1QJPA

High resolution structure of the outer membrane protein a (ompa) transmembrane domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
171
structure length
137
Chain Sequence
b'APKDNTWYTGAKLGWSQHENKLGAGAFGGYQVNPYVGFEMGYDWLGRMPYAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNGMLSLGVSYRFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OUTER MEMBRANE PROTEIN A
publication title High Resolution Structure of the Ompa Membrane Domain
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Outer membrane
total genus 35
structure length 137
sequence length 171
ec nomenclature
pdb deposition date 1999-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1qjpA00
2M06A 3GP6A 1MM5A 3QRAA 2F1VA 2MNHA 1QJ9A 1THQA 1QJ8A 1Q9GA 4PUXA 2F1TA 1QJPA 3C5OA 3QRCA 1P4TA 2ERVA 4RLCA 2X27X 1G90A 1ORMA 2M07A 1MM4A 2GE4A 2N2MA 2LHFA 2JMMA 2N2LA 1Q9FA 1BXWA 3G7GA 2K0LA 2MHLA
chains in the Genus database with same CATH superfamily
4O4UA 2R89A 2O4VA 3AA7B 3JTYA 1MM5A 4GHBA 3T0SA 4AYDC 4PR7A 4C69X 5DL8A 2MNHA 3FYXA 4AFKA 5AFUL 4D5UA 5JDPA 1ZHYA 4GF4A 4O3WA 3VY8X 5G26A 1MPFA 3AA0A 5GTHO 3UAQA 4RJXA 1ZHWA 1ZHXA 2KZ7A 1PRNA 3DWOX 3O0EA 4RL9A 4AKMA 2Y0LA 4RJWA 3LK41 4GCPA 4FESA 4GCQA 3AAAA 4CTDA 1GFOA 2KXPB 3PF1A 5AFUK 1E54A 3WI5A 5PRNA 3V8UA 5IYUA 4LSHA 2WVPA 2WJQA 2J1NA 5KAFO 2M07A 4FZLA 3A0HO 1S5LO 3SYSA 3AAEB 2XE3A 3AA6B 3LK2B 3POQA 2R88A 4FQEA 1GFPA 5E79O 3PRNA 4FZNA 4FSOA 2WJRA 2R4LA 5TISO 3PORA 4O3XB 3GP6A 3A2SX 4FRTA 2XMXA 4RLBA 2ZFGA 3SZVA 5ADXK 2R4OA 3PGUA 3BRYA 4G75A 1QJ9A 4KR8A 1QJ8A 1HXUA 4XNKA 4D65A 5T5FA 3HOLA 3NSGA 3SY9A 2J4UP 4JFBA 1HXXA 4AYNA 3A0BO 3AA7A 4O4XA 4E1TA 4LSFA 1QJPA 3C5OA 3POXA 3DZMA 4N59A 1P4TA 4N75A 4O3ZA 5G39A 3RBHA 2XG6A 3SY7A 4B61A 5B66O 4AZLA 2Y0KA 5DL5A 2F1CX 1ZHTA 5GTIO 4FSPA 3LK42 3PQUA 3T20A 1HXTA 2YPVA 3VE2A 4D64A 3VZUX 2FGRA 2X27X 5GV0A 1G90A 5KAIO 2R4NA 3UU2A 3K19A 4PJ0O 3VZTX 2LHFA 2N2LA 3BRZA 2AXTO 3PQSA 5G3AA 4C4VA 3SYBA 3AA1A 4K3CA 4AYID 1T16A 3AA0B 3VY9X 2M06A 4XNLA 3PGSA 4O49A 3HWBA 1T1LA 2OMFA 2F1VA 2Y0HA 3KZIO 3LK2A 1IZNB 2XTRA 2JQYA 4FOZA 4AKRA 1GFMA 3LK3A 2LFUA 4N74A 4FRXA 1BH3A 3POUA 3WU2O 4BUMX 3HOEA 4FZMA 4U9CA 5G38A 5DL6A 2K4TA 3QRCA 4KRAA 3JCUO 3NJTA 4LSIA 1PHOA 2ERVA 6PRNA 8PRNA 2Y7SA 4UB6O 2XE5A 4O3YA 5B5EO 2QTKA 3EMNX 4AUIA 4K3BA 2KDYA 1ORMA 1OPFA 5H2FO 1YS5A 2GE4A 3TZGA 3PGRA 2JMMA 2ZLDA 2KXPA 3VE1A 1BXWA 2K0LA 7PRNA 2ODJA 3SZDA 3DA3A 4FMSA 4F4BA 2XTQA 1GFQA 1ZHZA 2KZ7B 3KVDD 4JCHA 2XE1A 2R4PA 2X9KA 3DWNA 3AAEA 4G76A 3AA6A 4LSEA 1THQA 3AAAB 4UB8O 3WI4A 4AYMC 2IWWA 4QQ1A 2W80C 2PORA 1Q9GA 3BS0A 4PUXA 2F1TA 1H6S1 5EE2A 3DA4A 4C00A 1IZNA 3HW9A 3T24A 4C4VB 2R8AA 4Z3TA 4IL6O 3AA1B 1GFNA 2PRNA 3VZWX 4AYEC 2YNKA 1OSMA 4E1SA 4RLCA 4N58A 4GCSA 5ADXL 2XE2A 5D5DA 2N2MA 1MM4A 5FVNA 2W81C 4AKRB 2Y2XA 3LK3B 1Q9FA 2IWVA 4FT6A 1BT9A 2FGQX 2KC0A 4FUVA 4KR4A 5DL7A 3UPGA 3G7GA 3QRAA 2MHLA
chains in the Genus database with same CATH topology
4O4UA 2O4VA 3AA7B 3JTYA 1MM5A 4GHBA 3T0SA 4AYDC 4C69X 5DL8A 2MNHA 3FYXA 4AFKA 5AFUL 4D5UA 5JDPA 1ZHYA 4GF4A 4O3WA 3VY8X 5G26A 1MPFA 3AA0A 3UAQA 4RJXA 1ZHWA 1ZHXA 2KZ7A 1PRNA 4RL9A 3O0EA 4AKMA 4E1TA 2Y0LA 4RJWA 3LK41 4GCPA 4FESA 4GCQA 3AAAA 5AFUK 1GFOA 2KXPB 1E54A 3WI5A 5PRNA 3V8UA 5IYUA 4LSHA 2J1NA 2M07A 4FZLA 3SYSA 3AAEB 2XE3A 3AA6B 3LK2B 3POQA 1GFPA 3PRNA 4FZNA 4FSOA 3PORA 4O3XB 3GP6A 3A2SX 4FRTA 2XMXA 4RLBA 2ZFGA 3SZVA 5ADXK 4G75A 1QJ9A 4KR8A 1QJ8A 1HXUA 4XNKA 4D65A 5T5FA 3HOLA 3NSGA 3SY9A 2J4UP 4JFBA 1HXXA 4AYNA 4O4XA 3AA7A 4LSFA 1QJPA 3C5OA 3POXA 4N59A 4O3ZA 1P4TA 3RBHA 3SY7A 4B61A 2XG6A 4AZLA 2Y0KA 5DL5A 1ZHTA 4FSPA 3LK42 3PQUA 3T20A 1HXTA 2YPVA 3VE2A 4D64A 3VZUX 2FGRA 2X27X 5GV0A 1G90A 3UU2A 3K19A 3VZTX 2LHFA 2N2LA 3PQSA 3SYBA 3AA1A 4AYID 3AA0B 3VY9X 2M06A 4XNLA 4O49A 3HWBA 2OMFA 2F1VA 2Y0HA 3LK2A 4FOZA 1IZNB 2XTRA 4AKRA 1GFMA 3LK3A 2LFUA 4FRXA 1BH3A 3POUA 4BUMX 3HOEA 4FZMA 4U9CA 5DL6A 2K4TA 3QRCA 4KRAA 4LSIA 1PHOA 2ERVA 6PRNA 8PRNA 2Y7SA 2XE5A 4O3YA 2QTKA 3EMNX 4AUIA 2KDYA 1ORMA 1OPFA 1YS5A 2GE4A 3TZGA 2JMMA 2ZLDA 2KXPA 3VE1A 1BXWA 2K0LA 7PRNA 2ODJA 3SZDA 3DA3A 4FMSA 4F4BA 2XTQA 1GFQA 1ZHZA 2KZ7B 3KVDD 4JCHA 2XE1A 4LSEA 3WI4A 3AAEA 4G76A 3AA6A 1THQA 3AAAB 4AYMC 4QQ1A 2W80C 2PORA 1Q9GA 4PUXA 2F1TA 1H6S1 5EE2A 3DA4A 1IZNA 3HW9A 3T24A 4Z3TA 3AA1B 1GFNA 2PRNA 3VZWX 4AYEC 2YNKA 1OSMA 4E1SA 4RLCA 4N58A 4GCSA 5ADXL 2XE2A 5D5DA 1MM4A 2N2MA 5FVNA 2W81C 4AKRB 2Y2XA 3LK3B 1Q9FA 4FT6A 4FUVA 1BT9A 2FGQX 2KC0A 4KR4A 5DL7A 3UPGA 3G7GA 3QRAA 2MHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M06 A;  3GP6 A;  1MM5 A;  3QRA A;  2F1V A;  2MNH A;  1QJ9 A;  1THQ A;  1QJ8 A;  1Q9G A;  4PUX A;  2F1T A;  1QJP A;  3C5O A;  3QRC A;  1P4T A;  2ERV A;  4RLC A;  2X27 X;  1G90 A;  1ORM A;  2M07 A;  1MM4 A;  2GE4 A;  2N2M A;  2LHF A;  2JMM A;  2N2L A;  1Q9F A;  1BXW A;  3G7G A;  2K0L A;  2MHL A; 
#chains in the Genus database with same CATH topology
 4O4U A;  2R89 A;  2O4V A;  3AA7 B;  3JTY A;  1MM5 A;  4GHB A;  3T0S A;  4AYD C;  4PR7 A;  4C69 X;  5DL8 A;  2MNH A;  3FYX A;  4AFK A;  5AFU L;  4D5U A;  5JDP A;  1ZHY A;  4GF4 A;  4O3W A;  3VY8 X;  5G26 A;  1MPF A;  3AA0 A;  5GTH O;  3UAQ A;  4RJX A;  1ZHW A;  1ZHX A;  2KZ7 A;  1PRN A;  3DWO X;  3O0E A;  4RL9 A;  4AKM A;  2Y0L A;  4RJW A;  3LK4 1;  4GCP A;  4FES A;  4GCQ A;  3AAA A;  4CTD A;  1GFO A;  2KXP B;  3PF1 A;  5AFU K;  1E54 A;  3WI5 A;  5PRN A;  3V8U A;  5IYU A;  4LSH A;  2WVP A;  2WJQ A;  2J1N A;  5KAF O;  2M07 A;  4FZL A;  3A0H O;  1S5L O;  3SYS A;  3AAE B;  2XE3 A;  3AA6 B;  3LK2 B;  3POQ A;  2R88 A;  4FQE A;  1GFP A;  5E79 O;  3PRN A;  4FZN A;  4FSO A;  2WJR A;  2R4L A;  5TIS O;  3POR A;  4O3X B;  3GP6 A;  3A2S X;  4FRT A;  2XMX A;  4RLB A;  2ZFG A;  3SZV A;  5ADX K;  2R4O A;  3PGU A;  3BRY A;  4G75 A;  1QJ9 A;  4KR8 A;  1QJ8 A;  1HXU A;  4XNK A;  4D65 A;  5T5F A;  3HOL A;  3NSG A;  3SY9 A;  2J4U P;  4JFB A;  1HXX A;  4AYN A;  3A0B O;  3AA7 A;  4O4X A;  4E1T A;  4LSF A;  1QJP A;  3C5O A;  3POX A;  3DZM A;  4N59 A;  1P4T A;  4N75 A;  4O3Z A;  5G39 A;  3RBH A;  2XG6 A;  3SY7 A;  4B61 A;  5B66 O;  4AZL A;  2Y0K A;  5DL5 A;  2F1C X;  1ZHT A;  5GTI O;  4FSP A;  3LK4 2;  3PQU A;  3T20 A;  1HXT A;  2YPV A;  3VE2 A;  4D64 A;  3VZU X;  2FGR A;  2X27 X;  5GV0 A;  1G90 A;  5KAI O;  2R4N A;  3UU2 A;  3K19 A;  4PJ0 O;  3VZT X;  2LHF A;  2N2L A;  3BRZ A;  2AXT O;  3PQS A;  5G3A A;  4C4V A;  3SYB A;  3AA1 A;  4K3C A;  4AYI D;  1T16 A;  3AA0 B;  3VY9 X;  2M06 A;  4XNL A;  3PGS A;  4O49 A;  3HWB A;  1T1L A;  2OMF A;  2F1V A;  2Y0H A;  3KZI O;  3LK2 A;  1IZN B;  2XTR A;  2JQY A;  4FOZ A;  4AKR A;  1GFM A;  3LK3 A;  2LFU A;  4N74 A;  4FRX A;  1BH3 A;  3POU A;  3WU2 O;  4BUM X;  3HOE A;  4FZM A;  4U9C A;  5G38 A;  5DL6 A;  2K4T A;  3QRC A;  4KRA A;  3JCU O;  3NJT A;  4LSI A;  1PHO A;  2ERV A;  6PRN A;  8PRN A;  2Y7S A;  4UB6 O;  2XE5 A;  4O3Y A;  5B5E O;  2QTK A;  3EMN X;  4AUI A;  4K3B A;  2KDY A;  1ORM A;  1OPF A;  5H2F O;  1YS5 A;  2GE4 A;  3TZG A;  3PGR A;  2JMM A;  2ZLD A;  2KXP A;  3VE1 A;  1BXW A;  2K0L A;  7PRN A;  2ODJ A;  3SZD A;  3DA3 A;  4FMS A;  4F4B A;  2XTQ A;  1GFQ A;  1ZHZ A;  2KZ7 B;  3KVD D;  4JCH A;  2XE1 A;  2R4P A;  2X9K A;  3DWN A;  3AAE A;  4G76 A;  3AA6 A;  4LSE A;  1THQ A;  3AAA B;  4UB8 O;  3WI4 A;  4AYM C;  2IWW A;  4QQ1 A;  2W80 C;  2POR A;  1Q9G A;  3BS0 A;  4PUX A;  2F1T A;  1H6S 1;  5EE2 A;  3DA4 A;  4C00 A;  1IZN A;  3HW9 A;  3T24 A;  4C4V B;  2R8A A;  4Z3T A;  4IL6 O;  3AA1 B;  1GFN A;  2PRN A;  3VZW X;  4AYE C;  2YNK A;  1OSM A;  4E1S A;  4RLC A;  4N58 A;  4GCS A;  5ADX L;  2XE2 A;  5D5D A;  2N2M A;  1MM4 A;  5FVN A;  2W81 C;  4AKR B;  2Y2X A;  3LK3 B;  1Q9F A;  2IWV A;  4FT6 A;  1BT9 A;  2FGQ X;  2KC0 A;  4FUV A;  4KR4 A;  5DL7 A;  3UPG A;  3G7G A;  3QRA A;  2MHL A; 
#chains in the Genus database with same CATH homology
 4O4U A;  2O4V A;  3AA7 B;  3JTY A;  1MM5 A;  4GHB A;  3T0S A;  4AYD C;  4C69 X;  5DL8 A;  2MNH A;  3FYX A;  4AFK A;  5AFU L;  4D5U A;  5JDP A;  1ZHY A;  4GF4 A;  4O3W A;  3VY8 X;  5G26 A;  1MPF A;  3AA0 A;  3UAQ A;  4RJX A;  1ZHW A;  1ZHX A;  2KZ7 A;  1PRN A;  4RL9 A;  3O0E A;  4AKM A;  4E1T A;  2Y0L A;  4RJW A;  3LK4 1;  4GCP A;  4FES A;  4GCQ A;  3AAA A;  5AFU K;  1GFO A;  2KXP B;  1E54 A;  3WI5 A;  5PRN A;  3V8U A;  5IYU A;  4LSH A;  2J1N A;  2M07 A;  4FZL A;  3SYS A;  3AAE B;  2XE3 A;  3AA6 B;  3LK2 B;  3POQ A;  1GFP A;  3PRN A;  4FZN A;  4FSO A;  3POR A;  4O3X B;  3GP6 A;  3A2S X;  4FRT A;  2XMX A;  4RLB A;  2ZFG A;  3SZV A;  5ADX K;  4G75 A;  1QJ9 A;  4KR8 A;  1QJ8 A;  1HXU A;  4XNK A;  4D65 A;  5T5F A;  3HOL A;  3NSG A;  3SY9 A;  2J4U P;  4JFB A;  1HXX A;  4AYN A;  4O4X A;  3AA7 A;  4LSF A;  1QJP A;  3C5O A;  3POX A;  4N59 A;  4O3Z A;  1P4T A;  3RBH A;  3SY7 A;  4B61 A;  2XG6 A;  4AZL A;  2Y0K A;  5DL5 A;  1ZHT A;  4FSP A;  3LK4 2;  3PQU A;  3T20 A;  1HXT A;  2YPV A;  3VE2 A;  4D64 A;  3VZU X;  2FGR A;  2X27 X;  5GV0 A;  1G90 A;  3UU2 A;  3K19 A;  3VZT X;  2LHF A;  2N2L A;  3PQS A;  3SYB A;  3AA1 A;  4AYI D;  3AA0 B;  3VY9 X;  2M06 A;  4XNL A;  4O49 A;  3HWB A;  2OMF A;  2F1V A;  2Y0H A;  3LK2 A;  4FOZ A;  1IZN B;  2XTR A;  4AKR A;  1GFM A;  3LK3 A;  2LFU A;  4FRX A;  1BH3 A;  3POU A;  4BUM X;  3HOE A;  4FZM A;  4U9C A;  5DL6 A;  2K4T A;  3QRC A;  4KRA A;  4LSI A;  1PHO A;  2ERV A;  6PRN A;  8PRN A;  2Y7S A;  2XE5 A;  4O3Y A;  2QTK A;  3EMN X;  4AUI A;  2KDY A;  1ORM A;  1OPF A;  1YS5 A;  2GE4 A;  3TZG A;  2JMM A;  2ZLD A;  2KXP A;  3VE1 A;  1BXW A;  2K0L A;  7PRN A;  2ODJ A;  3SZD A;  3DA3 A;  4FMS A;  4F4B A;  2XTQ A;  1GFQ A;  1ZHZ A;  2KZ7 B;  3KVD D;  4JCH A;  2XE1 A;  4LSE A;  3WI4 A;  3AAE A;  4G76 A;  3AA6 A;  1THQ A;  3AAA B;  4AYM C;  4QQ1 A;  2W80 C;  2POR A;  1Q9G A;  4PUX A;  2F1T A;  1H6S 1;  5EE2 A;  3DA4 A;  1IZN A;  3HW9 A;  3T24 A;  4Z3T A;  3AA1 B;  1GFN A;  2PRN A;  3VZW X;  4AYE C;  2YNK A;  1OSM A;  4E1S A;  4RLC A;  4N58 A;  4GCS A;  5ADX L;  2XE2 A;  5D5D A;  1MM4 A;  2N2M A;  5FVN A;  2W81 C;  4AKR B;  2Y2X A;  3LK3 B;  1Q9F A;  4FT6 A;  4FUV A;  1BT9 A;  2FGQ X;  2KC0 A;  4KR4 A;  5DL7 A;  3UPG A;  3G7G A;  3QRA A;  2MHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...