1QJOA

Innermost lipoyl domain of the pyruvate dehydrogenase from escherichia coli
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
80
structure length
80
Chain Sequence
MVKEVNVPDIGGDEVEVTEVMVKVGDKVAAEQSLITVEGDKASMEVPAPFAGVVKELKVNVGDKVKTGSLIMIFEVEGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Restricted motion of the lipoyl-lysine swinging arm in the pyruvate dehydrogenase complex of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Dihydrolipoamide acetyltransferase
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE
total genus 7
structure length 80
sequence length 80
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1999-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1qjoA00
2E76C 1HPCA 1T5EA 1GUSA 1LABA 3CRLC 3GD7A 1Q12A 2F1MA 3I73A 4TQUS 2QF7A 1CI3M 5BN4A 5KNCA 4IFDG 3QJYA 1Y69U 3ND9A 3VR5A 2EVBA 1E2VA 2BA0A 2D5DA 2R6GA 3LWUA 4TKOB 4JBWA 5K36H 2D2CC 1E2WA 5BN5A 3W3AA 3OW7A 4DK0A 4RCNA 1YNJC 2PPBC 2BE5C 1DD2A 1H9SB 1SMYC 1E2ZA 5KNDA 2NN6G 3I72A 2E75C 3EQLC 3HGBA 1FR3A 2K7VA 1B9MA 3A8IE 2KA7A 1CTMA 2BA1A 4OGQC 3DXJC 1Z6HA 3VR2A 2A6EC 1H9KA 4KHZA 1GUOA 2K32A 2BE5D 1VCIA 3OOCA 3BDOA 4OO1G 4BA2I 2JEBI 1GHKA 3QG1A 1Y8NB 3I4LA 2EJGC 1H9MA 3PV0A 3M7NA 1GUTA 1HQMC 1Y8OB 4IFDH 1GUGA 2JEAI 1O7LA 1I6VC 2LMCB 1OXTA 4XIGS 2NN6I 2A69D 2JXMB 3WDNA 3VR6A 1OXUA 5K36G 1TU2B 4KMUC 3L7ZC 3M85A 2CW0C 3GQBA 3FPPA 1BDOA 1FYCA 1HTPA 2A6ED 2DNEA 1CFMA 1IW7D 2JE6I 1EWHA 3AB9A 3PUVA 5JEAH 3KLRA 4HR7B 3VR4A 4JK1C 3PUXA 3PUYA 1H9RA 1Q90A 1OXXK 2PNRC 3RLFA 4L8JA 2A69C 4G7HC 1IYUA 2EJFC 2BDOA 2O5JC 4H0LC 3N6RA 3ND8A 3LNNA 1H9SA 2DN8A 4I7ZC 3T56B 5BN3A 3D31A 4XTCS 3CRKC 3IKJA 1IW7C 1Z7TA 1V8QA 3SDZA 3QIAA 3VR3A 5C0XH 5A35A 4BA1I 1ONLA 3T53B 3SE0A 3VA7A 1OXVA 1K8OA 2B8FA 5KNBA 4DNTB 3TZUA 4DK1A 1ZKOA 4GZYC 2PCFB 3FMCA 2DNCA 3NE5B 1K8MA 1GJXA 2IT1A 4G7OC 1HCZA 3PUZA 4H13C 1Q1EA 1VF7A 2V4DA 3A7LA 3U9SA 2YYZA 1LACA 4KKTA 3MFYA 1V43A 3M4YA 5JEAG 1GUNA 3OPOA 1H9JA 3H94A 2D62A 4IQZA 1DCZA 1OXSC 4LJZC 1QJOA 2EDGA 2A6HD 1Y8PB 4G7ZC 4OO1H 3A8JE 1B9NA 1YNNC 2K33A 2A6HC 1TKWB 2AUJD 2B8GA 2NN6H 3IFTA 1IYVA 2A68D 1O78A 2AUKA 3A8KE 2Q8IB 1A6XA 1VF5C 3T51B 4KKSA 2ZT9C 4KN7C 3A7AB 2O5IC 4PV1C 2A68C 3P20A 3BG3A 1G291 4H44C 4KI0A 5C0XG 4KN4C 3D4RA 2KCCA 4DNRB 1VDZA 1PMRA 2EJMA 3MXUA 1Q1BA 2AWOA 3PUWA 4LK1C 1DXMA 2E74C 1GHJA 4KKUA 1ZYRC 2L5TA
chains in the Genus database with same CATH superfamily
3H3VI 2OCEA 4TQUS 2JK8A 2LFNA 1Q82C 5ELCA 1CZGA 4KY7A 3M7GA 1B50A 1PH7A 5E4XA 4DV5Q 3J80c 2NTTA 5CBAE 2DJFC 4I7AA 2R7ZB 3DXJC 4NPSA 1HZAA 4EQ5A 1V1QA 4RHSA 3BZKA 1Z9FA 4UHVA 3RZDH 2KEDA 4DV1L 3NENA 3GTPH 2LS01 3PGZA 1Y8OB 2OXPA 2HIVA 4JI5L 4DF7A 1KIXA 1TQOA 5I6YA 3DWPA 1RKNA 2F0IA 1VQ7A 4KLKA 3FHWA 4P72A 1HR0W 2SNMA 2DUDA 5ELFA 3H91A 3Q8DA 3FVQA 1W6JA 2IHEA 1WVLA 4TSSA 4K5WA 5JJLA 2RSOA 1CA6A 4GKJL 1MJEA 4G57A 3S1QB 4EVOA 4A93B 4OO1I 1SNOA 1K73C 4LFBL 3RZOH 4UPAA 2JA6H 1MHWC 1PH6A 1XNQL 1WTHA 1RTOA 1ONLA 4IUPA 3I8ZA 5CV6A 2YTYA 4I65A 4C2MH 4DNTB 4DK1A 4LWCA 3O13A 2O2LD 2K50A 1N34Q 1BOSA 3SEBA 3G71A 3S1NB 3FRPB 2KECA 5IT9E 2XWJB 3NTIA 1V43A 3OTOQ 5EJWA 1L0YB 4JI1L 3AQQA 1KNEA 4HJ8A 1QB5D 4AQYL 3I4MG 1SNDA 3ULPA 2RKSA 3GP7A 3S15H 2GN5A 3S17H 2ZJPA 3E9IA 1TT2A 2K5NA 3HKSA 1G291 2UUBL 1CKNB 1WTPA 1U4RA 3JAML 1QUQB 1VDZA 4JW0A 3WWVA 1DXMA 2BDNA 4RHRA 1L0WA 5KRUA 3GTQH 2E76C 1MSHA 2K5DA 2L0CA 3HOXB 3S17B 4LF6L 4CDEC 4TKOB 1EL0A 1PFSA 1PZKD 2R93B 3CP0A 1AZPA 4OX9L 5D3DA 3H0GH 4JI5Q 4DA2A 1CSQA 1S5DD 4JI3L 4DKAC 2GA4B 4A3DH 5M5WH 1VQAA 3A8IE 3GTJB 1VQBA 3ITPA 4YHHQ 1PH2A 4JI7L 1EYCA 3C46A 3BZDB 1SR3A 4X66Q 3HOWH 4A3DG 1QZGA 4Q5VA 3R2TA 4R4QA 4M8AA 3EIVA 3PIP3 2MO0A 2K52A 1TVXA 3I90A 4IFDH 2RHQB 1O7LA 1IBKQ 5M3MH 3M4OB 5C4JH 2BH8A 4CKCA 3JAME 1JMCA 2EQSA 2B29A 1C9OA 4JK1C 1UNSA 3K58A 5CV4A 4ZKCB 3T1YL 1IYUA 2O5JC 4H0LC 4K8JA 1EOTA 4X3SA 1STYA 4GNXB 1YHBA 5M3FH 4GKKQ 4YCUA 1Z7TA 1K3RA 3C2PA 4FF4A 4JI8L 5GADC 5A35A 1YHAA 2KUMA 4GN3B 2HCIA 1QNUA 3SE0A 5GAHC 1R4PB 5A2QL 3ICEA 4WFN3 3AFPA 3K5NA 1AW7A 4G7OC 1B7YB 4CJ0B 1PRTB 3HKZG 1EIFA 1GM5A 3CPWA 4KKTA 3ZJYC 2MHVA 1DM0B 1SLJA 1A3TA 4FP5D 2D62A 4R4CA 2E2IB 2F0DA 4GNXC 2C9OA 4A3FG 2F0LA 1X3FA 3A8KE 4RWSC 3A5ZB 4KKSA 1P8LA 2CFMA 2VY3A 3RR5A 1DZ1A 1HJPA 1D6EC 2EE1A 4LF6Q 1HNXQ 3D0FA 3CAMA 1P16A 2EPBA 1NBWA 1LLRD 2F3WA 4X6AH 4QGUA 4LF8Q 4LF9L 1UUPA 3CD6A 4C3HB 5KYLA 2B2UC 1WFQA 4DR6L 1XMQQ 3TP6A 5NUCA 1WD0A 1TY0A 1QCBD 1B44D 4HMJA 3PO2G 1XTDA 2E5LQ 4JYAL 2B2WC 1F2ZA 4DAYA 3STBC 3I72A 3K6OA 3WOFA 1TWGB 3HGBA 1A62A 1RTNA 1WD1A 2K75A 2KENA 5C0XI 1GUOA 2YU9B 1DJRD 2HIXA 1LT3D 4DR3Q 4JBJA 3OOCA 3SR1A 3BVZA 1KL9A 1G6PA 4FF1A 1H9MA 1XMOL 1FVIA 1LTID 4BXXG 1N33Q 3PMFA 4LFAL 3TREA 4LFCL 3VYTA 4F8MA 4L5QA 5I9OA 2WFWA 3M85A 3HOUG 1EFWA 1JB3A 4DAVA 2A6ED 3M3YB 1BBWA 3RUZA 3H0GG 2F0UA 2HCCA 3KLRA 4MTKA 3HOUH 1FGUA 1S5BD 2E2HH 5KGUA 4A3CH 1A0IA 3FKIG 5JJKA 4DV0Q 2ZM6Q 1F9QA 3MXNB 5EKKA 4A3CG 2F4VL 2I46A 4DN4M 2I0QA 3BVGA 2IL8A 3NK9A 3VR3A 4WJ4A 2MP1A 1FD7D 2QKIC 4HEDA 4MZ9A 4X66L 4EX5A 4IO9A 4QUFA 4WRDA 4MTNA 1GJXA 1O7YA 1MKHA 3A7LA 4KJNA 2OWOA 1C48A 3JC66 1LM0A 3RLNA 3HOZH 3GV6A 3ER0A 4DUYL 3UDGA 2PW5A 3PO3G 1XPOA 4GOPB 2B8GA 1YNXA 3KF8A 3HOVB 4WJ3M 4ID6A 5ISRA 1JWUD 4PZ8A 3BYTB 4AYBG 1TXYA 3SGIA 1MI2A 1LTLA 2XVSA 4A3IB 5GQOA 1W2BA 3ERQA 1JB7A 3I70A 1QWYA 3OHXC 1X56A 4C56C 1ZYRC 1AH9A 2AKWB 1ZYRD 5BN4A 1V9PA 1SYFA 1GKHA 4OHJA 3GO5A 4B3TQ 1KAAA 2F0NA 4FF3A 2R6GA 1S4ZA 3OMCA 3QWNA 4RCOA 3D6WA 1Y1WB 4RCNA 3SK8A 2IX1A 1SMYC 1E2ZA 5CC4A 4LUZA 5IIFA 3K5OA 4BY1B 3SVMA 4OWTB 1BCPC 4V0BA 3UI2A 1CTMA 1JOOA 1Q7YC 3DM1A 2RF4A 3NXWA 3HFZB 1J9OA 4YIJA 1AZQA 4WORA 2BE5D 1VQPA 5ELBA 1I3QH 1A3VA 3S1MB 1LYLA 3NSWA 1K8AC 2UXBL 2Z8LA 4QIWE 1FJGQ 2E5LL 5IP9G 3CCQA 4DV7L 4M1UB 2Z4HA 3RN2A 1B2TA 2IWHA 3SXHA 4BY1H 1EQVA 4JCVE 1JJGA 4J15A 1VQHA 2LKVA 2JA5G 3GTMB 4LF9Q 2YTVA 1V1OA 5FLMH 3CC4A 1L2FA 1WTOA 4NKLA 5IYCG 2H5XA 2RCNA 3U4VA 4B9XA 3E0JA 3NBIA 3AB9A 3PUVA 4HJ7A 2NYZD 3RLFA 2JA6B 1ENCA 2ASBA 4CJ2C 4AYBB 1E3PA 3NBHB 3QOLA 5CV7A 5ELOA 2F0JA 4AYBE 1Q3LA 5FK9C 5DAUA 4RAUC 1E22A 2XN9C 3Q22A 2F3VA 1B70B 2K14A 5D3IB 4DR5Q 2JA8H 4QJFA 4DPGA 2L4NA 3J81i 3GTMH 3OTOL 4JI3Q 1K0RA 1BKBA 5JEAG 4E6IA 3A74A 4DV5L 4XT3B 4A3DB 4ZK9B 1NAPA 2N49A 2R7ZG 2NUCA 3J7ZC 3I3CA 2PZUA 2NVXB 1IYVA 3T51B 2R7ZH 2Z6BA 4HCSA 3P20A 3URYA 5C0XG 2KCCA 5FLXE 4JI0Q 4J6HA 1NR2A 1UEBA 1SFOH 2B63G 3MTSA 3H15A 1NCVA 2B3GA 4YWKA 1GUSA 1LABA 3PQIA 1LTTD 3HOYB 3QJYA 1XX8A 3R8BA 2WAQG 2IHFA 5BN5A 1VQ5A 2PPBC 3TN2A 4HIKA 1DD2A 4R1JA 1PH1A 3MXNA 1K0SA 1SE2A 1EFID 3QOJA 3S15B 1FNVA 1JICA 1Q8KA 3R3OA 5DLQE 3EJIA 3KDFB 3GTGH 2C5CA 3MC0B 3BDOA 3HOVH 3I4OA 1JE4A 3I4LA 1SJED 4Y7NH 1IBML 2VB3X 4JV5L 3IFDA 2RQXA 4XIGS 1U4LA 3TS2A 4A93H 2NZHA 1VQ6A 4A3KG 1IKLA 3FPPA 2MUYA 1KC8C 5T1GA 2CH4W 2UXDL 4A93G 1NSNS 4DAMA 2EYOA 2CQAA 2L15A 4UP8A 2B2VA 4IUNA 3S2DB 4OIKA 5EBCA 2JA6G 1OO9B 2UUAQ 1VQKA 5C6AA 3MWYW 1HXYD 4K14A 1A15A 1PXUA 1I50H 1A3UA 4LUOA 3T56B 1X3GA 5BR8Q 5C4XB 5IP9H 1L1OB 3VA7A 4LF7L 2B8FA 1EZ6A 3A54A 1I4HA 3NE5B 2I07B 2R93G 2V4DA 2E2IH 1QNKA 5DNFA 1LUZA 2AQ1B 4O1NA 5IP7H 2B63B 3OPOA 4H7BA 1WTWA 3E5SA 2CH4A 2NTSA 2XRSD 1TWAH 1XTCD 4X65L 2A68D 4Z9CB 3E6ZX 5GAGC 5F2DA 2B2TC 2CKZB 3M9BA 2LXKA 2FFKB 3A56A 1I4PA 3CCRA 1K3BC 3E3XA 4Y7NB 1I4GA 2VS1A 4LK1C 4C3JB 4CDFC 3NELA 3KFUA 3I73A 4C3IB 3GD7A 3KBGA 1OTCA 3K80C 2UXDQ 2R61A 4NXMQ 1B4OA 2AWNA 4JOIA 4BY7G 3ULJA 2D2CC 1SSOA 4DV1Q 1IBMQ 3CKIB 3W3AA 4IN3A 4DK0A 4HMIA 5M5YH 1JOKA 1YNJC 1L1OC 1H9SB 4JI2Q 4A3MB 4HN7A 2NN6G 4BBRB 3NUCA 2E75C 3M4OH 5LMUQ 5ELDA 3TP5A 3CMAA 4JV5Q 3C3LA 2A1AA 3AYHB 3KDFA 5H1SE 1PZJD 2ZXRA 4LMQD 2UXBQ 4IFDI 1MJCA 1ENAA 2F4IA 2KVMA 3U4ZA 4ABNA 4GLVB 2WB1E 1SN8A 2E2DC 4IUUA 4A3FH 3PV0A 2FJ2A 4DR7Q 3HOWG 1HQMC 2LY7A 3VYRA 3I4MH 2NN6I 4IURA 5G3LD 1OXUA 4ME3A 2QEXA 1TU2B 5CV9A 2RDFA 5J3BA 1EY9A 4CJ1B 1TWAB 3HOXG 1BDOA 1BBXC 2NVXH 1X9NA 1EQRA 1KQSA 2Q2IA 3CW2C 1EU4A 3CCUA 1QG7A 1LO5D 3DWQA 1XWEA 3CCMA 5C4XG 2QGQA 3QIAA 1VQLA 4A3GH 1D1KA 2X6LA 2JSOA 1U5KA 5T1IA 1IBKL 1JJ2A 2JYOA 3VDYA 5C4XH 2LSSA 1KD1C 4X3UA 5C4HA 4DR4L 3MXGA 4ODGA 1RIPA 2K03A 3S2HH 4RKBA 5ELNA 4LF5Q 1HNWL 4LUVA 2K5HA 2EXZA 2F0FA 2R92H 4KD3A 3I7FA 3KF6B 1QJOA 2WKDA 3DM3A 5D14A 1IHZA 2MGSA 1N32Q 1HFGA 3TSSA 5L37A 1LTAD 3DMUA 3KJOA 4JVZA 2BH2A 3PF5A 4TVAB 1X54A 2J4XA 5C3WA 1VQJA 3FP9A 3NQTA 3PUWA 1FNWA 1BXTA 1GHJA 3ERSX 4FO2A 2JA8B 1XPUA 1MBYA 5KNCA 3PCOB 1CI3M 1PRTF 1WCMG 1Y69U 4JI4L 4ILWA 2ATWA 5EPKA 5EQ0A 5EAYA 5G3LF 3LWUA 3OWEB 4FYDA 4DAYB 4ZKBB 3G4SA 5J22A 4H02A 4DV2L 1VQDA 5HGTA 3PO3H 5IYCH 3K59A 3L9AX 4B3MQ 1KRSA 4BBSB 5IODA 4O0AA 4EGVA 3HOZG 2UUCL 4LF5L 1N36Q 2B39A 2H4OA 4KJOA 5IGFA 5I2XA 1JJCB 4NP5A 1UWVA 2PO4A 1EZ8A 3VYSA 2VW9A 1VQ8A 3OIQA 1F2YA 1BVSA 3NHHA 3VR6A 1E1TA 3GTKB 3E9HA 1F2LA 3ULLA 3RMHA 4B3SL 1IZ6A 1X3PA 4K2LA 3DLLA 1R9TH 4TRDA 3W5OA 4F7XA 4PG3A 2X69A 3PUXA 2N88A 4A3BG 4IZ8A 1Q90A 3KJPA 2ALYB 1TWGH 4HJ9A 2Z0SA 5IT9c 2J7ZA 1I4XA 2E8GA 2ID0A 4LFAQ 3BJUA 5JJIA 3D8GA 2WV6D 1DYQA 3IKJA 1YIJA 1KHIA 2A8VA 1V8QA 1OXVA 2EY6A 2UUCQ 4P74A 5LMNL 2Y0SG 1S40A 1SYBA 4YHHL 2LXJA 4JBKA 1ASZA 1Q1EA 1AFPA 2ZJQA 2YTXA 1MSGA 1WYDA 4RA8A 2A19A 1VQOA 1M90C 1PRTD 4X3KA 5I9PA 1JORA 4A3KB 4QUCA 4HTHA 2XTIA 2WINB 1KRTA 1RJTA 2ENBA 1F9PA 2EYHA 1SMXA 2Q8RE 4R9WA 3T13A 1I4RA 3Q23A 5C3EB 3HOYG 1W6KA 4H44C 3CMEA 1ET9A 2PNHA 1EEFD 4MHEA 3LWEA 1HNXL 4C1NI 5C3EH 2UU9L 3TP8A 1BO0A 1SMYD 2SOBA 1VMPA 3S1RH 2F0EA 2ZTCA 3J7AV 1KLUD 1F9SA 5FLXL 3OIPA 1TWHH 3TZDA 2E2HB 2D5DA 4HSVA 3PIO3 2OQKA 3GTQB 1E1OA 1Q86C 1KDBA 4BBSH 2R3ZA 4N9PA 5EKLA 1RD9D 1BNZA 4R8IA 4QB4A 2VQFL 3U50C 2QW7A 2L9HA 1N36L 3B6YA 1F9RA 5IYDG 3M3YH 1D5XC 3QG1A 3PF4A 4A3JG 4R8NA 3OW2A 3TDQA 2KOLA 3DEOA 1GUGA 4B3ML 2R7FA 3PSIA 1NJIC 2JEAI 1WCMH 2AQ3B 1IXRA 5CYUA 3D3RA 4LF8L 1J8IA 5FKAC 4L63B 3GQBA 3MVVA 1WTQA 3HOWB 1CFMA 4JI4Q 5JEAJ 5IY0A 1LT6D 5IT9L 4S3SA 4A4IA 2F0HA 3RLOA 1E24A 2HUGA 2UXCL 1EY0A 3AU7A 5LMNW 2KHIA 3GTOH 4DV6Q 4DUYQ 1QOHA 3EN2A 1Y1VG 1IBLQ 5D65A 2Z4IA 4JI6L 4A3GB 4RKLA 4XQQA 1FJGL 3PO2B 4JOIC 3J81L 1BQQT 2RDGA 1KAWA 4A3BH 2K5VA 4JI8Q 3FKIH 1HR0L 1Y8PB 4JPBW 2HDMA 1X65A 2AUJD 3IFTA 3S1RB 3DWAA 4OONA 1VF5C 2PQAB 4LAAA 1UE5A 4KN4C 3KYHC 2FINB 3I4MB 2K05A 1RF2D 2N3SA 2P5ZX 2G5DA 4B3SQ 3HS0C 2RBMA 2E2JH 1T5EA 1O7ZA 1VQFA 2F1MA 2QF7A 4IFDG 2PI2E 3VR5A 1LT5D 5AJ3L 1E2VA 2BA0A 4YCVA 3D6CA 4NXNL 4OIJA 2H1EA 1O80A 2BE5C 3NWSA 4A3EH 4QMGA 1YHQA 1SFOB 4K6LA 1Y1VH 3K7AH 1VQMA 5M9OA 5CV5A 5C4ZA 1B53A 3MFGA 1Y14B 2Z6KC 2VXWA 4K5XA 4CBVA 1CKNA 3CXCA 1D1IA 4XQJA 1Q81C 4OELB 3GV3A 3UDXA 2IJ0A 5E4WC 4DV2Q 1E0BA 1VQIA 4K8IA 4A3JB 1I4QA 4WJWA 1X6OA 4C3JH 1IKMA 1SYGA 2IW3A 3V2TA 1AE3A 4DXGA 3WOEA 3J80i 3T1HQ 1S72A 2FHTA 3S14H 2RVLA 4UAIA 3OSOA 3EFXD 3CCVA 2B2YC 1FNUA 1KNAA 2NBFA 3H6MA 3F2CA 2ICEC 1CKOA 2RHSB 4YY3L 2KHJA 4ZCKA 5DM63 4I7ZC 1GUWA 3KUPA 5BN3A 1W3SA 3CRKC 1I3QB 1UE7A 2CWAA 3S1MH 4QY7A 3AFQA 2WB1B 1LTGD 4GN5A 1TS5A 4O42A 2FMCA 1VQCA 2PQEA 1X3QA 1D2BA 5KNBA 2WACA 2DNCA 1EY6A 2D0PA 3PUZA 4H13C 3HKZB 1LACA 1U0LA 3GTOB 3M4YA 4RGMA 1GUNA 4QQBX 1ILQA 2OQ0A 1CKMA 4UP7A 3FPUB 3NPPA 4U68A 3T4AC 3L2PA 3SHLA 4ULLA 1O7IA 5IE8A 3KOJA 2WP8J 1PA6A 1K28A 4B3TL 4PV1C 2A68C 4RGTA 1PFBA 3BG3A 3V96A 5BR8L 2QEJC 5M3MB 1Q8IA 1XNRL 4YY3Q 1N9WA 5M5XH 1SNMA 4GOPC 4IALA 1HRJA 4BY7H 2F0KA 2K01A 4B9WA 3S9WA 4A3MG 1YZ6A 4LW1A 4UDUC 4A3GG 1BF4A 5K36H 4JBWA 2SDFA 3A5UA 3VA5A 2EY1A 4YCWA 1KDAA 4DU9A 3S2HB 3FEWX 3CCSA 3BYYB 1EQQA 1C0AA 1FR3A 2F0GA 1JWMD 1I94L 4OL7A 1Z6HA 5CMDA 5E7NA 2KEEA 4DGZA 1PYBA 3KLSA 4ZLTF 4NB3A 4BA2I 1GHKA 1PH3A 1SRUA 5DM73 2I5HA 3HEJA 4HCEA 3K0XA 4KD4A 4U673 2K5WA 3F1ZA 2E2JB 1EIGA 4J8QA 3DUZA 5J39A 4PMBA 4XYOA 1SNQA 2GVBA 4R4IA 2OTLA 1TWFB 1EIYB 3WDNA 3NP8A 3J81E 2NVTB 5IGGA 3ZYYX 4OXPA 4J1MA 1HTPA 2FXQA 4AH6A 1EWHA 1SEBD 3G6EA 1AE2A 2K6AA 1OXXK 1CA5A 1G51A 2F0OA 4A3LG 4EQPA 3S1NH 1STHA 4B3RL 2K1BA 1MGSA 2HHHQ 1XXGA 1VQGA 1MIUA 2XWBB 3OYYA 2Q2HA 1R4QB 4K0KL 3BS1A 1M1KC 1TR5A 1PH5A 1HR0Q 1BCPD 2BOSA 3D4WA 4C3HH 2IT1A 2M00A 2KJXA 3S1QH 4FDBA 3BVMA 4A3MH 1KXLA 1ESFA 5LL6S 1JC7A 3S16B 1STAA 1FGBD 2QA4A 1QUQA 1H95A 2MQHA 3C1FA 3KLWA 1IBLL 1OXSC 2B2VC 1S5FD 2K33A 1CK1A 1TKWB 1TWCB 2NN6H 1B1ZA 1B3QA 1O78A 3A0JA 3K5LA 3U58A 1J5EQ 1PV4A 4G4KA 2XSCA 1ICWA 3M4QA 2BCOA 4KI0A 1YJNA 3D4RA 4RG1A 4DNRB 1VQEA 1BR9A 4KKUA 2K5QA 5CV8A 1M8AA 1ICFB 4XT1B 3F2UA 5IP7G 1SAPA 4RH6A 1T9HA 1JQYD 2GVAA 3S14B 1VMCA 4DV7Q 1WTRA 1YI2A 1SE4A 1G8ZD 2MNAA 5CGKA 1A2TA 4ZAIA 4DV3Q 4KHPL 5M3FB 2VQEQ 2QILA 1ML0D 3UDIA 1NTGA 5IOCA 1BCPB 4A3LH 2IX3A 4FXGC 1XPRA 3DHQA 4QIWB 4C3HG 2NZOA 4BXXH 2JA9A 3HG9A 4DR1L 4KV6A 1L0XB 4RFBA 2MPMA 2EYJA 2ICIA 3PO3B 4OWXB 4POGA 2L12A 5C44H 4QCLA 1PLFA 3BZCA 3BDLA 4R4OA 4DV0L 1HA6A 2PMZB 2JA8G 2B2TA 1GXDC 3S24A 4EQOA 4GKKL 5IYBG 1JT8A 2CW0C 3M4PA 3CQZB 4EQNA 2UU9Q 4A75A 2JE6I 4X3TA 5LL6X 4C3IH 3MEHA 3I91A 3VR4A 5IYBH 1VS0A 1QVFA 4L8JA 2MJ8A 3LNNA 3JAMi 4DR2L 4BBSG 2A5HA 4UY8C 2JJQA 3U9OA 2QDLA 3IL8A 3TRZA 1HHVA 3KBXA 5HY6A 2B2YA 4X62Q 1YJWA 3K5MA 1HZ9A 3TZUA 3CCJA 3C1EA 3J7A5 2PCFB 2B2WA 5COYA 2B63H 4V190 1L1OA 1TY2A 1VF7A 1CUKA 1CQFA 4DR5L 3K7AB 2VQEL 5EPJA 1IYJB 1SNPA 2RCFA 1EWIA 3QB3A 3H94A 1PDQA 2PQAA 4BS9A 4ZQ3A 2F4VQ 1B9NA 3GDEA 2R7DA 3QR8A 1HA5A 1JCKB 4NXML 2F0QA 2SEBD 3J7YW 4OX9Q 5M3FG 2DY8A 1DOMA 4PNYA 5C44G 1PFMA 3A7AB 1I50B 1YNJD 2PZWA 1J6QA 1WJJA 5C3EG 1EY8A 2EYPA 4FVMA 5A2QE 2A74C 2AQ2B 1AN8A 2KCNA 4B3RQ 1PMRA 1VQ9A 3GTKH 3MXUA 2ZM6L 1ESRA 2K04A 3EA6A 1EU3A 4N8X1 3W2DA 4IPGA 4LJZC 1YBYA 5KEEA 1HPCA 1RCVD 1N32L 2F52A 3T16A 3CCEA 3RZOB 2ZTEA 4CKEA 4OEMB 1JE5A 2JA5B 1Y1WH 3TMEA 4OGQC 1RODA 4XDXA 4HJAA 3SK5A 2I5LX 3KF8B 2EYMA 5JJZA 2EJGC 4FNFA 2VUMH 2B2UA 3X3NA 1ZEQX 1Y1VB 2Y0SE 5IWAL 2D0OA 3X3MA 5FLXc 3CC2A 5FO7B 5TSSA 1OXTA 3K81C 3HP3A 1HH2P 4DNIA 4KMUC 3L7ZC 5LHY1 1XNQQ 1EY7A 3HOUB 3TQYA 4N8FA 5GROA 4ME5A 2DNEA 1PTOD 2QDBA 1YEZA 2K4KA 4C2MB 1CHPD 5FLMG 3P75A 1H9RA 4Q0FA 2VNUD 1PTOH 2A69C 4G7HC 2ZJRA 3GTJH 1D7QA 1LTSD 3MAQA 1LV9A 4XQNA 4XTCS 4DR7L 2F0PA 4A3EG 3L0OA 4LF4L 1HZBA 1KABA 1KLGD 4BA1I 3CPFA 3DEPA 3T53B 1SBBB 3KF6A 3SK4A 3TS0A 3FMCA 4AQYQ 5JVH3 4GS3A 4DR4Q 4A3BB 2NVQB 1C4QA 3HOVG 1Y1WG 4C3IG 1SXTA 1CHQD 1K83H 3D4DA 1HNWQ 3QO2A 2KHSA 3BU2A 4X64L 4K0KQ 4PZ7A 4IJLA 1PH4A 1DCZA 4OO1H 2JP1A 2HD3A 1VQNA 4XXEA 1A63A 5JPNC 3T1YQ 4IOCA 4A76A 1AEXA 3F8TA 2F0WA 3CC7A 1WTVA 3W1GA 1S5CD 3EVQA 5HGQA 2EJMA 4PQXA 1Q1BA 1ENFA 4K2KA 3EROA 3KK7A 4IOAA 1Q12A 4PZ6A 4P2CB 3TBIB 3ND9A 2EVBA 1N33L 3CU7A 1IL8A 1NE3A 3R93A 2I5MX 3TP7A 5M5WB 2R92B 4APVA 1I6HB 1RL2A 4IPCA 4KY6A 1DOKA 1SYEA 3G6JB 4IPDA 4JBMA 3OWFA 1B9MA 1WI5A 1PTOC 2KA7A 5C5LA 5IGDA 2K32A 2IX0A 4C1NK 1II3A 2PI2A 3I4NH 1NMGA 1TWFH 1Y8NB 4KTAA 5IGEA 2WAQB 2EYLA 3HRZC 3UE1A 1DOLA 1GUTA 3W1BA 5JVG3 5LMNQ 1QVGA 2F0TA 1E7ZA 3I4NG 2UXCQ 3K57A 4IPHA 4GKJQ 4HIMA 5AFWA 4DV6L 4LF4Q 4QF4A 1STGA 4DR2Q 1F77A 2EZVA 1UEAB 1XNRQ 1G2TA 1WTXA 3PUYA 1EY5A 2HQLA 2PNRC 1EUJA 2F0MA 1LTRD 2DY7A 4IUTA 4A3IH 3MZ5A 2K28A 2QCPX 1EYDA 4GNXA 2Y0SB 2RDHA 1HQRD 5E3FA 4CGYB 1SE8A 1PTOF 3D31A 3IAYA 2UUBQ 2ZXOA 5C5MA 1PH9A 3UDFA 1KDCA 5C0XH 1IL2A 1HNZL 4A3FB 1QILA 3EBEA 2YU9H 4BBRG 1X55A 1QVCA 3GTLH 1K9MC 2XRQD 2KCMA 1XMOQ 1HCZA 3K7UC 5ELEA 4DR1Q 1YITA 2G9HD 3H3VH 3MFYA 1QE6A 1D5ZC 2PW7A 2VZAA 5DEHA 3NTKA 2R93H 2O4XA 5M5YB 4DFAA 1B3AA 2ES2A 4G7ZC 2A6HD 1STNA 2A6HC 1SYDA 2VQFQ 4LFBQ 1G2SA 1V1PB 2NVYH 3E0EA 4IJHA 5EPLA 4O2DA 3CHBD 4JG2A 1RHPA 3P1HA 1D5MC 4DR6Q 4MN3A 4PMWA 2OTJA 2OF1A 3HOZB 1C7YA 3GTPB 1CM9A 2L5TA 3T1HL 3NBHA 3CRLC 1G91A 1GOZA 1GVPA 5IGBA 1AP0A 5HURA 4A3IG 4HSPA 4GLXA 2KCTA 1C8CA 2IY5B 2EXDA 2CQOA 3CQZH 2JQOA 3OW7A 3PIOA 4QL5A 2SNSA 2KBNA 5KNDA 3SK6A 1PTOB 2K7VA 3I56A 1HFNA 3VR2A 1H9KA 4KHZA 4IUVA 5FO8B 1TIID 2JEBI 2MFIA 5KIXA 5FJ8G 3IRBA 4ZUJA 1VQ4A 3M7NA 2EY2A 1FL0A 3K0YA 4BBRH 3RNUA 4HJ5A 2MO1A 2N55A 2RSNA 4MNOA 3MA2B 4ALPA 1FYCA 2D9UA 3H3VC 2WIIB 1BUVT 4F87A 4KK7A 4HR7B 2KQ3A 5I6WA 3UE0A 2PMZE 3A55A 1UE6A 2BDOA 3I55A 3HZXA 5C4JB 1RDPD 3N6RA 1B8AA 1H9SA 4KY5A 5M5XB 3J81j 4CKBA 1HTLD 1BCPF 3GTLB 3SDZA 1SJHD 3NTHA 1ASYA 4MIUA 1SROA 4DR3L 1ZKOA 1TWCH 3MEFA 5J1ZA 1NMFA 2VL6A 1MD2D 1N34L 2NVTH 2HQEA 3U9SA 2CW0D 1PVOA 3Q0AA 4HIDA 1DONA 1WOCA 4FXKC 4DUZL 2Q2UA 5C44B 4L5RC 4JI7Q 4XYQA 4RGNA 1HNZQ 1M4VA 5CBEE 4A3EB 4K6DA 5LMUL 2JA7B 1K83B 4P73A 3JAMc 1ILPA 1YNNC 2XGTA 3Q6SA 2NZ1D 1XYIA 1S5ED 4LNQA 4ZRZA 2Z6KA 2Q8IB 1A6XA 4KN7C 1A2UA 5JPMC 1XMQL 4N9TA 4P71A 3FDTA 1LT4D 5FO9B 1T5XD 4YWMA 5JOBA 5FJ8H 3L3OC 1TWHB 4P75A 3STBD 3RN5A 3Q24A 1SNCA 5M3MG 1YJ9A 1SDFA 2XNAC 3LX0A 4AIMA 1X3EA 1PH8A 1STBA 2JA5H 1JWSD 4NMZA 1PRTC 5IGCA 2EY5A 3MHBA 4FXDA 3FKIB 4FF2A 2M9VA 4DUZQ 5JAVA 4IFDJ 2G9DA 1NY4A 3KLSX 2BA1A 1KTKA 2WB1G 1F2MA 2EIFA 2F03A 1CT1D 1DGSA 1NR4A 5KYIA 2CHBD 4NW2A 1PYSB 3H0GB 4CDCC 3J80L 2R92G 1TS4A 2LMCB 4DV3L 3HKZE 2JXMB 1CSPA 5K36G 4JYAQ 1UAPA 3F2DA 4ZYSA 3AEVA 3S2DH 1CZWA 1IW7D 2N78A 1V1PA 2N8NA 3H09A 2NWGA 4CHTB 4JI0L 5JEAH 2AMCB 1R9TB 2EJFC 1ET6A 2V1CC 2C35B 3ONAB 1PFNA 2NVQH 4LFCQ 4UP9A 2DN8A 2F3IA 4L5TA 3BDCA 1U4PA 1EWCA 4IUQA 1SE3A 1K8GA 1EYAA 1TS2A 4R4TA 5I2YA 1EYGA 2F0SA 4B08A 1XJVA 1K8OA 4YWLA 1PZID 4GZYC 4RGOS 3CF5A 1I94Q 2TSSA 5IYDH 1TS3A 3VYUA 3NEMA 4F88A 3HOXH 2L1BA 3CCLA 4JI6Q 2YYZA 4KHPQ 2L11A 4JI2L 4GN4B 4POFA 2EYFA 1H9JA 3MXPA 4DXFA 5CR3A 2EDGA 1SYCA 3A8JE 2JA7G 2DGYA 3J7AF 4X62L 3I4NB 2WKCA 2F0VA 2CCZA 4NXNQ 2JA7H 2PZTA 5CORA 4DAPA 4BWGB 2M2LA 1NUCA 4K5VA 3G7LA 3S16H 3OMGA 1A8VA 3LGJA 5EGTA 5I4DA 2VUMB 2E74C 3NQIA 3I2ZA 1J5EL 4OWWB 2XIWA 1S3OA 1PHJA 2Q8TA 4L5SA 5EKIA 3NWTA 5IWAQ 2Q2TA 3J80E 1E2WA 2FMMA 3F2BA 1N8RC 2HT1A 2DJGC 3EQLC 3N52A 1X32A 5FOBB 4JI1Q 4X64Q 3RD4A 1CQVA 2A6EC 4A3JH 1STEA 4PMCA 2ZTDA 4KHVA 1VCIA 2CVRA 4OO1G 2NVYB 5GAEC 4BY1G 1HUNA 4DV4Q 2IPKD 2YV5A 2RA4A 3P7JA 3V05A 1I6VC 2X6GA 2A69D 2Z9HA 3G48A 2UUAL 1U9RA 3PO2H 1QZHA 2WAQE 1YNND 4RMFA 1JOQA 2EOTA 1Z47A 3HOYH 3RZDB 4JC0A 1G6ZA 1HZCA 5E1FA 4HIOA 2PYKA 2OEOA 2Z1CA 3ND8A 2HDLA 5EBDA 4GOPA 1NNXA 1IW7C 1ZXTA 2AHOB 1GO3E 4ZUIA 1U4MA 1LTBD 2VB2X 4X65Q 5C3XA 4GLAC 2J0TD 4BY7B 4CDDC 1K8MA 4DV4L 1I6HH 4L6TB 2JN4A 4A3KH 1I5FA 2A73B 4NDXA 3AMUA 3J81c 1EOVA 1WCMB 2OT2A 4C3JG 4DK6C 1YVCA 5C0XJ 4IQZA 1EQTA 3TEHB 3GTGB 2HHHL 1EEID 1HUMA 1BBUA 3R2IA 4LF7Q 1EIHA 1GD7A 2AUKA 2ZT9C 1D8LA 2L55A 2O5IC 2CWPA 3PIPA 1UE1A 1PYWD 5K5PA 5AJ3Q 4HAEA 1EY4A 2AWOA 4Y52H 4DK3C 2VUMG 3K8AA 2ZXPA 1Q46A 2NB0A 2TMPA 1JR0D
chains in the Genus database with same CATH topology
4TQUS 2LFNA 5ELCA 1CZGA 4KY7A 3M7GA 1B50A 5E4XA 2NTTA 5CBAE 2R7ZB 3DXJC 4RHSA 2KEDA 2LS01 1Y8OB 2OXPA 4DF7A 1TQOA 5I6YA 3DWPA 1RKNA 2F0IA 2SNMA 5ELFA 3H91A 3FVQA 1W6JA 1WVLA 4TSSA 4K5WA 2RSOA 1CA6A 4G57A 3S1QB 4EVOA 4A93B 4OO1I 1SNOA 1RTOA 1ONLA 4IUPA 3I8ZA 5CV6A 4I65A 4DNTB 4DK1A 3O13A 2O2LD 1BOSA 3SEBA 3S1NB 3FRPB 2KECA 5IT9E 2XWJB 3NTIA 1V43A 5EJWA 1L0YB 1KNEA 1QB5D 1SNDA 2RKSA 3GP7A 1TT2A 1G291 1WTPA 1U4RA 3JAML 1VDZA 1DXMA 2BDNA 4RHRA 5KRUA 2E76C 1MSHA 2K5DA 2L0CA 3HOXB 3S17B 4TKOB 1EL0A 1PZKD 2R93B 1AZPA 5D3DA 4DA2A 1S5DD 2GA4B 3A8IE 3GTJB 3ITPA 1EYCA 3C46A 3BZDB 4Q5VA 3R2TA 4M8AA 3PIP3 1TVXA 3I90A 4IFDH 1O7LA 3M4OB 4CKCA 3JAME 4JK1C 1UNSA 3K58A 5CV4A 4ZKCB 1IYUA 2O5JC 4H0LC 4K8JA 1EOTA 4X3SA 1STYA 4FF4A 1Z7TA 3C2PA 5A35A 2KUMA 2HCIA 1QNUA 3SE0A 1R4PB 5A2QL 4WFN3 3K5NA 1AW7A 4G7OC 4CJ0B 1PRTB 4KKTA 2MHVA 1DM0B 1A3TA 4FP5D 2D62A 2E2IB 2F0DA 2C9OA 2F0LA 3A8KE 4RWSC 4KKSA 1DZ1A 1D6EC 2EE1A 2EPBA 1LLRD 2F3WA 1UUPA 4C3HB 5KYLA 2B2UC 3TP6A 5NUCA 1WD0A 1TY0A 1QCBD 1B44D 4HMJA 2B2WC 1F2ZA 4DAYA 3I72A 3K6OA 3WOFA 1TWGB 3HGBA 1RTNA 1WD1A 5C0XI 2YU9B 1GUOA 1DJRD 1LT3D 3SR1A 3OOCA 3BVZA 4FF1A 1H9MA 1LTID 3PMFA 3VYTA 4F8MA 5I9OA 3M85A 1JB3A 4DAVA 2A6ED 3M3YB 3RUZA 2F0UA 2HCCA 3KLRA 1S5BD 5KGUA 1F9QA 5EKKA 2I46A 4DN4M 3BVGA 2IL8A 3NK9A 3VR3A 2MP1A 1FD7D 2QKIC 4HEDA 4QUFA 4WRDA 1GJXA 1O7YA 4KJNA 3A7LA 1C48A 3GV6A 2PW5A 2B8GA 3HOVB 3KF8A 4ID6A 5ISRA 1JWUD 3BYTB 1MI2A 2XVSA 4A3IB 3ERQA 3I70A 4C56C 3OHXC 1QWYA 1ZYRC 1ZYRD 5BN4A 1SYFA 4OHJA 3GO5A 1KAAA 2F0NA 4FF3A 2R6GA 1S4ZA 3OMCA 3QWNA 4RCOA 3D6WA 1Y1WB 4RCNA 3SK8A 2IX1A 1SMYC 1E2ZA 5CC4A 5IIFA 3K5OA 4BY1B 3SVMA 1BCPC 4V0BA 3UI2A 1CTMA 1JOOA 3DM1A 3NXWA 1J9OA 4YIJA 1AZQA 4WORA 2BE5D 5ELBA 3S1MB 1A3VA 3NSWA 2Z8LA 4M1UB 2Z4HA 1B2TA 2IWHA 3SXHA 1EQVA 2LKVA 3GTMB 1V1OA 1WTOA 4NKLA 4B9XA 3E0JA 3NBIA 3AB9A 3PUVA 2NYZD 3RLFA 2JA6B 1ENCA 4CJ2C 4AYBB 3QOLA 5CV7A 2F0JA 1Q3LA 5FK9C 5DAUA 4RAUC 2XN9C 3Q22A 2F3VA 5D3IB 2L4NA 5JEAG 4E6IA 4A3DB 4XT3B 4ZK9B 1NAPA 2NUCA 3I3CA 2PZUA 2NVXB 1IYVA 3T51B 4HCSA 3P20A 3URYA 5C0XG 2KCCA 5FLXE 4J6HA 1NR2A 3MTSA 1NCVA 1GUSA 1LABA 1LTTD 3HOYB 3QJYA 1XX8A 3R8BA 5BN5A 2PPBC 3TN2A 1DD2A 3MXNA 1SE2A 1EFID 3QOJA 3S15B 1FNVA 1JICA 3R3OA 3EJIA 2C5CA 3MC0B 3BDOA 1JE4A 3I4LA 1SJED 2VB3X 3IFDA 2RQXA 4XIGS 1U4LA 1IKLA 3FPPA 2MUYA 5T1GA 1NSNS 2EYOA 2CQAA 2B2VA 4IUNA 3S2DB 4OIKA 5EBCA 1OO9B 5C6AA 3MWYW 1HXYD 4K14A 1A15A 1PXUA 1A3UA 3T56B 5C4XB 3VA7A 2B8FA 1EZ6A 3A54A 1I4HA 3NE5B 2I07B 2V4DA 1QNKA 5DNFA 2AQ1B 4O1NA 2B63B 3OPOA 4H7BA 1WTWA 3E5SA 2NTSA 2XRSD 1XTCD 2A68D 4Z9CB 3E6ZX 5F2DA 2B2TC 2FFKB 3A56A 1I4PA 4Y7NB 1I4GA 4LK1C 4C3JB 3I73A 4C3IB 3GD7A 3KBGA 2R61A 1B4OA 2AWNA 2D2CC 1SSOA 3CKIB 3W3AA 4IN3A 4DK0A 4HMIA 1JOKA 1YNJC 1H9SB 4A3MB 4HN7A 2NN6G 4BBRB 3NUCA 2E75C 5ELDA 3TP5A 3C3LA 1PZJD 2ZXRA 4LMQD 4IFDI 1ENAA 2F4IA 2KVMA 4ABNA 2E2DC 4IUUA 3PV0A 2FJ2A 1HQMC 2LY7A 3VYRA 2NN6I 4IURA 5G3LD 1OXUA 1TU2B 5CV9A 2RDFA 1EY9A 4CJ1B 1TWAB 1BDOA 1BBXC 1EU4A 1QG7A 1LO5D 3DWQA 1XWEA 3QIAA 1D1KA 2X6LA 2JSOA 5T1IA 2JYOA 4X3UA 5C4HA 3MXGA 4ODGA 2K03A 4RKBA 2EXZA 2F0FA 4KD3A 1QJOA 2WKDA 5D14A 1IHZA 2MGSA 1HFGA 3TSSA 1LTAD 3DMUA 2J4XA 5C3WA 3NQTA 3PUWA 1FNWA 1BXTA 1GHJA 4FO2A 2JA8B 1MBYA 5KNCA 1CI3M 1PRTF 1Y69U 4ILWA 5EPKA 5EQ0A 5G3LF 3LWUA 3OWEB 4FYDA 4ZKBB 5J22A 5HGTA 3K59A 3L9AX 4BBSB 5IODA 4EGVA 2B39A 2H4OA 4KJOA 5IGFA 5I2XA 4NP5A 2PO4A 1EZ8A 3VYSA 3OIQA 1F2YA 3NHHA 3VR6A 3GTKB 1F2LA 3RMHA 1X3PA 4K2LA 4TRDA 4F7XA 2X69A 3PUXA 2N88A 4IZ8A 1Q90A 2J7ZA 1I4XA 2ID0A 3D8GA 2WV6D 1DYQA 3IKJA 1V8QA 1OXVA 2EY6A 1SYBA 1Q1EA 1AFPA 1MSGA 4RA8A 1PRTD 4X3KA 5I9PA 1JORA 4A3KB 4QUCA 4HTHA 2WINB 1RJTA 2ENBA 1F9PA 2EYHA 2Q8RE 4R9WA 3T13A 1I4RA 3Q23A 5C3EB 1W6KA 4H44C 1ET9A 1EEFD 4MHEA 3LWEA 4C1NI 3TP8A 1BO0A 1SMYD 2SOBA 1VMPA 2F0EA 3J7AV 1KLUD 1F9SA 5FLXL 3OIPA 3TZDA 2E2HB 2D5DA 4HSVA 3PIO3 3GTQB 1KDBA 2R3ZA 4N9PA 5EKLA 1RD9D 1BNZA 4R8IA 4QB4A 2L9HA 1F9RA 1D5XC 3QG1A 4R8NA 3TDQA 2KOLA 3DEOA 1GUGA 2JEAI 2AQ3B 5CYUA 3D3RA 1J8IA 5FKAC 4L63B 3GQBA 3MVVA 1WTQA 3HOWB 1CFMA 5JEAJ 1LT6D 5IT9L 4S3SA 2F0HA 2HUGA 1EY0A 3AU7A 1QOHA 5D65A 2Z4IA 4A3GB 4RKLA 4XQQA 3PO2B 3J81L 1BQQT 2RDGA 1Y8PB 2HDMA 2AUJD 3IFTA 3S1RB 3DWAA 1VF5C 4LAAA 4KN4C 3I4MB 2FINB 2K05A 1RF2D 3HS0C 2RBMA 1T5EA 1O7ZA 2F1MA 2QF7A 4IFDG 3VR5A 1LT5D 1E2VA 2BA0A 3D6CA 4OIJA 2H1EA 1O80A 2BE5C 3NWSA 4QMGA 1SFOB 4K6LA 5M9OA 5CV5A 5C4ZA 1B53A 3MFGA 2VXWA 4K5XA 4CBVA 1D1IA 4XQJA 3GV3A 2IJ0A 5E4WC 1E0BA 4K8IA 4A3JB 1I4QA 4WJWA 1IKMA 1SYGA 2IW3A 3V2TA 4DXGA 3WOEA 2FHTA 2RVLA 4UAIA 3OSOA 3EFXD 2B2YC 1FNUA 1KNAA 2NBFA 3H6MA 2ICEC 5DM63 4I7ZC 1GUWA 3KUPA 5BN3A 3CRKC 1I3QB 2WB1B 1LTGD 1TS5A 4O42A 2FMCA 2PQEA 1X3QA 1D2BA 5KNBA 2WACA 2DNCA 1EY6A 3PUZA 4H13C 3HKZB 1LACA 3GTOB 3M4YA 4RGMA 1GUNA 1ILQA 3FPUB 3NPPA 4U68A 3T4AC 3SHLA 4ULLA 2WP8J 4PV1C 2A68C 4RGTA 1PFBA 3BG3A 3V96A 2QEJC 5M3MB 1Q8IA 1SNMA 4IALA 1HRJA 2F0KA 2K01A 4B9WA 3S9WA 4UDUC 1BF4A 5K36H 4JBWA 2SDFA 3VA5A 2EY1A 1KDAA 4DU9A 3S2HB 3FEWX 3BYYB 1FR3A 2F0GA 1JWMD 4OL7A 1Z6HA 5CMDA 2KEEA 4DGZA 3KLSA 4ZLTF 4BA2I 1GHKA 5DM73 3HEJA 4HCEA 4U673 4KD4A 2K5WA 2E2JB 1EIGA 4J8QA 3DUZA 5J39A 4PMBA 4XYOA 1SNQA 1TWFB 3WDNA 3NP8A 3J81E 2NVTB 5IGGA 3ZYYX 4J1MA 1HTPA 1EWHA 1SEBD 2K6AA 1OXXK 1CA5A 2F0OA 4EQPA 1STHA 2K1BA 1MGSA 1XXGA 2XWBB 1R4QB 3BS1A 1TR5A 1BCPD 2BOSA 3D4WA 2IT1A 2M00A 2KJXA 3BVMA 1ESFA 5LL6S 1JC7A 3S16B 1STAA 1FGBD 3C1FA 1OXSC 2B2VC 1S5FD 2K33A 1CK1A 1TKWB 1TWCB 2NN6H 1B1ZA 3K5LA 1O78A 4G4KA 2XSCA 1ICWA 2BCOA 4KI0A 3D4RA 4DNRB 1BR9A 4KKUA 2K5QA 5CV8A 1M8AA 4XT1B 3F2UA 1SAPA 4RH6A 1JQYD 3S14B 1VMCA 1WTRA 1SE4A 1G8ZD 5CGKA 1A2TA 4ZAIA 5M3FB 2QILA 1ML0D 5IOCA 1BCPB 2IX3A 4FXGC 3DHQA 4QIWB 4C3HG 3HG9A 4KV6A 1L0XB 4RFBA 2MPMA 2EYJA 2ICIA 3PO3B 2L12A 4QCLA 1PLFA 3BDLA 1HA6A 2PMZB 2B2TA 1GXDC 4EQOA 2CW0C 3CQZB 4EQNA 2JE6I 4X3TA 5LL6X 3MEHA 3I91A 3VR4A 4L8JA 2MJ8A 3LNNA 2A5HA 3U9OA 3IL8A 1HHVA 3KBXA 2B2YA 3K5MA 3TZUA 3C1EA 2PCFB 2B2WA 5COYA 4V190 1TY2A 1VF7A 1CQFA 3K7AB 5EPJA 1SNPA 3QB3A 3H94A 1PDQA 4BS9A 4ZQ3A 1B9NA 1HA5A 1JCKB 2F0QA 3J7YW 2SEBD 2DY8A 1DOMA 4PNYA 1PFMA 3A7AB 1I50B 1YNJD 2PZWA 1EY8A 2EYPA 4FVMA 5A2QE 2A74C 2AQ2B 1AN8A 2KCNA 1PMRA 3MXUA 1ESRA 2K04A 3EA6A 1EU3A 3W2DA 4LJZC 5KEEA 1HPCA 1RCVD 3T16A 3RZOB 4CKEA 2JA5B 3TMEA 4OGQC 1RODA 4XDXA 3SK5A 2EYMA 5JJZA 2EJGC 4FNFA 2B2UA 3X3NA 1ZEQX 1Y1VB 3X3MA 5FO7B 5TSSA 1OXTA 3HP3A 4KMUC 3L7ZC 5LHY1 1EY7A 3HOUB 4ME5A 2DNEA 1PTOD 2QDBA 4C2MB 1CHPD 3P75A 1H9RA 4Q0FA 2VNUD 1PTOH 2A69C 4G7HC 1LTSD 3MAQA 1LV9A 4XQNA 4XTCS 2F0PA 1KABA 1KLGD 4BA1I 3DEPA 3T53B 1SBBB 3SK4A 3FMCA 5JVH3 4A3BB 2NVQB 1C4QA 4C3IG 1SXTA 1CHQD 3D4DA 3QO2A 2KHSA 1DCZA 4OO1H 2JP1A 4XXEA 5JPNC 1AEXA 2F0WA 1WTVA 1S5CD 3EVQA 2EJMA 4PQXA 1Q1BA 1ENFA 4K2KA 3EROA 3KK7A 1Q12A 4P2CB 3TBIB 3ND9A 2EVBA 3CU7A 1IL8A 3R93A 3TP7A 5M5WB 2R92B 1I6HB 4KY6A 1DOKA 1SYEA 3G6JB 3OWFA 1B9MA 1PTOC 2KA7A 5C5LA 5IGDA 2K32A 2IX0A 4C1NK 1II3A 1Y8NB 5IGEA 4KTAA 2WAQB 2EYLA 3HRZC 1DOLA 1GUTA 5JVG3 2F0TA 3K57A 5AFWA 4QF4A 1STGA 1F77A 2EZVA 1UEAB 1G2TA 1WTXA 3PUYA 1EY5A 2PNRC 2F0MA 1LTRD 2DY7A 4IUTA 3MZ5A 2K28A 2QCPX 1EYDA 2Y0SB 2RDHA 1HQRD 5E3FA 4CGYB 1PTOF 3D31A 3IAYA 2ZXOA 5C5MA 1KDCA 5C0XH 4A3FB 1QILA 2XRQD 1HCZA 5ELEA 2G9HD 3MFYA 1QE6A 1D5ZC 2PW7A 5DEHA 3NTKA 2O4XA 5M5YB 4DFAA 1B3AA 4G7ZC 2A6HD 1STNA 2A6HC 1SYDA 1G2SA 1V1PB 5EPLA 3CHBD 1RHPA 3P1HA 1D5MC 4MN3A 4PMWA 2OF1A 3HOZB 3GTPB 1CM9A 2L5TA 3NBHA 3CRLC 1G91A 1GOZA 5IGBA 1AP0A 5HURA 4HSPA 1C8CA 3OW7A 2SNSA 5KNDA 3SK6A 1PTOB 2K7VA 1HFNA 3VR2A 1H9KA 4KHZA 4IUVA 5FO8B 1TIID 2JEBI 5KIXA 4ZUJA 3M7NA 2EY2A 3K0YA 2N55A 2RSNA 3MA2B 1FYCA 2D9UA 3H3VC 2WIIB 1BUVT 4F87A 4KK7A 4HR7B 2KQ3A 5I6WA 3A55A 2BDOA 3HZXA 5C4JB 1RDPD 3N6RA 1H9SA 4KY5A 5M5XB 4CKBA 1HTLD 1BCPF 3GTLB 3SDZA 1SJHD 3NTHA 4MIUA 1ZKOA 5J1ZA 1MD2D 2HQEA 3U9SA 2CW0D 1DONA 3Q0AA 4FXKC 5C44B 4XYQA 4RGNA 1M4VA 5CBEE 4A3EB 4K6DA 2JA7B 1K83B 1ILPA 1YNNC 3Q6SA 2NZ1D 1XYIA 1S5ED 4ZRZA 1A6XA 2Q8IB 4KN7C 1A2UA 5JPMC 4N9TA 3FDTA 1LT4D 5FO9B 1T5XD 5JOBA 3L3OC 1TWHB 3Q24A 1SNCA 1SDFA 2XNAC 3LX0A 1STBA 1JWSD 4NMZA 1PRTC 5IGCA 2EY5A 3MHBA 4FXDA 3FKIB 4FF2A 2M9VA 5JAVA 4IFDJ 2G9DA 3KLSX 2BA1A 1KTKA 1F2MA 2F03A 1CT1D 1NR4A 5KYIA 2CHBD 4NW2A 3H0GB 3J80L 1TS4A 2LMCB 2JXMB 5K36G 1UAPA 4ZYSA 1CZWA 1IW7D 1V1PA 3H09A 2NWGA 4CHTB 5JEAH 1R9TB 2EJFC 1ET6A 3ONAB 1PFNA 2DN8A 3BDCA 1U4PA 1EWCA 4IUQA 1SE3A 1EYAA 1TS2A 5I2YA 2F0SA 4B08A 1K8OA 1PZID 4GZYC 4RGOS 2TSSA 1TS3A 3VYUA 4F88A 2L1BA 2YYZA 2L11A 2EYFA 1H9JA 3MXPA 4DXFA 5CR3A 2EDGA 1SYCA 3A8JE 3J7AF 3I4NB 2WKCA 2F0VA 2PZTA 5CORA 4DAPA 4BWGB 2M2LA 1NUCA 3G7LA 4K5VA 3OMGA 5EGTA 5I4DA 2VUMB 2E74C 3NQIA 2XIWA 2Q8TA 5EKIA 3NWTA 3J80E 1E2WA 2FMMA 3EQLC 3N52A 1X32A 5FOBB 3RD4A 1CQVA 2A6EC 1STEA 4PMCA 4KHVA 1VCIA 2CVRA 4OO1G 2NVYB 1HUNA 2IPKD 2RA4A 3P7JA 3V05A 1I6VC 2X6GA 2A69D 1U9RA 1YNND 1JOQA 2EOTA 1Z47A 3RZDB 1G6ZA 5E1FA 2PYKA 2OEOA 2Z1CA 3ND8A 2HDLA 5EBDA 1IW7C 1ZXTA 4ZUIA 1U4MA 1LTBD 2VB2X 5C3XA 2J0TD 4BY7B 1K8MA 4L6TB 2A73B 4NDXA 3AMUA 1WCMB 4C3JG 2OT2A 5C0XJ 4IQZA 1EQTA 3GTGB 1EEID 1HUMA 3R2IA 1EIHA 2AUKA 2ZT9C 2L55A 2O5IC 1PYWD 5K5PA 4HAEA 1EY4A 2AWOA 2ZXPA 2NB0A 2TMPA 1JR0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E76 C;  1HPC A;  1T5E A;  1GUS A;  1LAB A;  3CRL C;  3GD7 A;  1Q12 A;  2F1M A;  3I73 A;  4TQU S;  2QF7 A;  1CI3 M;  5BN4 A;  5KNC A;  4IFD G;  3QJY A;  1Y69 U;  3ND9 A;  3VR5 A;  2EVB A;  1E2V A;  2BA0 A;  2D5D A;  2R6G A;  3LWU A;  4TKO B;  4JBW A;  5K36 H;  2D2C C;  1E2W A;  5BN5 A;  3W3A A;  3OW7 A;  4DK0 A;  4RCN A;  1YNJ C;  2PPB C;  2BE5 C;  1DD2 A;  1H9S B;  1SMY C;  1E2Z A;  5KND A;  2NN6 G;  3I72 A;  2E75 C;  3EQL C;  3HGB A;  1FR3 A;  2K7V A;  1B9M A;  3A8I E;  2KA7 A;  1CTM A;  2BA1 A;  4OGQ C;  3DXJ C;  1Z6H A;  3VR2 A;  2A6E C;  1H9K A;  4KHZ A;  1GUO A;  2K32 A;  2BE5 D;  1VCI A;  3OOC A;  3BDO A;  4OO1 G;  4BA2 I;  2JEB I;  1GHK A;  3QG1 A;  1Y8N B;  3I4L A;  2EJG C;  1H9M A;  3PV0 A;  3M7N A;  1GUT A;  1HQM C;  1Y8O B;  4IFD H;  1GUG A;  2JEA I;  1O7L A;  1I6V C;  2LMC B;  1OXT A;  4XIG S;  2NN6 I;  2A69 D;  2JXM B;  3WDN A;  3VR6 A;  1OXU A;  5K36 G;  1TU2 B;  4KMU C;  3L7Z C;  3M85 A;  2CW0 C;  3GQB A;  3FPP A;  1BDO A;  1FYC A;  1HTP A;  2A6E D;  2DNE A;  1CFM A;  1IW7 D;  2JE6 I;  1EWH A;  3AB9 A;  3PUV A;  5JEA H;  3KLR A;  4HR7 B;  3VR4 A;  4JK1 C;  3PUX A;  3PUY A;  1H9R A;  1Q90 A;  1OXX K;  2PNR C;  3RLF A;  4L8J A;  2A69 C;  4G7H C;  1IYU A;  2EJF C;  2BDO A;  2O5J C;  4H0L C;  3N6R A;  3ND8 A;  3LNN A;  1H9S A;  2DN8 A;  4I7Z C;  3T56 B;  5BN3 A;  3D31 A;  4XTC S;  3CRK C;  3IKJ A;  1IW7 C;  1Z7T A;  1V8Q A;  3SDZ A;  3QIA A;  3VR3 A;  5C0X H;  5A35 A;  4BA1 I;  1ONL A;  3T53 B;  3SE0 A;  3VA7 A;  1OXV A;  1K8O A;  2B8F A;  5KNB A;  4DNT B;  3TZU A;  4DK1 A;  1ZKO A;  4GZY C;  2PCF B;  3FMC A;  2DNC A;  3NE5 B;  1K8M A;  1GJX A;  2IT1 A;  4G7O C;  1HCZ A;  3PUZ A;  4H13 C;  1Q1E A;  1VF7 A;  2V4D A;  3A7L A;  3U9S A;  2YYZ A;  1LAC A;  4KKT A;  3MFY A;  1V43 A;  3M4Y A;  5JEA G;  1GUN A;  3OPO A;  1H9J A;  3H94 A;  2D62 A;  4IQZ A;  1DCZ A;  1OXS C;  4LJZ C;  1QJO A;  2EDG A;  2A6H D;  1Y8P B;  4G7Z C;  4OO1 H;  3A8J E;  1B9N A;  1YNN C;  2K33 A;  2A6H C;  1TKW B;  2AUJ D;  2B8G A;  2NN6 H;  3IFT A;  1IYV A;  2A68 D;  1O78 A;  2AUK A;  3A8K E;  2Q8I B;  1A6X A;  1VF5 C;  3T51 B;  4KKS A;  2ZT9 C;  4KN7 C;  3A7A B;  2O5I C;  4PV1 C;  2A68 C;  3P20 A;  3BG3 A;  1G29 1;  4H44 C;  4KI0 A;  5C0X G;  4KN4 C;  3D4R A;  2KCC A;  4DNR B;  1VDZ A;  1PMR A;  2EJM A;  3MXU A;  1Q1B A;  2AWO A;  3PUW A;  4LK1 C;  1DXM A;  2E74 C;  1GHJ A;  4KKU A;  1ZYR C;  2L5T A; 
#chains in the Genus database with same CATH topology
 3H3V I;  2OCE A;  4TQU S;  2JK8 A;  2LFN A;  1Q82 C;  5ELC A;  1CZG A;  4KY7 A;  3M7G A;  1B50 A;  1PH7 A;  5E4X A;  4DV5 Q;  3J80 c;  2NTT A;  5CBA E;  2DJF C;  4I7A A;  2R7Z B;  3DXJ C;  4NPS A;  1HZA A;  4EQ5 A;  1V1Q A;  4RHS A;  3BZK A;  1Z9F A;  4UHV A;  3RZD H;  2KED A;  4DV1 L;  3NEN A;  3GTP H;  2LS0 1;  3PGZ A;  1Y8O B;  2OXP A;  2HIV A;  4JI5 L;  4DF7 A;  1KIX A;  1TQO A;  5I6Y A;  3DWP A;  1RKN A;  2F0I A;  1VQ7 A;  4KLK A;  3FHW A;  4P72 A;  1HR0 W;  2SNM A;  2DUD A;  5ELF A;  3H91 A;  3Q8D A;  3FVQ A;  1W6J A;  2IHE A;  1WVL A;  4TSS A;  4K5W A;  5JJL A;  2RSO A;  1CA6 A;  4GKJ L;  1MJE A;  4G57 A;  3S1Q B;  4EVO A;  4A93 B;  4OO1 I;  1SNO A;  1K73 C;  4LFB L;  3RZO H;  4UPA A;  2JA6 H;  1MHW C;  1PH6 A;  1XNQ L;  1WTH A;  1RTO A;  1ONL A;  4IUP A;  3I8Z A;  5CV6 A;  2YTY A;  4I65 A;  4C2M H;  4DNT B;  4DK1 A;  4LWC A;  3O13 A;  2O2L D;  2K50 A;  1N34 Q;  1BOS A;  3SEB A;  3G71 A;  3S1N B;  3FRP B;  2KEC A;  5IT9 E;  2XWJ B;  3NTI A;  1V43 A;  3OTO Q;  5EJW A;  1L0Y B;  4JI1 L;  3AQQ A;  1KNE A;  4HJ8 A;  1QB5 D;  4AQY L;  3I4M G;  1SND A;  3ULP A;  2RKS A;  3GP7 A;  3S15 H;  2GN5 A;  3S17 H;  2ZJP A;  3E9I A;  1TT2 A;  2K5N A;  3HKS A;  1G29 1;  2UUB L;  1CKN B;  1WTP A;  1U4R A;  3JAM L;  1QUQ B;  1VDZ A;  4JW0 A;  3WWV A;  1DXM A;  2BDN A;  4RHR A;  1L0W A;  5KRU A;  3GTQ H;  2E76 C;  1MSH A;  2K5D A;  2L0C A;  3HOX B;  3S17 B;  4LF6 L;  4CDE C;  4TKO B;  1EL0 A;  1PFS A;  1PZK D;  2R93 B;  3CP0 A;  1AZP A;  4OX9 L;  5D3D A;  3H0G H;  4JI5 Q;  4DA2 A;  1CSQ A;  1S5D D;  4JI3 L;  4DKA C;  2GA4 B;  4A3D H;  5M5W H;  1VQA A;  3A8I E;  3GTJ B;  1VQB A;  3ITP A;  4YHH Q;  1PH2 A;  4JI7 L;  1EYC A;  3C46 A;  3BZD B;  1SR3 A;  4X66 Q;  3HOW H;  4A3D G;  1QZG A;  4Q5V A;  3R2T A;  4R4Q A;  4M8A A;  3EIV A;  3PIP 3;  2MO0 A;  2K52 A;  1TVX A;  3I90 A;  4IFD H;  2RHQ B;  1O7L A;  1IBK Q;  5M3M H;  3M4O B;  5C4J H;  2BH8 A;  4CKC A;  3JAM E;  1JMC A;  2EQS A;  2B29 A;  1C9O A;  4JK1 C;  1UNS A;  3K58 A;  5CV4 A;  4ZKC B;  3T1Y L;  1IYU A;  2O5J C;  4H0L C;  4K8J A;  1EOT A;  4X3S A;  1STY A;  4GNX B;  1YHB A;  5M3F H;  4GKK Q;  4YCU A;  1Z7T A;  1K3R A;  3C2P A;  4FF4 A;  4JI8 L;  5GAD C;  5A35 A;  1YHA A;  2KUM A;  4GN3 B;  2HCI A;  1QNU A;  3SE0 A;  5GAH C;  1R4P B;  5A2Q L;  3ICE A;  4WFN 3;  3AFP A;  3K5N A;  1AW7 A;  4G7O C;  1B7Y B;  4CJ0 B;  1PRT B;  3HKZ G;  1EIF A;  1GM5 A;  3CPW A;  4KKT A;  3ZJY C;  2MHV A;  1DM0 B;  1SLJ A;  1A3T A;  4FP5 D;  2D62 A;  4R4C A;  2E2I B;  2F0D A;  4GNX C;  2C9O A;  4A3F G;  2F0L A;  1X3F A;  3A8K E;  4RWS C;  3A5Z B;  4KKS A;  1P8L A;  2CFM A;  2VY3 A;  3RR5 A;  1DZ1 A;  1HJP A;  1D6E C;  2EE1 A;  4LF6 Q;  1HNX Q;  3D0F A;  3CAM A;  1P16 A;  2EPB A;  1NBW A;  1LLR D;  2F3W A;  4X6A H;  4QGU A;  4LF8 Q;  4LF9 L;  1UUP A;  3CD6 A;  4C3H B;  5KYL A;  2B2U C;  1WFQ A;  4DR6 L;  1XMQ Q;  3TP6 A;  5NUC A;  1WD0 A;  1TY0 A;  1QCB D;  1B44 D;  4HMJ A;  3PO2 G;  1XTD A;  2E5L Q;  4JYA L;  2B2W C;  1F2Z A;  4DAY A;  3STB C;  3I72 A;  3K6O A;  3WOF A;  1TWG B;  3HGB A;  1A62 A;  1RTN A;  1WD1 A;  2K75 A;  2KEN A;  5C0X I;  1GUO A;  2YU9 B;  1DJR D;  2HIX A;  1LT3 D;  4DR3 Q;  4JBJ A;  3OOC A;  3SR1 A;  3BVZ A;  1KL9 A;  1G6P A;  4FF1 A;  1H9M A;  1XMO L;  1FVI A;  1LTI D;  4BXX G;  1N33 Q;  3PMF A;  4LFA L;  3TRE A;  4LFC L;  3VYT A;  4F8M A;  4L5Q A;  5I9O A;  2WFW A;  3M85 A;  3HOU G;  1EFW A;  1JB3 A;  4DAV A;  2A6E D;  3M3Y B;  1BBW A;  3RUZ A;  3H0G G;  2F0U A;  2HCC A;  3KLR A;  4MTK A;  3HOU H;  1FGU A;  1S5B D;  2E2H H;  5KGU A;  4A3C H;  1A0I A;  3FKI G;  5JJK A;  4DV0 Q;  2ZM6 Q;  1F9Q A;  3MXN B;  5EKK A;  4A3C G;  2F4V L;  2I46 A;  4DN4 M;  2I0Q A;  3BVG A;  2IL8 A;  3NK9 A;  3VR3 A;  4WJ4 A;  2MP1 A;  1FD7 D;  2QKI C;  4HED A;  4MZ9 A;  4X66 L;  4EX5 A;  4IO9 A;  4QUF A;  4WRD A;  4MTN A;  1GJX A;  1O7Y A;  1MKH A;  3A7L A;  4KJN A;  2OWO A;  1C48 A;  3JC6 6;  1LM0 A;  3RLN A;  3HOZ H;  3GV6 A;  3ER0 A;  4DUY L;  3UDG A;  2PW5 A;  3PO3 G;  1XPO A;  4GOP B;  2B8G A;  1YNX A;  3KF8 A;  3HOV B;  4WJ3 M;  4ID6 A;  5ISR A;  1JWU D;  4PZ8 A;  3BYT B;  4AYB G;  1TXY A;  3SGI A;  1MI2 A;  1LTL A;  2XVS A;  4A3I B;  5GQO A;  1W2B A;  3ERQ A;  1JB7 A;  3I70 A;  1QWY A;  3OHX C;  1X56 A;  4C56 C;  1ZYR C;  1AH9 A;  2AKW B;  1ZYR D;  5BN4 A;  1V9P A;  1SYF A;  1GKH A;  4OHJ A;  3GO5 A;  4B3T Q;  1KAA A;  2F0N A;  4FF3 A;  2R6G A;  1S4Z A;  3OMC A;  3QWN A;  4RCO A;  3D6W A;  1Y1W B;  4RCN A;  3SK8 A;  2IX1 A;  1SMY C;  1E2Z A;  5CC4 A;  4LUZ A;  5IIF A;  3K5O A;  4BY1 B;  3SVM A;  4OWT B;  1BCP C;  4V0B A;  3UI2 A;  1CTM A;  1JOO A;  1Q7Y C;  3DM1 A;  2RF4 A;  3NXW A;  3HFZ B;  1J9O A;  4YIJ A;  1AZQ A;  4WOR A;  2BE5 D;  1VQP A;  5ELB A;  1I3Q H;  1A3V A;  3S1M B;  1LYL A;  3NSW A;  1K8A C;  2UXB L;  2Z8L A;  4QIW E;  1FJG Q;  2E5L L;  5IP9 G;  3CCQ A;  4DV7 L;  4M1U B;  2Z4H A;  3RN2 A;  1B2T A;  2IWH A;  3SXH A;  4BY1 H;  1EQV A;  4JCV E;  1JJG A;  4J15 A;  1VQH A;  2LKV A;  2JA5 G;  3GTM B;  4LF9 Q;  2YTV A;  1V1O A;  5FLM H;  3CC4 A;  1L2F A;  1WTO A;  4NKL A;  5IYC G;  2H5X A;  2RCN A;  3U4V A;  4B9X A;  3E0J A;  3NBI A;  3AB9 A;  3PUV A;  4HJ7 A;  2NYZ D;  3RLF A;  2JA6 B;  1ENC A;  2ASB A;  4CJ2 C;  4AYB B;  1E3P A;  3NBH B;  3QOL A;  5CV7 A;  5ELO A;  2F0J A;  4AYB E;  1Q3L A;  5FK9 C;  5DAU A;  4RAU C;  1E22 A;  2XN9 C;  3Q22 A;  2F3V A;  1B70 B;  2K14 A;  5D3I B;  4DR5 Q;  2JA8 H;  4QJF A;  4DPG A;  2L4N A;  3J81 i;  3GTM H;  3OTO L;  4JI3 Q;  1K0R A;  1BKB A;  5JEA G;  4E6I A;  3A74 A;  4DV5 L;  4XT3 B;  4A3D B;  4ZK9 B;  1NAP A;  2N49 A;  2R7Z G;  2NUC A;  3J7Z C;  3I3C A;  2PZU A;  2NVX B;  1IYV A;  3T51 B;  2R7Z H;  2Z6B A;  4HCS A;  3P20 A;  3URY A;  5C0X G;  2KCC A;  5FLX E;  4JI0 Q;  4J6H A;  1NR2 A;  1UEB A;  1SFO H;  2B63 G;  3MTS A;  3H15 A;  1NCV A;  2B3G A;  4YWK A;  1GUS A;  1LAB A;  3PQI A;  1LTT D;  3HOY B;  3QJY A;  1XX8 A;  3R8B A;  2WAQ G;  2IHF A;  5BN5 A;  1VQ5 A;  2PPB C;  3TN2 A;  4HIK A;  1DD2 A;  4R1J A;  1PH1 A;  3MXN A;  1K0S A;  1SE2 A;  1EFI D;  3QOJ A;  3S15 B;  1FNV A;  1JIC A;  1Q8K A;  3R3O A;  5DLQ E;  3EJI A;  3KDF B;  3GTG H;  2C5C A;  3MC0 B;  3BDO A;  3HOV H;  3I4O A;  1JE4 A;  3I4L A;  1SJE D;  4Y7N H;  1IBM L;  2VB3 X;  4JV5 L;  3IFD A;  2RQX A;  4XIG S;  1U4L A;  3TS2 A;  4A93 H;  2NZH A;  1VQ6 A;  4A3K G;  1IKL A;  3FPP A;  2MUY A;  1KC8 C;  5T1G A;  2CH4 W;  2UXD L;  4A93 G;  1NSN S;  4DAM A;  2EYO A;  2CQA A;  2L15 A;  4UP8 A;  2B2V A;  4IUN A;  3S2D B;  4OIK A;  5EBC A;  2JA6 G;  1OO9 B;  2UUA Q;  1VQK A;  5C6A A;  3MWY W;  1HXY D;  4K14 A;  1A15 A;  1PXU A;  1I50 H;  1A3U A;  4LUO A;  3T56 B;  1X3G A;  5BR8 Q;  5C4X B;  5IP9 H;  1L1O B;  3VA7 A;  4LF7 L;  2B8F A;  1EZ6 A;  3A54 A;  1I4H A;  3NE5 B;  2I07 B;  2R93 G;  2V4D A;  2E2I H;  1QNK A;  5DNF A;  1LUZ A;  2AQ1 B;  4O1N A;  5IP7 H;  2B63 B;  3OPO A;  4H7B A;  1WTW A;  3E5S A;  2CH4 A;  2NTS A;  2XRS D;  1TWA H;  1XTC D;  4X65 L;  2A68 D;  4Z9C B;  3E6Z X;  5GAG C;  5F2D A;  2B2T C;  2CKZ B;  3M9B A;  2LXK A;  2FFK B;  3A56 A;  1I4P A;  3CCR A;  1K3B C;  3E3X A;  4Y7N B;  1I4G A;  2VS1 A;  4LK1 C;  4C3J B;  4CDF C;  3NEL A;  3KFU A;  3I73 A;  4C3I B;  3GD7 A;  3KBG A;  1OTC A;  3K80 C;  2UXD Q;  2R61 A;  4NXM Q;  1B4O A;  2AWN A;  4JOI A;  4BY7 G;  3ULJ A;  2D2C C;  1SSO A;  4DV1 Q;  1IBM Q;  3CKI B;  3W3A A;  4IN3 A;  4DK0 A;  4HMI A;  5M5Y H;  1JOK A;  1YNJ C;  1L1O C;  1H9S B;  4JI2 Q;  4A3M B;  4HN7 A;  2NN6 G;  4BBR B;  3NUC A;  2E75 C;  3M4O H;  5LMU Q;  5ELD A;  3TP5 A;  3CMA A;  4JV5 Q;  3C3L A;  2A1A A;  3AYH B;  3KDF A;  5H1S E;  1PZJ D;  2ZXR A;  4LMQ D;  2UXB Q;  4IFD I;  1MJC A;  1ENA A;  2F4I A;  2KVM A;  3U4Z A;  4ABN A;  4GLV B;  2WB1 E;  1SN8 A;  2E2D C;  4IUU A;  4A3F H;  3PV0 A;  2FJ2 A;  4DR7 Q;  3HOW G;  1HQM C;  2LY7 A;  3VYR A;  3I4M H;  2NN6 I;  4IUR A;  5G3L D;  1OXU A;  4ME3 A;  2QEX A;  1TU2 B;  5CV9 A;  2RDF A;  5J3B A;  1EY9 A;  4CJ1 B;  1TWA B;  3HOX G;  1BDO A;  1BBX C;  2NVX H;  1X9N A;  1EQR A;  1KQS A;  2Q2I A;  3CW2 C;  1EU4 A;  3CCU A;  1QG7 A;  1LO5 D;  3DWQ A;  1XWE A;  3CCM A;  5C4X G;  2QGQ A;  3QIA A;  1VQL A;  4A3G H;  1D1K A;  2X6L A;  2JSO A;  1U5K A;  5T1I A;  1IBK L;  1JJ2 A;  2JYO A;  3VDY A;  5C4X H;  2LSS A;  1KD1 C;  4X3U A;  5C4H A;  4DR4 L;  3MXG A;  4ODG A;  1RIP A;  2K03 A;  3S2H H;  4RKB A;  5ELN A;  4LF5 Q;  1HNW L;  4LUV A;  2K5H A;  2EXZ A;  2F0F A;  2R92 H;  4KD3 A;  3I7F A;  3KF6 B;  1QJO A;  2WKD A;  3DM3 A;  5D14 A;  1IHZ A;  2MGS A;  1N32 Q;  1HFG A;  3TSS A;  5L37 A;  1LTA D;  3DMU A;  3KJO A;  4JVZ A;  2BH2 A;  3PF5 A;  4TVA B;  1X54 A;  2J4X A;  5C3W A;  1VQJ A;  3FP9 A;  3NQT A;  3PUW A;  1FNW A;  1BXT A;  1GHJ A;  3ERS X;  4FO2 A;  2JA8 B;  1XPU A;  1MBY A;  5KNC A;  3PCO B;  1CI3 M;  1PRT F;  1WCM G;  1Y69 U;  4JI4 L;  4ILW A;  2ATW A;  5EPK A;  5EQ0 A;  5EAY A;  5G3L F;  3LWU A;  3OWE B;  4FYD A;  4DAY B;  4ZKB B;  3G4S A;  5J22 A;  4H02 A;  4DV2 L;  1VQD A;  5HGT A;  3PO3 H;  5IYC H;  3K59 A;  3L9A X;  4B3M Q;  1KRS A;  4BBS B;  5IOD A;  4O0A A;  4EGV A;  3HOZ G;  2UUC L;  4LF5 L;  1N36 Q;  2B39 A;  2H4O A;  4KJO A;  5IGF A;  5I2X A;  1JJC B;  4NP5 A;  1UWV A;  2PO4 A;  1EZ8 A;  3VYS A;  2VW9 A;  1VQ8 A;  3OIQ A;  1F2Y A;  1BVS A;  3NHH A;  3VR6 A;  1E1T A;  3GTK B;  3E9H A;  1F2L A;  3ULL A;  3RMH A;  4B3S L;  1IZ6 A;  1X3P A;  4K2L A;  3DLL A;  1R9T H;  4TRD A;  3W5O A;  4F7X A;  4PG3 A;  2X69 A;  3PUX A;  2N88 A;  4A3B G;  4IZ8 A;  1Q90 A;  3KJP A;  2ALY B;  1TWG H;  4HJ9 A;  2Z0S A;  5IT9 c;  2J7Z A;  1I4X A;  2E8G A;  2ID0 A;  4LFA Q;  3BJU A;  5JJI A;  3D8G A;  2WV6 D;  1DYQ A;  3IKJ A;  1YIJ A;  1KHI A;  2A8V A;  1V8Q A;  1OXV A;  2EY6 A;  2UUC Q;  4P74 A;  5LMN L;  2Y0S G;  1S40 A;  1SYB A;  4YHH L;  2LXJ A;  4JBK A;  1ASZ A;  1Q1E A;  1AFP A;  2ZJQ A;  2YTX A;  1MSG A;  1WYD A;  4RA8 A;  2A19 A;  1VQO A;  1M90 C;  1PRT D;  4X3K A;  5I9P A;  1JOR A;  4A3K B;  4QUC A;  4HTH A;  2XTI A;  2WIN B;  1KRT A;  1RJT A;  2ENB A;  1F9P A;  2EYH A;  1SMX A;  2Q8R E;  4R9W A;  3T13 A;  1I4R A;  3Q23 A;  5C3E B;  3HOY G;  1W6K A;  4H44 C;  3CME A;  1ET9 A;  2PNH A;  1EEF D;  4MHE A;  3LWE A;  1HNX L;  4C1N I;  5C3E H;  2UU9 L;  3TP8 A;  1BO0 A;  1SMY D;  2SOB A;  1VMP A;  3S1R H;  2F0E A;  2ZTC A;  3J7A V;  1KLU D;  1F9S A;  5FLX L;  3OIP A;  1TWH H;  3TZD A;  2E2H B;  2D5D A;  4HSV A;  3PIO 3;  2OQK A;  3GTQ B;  1E1O A;  1Q86 C;  1KDB A;  4BBS H;  2R3Z A;  4N9P A;  5EKL A;  1RD9 D;  1BNZ A;  4R8I A;  4QB4 A;  2VQF L;  3U50 C;  2QW7 A;  2L9H A;  1N36 L;  3B6Y A;  1F9R A;  5IYD G;  3M3Y H;  1D5X C;  3QG1 A;  3PF4 A;  4A3J G;  4R8N A;  3OW2 A;  3TDQ A;  2KOL A;  3DEO A;  1GUG A;  4B3M L;  2R7F A;  3PSI A;  1NJI C;  2JEA I;  1WCM H;  2AQ3 B;  1IXR A;  5CYU A;  3D3R A;  4LF8 L;  1J8I A;  5FKA C;  4L63 B;  3GQB A;  3MVV A;  1WTQ A;  3HOW B;  1CFM A;  4JI4 Q;  5JEA J;  5IY0 A;  1LT6 D;  5IT9 L;  4S3S A;  4A4I A;  2F0H A;  3RLO A;  1E24 A;  2HUG A;  2UXC L;  1EY0 A;  3AU7 A;  5LMN W;  2KHI A;  3GTO H;  4DV6 Q;  4DUY Q;  1QOH A;  3EN2 A;  1Y1V G;  1IBL Q;  5D65 A;  2Z4I A;  4JI6 L;  4A3G B;  4RKL A;  4XQQ A;  1FJG L;  3PO2 B;  4JOI C;  3J81 L;  1BQQ T;  2RDG A;  1KAW A;  4A3B H;  2K5V A;  4JI8 Q;  3FKI H;  1HR0 L;  1Y8P B;  4JPB W;  2HDM A;  1X65 A;  2AUJ D;  3IFT A;  3S1R B;  3DWA A;  4OON A;  1VF5 C;  2PQA B;  4LAA A;  1UE5 A;  4KN4 C;  3KYH C;  2FIN B;  3I4M B;  2K05 A;  1RF2 D;  2N3S A;  2P5Z X;  2G5D A;  4B3S Q;  3HS0 C;  2RBM A;  2E2J H;  1T5E A;  1O7Z A;  1VQF A;  2F1M A;  2QF7 A;  4IFD G;  2PI2 E;  3VR5 A;  1LT5 D;  5AJ3 L;  1E2V A;  2BA0 A;  4YCV A;  3D6C A;  4NXN L;  4OIJ A;  2H1E A;  1O80 A;  2BE5 C;  3NWS A;  4A3E H;  4QMG A;  1YHQ A;  1SFO B;  4K6L A;  1Y1V H;  3K7A H;  1VQM A;  5M9O A;  5CV5 A;  5C4Z A;  1B53 A;  3MFG A;  1Y14 B;  2Z6K C;  2VXW A;  4K5X A;  4CBV A;  1CKN A;  3CXC A;  1D1I A;  4XQJ A;  1Q81 C;  4OEL B;  3GV3 A;  3UDX A;  2IJ0 A;  5E4W C;  4DV2 Q;  1E0B A;  1VQI A;  4K8I A;  4A3J B;  1I4Q A;  4WJW A;  1X6O A;  4C3J H;  1IKM A;  1SYG A;  2IW3 A;  3V2T A;  1AE3 A;  4DXG A;  3WOE A;  3J80 i;  3T1H Q;  1S72 A;  2FHT A;  3S14 H;  2RVL A;  4UAI A;  3OSO A;  3EFX D;  3CCV A;  2B2Y C;  1FNU A;  1KNA A;  2NBF A;  3H6M A;  3F2C A;  2ICE C;  1CKO A;  2RHS B;  4YY3 L;  2KHJ A;  4ZCK A;  5DM6 3;  4I7Z C;  1GUW A;  3KUP A;  5BN3 A;  1W3S A;  3CRK C;  1I3Q B;  1UE7 A;  2CWA A;  3S1M H;  4QY7 A;  3AFQ A;  2WB1 B;  1LTG D;  4GN5 A;  1TS5 A;  4O42 A;  2FMC A;  1VQC A;  2PQE A;  1X3Q A;  1D2B A;  5KNB A;  2WAC A;  2DNC A;  1EY6 A;  2D0P A;  3PUZ A;  4H13 C;  3HKZ B;  1LAC A;  1U0L A;  3GTO B;  3M4Y A;  4RGM A;  1GUN A;  4QQB X;  1ILQ A;  2OQ0 A;  1CKM A;  4UP7 A;  3FPU B;  3NPP A;  4U68 A;  3T4A C;  3L2P A;  3SHL A;  4ULL A;  1O7I A;  5IE8 A;  3KOJ A;  2WP8 J;  1PA6 A;  1K28 A;  4B3T L;  4PV1 C;  2A68 C;  4RGT A;  1PFB A;  3BG3 A;  3V96 A;  5BR8 L;  2QEJ C;  5M3M B;  1Q8I A;  1XNR L;  4YY3 Q;  1N9W A;  5M5X H;  1SNM A;  4GOP C;  4IAL A;  1HRJ A;  4BY7 H;  2F0K A;  2K01 A;  4B9W A;  3S9W A;  4A3M G;  1YZ6 A;  4LW1 A;  4UDU C;  4A3G G;  1BF4 A;  5K36 H;  4JBW A;  2SDF A;  3A5U A;  3VA5 A;  2EY1 A;  4YCW A;  1KDA A;  4DU9 A;  3S2H B;  3FEW X;  3CCS A;  3BYY B;  1EQQ A;  1C0A A;  1FR3 A;  2F0G A;  1JWM D;  1I94 L;  4OL7 A;  1Z6H A;  5CMD A;  5E7N A;  2KEE A;  4DGZ A;  1PYB A;  3KLS A;  4ZLT F;  4NB3 A;  4BA2 I;  1GHK A;  1PH3 A;  1SRU A;  5DM7 3;  2I5H A;  3HEJ A;  4HCE A;  3K0X A;  4KD4 A;  4U67 3;  2K5W A;  3F1Z A;  2E2J B;  1EIG A;  4J8Q A;  3DUZ A;  5J39 A;  4PMB A;  4XYO A;  1SNQ A;  2GVB A;  4R4I A;  2OTL A;  1TWF B;  1EIY B;  3WDN A;  3NP8 A;  3J81 E;  2NVT B;  5IGG A;  3ZYY X;  4OXP A;  4J1M A;  1HTP A;  2FXQ A;  4AH6 A;  1EWH A;  1SEB D;  3G6E A;  1AE2 A;  2K6A A;  1OXX K;  1CA5 A;  1G51 A;  2F0O A;  4A3L G;  4EQP A;  3S1N H;  1STH A;  4B3R L;  2K1B A;  1MGS A;  2HHH Q;  1XXG A;  1VQG A;  1MIU A;  2XWB B;  3OYY A;  2Q2H A;  1R4Q B;  4K0K L;  3BS1 A;  1M1K C;  1TR5 A;  1PH5 A;  1HR0 Q;  1BCP D;  2BOS A;  3D4W A;  4C3H H;  2IT1 A;  2M00 A;  2KJX A;  3S1Q H;  4FDB A;  3BVM A;  4A3M H;  1KXL A;  1ESF A;  5LL6 S;  1JC7 A;  3S16 B;  1STA A;  1FGB D;  2QA4 A;  1QUQ A;  1H95 A;  2MQH A;  3C1F A;  3KLW A;  1IBL L;  1OXS C;  2B2V C;  1S5F D;  2K33 A;  1CK1 A;  1TKW B;  1TWC B;  2NN6 H;  1B1Z A;  1B3Q A;  1O78 A;  3A0J A;  3K5L A;  3U58 A;  1J5E Q;  1PV4 A;  4G4K A;  2XSC A;  1ICW A;  3M4Q A;  2BCO A;  4KI0 A;  1YJN A;  3D4R A;  4RG1 A;  4DNR B;  1VQE A;  1BR9 A;  4KKU A;  2K5Q A;  5CV8 A;  1M8A A;  1ICF B;  4XT1 B;  3F2U A;  5IP7 G;  1SAP A;  4RH6 A;  1T9H A;  1JQY D;  2GVA A;  3S14 B;  1VMC A;  4DV7 Q;  1WTR A;  1YI2 A;  1SE4 A;  1G8Z D;  2MNA A;  5CGK A;  1A2T A;  4ZAI A;  4DV3 Q;  4KHP L;  5M3F B;  2VQE Q;  2QIL A;  1ML0 D;  3UDI A;  1NTG A;  5IOC A;  1BCP B;  4A3L H;  2IX3 A;  4FXG C;  1XPR A;  3DHQ A;  4QIW B;  4C3H G;  2NZO A;  4BXX H;  2JA9 A;  3HG9 A;  4DR1 L;  4KV6 A;  1L0X B;  4RFB A;  2MPM A;  2EYJ A;  2ICI A;  3PO3 B;  4OWX B;  4POG A;  2L12 A;  5C44 H;  4QCL A;  1PLF A;  3BZC A;  3BDL A;  4R4O A;  4DV0 L;  1HA6 A;  2PMZ B;  2JA8 G;  2B2T A;  1GXD C;  3S24 A;  4EQO A;  4GKK L;  5IYB G;  1JT8 A;  2CW0 C;  3M4P A;  3CQZ B;  4EQN A;  2UU9 Q;  4A75 A;  2JE6 I;  4X3T A;  5LL6 X;  4C3I H;  3MEH A;  3I91 A;  3VR4 A;  5IYB H;  1VS0 A;  1QVF A;  4L8J A;  2MJ8 A;  3LNN A;  3JAM i;  4DR2 L;  4BBS G;  2A5H A;  4UY8 C;  2JJQ A;  3U9O A;  2QDL A;  3IL8 A;  3TRZ A;  1HHV A;  3KBX A;  5HY6 A;  2B2Y A;  4X62 Q;  1YJW A;  3K5M A;  1HZ9 A;  3TZU A;  3CCJ A;  3C1E A;  3J7A 5;  2PCF B;  2B2W A;  5COY A;  2B63 H;  4V19 0;  1L1O A;  1TY2 A;  1VF7 A;  1CUK A;  1CQF A;  4DR5 L;  3K7A B;  2VQE L;  5EPJ A;  1IYJ B;  1SNP A;  2RCF A;  1EWI A;  3QB3 A;  3H94 A;  1PDQ A;  2PQA A;  4BS9 A;  4ZQ3 A;  2F4V Q;  1B9N A;  3GDE A;  2R7D A;  3QR8 A;  1HA5 A;  1JCK B;  4NXM L;  2F0Q A;  2SEB D;  3J7Y W;  4OX9 Q;  5M3F G;  2DY8 A;  1DOM A;  4PNY A;  5C44 G;  1PFM A;  3A7A B;  1I50 B;  1YNJ D;  2PZW A;  1J6Q A;  1WJJ A;  5C3E G;  1EY8 A;  2EYP A;  4FVM A;  5A2Q E;  2A74 C;  2AQ2 B;  1AN8 A;  2KCN A;  4B3R Q;  1PMR A;  1VQ9 A;  3GTK H;  3MXU A;  2ZM6 L;  1ESR A;  2K04 A;  3EA6 A;  1EU3 A;  4N8X 1;  3W2D A;  4IPG A;  4LJZ C;  1YBY A;  5KEE A;  1HPC A;  1RCV D;  1N32 L;  2F52 A;  3T16 A;  3CCE A;  3RZO B;  2ZTE A;  4CKE A;  4OEM B;  1JE5 A;  2JA5 B;  1Y1W H;  3TME A;  4OGQ C;  1ROD A;  4XDX A;  4HJA A;  3SK5 A;  2I5L X;  3KF8 B;  2EYM A;  5JJZ A;  2EJG C;  4FNF A;  2VUM H;  2B2U A;  3X3N A;  1ZEQ X;  1Y1V B;  2Y0S E;  5IWA L;  2D0O A;  3X3M A;  5FLX c;  3CC2 A;  5FO7 B;  5TSS A;  1OXT A;  3K81 C;  3HP3 A;  1HH2 P;  4DNI A;  4KMU C;  3L7Z C;  5LHY 1;  1XNQ Q;  1EY7 A;  3HOU B;  3TQY A;  4N8F A;  5GRO A;  4ME5 A;  2DNE A;  1PTO D;  2QDB A;  1YEZ A;  2K4K A;  4C2M B;  1CHP D;  5FLM G;  3P75 A;  1H9R A;  4Q0F A;  2VNU D;  1PTO H;  2A69 C;  4G7H C;  2ZJR A;  3GTJ H;  1D7Q A;  1LTS D;  3MAQ A;  1LV9 A;  4XQN A;  4XTC S;  4DR7 L;  2F0P A;  4A3E G;  3L0O A;  4LF4 L;  1HZB A;  1KAB A;  1KLG D;  4BA1 I;  3CPF A;  3DEP A;  3T53 B;  1SBB B;  3KF6 A;  3SK4 A;  3TS0 A;  3FMC A;  4AQY Q;  5JVH 3;  4GS3 A;  4DR4 Q;  4A3B B;  2NVQ B;  1C4Q A;  3HOV G;  1Y1W G;  4C3I G;  1SXT A;  1CHQ D;  1K83 H;  3D4D A;  1HNW Q;  3QO2 A;  2KHS A;  3BU2 A;  4X64 L;  4K0K Q;  4PZ7 A;  4IJL A;  1PH4 A;  1DCZ A;  4OO1 H;  2JP1 A;  2HD3 A;  1VQN A;  4XXE A;  1A63 A;  5JPN C;  3T1Y Q;  4IOC A;  4A76 A;  1AEX A;  3F8T A;  2F0W A;  3CC7 A;  1WTV A;  3W1G A;  1S5C D;  3EVQ A;  5HGQ A;  2EJM A;  4PQX A;  1Q1B A;  1ENF A;  4K2K A;  3ERO A;  3KK7 A;  4IOA A;  1Q12 A;  4PZ6 A;  4P2C B;  3TBI B;  3ND9 A;  2EVB A;  1N33 L;  3CU7 A;  1IL8 A;  1NE3 A;  3R93 A;  2I5M X;  3TP7 A;  5M5W B;  2R92 B;  4APV A;  1I6H B;  1RL2 A;  4IPC A;  4KY6 A;  1DOK A;  1SYE A;  3G6J B;  4IPD A;  4JBM A;  3OWF A;  1B9M A;  1WI5 A;  1PTO C;  2KA7 A;  5C5L A;  5IGD A;  2K32 A;  2IX0 A;  4C1N K;  1II3 A;  2PI2 A;  3I4N H;  1NMG A;  1TWF H;  1Y8N B;  4KTA A;  5IGE A;  2WAQ B;  2EYL A;  3HRZ C;  3UE1 A;  1DOL A;  1GUT A;  3W1B A;  5JVG 3;  5LMN Q;  1QVG A;  2F0T A;  1E7Z A;  3I4N G;  2UXC Q;  3K57 A;  4IPH A;  4GKJ Q;  4HIM A;  5AFW A;  4DV6 L;  4LF4 Q;  4QF4 A;  1STG A;  4DR2 Q;  1F77 A;  2EZV A;  1UEA B;  1XNR Q;  1G2T A;  1WTX A;  3PUY A;  1EY5 A;  2HQL A;  2PNR C;  1EUJ A;  2F0M A;  1LTR D;  2DY7 A;  4IUT A;  4A3I H;  3MZ5 A;  2K28 A;  2QCP X;  1EYD A;  4GNX A;  2Y0S B;  2RDH A;  1HQR D;  5E3F A;  4CGY B;  1SE8 A;  1PTO F;  3D31 A;  3IAY A;  2UUB Q;  2ZXO A;  5C5M A;  1PH9 A;  3UDF A;  1KDC A;  5C0X H;  1IL2 A;  1HNZ L;  4A3F B;  1QIL A;  3EBE A;  2YU9 H;  4BBR G;  1X55 A;  1QVC A;  3GTL H;  1K9M C;  2XRQ D;  2KCM A;  1XMO Q;  1HCZ A;  3K7U C;  5ELE A;  4DR1 Q;  1YIT A;  2G9H D;  3H3V H;  3MFY A;  1QE6 A;  1D5Z C;  2PW7 A;  2VZA A;  5DEH A;  3NTK A;  2R93 H;  2O4X A;  5M5Y B;  4DFA A;  1B3A A;  2ES2 A;  4G7Z C;  2A6H D;  1STN A;  2A6H C;  1SYD A;  2VQF Q;  4LFB Q;  1G2S A;  1V1P B;  2NVY H;  3E0E A;  4IJH A;  5EPL A;  4O2D A;  3CHB D;  4JG2 A;  1RHP A;  3P1H A;  1D5M C;  4DR6 Q;  4MN3 A;  4PMW A;  2OTJ A;  2OF1 A;  3HOZ B;  1C7Y A;  3GTP B;  1CM9 A;  2L5T A;  3T1H L;  3NBH A;  3CRL C;  1G91 A;  1GOZ A;  1GVP A;  5IGB A;  1AP0 A;  5HUR A;  4A3I G;  4HSP A;  4GLX A;  2KCT A;  1C8C A;  2IY5 B;  2EXD A;  2CQO A;  3CQZ H;  2JQO A;  3OW7 A;  3PIO A;  4QL5 A;  2SNS A;  2KBN A;  5KND A;  3SK6 A;  1PTO B;  2K7V A;  3I56 A;  1HFN A;  3VR2 A;  1H9K A;  4KHZ A;  4IUV A;  5FO8 B;  1TII D;  2JEB I;  2MFI A;  5KIX A;  5FJ8 G;  3IRB A;  4ZUJ A;  1VQ4 A;  3M7N A;  2EY2 A;  1FL0 A;  3K0Y A;  4BBR H;  3RNU A;  4HJ5 A;  2MO1 A;  2N55 A;  2RSN A;  4MNO A;  3MA2 B;  4ALP A;  1FYC A;  2D9U A;  3H3V C;  2WII B;  1BUV T;  4F87 A;  4KK7 A;  4HR7 B;  2KQ3 A;  5I6W A;  3UE0 A;  2PMZ E;  3A55 A;  1UE6 A;  2BDO A;  3I55 A;  3HZX A;  5C4J B;  1RDP D;  3N6R A;  1B8A A;  1H9S A;  4KY5 A;  5M5X B;  3J81 j;  4CKB A;  1HTL D;  1BCP F;  3GTL B;  3SDZ A;  1SJH D;  3NTH A;  1ASY A;  4MIU A;  1SRO A;  4DR3 L;  1ZKO A;  1TWC H;  3MEF A;  5J1Z A;  1NMF A;  2VL6 A;  1MD2 D;  1N34 L;  2NVT H;  2HQE A;  3U9S A;  2CW0 D;  1PVO A;  3Q0A A;  4HID A;  1DON A;  1WOC A;  4FXK C;  4DUZ L;  2Q2U A;  5C44 B;  4L5R C;  4JI7 Q;  4XYQ A;  4RGN A;  1HNZ Q;  1M4V A;  5CBE E;  4A3E B;  4K6D A;  5LMU L;  2JA7 B;  1K83 B;  4P73 A;  3JAM c;  1ILP A;  1YNN C;  2XGT A;  3Q6S A;  2NZ1 D;  1XYI A;  1S5E D;  4LNQ A;  4ZRZ A;  2Z6K A;  2Q8I B;  1A6X A;  4KN7 C;  1A2U A;  5JPM C;  1XMQ L;  4N9T A;  4P71 A;  3FDT A;  1LT4 D;  5FO9 B;  1T5X D;  4YWM A;  5JOB A;  5FJ8 H;  3L3O C;  1TWH B;  4P75 A;  3STB D;  3RN5 A;  3Q24 A;  1SNC A;  5M3M G;  1YJ9 A;  1SDF A;  2XNA C;  3LX0 A;  4AIM A;  1X3E A;  1PH8 A;  1STB A;  2JA5 H;  1JWS D;  4NMZ A;  1PRT C;  5IGC A;  2EY5 A;  3MHB A;  4FXD A;  3FKI B;  4FF2 A;  2M9V A;  4DUZ Q;  5JAV A;  4IFD J;  2G9D A;  1NY4 A;  3KLS X;  2BA1 A;  1KTK A;  2WB1 G;  1F2M A;  2EIF A;  2F03 A;  1CT1 D;  1DGS A;  1NR4 A;  5KYI A;  2CHB D;  4NW2 A;  1PYS B;  3H0G B;  4CDC C;  3J80 L;  2R92 G;  1TS4 A;  2LMC B;  4DV3 L;  3HKZ E;  2JXM B;  1CSP A;  5K36 G;  4JYA Q;  1UAP A;  3F2D A;  4ZYS A;  3AEV A;  3S2D H;  1CZW A;  1IW7 D;  2N78 A;  1V1P A;  2N8N A;  3H09 A;  2NWG A;  4CHT B;  4JI0 L;  5JEA H;  2AMC B;  1R9T B;  2EJF C;  1ET6 A;  2V1C C;  2C35 B;  3ONA B;  1PFN A;  2NVQ H;  4LFC Q;  4UP9 A;  2DN8 A;  2F3I A;  4L5T A;  3BDC A;  1U4P A;  1EWC A;  4IUQ A;  1SE3 A;  1K8G A;  1EYA A;  1TS2 A;  4R4T A;  5I2Y A;  1EYG A;  2F0S A;  4B08 A;  1XJV A;  1K8O A;  4YWL A;  1PZI D;  4GZY C;  4RGO S;  3CF5 A;  1I94 Q;  2TSS A;  5IYD H;  1TS3 A;  3VYU A;  3NEM A;  4F88 A;  3HOX H;  2L1B A;  3CCL A;  4JI6 Q;  2YYZ A;  4KHP Q;  2L11 A;  4JI2 L;  4GN4 B;  4POF A;  2EYF A;  1H9J A;  3MXP A;  4DXF A;  5CR3 A;  2EDG A;  1SYC A;  3A8J E;  2JA7 G;  2DGY A;  3J7A F;  4X62 L;  3I4N B;  2WKC A;  2F0V A;  2CCZ A;  4NXN Q;  2JA7 H;  2PZT A;  5COR A;  4DAP A;  4BWG B;  2M2L A;  1NUC A;  4K5V A;  3G7L A;  3S16 H;  3OMG A;  1A8V A;  3LGJ A;  5EGT A;  5I4D A;  2VUM B;  2E74 C;  3NQI A;  3I2Z A;  1J5E L;  4OWW B;  2XIW A;  1S3O A;  1PHJ A;  2Q8T A;  4L5S A;  5EKI A;  3NWT A;  5IWA Q;  2Q2T A;  3J80 E;  1E2W A;  2FMM A;  3F2B A;  1N8R C;  2HT1 A;  2DJG C;  3EQL C;  3N52 A;  1X32 A;  5FOB B;  4JI1 Q;  4X64 Q;  3RD4 A;  1CQV A;  2A6E C;  4A3J H;  1STE A;  4PMC A;  2ZTD A;  4KHV A;  1VCI A;  2CVR A;  4OO1 G;  2NVY B;  5GAE C;  4BY1 G;  1HUN A;  4DV4 Q;  2IPK D;  2YV5 A;  2RA4 A;  3P7J A;  3V05 A;  1I6V C;  2X6G A;  2A69 D;  2Z9H A;  3G48 A;  2UUA L;  1U9R A;  3PO2 H;  1QZH A;  2WAQ E;  1YNN D;  4RMF A;  1JOQ A;  2EOT A;  1Z47 A;  3HOY H;  3RZD B;  4JC0 A;  1G6Z A;  1HZC A;  5E1F A;  4HIO A;  2PYK A;  2OEO A;  2Z1C A;  3ND8 A;  2HDL A;  5EBD A;  4GOP A;  1NNX A;  1IW7 C;  1ZXT A;  2AHO B;  1GO3 E;  4ZUI A;  1U4M A;  1LTB D;  2VB2 X;  4X65 Q;  5C3X A;  4GLA C;  2J0T D;  4BY7 B;  4CDD C;  1K8M A;  4DV4 L;  1I6H H;  4L6T B;  2JN4 A;  4A3K H;  1I5F A;  2A73 B;  4NDX A;  3AMU A;  3J81 c;  1EOV A;  1WCM B;  2OT2 A;  4C3J G;  4DK6 C;  1YVC A;  5C0X J;  4IQZ A;  1EQT A;  3TEH B;  3GTG B;  2HHH L;  1EEI D;  1HUM A;  1BBU A;  3R2I A;  4LF7 Q;  1EIH A;  1GD7 A;  2AUK A;  2ZT9 C;  1D8L A;  2L55 A;  2O5I C;  2CWP A;  3PIP A;  1UE1 A;  1PYW D;  5K5P A;  5AJ3 Q;  4HAE A;  1EY4 A;  2AWO A;  4Y52 H;  4DK3 C;  2VUM G;  3K8A A;  2ZXP A;  1Q46 A;  2NB0 A;  2TMP A;  1JR0 D; 
#chains in the Genus database with same CATH homology
 4TQU S;  2LFN A;  5ELC A;  1CZG A;  4KY7 A;  3M7G A;  1B50 A;  5E4X A;  2NTT A;  5CBA E;  2R7Z B;  3DXJ C;  4RHS A;  2KED A;  2LS0 1;  1Y8O B;  2OXP A;  4DF7 A;  1TQO A;  5I6Y A;  3DWP A;  1RKN A;  2F0I A;  2SNM A;  5ELF A;  3H91 A;  3FVQ A;  1W6J A;  1WVL A;  4TSS A;  4K5W A;  2RSO A;  1CA6 A;  4G57 A;  3S1Q B;  4EVO A;  4A93 B;  4OO1 I;  1SNO A;  1RTO A;  1ONL A;  4IUP A;  3I8Z A;  5CV6 A;  4I65 A;  4DNT B;  4DK1 A;  3O13 A;  2O2L D;  1BOS A;  3SEB A;  3S1N B;  3FRP B;  2KEC A;  5IT9 E;  2XWJ B;  3NTI A;  1V43 A;  5EJW A;  1L0Y B;  1KNE A;  1QB5 D;  1SND A;  2RKS A;  3GP7 A;  1TT2 A;  1G29 1;  1WTP A;  1U4R A;  3JAM L;  1VDZ A;  1DXM A;  2BDN A;  4RHR A;  5KRU A;  2E76 C;  1MSH A;  2K5D A;  2L0C A;  3HOX B;  3S17 B;  4TKO B;  1EL0 A;  1PZK D;  2R93 B;  1AZP A;  5D3D A;  4DA2 A;  1S5D D;  2GA4 B;  3A8I E;  3GTJ B;  3ITP A;  1EYC A;  3C46 A;  3BZD B;  4Q5V A;  3R2T A;  4M8A A;  3PIP 3;  1TVX A;  3I90 A;  4IFD H;  1O7L A;  3M4O B;  4CKC A;  3JAM E;  4JK1 C;  1UNS A;  3K58 A;  5CV4 A;  4ZKC B;  1IYU A;  2O5J C;  4H0L C;  4K8J A;  1EOT A;  4X3S A;  1STY A;  4FF4 A;  1Z7T A;  3C2P A;  5A35 A;  2KUM A;  2HCI A;  1QNU A;  3SE0 A;  1R4P B;  5A2Q L;  4WFN 3;  3K5N A;  1AW7 A;  4G7O C;  4CJ0 B;  1PRT B;  4KKT A;  2MHV A;  1DM0 B;  1A3T A;  4FP5 D;  2D62 A;  2E2I B;  2F0D A;  2C9O A;  2F0L A;  3A8K E;  4RWS C;  4KKS A;  1DZ1 A;  1D6E C;  2EE1 A;  2EPB A;  1LLR D;  2F3W A;  1UUP A;  4C3H B;  5KYL A;  2B2U C;  3TP6 A;  5NUC A;  1WD0 A;  1TY0 A;  1QCB D;  1B44 D;  4HMJ A;  2B2W C;  1F2Z A;  4DAY A;  3I72 A;  3K6O A;  3WOF A;  1TWG B;  3HGB A;  1RTN A;  1WD1 A;  5C0X I;  2YU9 B;  1GUO A;  1DJR D;  1LT3 D;  3SR1 A;  3OOC A;  3BVZ A;  4FF1 A;  1H9M A;  1LTI D;  3PMF A;  3VYT A;  4F8M A;  5I9O A;  3M85 A;  1JB3 A;  4DAV A;  2A6E D;  3M3Y B;  3RUZ A;  2F0U A;  2HCC A;  3KLR A;  1S5B D;  5KGU A;  1F9Q A;  5EKK A;  2I46 A;  4DN4 M;  3BVG A;  2IL8 A;  3NK9 A;  3VR3 A;  2MP1 A;  1FD7 D;  2QKI C;  4HED A;  4QUF A;  4WRD A;  1GJX A;  1O7Y A;  4KJN A;  3A7L A;  1C48 A;  3GV6 A;  2PW5 A;  2B8G A;  3HOV B;  3KF8 A;  4ID6 A;  5ISR A;  1JWU D;  3BYT B;  1MI2 A;  2XVS A;  4A3I B;  3ERQ A;  3I70 A;  4C56 C;  3OHX C;  1QWY A;  1ZYR C;  1ZYR D;  5BN4 A;  1SYF A;  4OHJ A;  3GO5 A;  1KAA A;  2F0N A;  4FF3 A;  2R6G A;  1S4Z A;  3OMC A;  3QWN A;  4RCO A;  3D6W A;  1Y1W B;  4RCN A;  3SK8 A;  2IX1 A;  1SMY C;  1E2Z A;  5CC4 A;  5IIF A;  3K5O A;  4BY1 B;  3SVM A;  1BCP C;  4V0B A;  3UI2 A;  1CTM A;  1JOO A;  3DM1 A;  3NXW A;  1J9O A;  4YIJ A;  1AZQ A;  4WOR A;  2BE5 D;  5ELB A;  3S1M B;  1A3V A;  3NSW A;  2Z8L A;  4M1U B;  2Z4H A;  1B2T A;  2IWH A;  3SXH A;  1EQV A;  2LKV A;  3GTM B;  1V1O A;  1WTO A;  4NKL A;  4B9X A;  3E0J A;  3NBI A;  3AB9 A;  3PUV A;  2NYZ D;  3RLF A;  2JA6 B;  1ENC A;  4CJ2 C;  4AYB B;  3QOL A;  5CV7 A;  2F0J A;  1Q3L A;  5FK9 C;  5DAU A;  4RAU C;  2XN9 C;  3Q22 A;  2F3V A;  5D3I B;  2L4N A;  5JEA G;  4E6I A;  4A3D B;  4XT3 B;  4ZK9 B;  1NAP A;  2NUC A;  3I3C A;  2PZU A;  2NVX B;  1IYV A;  3T51 B;  4HCS A;  3P20 A;  3URY A;  5C0X G;  2KCC A;  5FLX E;  4J6H A;  1NR2 A;  3MTS A;  1NCV A;  1GUS A;  1LAB A;  1LTT D;  3HOY B;  3QJY A;  1XX8 A;  3R8B A;  5BN5 A;  2PPB C;  3TN2 A;  1DD2 A;  3MXN A;  1SE2 A;  1EFI D;  3QOJ A;  3S15 B;  1FNV A;  1JIC A;  3R3O A;  3EJI A;  2C5C A;  3MC0 B;  3BDO A;  1JE4 A;  3I4L A;  1SJE D;  2VB3 X;  3IFD A;  2RQX A;  4XIG S;  1U4L A;  1IKL A;  3FPP A;  2MUY A;  5T1G A;  1NSN S;  2EYO A;  2CQA A;  2B2V A;  4IUN A;  3S2D B;  4OIK A;  5EBC A;  1OO9 B;  5C6A A;  3MWY W;  1HXY D;  4K14 A;  1A15 A;  1PXU A;  1A3U A;  3T56 B;  5C4X B;  3VA7 A;  2B8F A;  1EZ6 A;  3A54 A;  1I4H A;  3NE5 B;  2I07 B;  2V4D A;  1QNK A;  5DNF A;  2AQ1 B;  4O1N A;  2B63 B;  3OPO A;  4H7B A;  1WTW A;  3E5S A;  2NTS A;  2XRS D;  1XTC D;  2A68 D;  4Z9C B;  3E6Z X;  5F2D A;  2B2T C;  2FFK B;  3A56 A;  1I4P A;  4Y7N B;  1I4G A;  4LK1 C;  4C3J B;  3I73 A;  4C3I B;  3GD7 A;  3KBG A;  2R61 A;  1B4O A;  2AWN A;  2D2C C;  1SSO A;  3CKI B;  3W3A A;  4IN3 A;  4DK0 A;  4HMI A;  1JOK A;  1YNJ C;  1H9S B;  4A3M B;  4HN7 A;  2NN6 G;  4BBR B;  3NUC A;  2E75 C;  5ELD A;  3TP5 A;  3C3L A;  1PZJ D;  2ZXR A;  4LMQ D;  4IFD I;  1ENA A;  2F4I A;  2KVM A;  4ABN A;  2E2D C;  4IUU A;  3PV0 A;  2FJ2 A;  1HQM C;  2LY7 A;  3VYR A;  2NN6 I;  4IUR A;  5G3L D;  1OXU A;  1TU2 B;  5CV9 A;  2RDF A;  1EY9 A;  4CJ1 B;  1TWA B;  1BDO A;  1BBX C;  1EU4 A;  1QG7 A;  1LO5 D;  3DWQ A;  1XWE A;  3QIA A;  1D1K A;  2X6L A;  2JSO A;  5T1I A;  2JYO A;  4X3U A;  5C4H A;  3MXG A;  4ODG A;  2K03 A;  4RKB A;  2EXZ A;  2F0F A;  4KD3 A;  1QJO A;  2WKD A;  5D14 A;  1IHZ A;  2MGS A;  1HFG A;  3TSS A;  1LTA D;  3DMU A;  2J4X A;  5C3W A;  3NQT A;  3PUW A;  1FNW A;  1BXT A;  1GHJ A;  4FO2 A;  2JA8 B;  1MBY A;  5KNC A;  1CI3 M;  1PRT F;  1Y69 U;  4ILW A;  5EPK A;  5EQ0 A;  5G3L F;  3LWU A;  3OWE B;  4FYD A;  4ZKB B;  5J22 A;  5HGT A;  3K59 A;  3L9A X;  4BBS B;  5IOD A;  4EGV A;  2B39 A;  2H4O A;  4KJO A;  5IGF A;  5I2X A;  4NP5 A;  2PO4 A;  1EZ8 A;  3VYS A;  3OIQ A;  1F2Y A;  3NHH A;  3VR6 A;  3GTK B;  1F2L A;  3RMH A;  1X3P A;  4K2L A;  4TRD A;  4F7X A;  2X69 A;  3PUX A;  2N88 A;  4IZ8 A;  1Q90 A;  2J7Z A;  1I4X A;  2ID0 A;  3D8G A;  2WV6 D;  1DYQ A;  3IKJ A;  1V8Q A;  1OXV A;  2EY6 A;  1SYB A;  1Q1E A;  1AFP A;  1MSG A;  4RA8 A;  1PRT D;  4X3K A;  5I9P A;  1JOR A;  4A3K B;  4QUC A;  4HTH A;  2WIN B;  1RJT A;  2ENB A;  1F9P A;  2EYH A;  2Q8R E;  4R9W A;  3T13 A;  1I4R A;  3Q23 A;  5C3E B;  1W6K A;  4H44 C;  1ET9 A;  1EEF D;  4MHE A;  3LWE A;  4C1N I;  3TP8 A;  1BO0 A;  1SMY D;  2SOB A;  1VMP A;  2F0E A;  3J7A V;  1KLU D;  1F9S A;  5FLX L;  3OIP A;  3TZD A;  2E2H B;  2D5D A;  4HSV A;  3PIO 3;  3GTQ B;  1KDB A;  2R3Z A;  4N9P A;  5EKL A;  1RD9 D;  1BNZ A;  4R8I A;  4QB4 A;  2L9H A;  1F9R A;  1D5X C;  3QG1 A;  4R8N A;  3TDQ A;  2KOL A;  3DEO A;  1GUG A;  2JEA I;  2AQ3 B;  5CYU A;  3D3R A;  1J8I A;  5FKA C;  4L63 B;  3GQB A;  3MVV A;  1WTQ A;  3HOW B;  1CFM A;  5JEA J;  1LT6 D;  5IT9 L;  4S3S A;  2F0H A;  2HUG A;  1EY0 A;  3AU7 A;  1QOH A;  5D65 A;  2Z4I A;  4A3G B;  4RKL A;  4XQQ A;  3PO2 B;  3J81 L;  1BQQ T;  2RDG A;  1Y8P B;  2HDM A;  2AUJ D;  3IFT A;  3S1R B;  3DWA A;  1VF5 C;  4LAA A;  4KN4 C;  3I4M B;  2FIN B;  2K05 A;  1RF2 D;  3HS0 C;  2RBM A;  1T5E A;  1O7Z A;  2F1M A;  2QF7 A;  4IFD G;  3VR5 A;  1LT5 D;  1E2V A;  2BA0 A;  3D6C A;  4OIJ A;  2H1E A;  1O80 A;  2BE5 C;  3NWS A;  4QMG A;  1SFO B;  4K6L A;  5M9O A;  5CV5 A;  5C4Z A;  1B53 A;  3MFG A;  2VXW A;  4K5X A;  4CBV A;  1D1I A;  4XQJ A;  3GV3 A;  2IJ0 A;  5E4W C;  1E0B A;  4K8I A;  4A3J B;  1I4Q A;  4WJW A;  1IKM A;  1SYG A;  2IW3 A;  3V2T A;  4DXG A;  3WOE A;  2FHT A;  2RVL A;  4UAI A;  3OSO A;  3EFX D;  2B2Y C;  1FNU A;  1KNA A;  2NBF A;  3H6M A;  2ICE C;  5DM6 3;  4I7Z C;  1GUW A;  3KUP A;  5BN3 A;  3CRK C;  1I3Q B;  2WB1 B;  1LTG D;  1TS5 A;  4O42 A;  2FMC A;  2PQE A;  1X3Q A;  1D2B A;  5KNB A;  2WAC A;  2DNC A;  1EY6 A;  3PUZ A;  4H13 C;  3HKZ B;  1LAC A;  3GTO B;  3M4Y A;  4RGM A;  1GUN A;  1ILQ A;  3FPU B;  3NPP A;  4U68 A;  3T4A C;  3SHL A;  4ULL A;  2WP8 J;  4PV1 C;  2A68 C;  4RGT A;  1PFB A;  3BG3 A;  3V96 A;  2QEJ C;  5M3M B;  1Q8I A;  1SNM A;  4IAL A;  1HRJ A;  2F0K A;  2K01 A;  4B9W A;  3S9W A;  4UDU C;  1BF4 A;  5K36 H;  4JBW A;  2SDF A;  3VA5 A;  2EY1 A;  1KDA A;  4DU9 A;  3S2H B;  3FEW X;  3BYY B;  1FR3 A;  2F0G A;  1JWM D;  4OL7 A;  1Z6H A;  5CMD A;  2KEE A;  4DGZ A;  3KLS A;  4ZLT F;  4BA2 I;  1GHK A;  5DM7 3;  3HEJ A;  4HCE A;  4U67 3;  4KD4 A;  2K5W A;  2E2J B;  1EIG A;  4J8Q A;  3DUZ A;  5J39 A;  4PMB A;  4XYO A;  1SNQ A;  1TWF B;  3WDN A;  3NP8 A;  3J81 E;  2NVT B;  5IGG A;  3ZYY X;  4J1M A;  1HTP A;  1EWH A;  1SEB D;  2K6A A;  1OXX K;  1CA5 A;  2F0O A;  4EQP A;  1STH A;  2K1B A;  1MGS A;  1XXG A;  2XWB B;  1R4Q B;  3BS1 A;  1TR5 A;  1BCP D;  2BOS A;  3D4W A;  2IT1 A;  2M00 A;  2KJX A;  3BVM A;  1ESF A;  5LL6 S;  1JC7 A;  3S16 B;  1STA A;  1FGB D;  3C1F A;  1OXS C;  2B2V C;  1S5F D;  2K33 A;  1CK1 A;  1TKW B;  1TWC B;  2NN6 H;  1B1Z A;  3K5L A;  1O78 A;  4G4K A;  2XSC A;  1ICW A;  2BCO A;  4KI0 A;  3D4R A;  4DNR B;  1BR9 A;  4KKU A;  2K5Q A;  5CV8 A;  1M8A A;  4XT1 B;  3F2U A;  1SAP A;  4RH6 A;  1JQY D;  3S14 B;  1VMC A;  1WTR A;  1SE4 A;  1G8Z D;  5CGK A;  1A2T A;  4ZAI A;  5M3F B;  2QIL A;  1ML0 D;  5IOC A;  1BCP B;  2IX3 A;  4FXG C;  3DHQ A;  4QIW B;  4C3H G;  3HG9 A;  4KV6 A;  1L0X B;  4RFB A;  2MPM A;  2EYJ A;  2ICI A;  3PO3 B;  2L12 A;  4QCL A;  1PLF A;  3BDL A;  1HA6 A;  2PMZ B;  2B2T A;  1GXD C;  4EQO A;  2CW0 C;  3CQZ B;  4EQN A;  2JE6 I;  4X3T A;  5LL6 X;  3MEH A;  3I91 A;  3VR4 A;  4L8J A;  2MJ8 A;  3LNN A;  2A5H A;  3U9O A;  3IL8 A;  1HHV A;  3KBX A;  2B2Y A;  3K5M A;  3TZU A;  3C1E A;  2PCF B;  2B2W A;  5COY A;  4V19 0;  1TY2 A;  1VF7 A;  1CQF A;  3K7A B;  5EPJ A;  1SNP A;  3QB3 A;  3H94 A;  1PDQ A;  4BS9 A;  4ZQ3 A;  1B9N A;  1HA5 A;  1JCK B;  2F0Q A;  3J7Y W;  2SEB D;  2DY8 A;  1DOM A;  4PNY A;  1PFM A;  3A7A B;  1I50 B;  1YNJ D;  2PZW A;  1EY8 A;  2EYP A;  4FVM A;  5A2Q E;  2A74 C;  2AQ2 B;  1AN8 A;  2KCN A;  1PMR A;  3MXU A;  1ESR A;  2K04 A;  3EA6 A;  1EU3 A;  3W2D A;  4LJZ C;  5KEE A;  1HPC A;  1RCV D;  3T16 A;  3RZO B;  4CKE A;  2JA5 B;  3TME A;  4OGQ C;  1ROD A;  4XDX A;  3SK5 A;  2EYM A;  5JJZ A;  2EJG C;  4FNF A;  2B2U A;  3X3N A;  1ZEQ X;  1Y1V B;  3X3M A;  5FO7 B;  5TSS A;  1OXT A;  3HP3 A;  4KMU C;  3L7Z C;  5LHY 1;  1EY7 A;  3HOU B;  4ME5 A;  2DNE A;  1PTO D;  2QDB A;  4C2M B;  1CHP D;  3P75 A;  1H9R A;  4Q0F A;  2VNU D;  1PTO H;  2A69 C;  4G7H C;  1LTS D;  3MAQ A;  1LV9 A;  4XQN A;  4XTC S;  2F0P A;  1KAB A;  1KLG D;  4BA1 I;  3DEP A;  3T53 B;  1SBB B;  3SK4 A;  3FMC A;  5JVH 3;  4A3B B;  2NVQ B;  1C4Q A;  4C3I G;  1SXT A;  1CHQ D;  3D4D A;  3QO2 A;  2KHS A;  1DCZ A;  4OO1 H;  2JP1 A;  4XXE A;  5JPN C;  1AEX A;  2F0W A;  1WTV A;  1S5C D;  3EVQ A;  2EJM A;  4PQX A;  1Q1B A;  1ENF A;  4K2K A;  3ERO A;  3KK7 A;  1Q12 A;  4P2C B;  3TBI B;  3ND9 A;  2EVB A;  3CU7 A;  1IL8 A;  3R93 A;  3TP7 A;  5M5W B;  2R92 B;  1I6H B;  4KY6 A;  1DOK A;  1SYE A;  3G6J B;  3OWF A;  1B9M A;  1PTO C;  2KA7 A;  5C5L A;  5IGD A;  2K32 A;  2IX0 A;  4C1N K;  1II3 A;  1Y8N B;  5IGE A;  4KTA A;  2WAQ B;  2EYL A;  3HRZ C;  1DOL A;  1GUT A;  5JVG 3;  2F0T A;  3K57 A;  5AFW A;  4QF4 A;  1STG A;  1F77 A;  2EZV A;  1UEA B;  1G2T A;  1WTX A;  3PUY A;  1EY5 A;  2PNR C;  2F0M A;  1LTR D;  2DY7 A;  4IUT A;  3MZ5 A;  2K28 A;  2QCP X;  1EYD A;  2Y0S B;  2RDH A;  1HQR D;  5E3F A;  4CGY B;  1PTO F;  3D31 A;  3IAY A;  2ZXO A;  5C5M A;  1KDC A;  5C0X H;  4A3F B;  1QIL A;  2XRQ D;  1HCZ A;  5ELE A;  2G9H D;  3MFY A;  1QE6 A;  1D5Z C;  2PW7 A;  5DEH A;  3NTK A;  2O4X A;  5M5Y B;  4DFA A;  1B3A A;  4G7Z C;  2A6H D;  1STN A;  2A6H C;  1SYD A;  1G2S A;  1V1P B;  5EPL A;  3CHB D;  1RHP A;  3P1H A;  1D5M C;  4MN3 A;  4PMW A;  2OF1 A;  3HOZ B;  3GTP B;  1CM9 A;  2L5T A;  3NBH A;  3CRL C;  1G91 A;  1GOZ A;  5IGB A;  1AP0 A;  5HUR A;  4HSP A;  1C8C A;  3OW7 A;  2SNS A;  5KND A;  3SK6 A;  1PTO B;  2K7V A;  1HFN A;  3VR2 A;  1H9K A;  4KHZ A;  4IUV A;  5FO8 B;  1TII D;  2JEB I;  5KIX A;  4ZUJ A;  3M7N A;  2EY2 A;  3K0Y A;  2N55 A;  2RSN A;  3MA2 B;  1FYC A;  2D9U A;  3H3V C;  2WII B;  1BUV T;  4F87 A;  4KK7 A;  4HR7 B;  2KQ3 A;  5I6W A;  3A55 A;  2BDO A;  3HZX A;  5C4J B;  1RDP D;  3N6R A;  1H9S A;  4KY5 A;  5M5X B;  4CKB A;  1HTL D;  1BCP F;  3GTL B;  3SDZ A;  1SJH D;  3NTH A;  4MIU A;  1ZKO A;  5J1Z A;  1MD2 D;  2HQE A;  3U9S A;  2CW0 D;  1DON A;  3Q0A A;  4FXK C;  5C44 B;  4XYQ A;  4RGN A;  1M4V A;  5CBE E;  4A3E B;  4K6D A;  2JA7 B;  1K83 B;  1ILP A;  1YNN C;  3Q6S A;  2NZ1 D;  1XYI A;  1S5E D;  4ZRZ A;  1A6X A;  2Q8I B;  4KN7 C;  1A2U A;  5JPM C;  4N9T A;  3FDT A;  1LT4 D;  5FO9 B;  1T5X D;  5JOB A;  3L3O C;  1TWH B;  3Q24 A;  1SNC A;  1SDF A;  2XNA C;  3LX0 A;  1STB A;  1JWS D;  4NMZ A;  1PRT C;  5IGC A;  2EY5 A;  3MHB A;  4FXD A;  3FKI B;  4FF2 A;  2M9V A;  5JAV A;  4IFD J;  2G9D A;  3KLS X;  2BA1 A;  1KTK A;  1F2M A;  2F03 A;  1CT1 D;  1NR4 A;  5KYI A;  2CHB D;  4NW2 A;  3H0G B;  3J80 L;  1TS4 A;  2LMC B;  2JXM B;  5K36 G;  1UAP A;  4ZYS A;  1CZW A;  1IW7 D;  1V1P A;  3H09 A;  2NWG A;  4CHT B;  5JEA H;  1R9T B;  2EJF C;  1ET6 A;  3ONA B;  1PFN A;  2DN8 A;  3BDC A;  1U4P A;  1EWC A;  4IUQ A;  1SE3 A;  1EYA A;  1TS2 A;  5I2Y A;  2F0S A;  4B08 A;  1K8O A;  1PZI D;  4GZY C;  4RGO S;  2TSS A;  1TS3 A;  3VYU A;  4F88 A;  2L1B A;  2YYZ A;  2L11 A;  2EYF A;  1H9J A;  3MXP A;  4DXF A;  5CR3 A;  2EDG A;  1SYC A;  3A8J E;  3J7A F;  3I4N B;  2WKC A;  2F0V A;  2PZT A;  5COR A;  4DAP A;  4BWG B;  2M2L A;  1NUC A;  3G7L A;  4K5V A;  3OMG A;  5EGT A;  5I4D A;  2VUM B;  2E74 C;  3NQI A;  2XIW A;  2Q8T A;  5EKI A;  3NWT A;  3J80 E;  1E2W A;  2FMM A;  3EQL C;  3N52 A;  1X32 A;  5FOB B;  3RD4 A;  1CQV A;  2A6E C;  1STE A;  4PMC A;  4KHV A;  1VCI A;  2CVR A;  4OO1 G;  2NVY B;  1HUN A;  2IPK D;  2RA4 A;  3P7J A;  3V05 A;  1I6V C;  2X6G A;  2A69 D;  1U9R A;  1YNN D;  1JOQ A;  2EOT A;  1Z47 A;  3RZD B;  1G6Z A;  5E1F A;  2PYK A;  2OEO A;  2Z1C A;  3ND8 A;  2HDL A;  5EBD A;  1IW7 C;  1ZXT A;  4ZUI A;  1U4M A;  1LTB D;  2VB2 X;  5C3X A;  2J0T D;  4BY7 B;  1K8M A;  4L6T B;  2A73 B;  4NDX A;  3AMU A;  1WCM B;  4C3J G;  2OT2 A;  5C0X J;  4IQZ A;  1EQT A;  3GTG B;  1EEI D;  1HUM A;  3R2I A;  1EIH A;  2AUK A;  2ZT9 C;  2L55 A;  2O5I C;  1PYW D;  5K5P A;  4HAE A;  1EY4 A;  2AWO A;  2ZXP A;  2NB0 A;  2TMP A;  1JR0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...