1QJPA

High resolution structure of the outer membrane protein a (ompa) transmembrane domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
171
structure length
137
Chain Sequence
APKDNTWYTGAKLGWSQHENKLGAGAFGGYQVNPYVGFEMGYDWLGRMPYAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNGMLSLGVSYRFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structure of the Ompa Membrane Domain
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Outer membrane
molecule keywords OUTER MEMBRANE PROTEIN A
total genus 35
structure length 137
sequence length 171
ec nomenclature
pdb deposition date 1999-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1qjpA00
1BXWA 2M07A 2N2MA 4RLCA 3QRCA 3QRAA 3G7GA 2LHFA 1MM5A 1THQA 2M06A 1Q9FA 2K0LA 1QJPA 2F1VA 1ORMA 4PUXA 2MHLA 2GE4A 3GP6A 1MM4A 3C5OA 2X27X 2N2LA 1QJ9A 2MNHA 1QJ8A 2F1TA 1Q9GA 2ERVA 1P4TA 1G90A 2JMMA
chains in the Genus database with same CATH superfamily
3POUA 3HOLA 1S5LO 4RLCA 1IZNA 4E1TA 1GFPA 4FSOA 3VY8X 4AFKA 3WU2O 4O4UA 2Y0LA 1MM5A 1BT9A 3JTYA 2XE3A 3WI4A 2KZ7A 4G76A 4UB6O 3KVDD 1YS5A 2F1VA 2QTKA 4GHBA 4FQEA 2MHLA 2ODJA 4XNKA 4RJXA 4AKMA 2KC0A 2WJRA 2WVPA 4FMSA 5GTIO 3C5OA 2Y2XA 4FZMA 5KAIO 4LSEA 2J1NA 2ZFGA 3HOEA 2KXPB 2MNHA 2ZLDA 3AA0B 4O3YA 4FSPA 1ZHTA 2R89A 3UPGA 4KRAA 5TISO 4AKRB 3LK2A 3PGRA 4LSFA 3TZGA 3VE2A 4AUIA 4D5UA 3SYSA 1ZHWA 5G38A 2IWWA 4GCQA 3T0SA 4N59A 3VY9X 4G75A 2M07A 4PR7A 4FRTA 3UU2A 5B5EO 3V8UA 3T20A 3BRYA 4K3CA 4GCSA 3AA1A 3BRZA 1HXTA 5G26A 3G7GA 2FGQX 1T16A 5DL8A 2JQYA 4FRXA 5DL5A 4C00A 3VZUX 1ZHZA 2KXPA 2XE1A 3JCUO 4N75A 8PRNA 3LK3A 1PHOA 3SY7A 1MM4A 3PORA 2WJQA 3RBHA 2X27X 3PGUA 3SZDA 3PQUA 2XTRA 3AA6B 4LSHA 4JCHA 3NSGA 1HXXA 3HWBA 3AA7B 3UAQA 4BUMX 3T24A 5ADXL 4FZLA 3HW9A 3VZTX 5E79O 2XMXA 4GF4A 5FVNA 2W81C 1P4TA 3DA4A 3AA0A 3VE1A 4C69X 4C4VB 4RL9A 2W80C 2O4VA 3AAEB 4FZNA 1BXWA 4QQ1A 4AKRA 5GTHO 3AA1B 2KDYA 1GFOA 1E54A 2Y0KA 3O0EA 4N58A 3DA3A 5EE2A 4AYDC 2R4NA 5H2FO 2R4PA 3POQA 3LK3B 4O49A 5AFUL 4E1SA 4GCPA 4AYEC 6PRNA 2XE5A 2Y7SA 4FOZA 4K3BA 2M06A 4RJWA 5PRNA 4CTDA 4JFBA 4Z3TA 2K0LA 4UB8O 4PJ0O 3LK41 2R4LA 1ORMA 7PRNA 1OSMA 3BS0A 3FYXA 4PUXA 5G39A 4AYMC 2GE4A 2XE2A 2YNKA 2PORA 3AAAB 2FGRA 5DL7A 4FT6A 2N2LA 1ZHYA 2AXTO 2R88A 4C4VA 2LFUA 5ADXK 4AZLA 1IZNB 3AA6A 3EMNX 3POXA 3VZWX 2Y0HA 3PF1A 3AAEA 4IL6O 4KR8A 2ERVA 2R4OA 3A0HO 3AA7A 2R8AA 3PRNA 5DL6A 3SY9A 4AYID 4D64A 2JMMA 2J4UP 3DWOX 1G90A 1PRNA 2KZ7B 4KR4A 3WI5A 1GFQA 2F1CX 5AFUK 1GFMA 4FUVA 5B66O 3QRCA 5GV0A 2XG6A 2PRNA 3QRAA 4N74A 4D65A 2LHFA 4B61A 2OMFA 1ZHXA 3SZVA 1HXUA 1THQA 2X9KA 4FESA 1Q9FA 4RLBA 4O3XB 1MPFA 1QJPA 3PGSA 4LSIA 1BH3A 4O3ZA 5IYUA 2YPVA 5JDPA 2IWVA 3DWNA 3GP6A 2K4TA 1T1LA 3LK42 1OPFA 3A0BO 3SYBA 4F4BA 1H6S1 1QJ9A 3LK2B 1QJ8A 5G3AA 3NJTA 4U9CA 5KAFO 3A2SX 5T5FA 5D5DA 1GFNA 2F1TA 4AYNA 3KZIO 1Q9GA 3DZMA 3PQSA 4O3WA 3AAAA 2XTQA 4O4XA 3K19A 2N2MA 4XNLA
chains in the Genus database with same CATH topology
3POUA 3HOLA 4RLCA 1IZNA 4E1TA 1GFPA 4FSOA 3VY8X 4AFKA 4O4UA 2Y0LA 1MM5A 1BT9A 3JTYA 2XE3A 3WI4A 2KZ7A 4G76A 3KVDD 1YS5A 2F1VA 2QTKA 4GHBA 4XNKA 2MHLA 2ODJA 4AKMA 4RJXA 2KC0A 4FMSA 3C5OA 2Y2XA 4FZMA 4LSEA 2J1NA 2ZFGA 3HOEA 2KXPB 2MNHA 2ZLDA 3AA0B 4O3YA 4FSPA 1ZHTA 3UPGA 4KRAA 4AKRB 3LK2A 4LSFA 3TZGA 3VE2A 4AUIA 4D5UA 3SYSA 1ZHWA 4GCQA 3T0SA 4N59A 3VY9X 4G75A 2M07A 4FRTA 3UU2A 3V8UA 3T20A 4GCSA 3AA1A 5G26A 1HXTA 3G7GA 2FGQX 5DL8A 4FRXA 5DL5A 3VZUX 1ZHZA 2KXPA 2XE1A 8PRNA 3LK3A 1PHOA 3SY7A 1MM4A 3PORA 3RBHA 2X27X 3SZDA 3PQUA 2XTRA 3AA6B 4LSHA 4JCHA 3NSGA 1HXXA 3HWBA 3AA7B 3UAQA 4BUMX 3T24A 5ADXL 4FZLA 3HW9A 3VZTX 5FVNA 2XMXA 4GF4A 2W81C 1P4TA 3DA4A 3AA0A 3VE1A 4C69X 4RL9A 2W80C 2O4VA 3AAEB 4FZNA 1BXWA 4QQ1A 4AKRA 3AA1B 2KDYA 1GFOA 1E54A 2Y0KA 3O0EA 4N58A 3DA3A 5EE2A 4AYDC 3POQA 3LK3B 4O49A 5AFUL 4E1SA 4GCPA 4AYEC 6PRNA 2XE5A 2Y7SA 4FOZA 4RJWA 2M06A 5PRNA 4Z3TA 4JFBA 2K0LA 3LK41 7PRNA 1ORMA 1OSMA 3FYXA 4PUXA 4AYMC 2GE4A 2XE2A 2YNKA 2PORA 3AAAB 2FGRA 5DL7A 4FT6A 2N2LA 1ZHYA 2LFUA 5ADXK 4AZLA 1IZNB 3AA6A 3EMNX 3POXA 3VZWX 2Y0HA 3AAEA 4KR8A 2ERVA 3AA7A 3PRNA 4AYID 3SY9A 5DL6A 4D64A 1G90A 2JMMA 2J4UP 1PRNA 2KZ7B 4KR4A 3WI5A 1GFQA 5AFUK 1GFMA 4FUVA 3QRCA 5GV0A 2XG6A 2PRNA 3QRAA 4D65A 2LHFA 4B61A 2OMFA 1ZHXA 3SZVA 1HXUA 1THQA 4FESA 1Q9FA 4RLBA 4O3XB 1MPFA 1QJPA 4LSIA 1BH3A 4O3ZA 5IYUA 2YPVA 5JDPA 3GP6A 2K4TA 3LK42 1OPFA 3SYBA 4F4BA 1H6S1 1QJ9A 3LK2B 1QJ8A 4U9CA 3A2SX 5T5FA 5D5DA 1GFNA 2F1TA 4AYNA 1Q9GA 3PQSA 4O3WA 3AAAA 2XTQA 4O4XA 3K19A 2N2MA 4XNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BXW A;  2M07 A;  2N2M A;  4RLC A;  3QRC A;  3QRA A;  3G7G A;  2LHF A;  1MM5 A;  1THQ A;  2M06 A;  1Q9F A;  2K0L A;  1QJP A;  2F1V A;  1ORM A;  4PUX A;  2MHL A;  2GE4 A;  3GP6 A;  1MM4 A;  3C5O A;  2X27 X;  2N2L A;  1QJ9 A;  2MNH A;  1QJ8 A;  2F1T A;  1Q9G A;  2ERV A;  1P4T A;  1G90 A;  2JMM A; 
#chains in the Genus database with same CATH topology
 3POU A;  3HOL A;  1S5L O;  4RLC A;  1IZN A;  4E1T A;  1GFP A;  4FSO A;  3VY8 X;  4AFK A;  3WU2 O;  4O4U A;  2Y0L A;  1MM5 A;  1BT9 A;  3JTY A;  2XE3 A;  3WI4 A;  2KZ7 A;  4G76 A;  4UB6 O;  3KVD D;  1YS5 A;  2F1V A;  2QTK A;  4GHB A;  4FQE A;  2MHL A;  2ODJ A;  4XNK A;  4RJX A;  4AKM A;  2KC0 A;  2WJR A;  2WVP A;  4FMS A;  5GTI O;  3C5O A;  2Y2X A;  4FZM A;  5KAI O;  4LSE A;  2J1N A;  2ZFG A;  3HOE A;  2KXP B;  2MNH A;  2ZLD A;  3AA0 B;  4O3Y A;  4FSP A;  1ZHT A;  2R89 A;  3UPG A;  4KRA A;  5TIS O;  4AKR B;  3LK2 A;  3PGR A;  4LSF A;  3TZG A;  3VE2 A;  4AUI A;  4D5U A;  3SYS A;  1ZHW A;  5G38 A;  2IWW A;  4GCQ A;  3T0S A;  4N59 A;  3VY9 X;  4G75 A;  2M07 A;  4PR7 A;  4FRT A;  3UU2 A;  5B5E O;  3V8U A;  3T20 A;  3BRY A;  4K3C A;  4GCS A;  3AA1 A;  3BRZ A;  1HXT A;  5G26 A;  3G7G A;  2FGQ X;  1T16 A;  5DL8 A;  2JQY A;  4FRX A;  5DL5 A;  4C00 A;  3VZU X;  1ZHZ A;  2KXP A;  2XE1 A;  3JCU O;  4N75 A;  8PRN A;  3LK3 A;  1PHO A;  3SY7 A;  1MM4 A;  3POR A;  2WJQ A;  3RBH A;  2X27 X;  3PGU A;  3SZD A;  3PQU A;  2XTR A;  3AA6 B;  4LSH A;  4JCH A;  3NSG A;  1HXX A;  3HWB A;  3AA7 B;  3UAQ A;  4BUM X;  3T24 A;  5ADX L;  4FZL A;  3HW9 A;  3VZT X;  5E79 O;  2XMX A;  4GF4 A;  5FVN A;  2W81 C;  1P4T A;  3DA4 A;  3AA0 A;  3VE1 A;  4C69 X;  4C4V B;  4RL9 A;  2W80 C;  2O4V A;  3AAE B;  4FZN A;  1BXW A;  4QQ1 A;  4AKR A;  5GTH O;  3AA1 B;  2KDY A;  1GFO A;  1E54 A;  2Y0K A;  3O0E A;  4N58 A;  3DA3 A;  5EE2 A;  4AYD C;  2R4N A;  5H2F O;  2R4P A;  3POQ A;  3LK3 B;  4O49 A;  5AFU L;  4E1S A;  4GCP A;  4AYE C;  6PRN A;  2XE5 A;  2Y7S A;  4FOZ A;  4K3B A;  2M06 A;  4RJW A;  5PRN A;  4CTD A;  4JFB A;  4Z3T A;  2K0L A;  4UB8 O;  4PJ0 O;  3LK4 1;  2R4L A;  1ORM A;  7PRN A;  1OSM A;  3BS0 A;  3FYX A;  4PUX A;  5G39 A;  4AYM C;  2GE4 A;  2XE2 A;  2YNK A;  2POR A;  3AAA B;  2FGR A;  5DL7 A;  4FT6 A;  2N2L A;  1ZHY A;  2AXT O;  2R88 A;  4C4V A;  2LFU A;  5ADX K;  4AZL A;  1IZN B;  3AA6 A;  3EMN X;  3POX A;  3VZW X;  2Y0H A;  3PF1 A;  3AAE A;  4IL6 O;  4KR8 A;  2ERV A;  2R4O A;  3A0H O;  3AA7 A;  2R8A A;  3PRN A;  5DL6 A;  3SY9 A;  4AYI D;  4D64 A;  2JMM A;  2J4U P;  3DWO X;  1G90 A;  1PRN A;  2KZ7 B;  4KR4 A;  3WI5 A;  1GFQ A;  2F1C X;  5AFU K;  1GFM A;  4FUV A;  5B66 O;  3QRC A;  5GV0 A;  2XG6 A;  2PRN A;  3QRA A;  4N74 A;  4D65 A;  2LHF A;  4B61 A;  2OMF A;  1ZHX A;  3SZV A;  1HXU A;  1THQ A;  2X9K A;  4FES A;  1Q9F A;  4RLB A;  4O3X B;  1MPF A;  1QJP A;  3PGS A;  4LSI A;  1BH3 A;  4O3Z A;  5IYU A;  2YPV A;  5JDP A;  2IWV A;  3DWN A;  3GP6 A;  2K4T A;  1T1L A;  3LK4 2;  1OPF A;  3A0B O;  3SYB A;  4F4B A;  1H6S 1;  1QJ9 A;  3LK2 B;  1QJ8 A;  5G3A A;  3NJT A;  4U9C A;  5KAF O;  3A2S X;  5T5F A;  5D5D A;  1GFN A;  2F1T A;  4AYN A;  3KZI O;  1Q9G A;  3DZM A;  3PQS A;  4O3W A;  3AAA A;  2XTQ A;  4O4X A;  3K19 A;  2N2M A;  4XNL A; 
#chains in the Genus database with same CATH homology
 3POU A;  3HOL A;  4RLC A;  1IZN A;  4E1T A;  1GFP A;  4FSO A;  3VY8 X;  4AFK A;  4O4U A;  2Y0L A;  1MM5 A;  1BT9 A;  3JTY A;  2XE3 A;  3WI4 A;  2KZ7 A;  4G76 A;  3KVD D;  1YS5 A;  2F1V A;  2QTK A;  4GHB A;  4XNK A;  2MHL A;  2ODJ A;  4AKM A;  4RJX A;  2KC0 A;  4FMS A;  3C5O A;  2Y2X A;  4FZM A;  4LSE A;  2J1N A;  2ZFG A;  3HOE A;  2KXP B;  2MNH A;  2ZLD A;  3AA0 B;  4O3Y A;  4FSP A;  1ZHT A;  3UPG A;  4KRA A;  4AKR B;  3LK2 A;  4LSF A;  3TZG A;  3VE2 A;  4AUI A;  4D5U A;  3SYS A;  1ZHW A;  4GCQ A;  3T0S A;  4N59 A;  3VY9 X;  4G75 A;  2M07 A;  4FRT A;  3UU2 A;  3V8U A;  3T20 A;  4GCS A;  3AA1 A;  5G26 A;  1HXT A;  3G7G A;  2FGQ X;  5DL8 A;  4FRX A;  5DL5 A;  3VZU X;  1ZHZ A;  2KXP A;  2XE1 A;  8PRN A;  3LK3 A;  1PHO A;  3SY7 A;  1MM4 A;  3POR A;  3RBH A;  2X27 X;  3SZD A;  3PQU A;  2XTR A;  3AA6 B;  4LSH A;  4JCH A;  3NSG A;  1HXX A;  3HWB A;  3AA7 B;  3UAQ A;  4BUM X;  3T24 A;  5ADX L;  4FZL A;  3HW9 A;  3VZT X;  5FVN A;  2XMX A;  4GF4 A;  2W81 C;  1P4T A;  3DA4 A;  3AA0 A;  3VE1 A;  4C69 X;  4RL9 A;  2W80 C;  2O4V A;  3AAE B;  4FZN A;  1BXW A;  4QQ1 A;  4AKR A;  3AA1 B;  2KDY A;  1GFO A;  1E54 A;  2Y0K A;  3O0E A;  4N58 A;  3DA3 A;  5EE2 A;  4AYD C;  3POQ A;  3LK3 B;  4O49 A;  5AFU L;  4E1S A;  4GCP A;  4AYE C;  6PRN A;  2XE5 A;  2Y7S A;  4FOZ A;  4RJW A;  2M06 A;  5PRN A;  4Z3T A;  4JFB A;  2K0L A;  3LK4 1;  7PRN A;  1ORM A;  1OSM A;  3FYX A;  4PUX A;  4AYM C;  2GE4 A;  2XE2 A;  2YNK A;  2POR A;  3AAA B;  2FGR A;  5DL7 A;  4FT6 A;  2N2L A;  1ZHY A;  2LFU A;  5ADX K;  4AZL A;  1IZN B;  3AA6 A;  3EMN X;  3POX A;  3VZW X;  2Y0H A;  3AAE A;  4KR8 A;  2ERV A;  3AA7 A;  3PRN A;  4AYI D;  3SY9 A;  5DL6 A;  4D64 A;  1G90 A;  2JMM A;  2J4U P;  1PRN A;  2KZ7 B;  4KR4 A;  3WI5 A;  1GFQ A;  5AFU K;  1GFM A;  4FUV A;  3QRC A;  5GV0 A;  2XG6 A;  2PRN A;  3QRA A;  4D65 A;  2LHF A;  4B61 A;  2OMF A;  1ZHX A;  3SZV A;  1HXU A;  1THQ A;  4FES A;  1Q9F A;  4RLB A;  4O3X B;  1MPF A;  1QJP A;  4LSI A;  1BH3 A;  4O3Z A;  5IYU A;  2YPV A;  5JDP A;  3GP6 A;  2K4T A;  3LK4 2;  1OPF A;  3SYB A;  4F4B A;  1H6S 1;  1QJ9 A;  3LK2 B;  1QJ8 A;  4U9C A;  3A2S X;  5T5F A;  5D5D A;  1GFN A;  2F1T A;  4AYN A;  1Q9G A;  3PQS A;  4O3W A;  3AAA A;  2XTQ A;  4O4X A;  3K19 A;  2N2M A;  4XNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...