA 4XYQA 5C4ZA 5C4XB 2HCIA 4RKLA 3H09A 5JPMC 4K14A 2ZXOA 4I7ZC 1LTSD 4JK1C 3S1RB 1WTOA 1U4LA 1CK1A 1PZJD 3SHLA 4K8JA 3HOVB 4HAEA 1IW7C 4A93B 4DXFA 4FF4A 1BOSA 1VF5C 2VB2X 4OIKA 3A55A 4ILWA 1XXGA 4WORA 1QWYA 2EYLA 5K36H 5KGUA 1ENAA 4G7OC 3FPPA 1LTTD 1SE4A 1U4RA 5KYLA 3GTLB 4ZUIA 3S1QB 4C3HB 4X3TA 1I4QA 3A7AB 3G7LA 4PMBA 1EQVA 2F1MA 4DGZA 1ZKOA 2R61A 2KA7A 3L9AX 1F2LA 3MXUA 2F3WA 3H94A 2WIIB 2Q8TA 2NTSA 1Q1BA 1ENFA 4A3BB 2EYFA 1STEA 2IPKD 3EQLC 4A3EB 1BNZA 1TT2A 1Y1VB 4R8NA 3OWEB 1EU4A 5J22A 5KNCA 4HCEA 2VNUD 3T56B 3RMHA 4XQQA 5C5LA 1DXMA 2F4IA 3NUCA 4RGOS 1JWMD 1MSGA 2ZT9C 1D5ZC 1XYIA 5E4XA 4K5VA 1SAPA 2KCCA 1AZPA 3FKIB 4J6HA 4KI0A 2XWBB 2Q8IB 2YU9B 5M3MB 5C3EB 1Q90A 3RZOB 3MAQA 4XQNA 2F0UA 4ZYSA 1AZQA 2F0KA 2L0CA 3GTGB 1SXTA 3J7AV 3ERQA 2QF7A 2BA1A 1IHZA 5IODA 1CTMA 3K6OA 2F0JA 3S1NB 3KLSA 3T13A 2MPMA 3TZUA 2PNRC 1LT5D 4NW2A 3DHQA 4C56C 1QILA 2BDOA 3VR4A 1LT6D 1U4MA 4RA8A 4FF2A 4R8IA 4EQNA 1V1PA 2ZXRA 3KLRA 2A6ED 1SSOA 4DAVA 2BDNA 1T5XD 5ELFA 2FHTA 1TWAB 4IZ8A 1HRJA 5ELEA 2HUGA 5JOBA 5FLXE 4C3JG 5JVH3 4EQOA 3VA7A 2F0QA 1S5DD 3I8ZA 2PCFB 3S1MB 3GD7A 1O78A 2D62A 3ONAB 1JICA 1STBA 4X3KA 2ID0A 4PNYA 2RDGA 1Y8PB 2XRQD 2RDHA 2WP8J 5I9PA 4MN3A 1W6KA 2EY6A 1GHKA 3P75A 1HA5A 1H9KA 1YNJC 5M3FB 1OXSC 2A74C 4X3SA 1IL8A 3P20A 1CHPD 2R7ZB 3MC0B 3G6JB 3CRKC 1RJTA 3NWSA 4KV6A 2AUJD 4CHTB 4DN4M 1BR9A 2B2YA 4G4KA 2XVSA 4ME5A 5I9OA 2K6AA 2RKSA 2PZWA 4CJ0B 4IN3A 3C3LA 1NR4A 3D4WA 3MFGA 5EQ0A 2AWOA 4FXGC 4S3SA 5I6YA 1U9RA 1X3QA 1I4GA 3PUYA 4BS9A 1D5XC 2B2WA 3K57A 2B63B 4Q5VA 3SK6A 3OOCA 2L1BA 3CKIB 2EOTA 3QOLA 2B2TC 5CORA 2BCOA 4BWGB 1EL0A 1TKWB 1C48A 3F2UA 1ESFA 3GV3A 2NTTA 5G3LF 1BO0A 1GUTA 2M2LA 1HFGA 1B53A 4IFDG 5CYUA 4F88A 4NKLA 4ZQ3A 3H3VC 4A3FB 3BYYB 1KDBA 2O5JC 2NB0A 4L63B 3EJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB9 A;  1IW7 D;  1O78 A;  1GUN A;  3QG1 A;  5KNC A;  2JEA I;  2D62 A;  3FMC A;  1OXX K;  1BDO A;  2LMC B;  3T56 B;  3ND9 A;  1O7L A;  3L7Z C;  1T5E A;  1FYC A;  1Y8P B;  2BE5 C;  3PUZ A;  5K36 G;  1H9J A;  4OO1 G;  2L5T A;  3M7N A;  1GUO A;  1DXM A;  5KND A;  4BA1 I;  2JE6 I;  2E76 C;  3BG3 A;  3VR5 A;  1GHK A;  4DNT B;  5C0X G;  4DK1 A;  2ZT9 C;  1IYU A;  3OW7 A;  1H9K A;  4I7Z C;  4KKT A;  1YNJ C;  2K32 A;  2V4D A;  1I6V C;  1QJO A;  3I73 A;  1OXS C;  4IFD H;  3A8J E;  2NN6 H;  4JK1 C;  3P20 A;  3RLF A;  3SE0 A;  2KCC A;  1YNN C;  4L8J A;  4KKU A;  4KN7 C;  1CI3 M;  3T51 B;  4KI0 A;  1Q1E A;  2R6G A;  1TU2 B;  2EVB A;  2IT1 A;  2Q8I B;  5KNB A;  3M85 A;  1GHJ A;  2B8F A;  3CRK C;  2O5I C;  1Q90 A;  1IW7 C;  4G7Z C;  2A68 C;  1B9M A;  1V43 A;  2A6H C;  5JEA H;  4TQU S;  2K7V A;  3PUV A;  2AUJ D;  1Y69 U;  1Y8O B;  2A68 D;  1VF5 C;  3PV0 A;  4PV1 C;  3A7L A;  3GQB A;  2AUK A;  3A8K E;  4OGQ C;  2EJG C;  2CW0 C;  4TKO B;  2QF7 A;  2BA1 A;  3VR6 A;  2K33 A;  3M4Y A;  1Q12 A;  1B9N A;  5K36 H;  3D4R A;  1V8Q A;  1CTM A;  3OPO A;  1CFM A;  4G7O C;  3FPP A;  1IYV A;  1H9S B;  4H0L C;  5BN5 A;  2EJM A;  4HR7 B;  1LAC A;  1DD2 A;  2D5D A;  3I72 A;  2B8G A;  1Z7T A;  2A69 D;  2AWO A;  4KN4 C;  1OXU A;  3PUW A;  2DNC A;  3PUX A;  4LK1 C;  5C0X H;  3A8I E;  2EDG A;  3DXJ C;  1HPC A;  3A7A B;  4KMU C;  1FR3 A;  1ZYR C;  1A6X A;  1E2W A;  4JBW A;  5JEA G;  2JEB I;  2EJF C;  1DCZ A;  2BE5 D;  2PNR C;  3IKJ A;  3TZU A;  4OO1 H;  1GJX A;  2F1M A;  2A6H D;  4IQZ A;  3PUY A;  1GUG A;  1ZKO A;  2BDO A;  2KA7 A;  2E75 C;  3VR4 A;  3MXU A;  4XTC S;  1GUS A;  3MFY A;  2D2C C;  2PPB C;  3D31 A;  3H94 A;  1VCI A;  3HGB A;  3IFT A;  3OOC A;  4H44 C;  4G7H C;  3CRL C;  3N6R A;  3T53 B;  2BA0 A;  3LNN A;  3KLR A;  3ND8 A;  2A6E D;  3VR2 A;  1HQM C;  2A69 C;  2DNE A;  1K8M A;  1Q1B A;  2YYZ A;  3BDO A;  1PMR A;  3QJY A;  4KKS A;  3SDZ A;  3QIA A;  5BN4 A;  1G29 1;  4DNR B;  1HTP A;  5A35 A;  1LAB A;  1K8O A;  3W3A A;  1E2Z A;  1H9M A;  3WDN A;  1E2V A;  4BA2 I;  4LJZ C;  1TKW B;  3EQL C;  1ONL A;  3NE5 B;  4H13 C;  2A6E C;  1VDZ A;  1VF7 A;  4DK0 A;  4GZY C;  4XIG S;  1H9S A;  2NN6 I;  1GUT A;  3I4L A;  1Y8N B;  3LWU A;  1HCZ A;  4IFD G;  3U9S A;  2DN8 A;  2E74 C;  4RCN A;  5BN3 A;  3VA7 A;  1EWH A;  3VR3 A;  1OXT A;  4KHZ A;  1Z6H A;  2PCF B;  2O5J C;  2NN6 G;  1SMY C;  2JXM B;  1OXV A;  1H9R A;  3GD7 A; 
#chains in the Genus database with same CATH topology
 5I2X A;  1IL2 A;  1SMY D;  1S4Z A;  1EQQ A;  1X3P A;  4KHV A;  4OWT B;  2UXC Q;  1NSN S;  2JA9 A;  1B8A A;  3SR1 A;  2IHE A;  2EY2 A;  1I6H B;  4DV7 L;  2WV6 D;  5IP9 H;  3I4M B;  3HOU H;  3NEN A;  3BVG A;  2JA5 G;  4A3M H;  1B7Y B;  2KEN A;  1II3 A;  3MA2 B;  2RF4 A;  4G57 A;  3I4N H;  4JI4 Q;  2N78 A;  3MHB A;  3SE0 A;  2KQ3 A;  4NXN Q;  2JA7 H;  2L55 A;  3GTL H;  1VQF A;  5LMN W;  1EFW A;  1VQI A;  4B3M L;  4EVO A;  2KEC A;  1PV4 A;  3U4V A;  1EYA A;  4JI1 Q;  3GO5 A;  2LXJ A;  1EY4 A;  2AUK A;  4OGQ C;  4HMI A;  4OHJ A;  5FJ8 G;  1QVG A;  2UXD L;  5M3F H;  2K33 A;  3TRZ A;  1DYQ A;  1V8Q A;  4PZ6 A;  3OPO A;  5DEH A;  3H0G B;  1F2Y A;  2P5Z X;  4LF5 Q;  3NBH B;  3SEB A;  4A3B H;  2XTI A;  4KHP Q;  1FNW A;  1L1O C;  3R8B A;  2B8G A;  2HT1 A;  3KBX A;  4LK1 C;  1K3R A;  1PRT D;  1DZ1 A;  2J7Z A;  2KCM A;  1FR3 A;  2TSS A;  1E2W A;  2ICI A;  4IUQ A;  3CCU A;  2EIF A;  3UE1 A;  2BH8 A;  3NTH A;  1JR0 D;  4AYB G;  3BYT B;  4OWX B;  1A3T A;  4ZKB B;  4BY1 G;  2JYO A;  1GD7 A;  3C46 A;  3D31 A;  1FNU A;  1GOZ A;  5JPN C;  2MFI A;  1EIG A;  1MHW C;  3VYT A;  1HR0 Q;  4LMQ D;  3BDO A;  2QGQ A;  5BN4 A;  1Q81 C;  1G8Z D;  4A3G B;  1BKB A;  1VQH A;  3ZJY C;  4LJZ C;  1FL0 A;  1VDZ A;  1KLG D;  2YV5 A;  5NUC A;  1BQQ T;  2NVT B;  1DOM A;  3ERO A;  3DLL A;  2VZA A;  4ALP A;  1DGS A;  1HXY D;  4X64 L;  2QA4 A;  1X9N A;  4RCO A;  1TWG B;  1F9P A;  4P2C B;  4BY1 H;  2MHV A;  4M8A A;  3NWT A;  2I07 B;  2JN4 A;  5C3X A;  4F87 A;  3ICE A;  4UP7 A;  5T1G A;  4DAM A;  3HOZ G;  1HZA A;  4IUR A;  3OHX C;  1EU3 A;  3SK8 A;  3M4Q A;  4IFD H;  1IBL L;  3W5O A;  4HJ5 A;  5CMD A;  1SNM A;  1AP0 A;  5E4W C;  4GLA C;  4JI3 L;  1CZG A;  1TU2 B;  4DUZ Q;  2NZH A;  1G6P A;  1Z47 A;  3S1N H;  2IWH A;  4Y7N B;  1RL2 A;  4NXM L;  3L3O C;  4DR7 Q;  2QKI C;  1C8C A;  2K05 A;  1Y1W H;  4NXM Q;  1PVO A;  4IUV A;  2JA6 H;  2F52 A;  3AU7 A;  1PHJ A;  2X69 A;  2F3I A;  3MXN B;  2F4V Q;  2F3V A;  1BF4 A;  4CDD C;  2F0M A;  1JJC B;  3V2T A;  4DPG A;  2VUM G;  1PH1 A;  1Q82 C;  4OO1 I;  1EIF A;  2EJM A;  4NP5 A;  3TBI B;  3I4N G;  1DD2 A;  2JA8 B;  2A69 D;  1I3Q B;  1EFI D;  4IPG A;  4MIU A;  3TRE A;  4B3S Q;  2I5L X;  3HKZ E;  2ICE C;  1LUZ A;  4PG3 A;  3HOU G;  1STH A;  1K83 H;  2I0Q A;  3I55 A;  4DAY A;  5IIF A;  3WOE A;  3NHH A;  4PMC A;  2MO1 A;  1HA6 A;  3HOV G;  1NNX A;  3D3R A;  4IJH A;  2SOB A;  3K7A H;  4DV7 Q;  4EGV A;  5COY A;  1TVX A;  3CPF A;  4C2M H;  3S1M H;  4FXK C;  2PNH A;  3LNN A;  1HQM C;  4KKS A;  1IBK Q;  1EYD A;  1LTB D;  3UI2 A;  2CFM A;  1K8O A;  4JI1 L;  3NEM A;  4FXD A;  3NTK A;  2WAQ B;  1VF7 A;  1A2T A;  1HFN A;  1TII D;  3QWN A;  2RSN A;  2UUC L;  2PW7 A;  1PH8 A;  2A5H A;  2Z4H A;  3DWA A;  3W1B A;  1EWH A;  4NB3 A;  4L5Q A;  4ME3 A;  2CQA A;  2EXD A;  4Q0F A;  2K5V A;  3FRP B;  3CC7 A;  2NBF A;  3P1H A;  4DV4 L;  1BDO A;  2F0W A;  5IYB H;  4DV4 Q;  1XNR L;  3ITP A;  3RLN A;  3M3Y B;  2BH2 A;  2OWO A;  5K36 G;  2HD3 A;  4R1J A;  2N8N A;  2Y0S G;  2PZU A;  5JJK A;  3JC6 6;  3LWE A;  3L0O A;  5IYB G;  4YY3 L;  2NVY H;  2R93 H;  3J80 c;  4EQP A;  1WTR A;  1AH9 A;  3URY A;  4LF8 Q;  4C3J H;  2N55 A;  4GS3 A;  3EBE A;  5LL6 S;  1B3Q A;  3NBI A;  1TWG H;  1SNP A;  2B2U C;  2WFW A;  4GKK Q;  3M85 A;  1DJR D;  3E6Z X;  4OEM B;  4QIW E;  4BXX H;  2EZV A;  3VYU A;  1SLJ A;  2DY7 A;  3PUV A;  2NVQ B;  4V19 0;  3F2C A;  5J1Z A;  3TS2 A;  4A3F G;  2I46 A;  4IFD J;  1S3O A;  1KAW A;  2PQA B;  3S16 H;  1CHQ D;  1TWC B;  4R9W A;  1Q12 A;  4C1N I;  3L2P A;  3D4R A;  2CH4 W;  3CU7 A;  2B2V A;  3I91 A;  4JI8 L;  4DV6 L;  2FMC A;  1UNS A;  5EKK A;  1PDQ A;  1Z7T A;  2KVM A;  4KY7 A;  1D5M C;  2N3S A;  5GAG C;  3CC2 A;  4NPS A;  2NVX H;  2JEB I;  4I7A A;  5ISR A;  4GKJ Q;  4IAL A;  5G3L D;  2LKV A;  2OQ0 A;  1GUS A;  3MFY A;  1E22 A;  4LF4 L;  2EQS A;  4KLK A;  5J39 A;  3N6R A;  2XN9 C;  3VR2 A;  1XWE A;  2Z8L A;  3TP7 A;  1LTG D;  3DWQ A;  1PYS B;  4K5W A;  5FLX c;  1MBY A;  1LAB A;  2XWJ B;  1IBM Q;  1EWC A;  3SXH A;  3KUP A;  2K5N A;  4LF6 L;  4L5R C;  1SRU A;  4DF7 A;  2A6E C;  1VQD A;  2K52 A;  2NN6 I;  1U5K A;  2EYO A;  5BN3 A;  3PSI A;  1TY2 A;  1RCV D;  2HDL A;  4X65 L;  2KHS A;  1SR3 A;  4KD4 A;  4C2M B;  1EUJ A;  1H9R A;  1VMP A;  2G9H D;  3K0Y A;  4XXE A;  1IW7 D;  4A3K B;  2FJ2 A;  3IFD A;  4A3L H;  3I3C A;  1UE5 A;  2LMC B;  3TP6 A;  1AEX A;  1T9H A;  2A1A A;  3J81 L;  3GTO H;  1V1Q A;  1QNK A;  1S5B D;  1B50 A;  4ZLT F;  5ELO A;  2N88 A;  1H9J A;  1QUQ A;  3U4Z A;  1VQ7 A;  2O4X A;  1Y1V H;  1PFB A;  4BA1 I;  2JE6 I;  1CZW A;  1YVC A;  1YJN A;  2E2J B;  3EIV A;  1A8V A;  2D0O A;  5D14 A;  1I6V C;  5JVG 3;  1BBX C;  5EPL A;  4R4I A;  2NN6 H;  4CKB A;  2K75 A;  2JP1 A;  2F0E A;  2Z6B A;  2ZXP A;  2ES2 A;  1YBY A;  3M4O H;  1N32 Q;  5HUR A;  4XT1 B;  5IT9 L;  2UUA L;  4JYA Q;  5CBE E;  1B9M A;  1ROD A;  1WTP A;  1PYB A;  3DEP A;  1Y8O B;  2A68 D;  1ZYR D;  1PFS A;  2R93 B;  1PH4 A;  3GQB A;  5BR8 Q;  2EJG C;  5K5P A;  1I4X A;  3OSO A;  3NXW A;  2JA5 H;  2PMZ E;  2K01 A;  5C0X J;  3MVV A;  2F0D A;  2RQX A;  4JV5 Q;  1B9N A;  2OXP A;  5JEA J;  3VDY A;  1M4V A;  4WRD A;  2QDL A;  1PTO D;  3GTM B;  2F0T A;  5C5M A;  2D5D A;  2IW3 A;  1CQF A;  2NUC A;  4KN4 C;  1ENC A;  2DNC A;  3KF8 A;  1D6E C;  1TR5 A;  3FHW A;  3EVQ A;  1X56 A;  3TP8 A;  4A3B G;  1CT1 D;  1VQE A;  1GUG A;  4JI7 Q;  4BBR H;  4DUZ L;  4XTC S;  4POF A;  3S16 B;  1PZK D;  2HQE A;  1N34 L;  1TWC H;  3IFT A;  5I4D A;  3CMA A;  4X62 L;  5FO8 B;  4XDX A;  1SYG A;  4O1N A;  1WVL A;  2WKC A;  3W3A A;  1B2T A;  4KY6 A;  3HFZ B;  3FDT A;  5CBA E;  3A5U A;  2IY5 B;  3Q0A A;  4DV1 L;  4NMZ A;  2LS0 1;  4JG2 A;  5KEE A;  5C4X H;  4RAU C;  3I4L A;  3U9S A;  1L0Y B;  3NQI A;  2FMM A;  4A3I B;  1J5E Q;  1GXD C;  1VQO A;  1KLU D;  2F0F A;  3GP7 A;  1WD0 A;  2OF1 A;  4IUT A;  4ABN A;  2RSO A;  2UXC L;  3UDX A;  3J7A F;  4GKJ L;  3KOJ A;  3HP3 A;  3HOV H;  3NSW A;  2BE5 C;  2DGY A;  1TWA H;  3PUZ A;  1TY0 A;  2E2I B;  1PYW D;  1N9W A;  1GUO A;  3AMU A;  3T1H Q;  1NR2 A;  4ZUJ A;  4B9W A;  4HJ9 A;  4DNT B;  1QG7 A;  1NY4 A;  1EY8 A;  1KAB A;  1B44 D;  1EZ6 A;  1X55 A;  2Z0S A;  3A8J E;  2MP1 A;  3F1Z A;  5IE8 A;  5FO9 B;  4A3K H;  4KKU A;  2F03 A;  1EYG A;  2R6G A;  4K2L A;  1SMX A;  3RLO A;  3K80 C;  5IT9 c;  4LFC L;  1BBU A;  1TWH B;  1Y1W G;  4TQU S;  1IKL A;  2K03 A;  1JOO A;  3QB3 A;  2NYZ D;  4DR5 L;  1F9Q A;  1LTI D;  4HED A;  3A8K E;  3OW2 A;  2E5L L;  1G2T A;  3IRB A;  4LUZ A;  4N9T A;  3M4O B;  1JT8 A;  4LF7 L;  1K8A C;  3BDC A;  1B3A A;  3B6Y A;  2CHB D;  4RWS C;  4CJ1 B;  3QOJ A;  1OXU A;  5ELD A;  1FGU A;  3TME A;  3PIO 3;  4U67 3;  4LNQ A;  2R92 B;  5LMU Q;  4R4C A;  2G9D A;  5LMN L;  2ALY B;  1K3B C;  1NAP A;  4IO9 A;  1PLF A;  1XNR Q;  3W2D A;  5M5Y B;  2A6H D;  2M9V A;  4YCW A;  1MD2 D;  4RHS A;  5EKL A;  4GNX A;  1XNQ L;  4EX5 A;  3K58 A;  4YIJ A;  1RTN A;  2ZTE A;  2SNM A;  1YI2 A;  2MJ8 A;  3D0F A;  3UDI A;  4CKE A;  3R93 A;  4YY3 Q;  1S5E D;  1QE6 A;  4JI6 Q;  4P73 A;  3QIA A;  4C3H G;  3GTM H;  5A35 A;  1G51 A;  4K0K L;  2VUM B;  5I6W A;  5FLX L;  4IOA A;  1MKH A;  4WJ4 A;  3M4P A;  2CWP A;  4B3T L;  3RZD B;  3O13 A;  3PO3 B;  1ML0 D;  2NVY B;  3K5N A;  4LF4 Q;  2EXZ A;  3VR3 A;  5EBC A;  3K59 A;  4HID A;  4C3J B;  2NN6 G;  1SMY C;  2JJQ A;  1X32 A;  1KL9 A;  3PUX A;  4DV2 L;  3D4D A;  2MNA A;  2CVR A;  2PO4 A;  4A93 G;  5GQO A;  1A0I A;  4DR4 Q;  4QY7 A;  3RNU A;  4YCU A;  3RZO H;  3C1F A;  2VQE Q;  5D3D A;  2EYH A;  3E0E A;  2VQE L;  3CC4 A;  3CQZ B;  1UEA B;  5CGK A;  2LSS A;  3C1E A;  1I4P A;  1DON A;  1SYE A;  5CV5 A;  1AW7 A;  5IGB A;  1ET9 A;  3ULP A;  5ELB A;  4A3D B;  2F0G A;  4L5S A;  4DV1 Q;  2QEJ C;  4H7B A;  4Z9C B;  4L8J A;  4MNO A;  4ULL A;  1EY0 A;  5FOB B;  2AHO B;  1DM0 B;  1ILQ A;  2I5M X;  3PO2 G;  1V43 A;  5JEA H;  3HOU B;  1J6Q A;  3AFP A;  4GLV B;  4O42 A;  4KJO A;  5FLM G;  1A3U A;  1F2M A;  2RBM A;  5L37 A;  1I4R A;  3I4N B;  2CWA A;  4FYD A;  4TKO B;  1KQS A;  4UPA A;  4PMW A;  2AQ1 B;  5M5W H;  2HCC A;  2H5X A;  2HIX A;  1TS2 A;  3KF6 A;  1BXT A;  2SEB D;  2A8V A;  5KRU A;  5GAH C;  2WAC A;  3PUW A;  1EIY B;  1YNX A;  1HPC A;  3OIP A;  4AQY Q;  4BBS G;  5IP9 G;  1XX8 A;  4KJN A;  5EKI A;  5C4H A;  2X6L A;  4C3I H;  2EY5 A;  2R7F A;  2UUA Q;  2K1B A;  2PW5 A;  1GVP A;  4CKC A;  4GOP A;  2HHH Q;  3RN2 A;  4GN4 B;  5CV7 A;  1LTA D;  3RD4 A;  5IGE A;  3H0G H;  3G6E A;  1I94 L;  3SDZ A;  1KDA A;  2F0H A;  2UUB Q;  4KK7 A;  1K8G A;  4JOI A;  4UDU C;  2EYP A;  4FNF A;  4TVA B;  4LFA Q;  4HJ8 A;  5C6A A;  1JC7 A;  2Q2I A;  4JV5 L;  4RGM A;  3ER0 A;  1SJE D;  2B2W C;  3TQY A;  2E2J H;  3JAM i;  5A2Q E;  1A2U A;  5EJW A;  4JI0 L;  1J5E L;  1HZ9 A;  1STG A;  4JVZ A;  5JJI A;  1EOT A;  2B2V C;  3K5L A;  1VQ9 A;  1CKO A;  2F0L A;  1VQA A;  5CR3 A;  1WI5 A;  3QO2 A;  3Q6S A;  3FMC A;  3IL8 A;  4FF3 A;  1EQR A;  2R93 G;  4RKB A;  3DM3 A;  5IGD A;  3J81 c;  3BS1 A;  1Q8I A;  4YWL A;  4DFA A;  1EEI D;  2QCP X;  1KRT A;  4GOP B;  5C3W A;  3GDE A;  4E6I A;  5M9O A;  3PIP A;  5CV4 A;  3PO3 H;  1JOK A;  4DK1 A;  3VA5 A;  4N8F A;  1LT4 D;  4H02 A;  4KY5 A;  2JA5 B;  1R4Q B;  2J0T D;  3FVQ A;  3I4M G;  3R2T A;  5JJL A;  3HOX B;  1R4P B;  5F2D A;  2EVB A;  4EQ5 A;  1GHJ A;  1S72 A;  3KJP A;  1NCV A;  1R9T B;  4HSV A;  4P74 A;  4ZRZ A;  4JI4 L;  4FP5 D;  1RF2 D;  2CW0 C;  4UY8 C;  4X66 L;  3CCV A;  3S1R H;  1O80 A;  3S2H B;  2WB1 B;  1NMF A;  5M3M G;  5M5X B;  2E2H H;  3Q24 A;  5BN5 A;  4R4T A;  3VYS A;  5AFW A;  1YNN D;  4UHV A;  4N9P A;  3HS0 C;  2KJX A;  4LUV A;  3H91 A;  4LF9 Q;  2X6G A;  5IYD G;  3OYY A;  4WJW A;  3HG9 A;  2XGT A;  2LXK A;  1CA6 A;  2K04 A;  4DR4 L;  3EN2 A;  2R3Z A;  1XMO Q;  5C44 B;  2UXB Q;  4DV3 L;  2GVA A;  1U0L A;  2UXB L;  2D2C C;  1VCI A;  4ZKC B;  1JOQ A;  1WTQ A;  4RH6 A;  2A69 C;  1BBW A;  2SNS A;  2YYZ A;  4N8X 1;  3S9W A;  3KLW A;  1ZEQ X;  1TS5 A;  1G6Z A;  1E2Z A;  1YZ6 A;  1ESR A;  1STN A;  3WDN A;  2OEO A;  2HQL A;  2PZT A;  3KDF B;  1EWI A;  1H95 A;  3HOY G;  3NBH A;  4RGT A;  1Y8N B;  3LWU A;  4C3I B;  2PI2 A;  4A3M B;  2B39 A;  4DAP A;  1VQP A;  1UE6 A;  4OXP A;  1PH5 A;  5EAY A;  5IGC A;  2KEE A;  4J1M A;  5ELC A;  1AN8 A;  2L9H A;  1HR0 L;  3PO3 G;  4GLX A;  1GUN A;  1PFN A;  4A3I G;  2EPB A;  2VQF Q;  1KIX A;  1JQY D;  1CSQ A;  4K2K A;  3CP0 A;  4HSP A;  3HRZ C;  2R7Z G;  1AE3 A;  3CD6 A;  1XTD A;  3KFU A;  1B1Z A;  1BVS A;  4DV6 Q;  2L5T A;  4A3E H;  2KUM A;  1PH9 A;  1STY A;  3UDF A;  2E76 C;  5IP7 H;  1HUN A;  3A0J A;  3OW7 A;  1A63 A;  1UE1 A;  3N52 A;  1NUC A;  2KCN A;  4JPB W;  3WWV A;  2CH4 A;  1YHB A;  3KJO A;  1IBL Q;  4KN7 C;  3GTQ H;  5JAV A;  3MZ5 A;  1TWF B;  3J7Z C;  1XMQ Q;  4IPC A;  1X54 A;  5IYC H;  2R92 H;  3M3Y H;  1CM9 A;  3GTJ H;  1MIU A;  4OIJ A;  3HOW G;  1E7Z A;  2LY7 A;  2I5H A;  4O2D A;  5DAU A;  2J4X A;  1SFO B;  1S40 A;  2XIW A;  3KBG A;  4ODG A;  4AH6 A;  1SE2 A;  1SYF A;  3MTS A;  4TSS A;  1W2B A;  2XSC A;  1V1O A;  1LAC A;  4L5T A;  3GV6 A;  1WD1 A;  3TEH B;  3A8I E;  2BOS A;  5DM6 3;  3HOW B;  1C0A A;  2NVQ H;  1PRT F;  3IKJ A;  1DCZ A;  2BE5 D;  1KTK A;  1STA A;  1JOR A;  2NVT H;  3NPP A;  3TSS A;  2DUD A;  1IZ6 A;  1DOK A;  1KNE A;  4O0A A;  1PRT B;  4A3G G;  4CBV A;  1ILP A;  4G7H C;  4IFD I;  5FK9 C;  3ND8 A;  5FJ8 H;  3PIO A;  5JEA G;  3MXG A;  4BY1 B;  1LO5 D;  3PO2 H;  2G5D A;  4AYB B;  4BA2 I;  5CC4 A;  1RD9 D;  1WTW A;  1PTO B;  1HHV A;  4NXN L;  2NVX B;  4JI2 Q;  1RIP A;  2DN8 A;  3U50 C;  4RCN A;  4LFC Q;  3R3O A;  2JA7 G;  1HUM A;  4DR6 L;  4KHP L;  1UUP A;  4F7X A;  1ASZ A;  4LW1 A;  1OXX K;  1X3F A;  4ZK9 B;  1C9O A;  1KAA A;  3FP9 A;  5E3F A;  3I56 A;  4RHR A;  1VQJ A;  3RR5 A;  3NQT A;  2B2U A;  4JBM A;  1F9R A;  3HOY B;  3NEL A;  2K4K A;  4DXG A;  1PFM A;  3MEH A;  2JA6 B;  3VR5 A;  1OO9 B;  1C7Y A;  3S2D B;  1IYU A;  5E7N A;  4IOC A;  5D65 A;  1VQG A;  1PH7 A;  4L6T B;  3RLF A;  4A3J B;  5IYC G;  1YNN C;  3Q22 A;  2JA8 H;  5KNB A;  5C44 G;  2WB1 E;  4G7Z C;  2HDM A;  1S5C D;  2A68 C;  3S1Q H;  1SE3 A;  1CUK A;  4C3H H;  2A6H C;  3PF4 A;  1BCP C;  2UUB L;  1SDF A;  1K83 B;  1V1P B;  4DU9 A;  2WAQ E;  3SVM A;  1SYD A;  4X64 Q;  3PIP 3;  1BCP B;  1EY5 A;  1Q46 A;  2Z4I A;  4C1N K;  3PMF A;  1M8A A;  3V05 A;  4RGN A;  3M4Y A;  3DUZ A;  3S14 B;  1CFM A;  2VL6 A;  4OWW B;  2L4N A;  2RHS B;  2R7Z H;  3S15 H;  1TXY A;  3CF5 A;  4HR7 B;  1E24 A;  1G2S A;  2NZ1 D;  2WAQ G;  5EBD A;  1FD7 D;  3HKZ G;  2Z1C A;  1LTR D;  4LUO A;  5T1I A;  4K0K Q;  2H4O A;  1Q3L A;  2ZJQ A;  4DR2 L;  4OO1 H;  5I2Y A;  5CV6 A;  1L1O A;  3IAY A;  3U9O A;  4HMJ A;  1J9O A;  3FPU B;  1PA6 A;  2RVL A;  4JI3 Q;  4BBS B;  1I4H A;  3CRL C;  4JBK A;  3DM1 A;  1ICF B;  1K8M A;  4FDB A;  1G29 1;  1H9M A;  1QOH A;  4OEL B;  1HZB A;  2B63 G;  1RHP A;  4R4O A;  1XPU A;  5KIX A;  4A3K G;  4CJ2 C;  4DA2 A;  1H9S A;  1XTC D;  1F9S A;  1B70 B;  1HCZ A;  4XQJ A;  5IGG A;  1NJI C;  4LFB Q;  2B63 H;  1OXT A;  3A5Z B;  4BBR B;  4K6D A;  4DK3 C;  5C4J B;  2RDF A;  4P71 A;  1SNO A;  4APV A;  1WCM G;  1KRS A;  2JXM B;  1JWS D;  3AB9 A;  3I70 A;  3NP8 A;  1UEB A;  3QG1 A;  4DUY Q;  2AMC B;  2JEA I;  3FKI H;  4ZAI A;  1SYC A;  2OQK A;  3ND9 A;  4X3U A;  3VYR A;  4GN5 A;  2RCN A;  3L7Z C;  2F0V A;  4HN7 A;  4I65 A;  4B3R L;  4A3D G;  1BUV T;  4B3R Q;  2VB3 X;  2IX1 A;  2YTY A;  3ZYY X;  2KED A;  2B3G A;  4YWM A;  1TS4 A;  1X3G A;  3J80 i;  1M1K C;  3BG3 A;  3CCQ A;  1GUW A;  4LF9 L;  5IWA L;  4OX9 Q;  4KKT A;  4A3J G;  2K32 A;  1IKM A;  3J7Y W;  1YEZ A;  2L12 A;  4XT3 B;  4A3C H;  3H15 A;  4AIM A;  2VY3 A;  5C0X I;  2RA4 A;  1SE8 A;  5M5X H;  2E2H B;  1D1K A;  4XYO A;  3H6M A;  3PCO B;  4R4Q A;  1PRT C;  3LGJ A;  2B8F A;  2UUC Q;  2O5I C;  2K50 A;  3HZX A;  1FJG L;  2KOL A;  1I6H H;  1C4Q A;  2K7V A;  3D6W A;  1Y69 U;  3I4M H;  1EY6 A;  2QIL A;  4A76 A;  1JE4 A;  2LFN A;  2B2Y C;  1PXU A;  1FGB D;  2B2T A;  3PV0 A;  1HR0 W;  3I2Z A;  3S2D H;  5A2Q L;  4RFB A;  4BY7 H;  5C44 H;  3BZC A;  1KD1 C;  2XNA C;  1PTO C;  4Y52 H;  3CAM A;  4JI2 L;  1RDP D;  4KD3 A;  1QNU A;  5EPJ A;  2TMP A;  1CKN B;  4B08 A;  4JI5 Q;  1FVI A;  1SN8 A;  1UAP A;  1W6J A;  1BCP D;  2ASB A;  5C0X H;  1SRO A;  1KC8 C;  3R2I A;  1TWH H;  1ZYR C;  1A6X A;  3RUZ A;  3G48 A;  1RTO A;  2K5Q A;  4IQZ A;  1MJE A;  4IPD A;  2N49 A;  1HH2 P;  3GTK H;  1A3V A;  2HHH L;  4JI7 L;  2PPB C;  1DOL A;  3MWY W;  4DNI A;  2K5W A;  1HNX Q;  1LT3 D;  1F77 A;  1PMR A;  1HNW Q;  3HKZ B;  1U4P A;  2ZTC A;  1GO3 E;  3GTO B;  2EYM A;  2A73 B;  1ONL A;  3TN2 A;  2OT2 A;  1HQR D;  1CKN A;  2CW0 D;  5DNF A;  2FIN B;  2JK8 A;  1IYJ B;  3KF8 B;  1Z6H A;  4CGY B;  4BBS H;  1WCM B;  1WFQ A;  2EYJ A;  3GTQ B;  1TQO A;  2PQE A;  5GRO A;  3J80 L;  4QGU A;  1EZ8 A;  2KHJ A;  5H1S E;  1YIT A;  4POG A;  3MEF A;  1SND A;  1ET6 A;  3A56 A;  2F0P A;  4AYB E;  2VS1 A;  4A3L G;  3ERS X;  3GTP B;  2JSO A;  3RN5 A;  1VMC A;  1SNQ A;  5LHY 1;  1SFO H;  5C3E G;  1WTV A;  1EEF D;  2MUY A;  2YTV A;  4FF1 A;  4QB4 A;  1N36 Q;  3I73 A;  2FXQ A;  3TZD A;  4DR2 Q;  1JB7 A;  4QF4 A;  1X6O A;  1EY9 A;  3EA6 A;  1Q1E A;  1XPO A;  1HTL D;  3Q8D A;  2K28 A;  4NDX A;  3BU2 A;  1MI2 A;  1D1I A;  1CA5 A;  3HOW H;  1Q7Y C;  1Q8K A;  2L15 A;  5LL6 X;  4JC0 A;  4DUY L;  1EYC A;  3CHB D;  4P72 A;  5GAD C;  3C2P A;  2C5C A;  3TP5 A;  2F0I A;  5D3I B;  3VR6 A;  1XMO L;  4V0B A;  1WOC A;  3CCJ A;  4A3D H;  1D2B A;  4QCL A;  1H9S B;  4H0L C;  1E0B A;  4DR6 Q;  4JI0 Q;  3LX0 A;  4RG1 A;  2O2L D;  3SK5 A;  1P8L A;  5FKA C;  4J15 A;  4KMU C;  3BDL A;  1WYD A;  2IL8 A;  2JQO A;  4A3E G;  5IOC A;  3X3N A;  3BVZ A;  2YTX A;  3BZD B;  4BY7 B;  2E2D C;  1X65 A;  4GKK L;  1XNQ Q;  2V1C C;  5IT9 E;  3I7F A;  1HZC A;  3JAM L;  1VQL A;  2VW9 A;  5M5W B;  2MO0 A;  3QJY A;  4K6L A;  4CDF C;  4DNR B;  1HTP A;  3JAM E;  4BXX G;  2QDB A;  1WTX A;  2VQF L;  3K5M A;  2Q8R E;  5KYI A;  4UP9 A;  2E2I H;  2PI2 E;  3BZK A;  3KYH C;  3E9H A;  3KK7 A;  4GZY C;  4J8Q A;  1UWV A;  1XMQ L;  3F8T A;  1KDC A;  4DR1 Q;  1BCP F;  4CDE C;  4DR1 L;  4DV0 L;  3GTK B;  4A3C G;  4CDC C;  1B4O A;  4QUF A;  2MGS A;  4IUN A;  3M7G A;  1KHI A;  1L0X B;  2JA7 B;  2XRS D;  2C9O A;  1FNV A;  4GNX B;  1JWU D;  1N33 L;  3HEJ A;  3E3X A;  1P16 A;  2F0S A;  4GNX C;  3MXN A;  2K14 A;  3MXP A;  4KTA A;  4MHE A;  4K5X A;  1PZI D;  5KND A;  5EPK A;  4PQX A;  4M1U B;  5IYD H;  4IUU A;  4DV5 L;  1HNX L;  3FKI G;  1CKM A;  2GA4 B;  1N8R C;  1HNW L;  3E0J A;  3S14 H;  3DWP A;  2IX3 A;  2AQ3 B;  3NTI A;  1CI3 M;  1LTL A;  3X3M A;  3S15 B;  3SK4 A;  1S5F D;  1LLR D;  1O7Z A;  2WKD A;  3CXC A;  5GAE C;  1E1O A;  4A75 A;  3EFX D;  5IGF A;  3QR8 A;  2L11 A;  3WOF A;  1VQ6 A;  3TDQ A;  4X6A H;  3J81 i;  1QVF A;  1YJ9 A;  1QUQ B;  3J80 E;  4C3I G;  1JB3 A;  1EIH A;  2UU9 Q;  1SYB A;  1CSP A;  1RKN A;  4LFB L;  3CW2 C;  3I72 A;  4LAA A;  1EOV A;  5C3E H;  2K5H A;  3D8G A;  1G91 A;  1M90 C;  2PYK A;  3BVM A;  4JBW A;  1O7Y A;  2EJF C;  2KCT A;  1GJX A;  5ELN A;  3J81 E;  3FEW X;  3CPW A;  1QZG A;  3E5S A;  3HOZ B;  2E75 C;  1YIJ A;  5HGT A;  4PZ8 A;  2JA6 G;  3HGB A;  1E1T A;  4QMG A;  4H44 C;  3T53 B;  2BA0 A;  4U68 A;  2DNE A;  5CV8 A;  3D6C A;  3STB C;  5EGT A;  3DMU A;  1O7I A;  3NE5 B;  4H13 C;  4HTH A;  4DK0 A;  4JYA L;  1Y14 B;  4XIG S;  4BBR G;  1L1O B;  4K8I A;  3T16 A;  4KHZ A;  4HJ7 A;  3ULL A;  1SNC A;  1D7Q A;  3OMC A;  1OXV A;  4TRD A;  1J8I A;  5LMU L;  5BR8 L;  1F2Z A;  2FFK B;  4YWK A;  3I4O A;  3V96 A;  4YCV A;  4A93 H;  2IJ0 A;  1JE5 A;  1IXR A;  4Y7N H;  3DEO A;  4HIK A;  4FVM A;  1KNA A;  1Y1W B;  1EQT A;  4X62 Q;  5C0X G;  5CV9 A;  3AEV A;  4DR5 Q;  2V4D A;  1QJO A;  3P7J A;  1YNJ D;  4GOP C;  3K7U C;  1L0W A;  1CQV A;  3NK9 A;  5DM7 3;  2B29 A;  3T51 B;  5E1F A;  2IT1 A;  3F2B A;  1I3Q H;  3HKS A;  2D0P A;  4HIM A;  3OWF A;  1PH6 A;  1AFP A;  5FLM H;  3Q23 A;  2E8G A;  3UDG A;  2AWN A;  4DAY B;  4PZ7 A;  1A15 A;  2QW7 A;  4PV1 C;  2H1E A;  2VXW A;  3A7L A;  4UAI A;  5JJZ A;  1SJH D;  2WB1 G;  1ZXT A;  2EE1 A;  5DLQ E;  3T4A C;  3S17 B;  3K7A B;  2F0N A;  4ID6 A;  3UE0 A;  3G71 A;  1WJJ A;  4X66 Q;  4QIW B;  2NWG A;  4OON A;  1IYV A;  1A62 A;  1LV9 A;  1MGS A;  1XJV A;  2WIN B;  1PTO F;  1SBB B;  3K5O A;  4DV5 Q;  3CCR A;  1JJG A;  2EDG A;  3DXJ C;  3GTJ B;  3CCE A;  2SDF A;  1JCK B;  1TS3 A;  1VQ4 A;  1VQ5 A;  5AJ3 L;  3SGI A;  1SEB D;  1EY7 A;  1MSH A;  3AYH B;  1ICW A;  4DV3 Q;  3OMG A;  3I90 A;  3G4S A;  1PH2 A;  5TSS A;  1QCB D;  1GKH A;  2EY1 A;  1YHQ A;  4LF6 Q;  1E2V A;  4HCS A;  2K5D A;  4MZ9 A;  3KLS X;  2PMZ B;  5FO7 B;  2R92 G;  1I50 B;  3J81 j;  3JAM c;  2OTL A;  2Y0S B;  3OIQ A;  4F8M A;  1QB5 D;  4IUP A;  4X65 Q;  4OL7 A;  1QZH A;  2E74 C;  3H3V H;  4QUC A;  4LF5 L;  4YHH L;  2ENB A;  2F0O A;  2M00 A;  1OTC A;  5IWA Q;  4A3M G;  4OX9 L;  2ZM6 L;  2AKW B;  3A54 A;  4P75 A;  4B9X A;  5IP7 G;  2Y0S E;  4FO2 A;  3PO2 B;  1YJW A;  2YU9 H;  1N32 L;  1O7L A;  5M3M H;  3F2D A;  2DY8 A;  4WFN 3;  1T5E A;  1FYC A;  2IX0 A;  1PTO H;  2D9U A;  2AQ2 B;  4LF7 Q;  3M7N A;  4XYQ A;  4OO1 G;  1R9T H;  5C4Z A;  5C4X B;  2HCI A;  4RKL A;  3H09 A;  2C35 B;  5JPM C;  3GTG H;  4K14 A;  2ZXO A;  5IY0 A;  3KF6 B;  4A3I H;  2Z6K C;  4I7Z C;  4HJA A;  4DV2 Q;  5LMN Q;  1LTS D;  3KDF A;  4JK1 C;  3S1R B;  1WTO A;  1U4L A;  1CK1 A;  1PZJ D;  4B3T Q;  3H3V I;  3S2H H;  3A74 A;  5C4X G;  1VS0 A;  3SHL A;  3T1Y Q;  4K8J A;  3HOV B;  4HAE A;  1VQK A;  1IW7 C;  4A93 B;  1NE3 A;  4DXF A;  4JI6 L;  4FF4 A;  1BOS A;  1I94 Q;  1VF5 C;  3CME A;  2VB2 X;  4OIK A;  3A55 A;  1JMC A;  4ILW A;  1XXG A;  4WOR A;  1QWY A;  3OTO L;  2EYL A;  1VQ8 A;  5K36 H;  5KGU A;  1ENA A;  4JCV E;  3E9I A;  4G7O C;  3FPP A;  1LTT D;  1SE4 A;  3S24 A;  3K0X A;  1U4R A;  1MJC A;  4DV0 Q;  5KYL A;  2Q2H A;  3GTL B;  4ZUI A;  4QJF A;  3S1Q B;  3PF5 A;  4C3H B;  4X3T A;  1I4Q A;  3A7A B;  3G7L A;  4PMB A;  1EQV A;  3HOX G;  2F1M A;  4DGZ A;  1I5F A;  1ZKO A;  1NTG A;  2R61 A;  2KA7 A;  3L9A X;  3MXU A;  1F2L A;  1VQN A;  2NZO A;  4RMF A;  2KHI A;  2F3W A;  3H94 A;  3U58 A;  2WII B;  2Q8T A;  2NTS A;  1Q1B A;  1ENF A;  4GN3 B;  4A3B B;  3CCM A;  1K0R A;  2EYF A;  1YHA A;  1STE A;  2IPK D;  2MQH A;  1W3S A;  3EQL C;  4A3E B;  1BNZ A;  1TT2 A;  1Y1V B;  4DKA C;  1NMG A;  4QQB X;  5M5Y H;  4R8N A;  3K8A A;  3OWE B;  2Z9H A;  1K9M C;  1EU4 A;  5J22 A;  1Y1V G;  3CCS A;  5KNC A;  4DK6 C;  4HCE A;  2VNU D;  1TWF H;  4A3G H;  3T56 B;  2VUM H;  1UE7 A;  3RMH A;  1K0S A;  4XQQ A;  5C5L A;  3RZD H;  1I50 H;  1DXM A;  2F4I A;  3NUC A;  4RGO S;  1JWM D;  1IBK L;  1MSG A;  2ZT9 C;  1D5Z C;  1GM5 A;  1XYI A;  1D8L A;  1N36 L;  5HGQ A;  5E4X A;  3M9B A;  4K5V A;  2ZTD A;  1SAP A;  2KCC A;  1AZP A;  1HNZ L;  2E5L Q;  3FKI B;  3J7A 5;  4J6H A;  4KI0 A;  2OCE A;  2XWB B;  2Q8I B;  4B3M Q;  2YU9 B;  2Z6K A;  5M3M B;  5C3E B;  1Q90 A;  2IHF A;  3RZO B;  2RCF A;  3MAQ A;  4XQN A;  2F0U A;  4ZYS A;  3CQZ H;  3TS0 A;  1AZQ A;  4MTK A;  1L2F A;  2F0K A;  2L0C A;  3GTG B;  4ZCK A;  1SXT A;  3HOZ H;  2UXD Q;  3J7A V;  3ERQ A;  2QF7 A;  2BA1 A;  1IHZ A;  5IOD A;  1VQB A;  1CTM A;  3K6O A;  2F0J A;  4YHH Q;  1K73 C;  3S1N B;  3KLS A;  2DJF C;  3AQQ A;  2CCZ A;  1KXL A;  3T13 A;  2HIV A;  2MPM A;  1X3E A;  3AFQ A;  4WJ3 M;  3TZU A;  2PNR C;  1LT5 D;  4NW2 A;  3DHQ A;  2ATW A;  1N33 Q;  4C56 C;  1QIL A;  2BDO A;  3VR4 A;  1LT6 D;  1U4M A;  4A3F H;  4RA8 A;  2ZJR A;  4FF2 A;  4R8I A;  4JI8 Q;  4EQN A;  2GVB A;  2KBN A;  1V1P A;  2ZXR A;  3KLR A;  2A6E D;  1SSO A;  4BY7 G;  4DAV A;  4DR3 L;  2BDN A;  4DR3 Q;  1T5X D;  1V9P A;  5ELF A;  2FHT A;  1ASY A;  1IBM L;  1TWA B;  4IZ8 A;  4MTN A;  3HOY H;  1HRJ A;  5ELE A;  3OTO Q;  2HUG A;  5JOB A;  5FLX E;  4C3J G;  5JVH 3;  4EQO A;  3VA7 A;  2F0Q A;  1S5D D;  3I8Z A;  4A4I A;  2PCF B;  4DR7 L;  3S1M B;  2DJG C;  4UP8 A;  3GD7 A;  4A3J H;  1O78 A;  4B3S L;  4HIO A;  2D62 A;  3ONA B;  1JIC A;  1STB A;  1XPR A;  4X3K A;  2CQO A;  2ID0 A;  4PNY A;  2RDG A;  1Y8P B;  2UU9 L;  2XRQ D;  5M3F G;  4IPH A;  2RDH A;  2WP8 J;  1N34 Q;  5I9P A;  4MN3 A;  1W6K A;  2EY6 A;  1GHK A;  3P75 A;  2Q2T A;  1HA5 A;  1H9K A;  1HJP A;  2ZM6 Q;  1YNJ C;  3S17 H;  5M3F B;  1OXS C;  2A74 C;  1WCM H;  2F4V L;  4X3S A;  2OTJ A;  1IL8 A;  3P20 A;  1CHP D;  4JW0 A;  1WTH A;  1NBW A;  2R7Z B;  5AJ3 Q;  3PQI A;  2ZJP A;  3MC0 B;  3G6J B;  3CCL A;  3CRK C;  2QEX A;  1RJT A;  3NWS A;  1VQC A;  1QVC A;  4KV6 A;  1Z9F A;  2AUJ D;  3GTP H;  4CHT B;  1AE2 A;  4JOI C;  4DN4 M;  1BR9 A;  2B2Y A;  4G4K A;  4JBJ A;  2XVS A;  3ULJ A;  4ME5 A;  5I9O A;  2K6A A;  4QL5 A;  1K28 A;  2RKS A;  5J3B A;  2PZW A;  4LWC A;  4CJ0 B;  3HOX H;  4IN3 A;  5HY6 A;  3C3L A;  1NR4 A;  3D4W A;  1FJG Q;  4JI5 L;  3T1H L;  3MFG A;  5EQ0 A;  2AWO A;  4FXG C;  4S3S A;  4AQY L;  5I6Y A;  4LF8 L;  2RHQ B;  2A19 A;  4IJL A;  1U9R A;  1LM0 A;  2R7D A;  1X3Q A;  1I4G A;  3PUY A;  4BS9 A;  1D5X C;  2B2W A;  3K57 A;  1HNZ Q;  2B63 B;  3T1Y L;  5C4J H;  3PGZ A;  4Q5V A;  2PQA A;  3SK6 A;  2Q2U A;  3OOC A;  2L1B A;  3CKI B;  1Q86 C;  1LYL A;  2EOT A;  3QOL A;  2GN5 A;  2B2T C;  5COR A;  1PH3 A;  2BCO A;  4BWG B;  4LFA L;  1EL0 A;  1TKW B;  1C48 A;  3F2U A;  3W1G A;  1ESF A;  3GV3 A;  2NTT A;  1JJ2 A;  5G3L F;  1BO0 A;  1GUT A;  3BJU A;  2JA8 G;  2M2L A;  1HFG A;  1E3P A;  1B53 A;  3K81 C;  3STB D;  4IFD G;  5CYU A;  4F88 A;  4NKL A;  4ZQ3 A;  3H3V C;  4A3F B;  3BYY B;  1VQM A;  1KDB A;  2O5J C;  2NB0 A;  2CKZ B;  3H0G G;  4L63 B;  3EJI A; 
#chains in the Genus database with same CATH homology
 5I2X A;  1SMY D;  1S4Z A;  1X3P A;  4KHV A;  1NSN S;  3SR1 A;  2EY2 A;  1I6H B;  2WV6 D;  3I4M B;  3BVG A;  1II3 A;  3MA2 B;  4G57 A;  3MHB A;  3SE0 A;  2KQ3 A;  2L55 A;  4EVO A;  2KEC A;  1EYA A;  3GO5 A;  1EY4 A;  2AUK A;  4OGQ C;  4HMI A;  4OHJ A;  2K33 A;  1DYQ A;  1V8Q A;  3OPO A;  5DEH A;  3H0G B;  1F2Y A;  3SEB A;  1FNW A;  3R8B A;  2B8G A;  3KBX A;  4LK1 C;  1PRT D;  1DZ1 A;  2J7Z A;  1FR3 A;  2TSS A;  1E2W A;  2ICI A;  4IUQ A;  3NTH A;  1JR0 D;  3BYT B;  1A3T A;  4ZKB B;  2JYO A;  3C46 A;  3D31 A;  1FNU A;  1GOZ A;  5JPN C;  1EIG A;  3VYT A;  4LMQ D;  3BDO A;  5BN4 A;  1G8Z D;  4A3G B;  4LJZ C;  1VDZ A;  1KLG D;  5NUC A;  1BQQ T;  2NVT B;  1DOM A;  3ERO A;  1HXY D;  4RCO A;  1TWG B;  1F9P A;  4P2C B;  2MHV A;  4M8A A;  3NWT A;  2I07 B;  5C3X A;  4F87 A;  5T1G A;  4IUR A;  3OHX C;  1EU3 A;  3SK8 A;  4IFD H;  5CMD A;  1SNM A;  1AP0 A;  5E4W C;  1CZG A;  1TU2 B;  1Z47 A;  2IWH A;  4Y7N B;  3L3O C;  2QKI C;  1C8C A;  2K05 A;  4IUV A;  3AU7 A;  2X69 A;  2F3V A;  1BF4 A;  2F0M A;  3V2T A;  4OO1 I;  2EJM A;  4NP5 A;  3TBI B;  1DD2 A;  2JA8 B;  2A69 D;  1I3Q B;  1EFI D;  4MIU A;  2ICE C;  1STH A;  4DAY A;  5IIF A;  3WOE A;  3NHH A;  4PMC A;  1HA6 A;  3D3R A;  2SOB A;  4EGV A;  5COY A;  1TVX A;  4FXK C;  3LNN A;  1HQM C;  4KKS A;  1EYD A;  1LTB D;  3UI2 A;  1K8O A;  4FXD A;  3NTK A;  2WAQ B;  1VF7 A;  1A2T A;  1HFN A;  1TII D;  3QWN A;  2RSN A;  2PW7 A;  2A5H A;  2Z4H A;  3DWA A;  1EWH A;  2CQA A;  4Q0F A;  3FRP B;  2NBF A;  3P1H A;  1BDO A;  2F0W A;  3ITP A;  3M3Y B;  5K36 G;  2PZU A;  3LWE A;  4EQP A;  1WTR A;  3URY A;  2N55 A;  5LL6 S;  3NBI A;  1SNP A;  2B2U C;  3M85 A;  1DJR D;  3E6Z X;  2EZV A;  3VYU A;  2DY7 A;  3PUV A;  2NVQ B;  4V19 0;  5J1Z A;  2I46 A;  4IFD J;  1CHQ D;  1TWC B;  4R9W A;  1Q12 A;  4C1N I;  3D4R A;  3CU7 A;  2B2V A;  3I91 A;  2FMC A;  1UNS A;  5EKK A;  1PDQ A;  1Z7T A;  2KVM A;  4KY7 A;  1D5M C;  2JEB I;  5ISR A;  4IAL A;  5G3L D;  2LKV A;  1GUS A;  3MFY A;  5J39 A;  3N6R A;  2XN9 C;  3VR2 A;  1XWE A;  2Z8L A;  3TP7 A;  1LTG D;  3DWQ A;  4K5W A;  1MBY A;  1LAB A;  2XWJ B;  1EWC A;  3SXH A;  3KUP A;  4DF7 A;  2A6E C;  2NN6 I;  2EYO A;  5BN3 A;  1TY2 A;  1RCV D;  2HDL A;  2KHS A;  4KD4 A;  4C2M B;  1H9R A;  1VMP A;  2G9H D;  3K0Y A;  4XXE A;  1IW7 D;  4A3K B;  2FJ2 A;  3IFD A;  3I3C A;  2LMC B;  3TP6 A;  1AEX A;  3J81 L;  1QNK A;  1S5B D;  1B50 A;  4ZLT F;  2N88 A;  1H9J A;  2O4X A;  1PFB A;  4BA1 I;  2JE6 I;  1CZW A;  2E2J B;  5D14 A;  1I6V C;  5JVG 3;  1BBX C;  5EPL A;  2NN6 H;  4CKB A;  2JP1 A;  2F0E A;  2ZXP A;  5HUR A;  4XT1 B;  5IT9 L;  5CBE E;  1B9M A;  1ROD A;  1WTP A;  3DEP A;  1Y8O B;  2A68 D;  1ZYR D;  2R93 B;  3GQB A;  2EJG C;  5K5P A;  1I4X A;  3OSO A;  3NXW A;  5C0X J;  2K01 A;  3MVV A;  2F0D A;  2RQX A;  1B9N A;  2OXP A;  5JEA J;  1M4V A;  4WRD A;  1PTO D;  3GTM B;  2F0T A;  5C5M A;  2D5D A;  2IW3 A;  1CQF A;  2NUC A;  4KN4 C;  1ENC A;  2DNC A;  3KF8 A;  1D6E C;  1TR5 A;  3EVQ A;  3TP8 A;  1CT1 D;  1GUG A;  4XTC S;  3S16 B;  1PZK D;  2HQE A;  3IFT A;  5I4D A;  5FO8 B;  4XDX A;  1SYG A;  4O1N A;  1WVL A;  2WKC A;  3W3A A;  1B2T A;  4KY6 A;  3FDT A;  5CBA E;  3Q0A A;  4NMZ A;  2LS0 1;  5KEE A;  4RAU C;  3I4L A;  3U9S A;  1L0Y B;  3NQI A;  2FMM A;  4A3I B;  1GXD C;  1KLU D;  2F0F A;  3GP7 A;  1WD0 A;  2OF1 A;  4IUT A;  4ABN A;  2RSO A;  3J7A F;  3HP3 A;  3NSW A;  2BE5 C;  3PUZ A;  1TY0 A;  2E2I B;  1PYW D;  1GUO A;  3AMU A;  1NR2 A;  4ZUJ A;  4B9W A;  4DNT B;  1QG7 A;  1EY8 A;  1KAB A;  1B44 D;  1EZ6 A;  3A8J E;  2MP1 A;  5FO9 B;  4KKU A;  2F03 A;  2R6G A;  4K2L A;  1TWH B;  4TQU S;  1IKL A;  2K03 A;  1JOO A;  3QB3 A;  2NYZ D;  1F9Q A;  1LTI D;  4HED A;  3A8K E;  1G2T A;  4N9T A;  3M4O B;  3BDC A;  1B3A A;  2CHB D;  4RWS C;  4CJ1 B;  3QOJ A;  5ELD A;  1OXU A;  3TME A;  2R92 B;  3PIO 3;  4U67 3;  2G9D A;  1NAP A;  1PLF A;  5M5Y B;  3W2D A;  2A6H D;  2M9V A;  1MD2 D;  4RHS A;  5EKL A;  3K58 A;  4YIJ A;  1RTN A;  2SNM A;  2MJ8 A;  4CKE A;  3R93 A;  1S5E D;  1QE6 A;  3QIA A;  4C3H G;  5A35 A;  2VUM B;  5I6W A;  5FLX L;  3RZD B;  3O13 A;  3PO3 B;  1ML0 D;  2NVY B;  3K5N A;  2EXZ A;  3VR3 A;  5EBC A;  3K59 A;  4C3J B;  2NN6 G;  1SMY C;  1X32 A;  3PUX A;  3D4D A;  2CVR A;  2PO4 A;  3C1F A;  5D3D A;  2EYH A;  3CQZ B;  1UEA B;  5CGK A;  3C1E A;  1I4P A;  1DON A;  1SYE A;  5CV5 A;  1AW7 A;  5IGB A;  1ET9 A;  5ELB A;  4A3D B;  2F0G A;  2QEJ C;  4H7B A;  4Z9C B;  4L8J A;  4ULL A;  1EY0 A;  5FOB B;  1DM0 B;  1ILQ A;  1V43 A;  5JEA H;  3HOU B;  4O42 A;  4KJO A;  1A3U A;  1F2M A;  2RBM A;  1I4R A;  3I4N B;  4FYD A;  4TKO B;  4PMW A;  2AQ1 B;  2HCC A;  1TS2 A;  1BXT A;  2SEB D;  5KRU A;  2WAC A;  3PUW A;  1HPC A;  3OIP A;  1XX8 A;  4KJN A;  5EKI A;  5C4H A;  2X6L A;  2EY5 A;  2K1B A;  2PW5 A;  4CKC A;  5CV7 A;  1LTA D;  3RD4 A;  5IGE A;  3SDZ A;  1KDA A;  2F0H A;  4KK7 A;  4UDU C;  2EYP A;  4FNF A;  5C6A A;  1JC7 A;  4RGM A;  1SJE D;  2B2W C;  5A2Q E;  1A2U A;  5EJW A;  1STG A;  1EOT A;  2B2V C;  3K5L A;  2F0L A;  5CR3 A;  3QO2 A;  3Q6S A;  3FMC A;  3IL8 A;  4FF3 A;  4RKB A;  5IGD A;  3BS1 A;  1Q8I A;  4DFA A;  1EEI D;  2QCP X;  5C3W A;  4E6I A;  5M9O A;  5CV4 A;  1JOK A;  4DK1 A;  3VA5 A;  1LT4 D;  4KY5 A;  2JA5 B;  1R4Q B;  2J0T D;  3FVQ A;  3R2T A;  3HOX B;  1R4P B;  5F2D A;  2EVB A;  1GHJ A;  1NCV A;  1R9T B;  4HSV A;  4ZRZ A;  4FP5 D;  1RF2 D;  2CW0 C;  1O80 A;  3S2H B;  2WB1 B;  5M5X B;  3Q24 A;  5BN5 A;  3VYS A;  5AFW A;  1YNN D;  4N9P A;  3HS0 C;  2KJX A;  3H91 A;  2X6G A;  4WJW A;  3HG9 A;  1CA6 A;  2K04 A;  2R3Z A;  5C44 B;  2D2C C;  1VCI A;  4ZKC B;  1JOQ A;  1WTQ A;  4RH6 A;  2A69 C;  2YYZ A;  2SNS A;  3S9W A;  1ZEQ X;  1TS5 A;  1G6Z A;  1E2Z A;  1ESR A;  1STN A;  3WDN A;  2OEO A;  2PZT A;  3NBH A;  4RGT A;  1Y8N B;  3LWU A;  4C3I B;  4A3M B;  2B39 A;  4DAP A;  5IGC A;  2KEE A;  4J1M A;  5ELC A;  1AN8 A;  2L9H A;  1GUN A;  1PFN A;  2EPB A;  1JQY D;  4K2K A;  4HSP A;  3HRZ C;  1B1Z A;  2L5T A;  2KUM A;  1STY A;  2E76 C;  1HUN A;  3OW7 A;  3N52 A;  1NUC A;  2KCN A;  4KN7 C;  5JAV A;  3MZ5 A;  1TWF B;  1CM9 A;  4OIJ A;  2LY7 A;  5DAU A;  2J4X A;  1SFO B;  2XIW A;  3KBG A;  4ODG A;  1SE2 A;  1SYF A;  3MTS A;  4TSS A;  2XSC A;  1V1O A;  1LAC A;  3GV6 A;  1WD1 A;  3A8I E;  2BOS A;  5DM6 3;  3HOW B;  1PRT F;  1DCZ A;  2BE5 D;  3IKJ A;  1KTK A;  1STA A;  1JOR A;  3NPP A;  3TSS A;  1DOK A;  1KNE A;  1PRT B;  1ILP A;  4CBV A;  4G7H C;  4IFD I;  5FK9 C;  3ND8 A;  5JEA G;  3MXG A;  4BY1 B;  1LO5 D;  4AYB B;  4BA2 I;  5CC4 A;  1RD9 D;  1WTW A;  1PTO B;  1HHV A;  2NVX B;  2DN8 A;  4RCN A;  3R3O A;  1HUM A;  4F7X A;  1UUP A;  1OXX K;  4ZK9 B;  1KAA A;  5E3F A;  4RHR A;  3NQT A;  2B2U A;  1F9R A;  3HOY B;  4DXG A;  1PFM A;  3MEH A;  2JA6 B;  3VR5 A;  1OO9 B;  3S2D B;  1IYU A;  5D65 A;  4L6T B;  3RLF A;  4A3J B;  1YNN C;  3Q22 A;  5KNB A;  4G7Z C;  2HDM A;  1S5C D;  2A68 C;  1SE3 A;  2A6H C;  1BCP C;  1SDF A;  1K83 B;  1V1P B;  4DU9 A;  3SVM A;  1SYD A;  3PIP 3;  1BCP B;  1EY5 A;  2Z4I A;  4C1N K;  3PMF A;  1M8A A;  3V05 A;  4RGN A;  3M4Y A;  3DUZ A;  3S14 B;  1CFM A;  2L4N A;  1G2S A;  4HR7 B;  2NZ1 D;  5EBD A;  1FD7 D;  2Z1C A;  1LTR D;  5T1I A;  2H4O A;  1Q3L A;  4OO1 H;  5I2Y A;  5CV6 A;  3IAY A;  3U9O A;  4HMJ A;  1J9O A;  3FPU B;  2RVL A;  4BBS B;  1I4H A;  3CRL C;  3DM1 A;  1K8M A;  1G29 1;  1H9M A;  1QOH A;  1RHP A;  5KIX A;  4CJ2 C;  4DA2 A;  1H9S A;  1XTC D;  1F9S A;  1HCZ A;  4XQJ A;  5IGG A;  1OXT A;  4BBR B;  4K6D A;  5C4J B;  2RDF A;  1SNO A;  2JXM B;  1JWS D;  3AB9 A;  3I70 A;  3NP8 A;  3QG1 A;  2JEA I;  4ZAI A;  1SYC A;  3ND9 A;  4X3U A;  3VYR A;  3L7Z C;  2F0V A;  4HN7 A;  4I65 A;  1BUV T;  2VB3 X;  2IX1 A;  3ZYY X;  2KED A;  1TS4 A;  3BG3 A;  1GUW A;  4KKT A;  2K32 A;  1IKM A;  3J7Y W;  2L12 A;  4XT3 B;  5C0X I;  2RA4 A;  2E2H B;  1D1K A;  4XYO A;  3H6M A;  1PRT C;  2B8F A;  2O5I C;  3HZX A;  2KOL A;  1C4Q A;  2K7V A;  3D6W A;  1Y69 U;  1EY6 A;  2QIL A;  1JE4 A;  2LFN A;  2B2Y C;  1PXU A;  1FGB D;  2B2T A;  3PV0 A;  5A2Q L;  4RFB A;  2XNA C;  1PTO C;  1RDP D;  4KD3 A;  1QNU A;  5EPJ A;  2TMP A;  4B08 A;  1UAP A;  1W6J A;  1BCP D;  5C0X H;  3R2I A;  1ZYR C;  1A6X A;  3RUZ A;  1RTO A;  2K5Q A;  4IQZ A;  1A3V A;  2PPB C;  1DOL A;  3MWY W;  2K5W A;  1LT3 D;  1F77 A;  1PMR A;  3HKZ B;  1U4P A;  3GTO B;  2EYM A;  2A73 B;  1ONL A;  3TN2 A;  2OT2 A;  1HQR D;  2CW0 D;  5DNF A;  2FIN B;  1Z6H A;  4CGY B;  1WCM B;  2EYJ A;  3GTQ B;  1TQO A;  2PQE A;  3J80 L;  1EZ8 A;  1SND A;  1ET6 A;  3A56 A;  2F0P A;  3GTP B;  2JSO A;  1VMC A;  1SNQ A;  5LHY 1;  1WTV A;  1EEF D;  2MUY A;  4FF1 A;  4QB4 A;  3I73 A;  3TZD A;  4QF4 A;  1EY9 A;  3EA6 A;  1Q1E A;  1HTL D;  2K28 A;  4NDX A;  1MI2 A;  1D1I A;  1CA5 A;  5LL6 X;  1EYC A;  3CHB D;  3C2P A;  2C5C A;  3TP5 A;  2F0I A;  5D3I B;  3VR6 A;  4V0B A;  1D2B A;  4QCL A;  1H9S B;  4H0L C;  1E0B A;  3LX0 A;  2O2L D;  3SK5 A;  5FKA C;  4KMU C;  3BDL A;  2IL8 A;  5IOC A;  3X3N A;  3BVZ A;  3BZD B;  4BY7 B;  2E2D C;  5IT9 E;  3JAM L;  5M5W B;  3QJY A;  4K6L A;  4DNR B;  1HTP A;  3JAM E;  2QDB A;  1WTX A;  3K5M A;  2Q8R E;  5KYI A;  3KK7 A;  4GZY C;  4J8Q A;  1KDC A;  1BCP F;  3GTK B;  1B4O A;  4QUF A;  2MGS A;  4IUN A;  3M7G A;  1L0X B;  2JA7 B;  2XRS D;  2C9O A;  1FNV A;  1JWU D;  3HEJ A;  2F0S A;  3MXN A;  3MXP A;  4KTA A;  4MHE A;  4K5X A;  1PZI D;  5KND A;  5EPK A;  4PQX A;  4M1U B;  4IUU A;  2GA4 B;  3E0J A;  3DWP A;  2IX3 A;  2AQ3 B;  3NTI A;  1CI3 M;  3X3M A;  3S15 B;  3SK4 A;  1S5F D;  1LLR D;  1O7Z A;  2WKD A;  3EFX D;  5IGF A;  2L11 A;  3WOF A;  3TDQ A;  3J80 E;  4C3I G;  1JB3 A;  1EIH A;  1SYB A;  1RKN A;  3I72 A;  4LAA A;  3D8G A;  1G91 A;  2PYK A;  3BVM A;  4JBW A;  1O7Y A;  2EJF C;  1GJX A;  3J81 E;  3FEW X;  3E5S A;  3HOZ B;  2E75 C;  5HGT A;  3HGB A;  4QMG A;  4H44 C;  3T53 B;  2BA0 A;  4U68 A;  2DNE A;  5CV8 A;  3D6C A;  5EGT A;  3DMU A;  3NE5 B;  4H13 C;  4HTH A;  4DK0 A;  4XIG S;  4K8I A;  3T16 A;  4KHZ A;  1SNC A;  3OMC A;  1OXV A;  4TRD A;  1J8I A;  1F2Z A;  2FFK B;  3V96 A;  2IJ0 A;  3DEO A;  4FVM A;  1KNA A;  1Y1W B;  1EQT A;  5C0X G;  5CV9 A;  2V4D A;  1QJO A;  3P7J A;  1YNJ D;  1CQV A;  3NK9 A;  5DM7 3;  3T51 B;  5E1F A;  2IT1 A;  3OWF A;  1AFP A;  3Q23 A;  2AWN A;  1A15 A;  4PV1 C;  2H1E A;  2VXW A;  3A7L A;  4UAI A;  5JJZ A;  1SJH D;  1ZXT A;  2EE1 A;  3T4A C;  3S17 B;  3K7A B;  2F0N A;  4ID6 A;  4QIW B;  2NWG A;  1IYV A;  1LV9 A;  1MGS A;  2WIN B;  1PTO F;  1SBB B;  3K5O A;  2EDG A;  3DXJ C;  3GTJ B;  2SDF A;  1JCK B;  1TS3 A;  1SEB D;  1EY7 A;  1MSH A;  1ICW A;  3OMG A;  3I90 A;  5TSS A;  1QCB D;  2EY1 A;  1E2V A;  4HCS A;  2K5D A;  3KLS X;  2PMZ B;  5FO7 B;  1I50 B;  2Y0S B;  3OIQ A;  4F8M A;  1QB5 D;  4IUP A;  4OL7 A;  2E74 C;  4QUC A;  2ENB A;  2F0O A;  2M00 A;  3A54 A;  4B9X A;  4FO2 A;  3PO2 B;  1O7L A;  2DY8 A;  4WFN 3;  1T5E A;  1FYC A;  2IX0 A;  1PTO H;  2D9U A;  2AQ2 B;  4OO1 G;  3M7N A;  4XYQ A;  5C4Z A;  5C4X B;  2HCI A;  4RKL A;  3H09 A;  5JPM C;  4K14 A;  2ZXO A;  4I7Z C;  1LTS D;  4JK1 C;  3S1R B;  1WTO A;  1U4L A;  1CK1 A;  1PZJ D;  3SHL A;  4K8J A;  3HOV B;  4HAE A;  1IW7 C;  4A93 B;  4DXF A;  4FF4 A;  1BOS A;  1VF5 C;  2VB2 X;  4OIK A;  3A55 A;  4ILW A;  1XXG A;  4WOR A;  1QWY A;  2EYL A;  5K36 H;  5KGU A;  1ENA A;  4G7O C;  3FPP A;  1LTT D;  1SE4 A;  1U4R A;  5KYL A;  3GTL B;  4ZUI A;  3S1Q B;  4C3H B;  4X3T A;  1I4Q A;  3A7A B;  3G7L A;  4PMB A;  1EQV A;  2F1M A;  4DGZ A;  1ZKO A;  2R61 A;  2KA7 A;  3L9A X;  1F2L A;  3MXU A;  2F3W A;  3H94 A;  2WII B;  2Q8T A;  2NTS A;  1Q1B A;  1ENF A;  4A3B B;  2EYF A;  1STE A;  2IPK D;  3EQL C;  4A3E B;  1BNZ A;  1TT2 A;  1Y1V B;  4R8N A;  3OWE B;  1EU4 A;  5J22 A;  5KNC A;  4HCE A;  2VNU D;  3T56 B;  3RMH A;  4XQQ A;  5C5L A;  1DXM A;  2F4I A;  3NUC A;  4RGO S;  1JWM D;  1MSG A;  2ZT9 C;  1D5Z C;  1XYI A;  5E4X A;  4K5V A;  1SAP A;  2KCC A;  1AZP A;  3FKI B;  4J6H A;  4KI0 A;  2XWB B;  2Q8I B;  2YU9 B;  5M3M B;  5C3E B;  1Q90 A;  3RZO B;  3MAQ A;  4XQN A;  2F0U A;  4ZYS A;  1AZQ A;  2F0K A;  2L0C A;  3GTG B;  1SXT A;  3J7A V;  3ERQ A;  2QF7 A;  2BA1 A;  1IHZ A;  5IOD A;  1CTM A;  3K6O A;  2F0J A;  3S1N B;  3KLS A;  3T13 A;  2MPM A;  3TZU A;  2PNR C;  1LT5 D;  4NW2 A;  3DHQ A;  4C56 C;  1QIL A;  2BDO A;  3VR4 A;  1LT6 D;  1U4M A;  4RA8 A;  4FF2 A;  4R8I A;  4EQN A;  1V1P A;  2ZXR A;  3KLR A;  2A6E D;  1SSO A;  4DAV A;  2BDN A;  1T5X D;  5ELF A;  2FHT A;  1TWA B;  4IZ8 A;  1HRJ A;  5ELE A;  2HUG A;  5JOB A;  5FLX E;  4C3J G;  5JVH 3;  4EQO A;  3VA7 A;  2F0Q A;  1S5D D;  3I8Z A;  2PCF B;  3S1M B;  3GD7 A;  1O78 A;  2D62 A;  3ONA B;  1JIC A;  1STB A;  4X3K A;  2ID0 A;  4PNY A;  2RDG A;  1Y8P B;  2XRQ D;  2RDH A;  2WP8 J;  5I9P A;  4MN3 A;  1W6K A;  2EY6 A;  1GHK A;  3P75 A;  1HA5 A;  1H9K A;  1YNJ C;  5M3F B;  1OXS C;  2A74 C;  4X3S A;  1IL8 A;  3P20 A;  1CHP D;  2R7Z B;  3MC0 B;  3G6J B;  3CRK C;  1RJT A;  3NWS A;  4KV6 A;  2AUJ D;  4CHT B;  4DN4 M;  1BR9 A;  2B2Y A;  4G4K A;  2XVS A;  4ME5 A;  5I9O A;  2K6A A;  2RKS A;  2PZW A;  4CJ0 B;  4IN3 A;  3C3L A;  1NR4 A;  3D4W A;  3MFG A;  5EQ0 A;  2AWO A;  4FXG C;  4S3S A;  5I6Y A;  1U9R A;  1X3Q A;  1I4G A;  3PUY A;  4BS9 A;  1D5X C;  2B2W A;  3K57 A;  2B63 B;  4Q5V A;  3SK6 A;  3OOC A;  2L1B A;  3CKI B;  2EOT A;  3QOL A;  2B2T C;  5COR A;  2BCO A;  4BWG B;  1EL0 A;  1TKW B;  1C48 A;  3F2U A;  1ESF A;  3GV3 A;  2NTT A;  5G3L F;  1BO0 A;  1GUT A;  2M2L A;  1HFG A;  1B53 A;  4IFD G;  5CYU A;  4F88 A;  4NKL A;  4ZQ3 A;  3H3V C;  4A3F B;  3BYY B;  1KDB A;  2O5J C;  2NB0 A;  4L63 B;  3EJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...