1QJPA

High resolution structure of the outer membrane protein a (ompa) transmembrane domain
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
171
structure length
137
Chain Sequence
APKDNTWYTGAKLGWSQHENKLGAGAFGGYQVNPYVGFEMGYDWLGRMPYAYKAQGVQLTAKLGYPITDDLDIYTRLGGMVWRADTYSNVYGKNHDTGVSPVFAGGVEYAITPEIATRLEYQWTNGMLSLGVSYRFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Structure of the Ompa Membrane Domain
pubmed doi rcsb
source organism Escherichia coli bl21(de3)
molecule tags Outer membrane
molecule keywords OUTER MEMBRANE PROTEIN A
total genus 35
structure length 137
sequence length 171
ec nomenclature
pdb deposition date 1999-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.20 Mainly Beta Beta Barrel Porin Porin 1qjpA00
4PUXA 1MM5A 2JMMA 2K0LA 4RLCA 2N2MA 1MM4A 2MNHA 3QRAA 2X27X 3QRCA 2N2LA 3G7GA 2M06A 1QJ8A 2F1VA 1ORMA 2LHFA 3C5OA 1G90A 1THQA 1QJ9A 1P4TA 2MHLA 2ERVA 1BXWA 2GE4A 3GP6A 1Q9FA 1Q9GA 1QJPA 2M07A 2F1TA
chains in the Genus database with same CATH superfamily
2JMMA 2Y7SA 4RLCA 1ZHWA 2OMFA 1MM4A 4GCSA 4O3YA 5T5FA 4C00A 4E1TA 3PGRA 2XG6A 5GTIO 3A0HO 3T0SA 2XTQA 4O3ZA 3POXA 4O4XA 3PGUA 4F4BA 2R4OA 3FYXA 5AFUK 3G7GA 2XE2A 1PRNA 3HWBA 3JCUO 5DL7A 3SY7A 4D64A 3UU2A 1GFMA 3UAQA 5GV0A 2W81C 4K3CA 5G39A 3LK42 3PRNA 1BXWA 4D5UA 4N58A 2R4NA 5KAIO 4XNKA 4C4VA 4UB8O 1Q9FA 3NSGA 4O4UA 1IZNB 3AA1A 4FQEA 2M07A 3AA7A 5E79O 1ZHTA 3O0EA 2Y0LA 2PRNA 3AAAB 1MM5A 3HOEA 3LK3A 3PF1A 4GHBA 4IL6O 2FGRA 3A0BO 4K3BA 4KR8A 3WU2O 2IWWA 1H6S1 2QTKA 4AFKA 3QRAA 5PRNA 3BS0A 5FVNA 2X27X 2XMXA 4Z3TA 4FZMA 5B66O 1QJ8A 1ORMA 2X9KA 1ZHXA 2R4LA 2R8AA 2WVPA 3LK41 5D5DA 5ADXL 2W80C 1P4TA 2KXPA 2MHLA 3T20A 4FT6A 5AFUL 3VY8X 5DL5A 4N59A 4AYID 4FZNA 2IWVA 2ODJA 3GP6A 4FESA 4N74A 4FSOA 5G26A 1PHOA 3AAEA 4G76A 2ZFGA 3JTYA 4AKMA 7PRNA 3AA6A 2WJRA 3AA0B 1BH3A 4KRAA 1IZNA 1GFOA 3SZDA 3EMNX 1MPFA 2F1TA 3SYBA 4PUXA 5KAFO 3DZMA 3K19A 2K0LA 4LSHA 5GTHO 5B5EO 2N2MA 4JCHA 3A2SX 3VY9X 3UPGA 2YNKA 5G38A 4AUIA 3BRYA 4KR4A 2KC0A 5IYUA 4AKRA 2XE3A 3PQUA 4GF4A 3VZUX 1HXUA 3NJTA 2XE1A 3DA3A 2M06A 4U9CA 2KZ7A 2F1VA 4O3WA 4XNLA 2WJQA 2XTRA 3VE1A 1G90A 1QJ9A 1THQA 3BRZA 5TISO 4AYEC 4O49A 4AZLA 1S5LO 1OSMA 2Y2XA 4LSFA 2K4TA 5DL6A 1ZHZA 3VZTX 2KXPB 5ADXK 4AYDC 2JQYA 5H2FO 3PQSA 4LSEA 3LK2B 1YS5A 3PORA 1T1LA 3PGSA 1GFNA 2O4VA 2PORA 1HXXA 3HOLA 1Q9GA 1QJPA 2FGQX 4RJWA 3WI5A 4E1SA 5JDPA 4PJ0O 3T24A 1GFQA 4RLBA 3KZIO 4FRXA 4LSIA 4FZLA 2AXTO 4AYMC 4N75A 3V8UA 4PR7A 3SYSA 3KVDD 2J4UP 4GCPA 2ZLDA 4C69X 2MNHA 3POUA 2XE5A 3TZGA 1BT9A 3AAEB 4FRTA 4AYNA 4CTDA 5EE2A 2R88A 4FOZA 3AA6B 3QRCA 2N2LA 3RBHA 5G3AA 1E54A 2R89A 2R4PA 3AA0A 3VZWX 4C4VB 4FSPA 2LHFA 3C5OA 2YPVA 4GCQA 2KZ7B 4UB6O 6PRNA 5DL8A 3DWNA 4QQ1A 1HXTA 3AA7B 3SZVA 8PRNA 4FUVA 3LK3B 4RL9A 3SY9A 4BUMX 2Y0HA 2ERVA 4RJXA 4O3XB 2J1NA 2GE4A 4FMSA 2KDYA 4AKRB 1ZHYA 3LK2A 1GFPA 3DWOX 3HW9A 2F1CX 2Y0KA 3AA1B 3POQA 3DA4A 1OPFA 3WI4A 4D65A 2LFUA 3VE2A 4B61A 1T16A 3AAAA 4JFBA 4G75A
chains in the Genus database with same CATH topology
2JMMA 2Y7SA 4RLCA 1ZHWA 2OMFA 1MM4A 4GCSA 4O3YA 5T5FA 4E1TA 2XG6A 3T0SA 2XTQA 4O3ZA 3POXA 4O4XA 5AFUK 4F4BA 3FYXA 3G7GA 2XE2A 1PRNA 3HWBA 5DL7A 3SY7A 4D64A 3UU2A 1GFMA 3UAQA 5GV0A 2W81C 3LK42 3PRNA 1BXWA 4D5UA 4N58A 4XNKA 1Q9FA 3NSGA 4O4UA 1IZNB 3AA1A 2M07A 3AA7A 1ZHTA 3O0EA 2Y0LA 2PRNA 3AAAB 1MM5A 3HOEA 3LK3A 4GHBA 2FGRA 4KR8A 1H6S1 2QTKA 4AFKA 3QRAA 5PRNA 5FVNA 2X27X 2XMXA 4Z3TA 4FZMA 1QJ8A 1ORMA 1ZHXA 3LK41 5D5DA 2W80C 1P4TA 2KXPA 2MHLA 3T20A 4FT6A 5AFUL 3VY8X 5DL5A 4N59A 4AYID 4FZNA 2ODJA 4FESA 3GP6A 4FSOA 5G26A 3AAEA 4G76A 2ZFGA 3JTYA 4AKMA 7PRNA 3AA6A 3AA0B 1BH3A 4KRAA 1IZNA 1GFOA 3SZDA 3EMNX 1MPFA 2F1TA 3SYBA 4PUXA 3K19A 2K0LA 4LSHA 2N2MA 4JCHA 3A2SX 3VY9X 3UPGA 2YNKA 4AUIA 4KR4A 2KC0A 5IYUA 4AKRA 2XE3A 3PQUA 4GF4A 3VZUX 1HXUA 2XE1A 3DA3A 2M06A 4U9CA 2KZ7A 2F1VA 4O3WA 4XNLA 2XTRA 3VE1A 1G90A 1QJ9A 1THQA 4AYEC 4AZLA 4O49A 2Y2XA 1OSMA 4LSFA 2K4TA 5DL6A 1ZHZA 3VZTX 2KXPB 5ADXK 4AYDC 3PQSA 4LSEA 3LK2B 1YS5A 3PORA 1GFNA 2O4VA 2PORA 1HXXA 3HOLA 1Q9GA 1QJPA 2FGQX 4RJWA 3WI5A 4E1SA 5JDPA 3T24A 1GFQA 4RLBA 4FRXA 4LSIA 4FZLA 4AYMC 3V8UA 3SYSA 2J4UP 3KVDD 4GCPA 2ZLDA 4C69X 2MNHA 3POUA 2XE5A 3TZGA 1BT9A 3AAEB 4FRTA 4AYNA 5EE2A 4FOZA 3RBHA 3AA6B 3QRCA 2N2LA 3VZWX 5ADXL 1E54A 3AA0A 4FSPA 2LHFA 3C5OA 2YPVA 4GCQA 2KZ7B 6PRNA 5DL8A 4QQ1A 1HXTA 3AA7B 3SZVA 8PRNA 4FUVA 3LK3B 4RL9A 3SY9A 4BUMX 2Y0HA 2ERVA 4RJXA 4O3XB 2J1NA 2GE4A 4FMSA 2KDYA 4AKRB 1ZHYA 3LK2A 1GFPA 3HW9A 2Y0KA 3AA1B 3POQA 3WI4A 3DA4A 1OPFA 4D65A 2LFUA 3VE2A 4B61A 1PHOA 3AAAA 4JFBA 4G75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PUX A;  1MM5 A;  2JMM A;  2K0L A;  4RLC A;  2N2M A;  1MM4 A;  2MNH A;  3QRA A;  2X27 X;  3QRC A;  2N2L A;  3G7G A;  2M06 A;  1QJ8 A;  2F1V A;  1ORM A;  2LHF A;  3C5O A;  1G90 A;  1THQ A;  1QJ9 A;  1P4T A;  2MHL A;  2ERV A;  1BXW A;  2GE4 A;  3GP6 A;  1Q9F A;  1Q9G A;  1QJP A;  2M07 A;  2F1T A; 
#chains in the Genus database with same CATH topology
 2JMM A;  2Y7S A;  4RLC A;  1ZHW A;  2OMF A;  1MM4 A;  4GCS A;  4O3Y A;  5T5F A;  4C00 A;  4E1T A;  3PGR A;  2XG6 A;  5GTI O;  3A0H O;  3T0S A;  2XTQ A;  4O3Z A;  3POX A;  4O4X A;  3PGU A;  4F4B A;  2R4O A;  3FYX A;  5AFU K;  3G7G A;  2XE2 A;  1PRN A;  3HWB A;  3JCU O;  5DL7 A;  3SY7 A;  4D64 A;  3UU2 A;  1GFM A;  3UAQ A;  5GV0 A;  2W81 C;  4K3C A;  5G39 A;  3LK4 2;  3PRN A;  1BXW A;  4D5U A;  4N58 A;  2R4N A;  5KAI O;  4XNK A;  4C4V A;  4UB8 O;  1Q9F A;  3NSG A;  4O4U A;  1IZN B;  3AA1 A;  4FQE A;  2M07 A;  3AA7 A;  5E79 O;  1ZHT A;  3O0E A;  2Y0L A;  2PRN A;  3AAA B;  1MM5 A;  3HOE A;  3LK3 A;  3PF1 A;  4GHB A;  4IL6 O;  2FGR A;  3A0B O;  4K3B A;  4KR8 A;  3WU2 O;  2IWW A;  1H6S 1;  2QTK A;  4AFK A;  3QRA A;  5PRN A;  3BS0 A;  5FVN A;  2X27 X;  2XMX A;  4Z3T A;  4FZM A;  5B66 O;  1QJ8 A;  1ORM A;  2X9K A;  1ZHX A;  2R4L A;  2R8A A;  2WVP A;  3LK4 1;  5D5D A;  5ADX L;  2W80 C;  1P4T A;  2KXP A;  2MHL A;  3T20 A;  4FT6 A;  5AFU L;  3VY8 X;  5DL5 A;  4N59 A;  4AYI D;  4FZN A;  2IWV A;  2ODJ A;  3GP6 A;  4FES A;  4N74 A;  4FSO A;  5G26 A;  1PHO A;  3AAE A;  4G76 A;  2ZFG A;  3JTY A;  4AKM A;  7PRN A;  3AA6 A;  2WJR A;  3AA0 B;  1BH3 A;  4KRA A;  1IZN A;  1GFO A;  3SZD A;  3EMN X;  1MPF A;  2F1T A;  3SYB A;  4PUX A;  5KAF O;  3DZM A;  3K19 A;  2K0L A;  4LSH A;  5GTH O;  5B5E O;  2N2M A;  4JCH A;  3A2S X;  3VY9 X;  3UPG A;  2YNK A;  5G38 A;  4AUI A;  3BRY A;  4KR4 A;  2KC0 A;  5IYU A;  4AKR A;  2XE3 A;  3PQU A;  4GF4 A;  3VZU X;  1HXU A;  3NJT A;  2XE1 A;  3DA3 A;  2M06 A;  4U9C A;  2KZ7 A;  2F1V A;  4O3W A;  4XNL A;  2WJQ A;  2XTR A;  3VE1 A;  1G90 A;  1QJ9 A;  1THQ A;  3BRZ A;  5TIS O;  4AYE C;  4O49 A;  4AZL A;  1S5L O;  1OSM A;  2Y2X A;  4LSF A;  2K4T A;  5DL6 A;  1ZHZ A;  3VZT X;  2KXP B;  5ADX K;  4AYD C;  2JQY A;  5H2F O;  3PQS A;  4LSE A;  3LK2 B;  1YS5 A;  3POR A;  1T1L A;  3PGS A;  1GFN A;  2O4V A;  2POR A;  1HXX A;  3HOL A;  1Q9G A;  1QJP A;  2FGQ X;  4RJW A;  3WI5 A;  4E1S A;  5JDP A;  4PJ0 O;  3T24 A;  1GFQ A;  4RLB A;  3KZI O;  4FRX A;  4LSI A;  4FZL A;  2AXT O;  4AYM C;  4N75 A;  3V8U A;  4PR7 A;  3SYS A;  3KVD D;  2J4U P;  4GCP A;  2ZLD A;  4C69 X;  2MNH A;  3POU A;  2XE5 A;  3TZG A;  1BT9 A;  3AAE B;  4FRT A;  4AYN A;  4CTD A;  5EE2 A;  2R88 A;  4FOZ A;  3AA6 B;  3QRC A;  2N2L A;  3RBH A;  5G3A A;  1E54 A;  2R89 A;  2R4P A;  3AA0 A;  3VZW X;  4C4V B;  4FSP A;  2LHF A;  3C5O A;  2YPV A;  4GCQ A;  2KZ7 B;  4UB6 O;  6PRN A;  5DL8 A;  3DWN A;  4QQ1 A;  1HXT A;  3AA7 B;  3SZV A;  8PRN A;  4FUV A;  3LK3 B;  4RL9 A;  3SY9 A;  4BUM X;  2Y0H A;  2ERV A;  4RJX A;  4O3X B;  2J1N A;  2GE4 A;  4FMS A;  2KDY A;  4AKR B;  1ZHY A;  3LK2 A;  1GFP A;  3DWO X;  3HW9 A;  2F1C X;  2Y0K A;  3AA1 B;  3POQ A;  3DA4 A;  1OPF A;  3WI4 A;  4D65 A;  2LFU A;  3VE2 A;  4B61 A;  1T16 A;  3AAA A;  4JFB A;  4G75 A; 
#chains in the Genus database with same CATH homology
 2JMM A;  2Y7S A;  4RLC A;  1ZHW A;  2OMF A;  1MM4 A;  4GCS A;  4O3Y A;  5T5F A;  4E1T A;  2XG6 A;  3T0S A;  2XTQ A;  4O3Z A;  3POX A;  4O4X A;  5AFU K;  4F4B A;  3FYX A;  3G7G A;  2XE2 A;  1PRN A;  3HWB A;  5DL7 A;  3SY7 A;  4D64 A;  3UU2 A;  1GFM A;  3UAQ A;  5GV0 A;  2W81 C;  3LK4 2;  3PRN A;  1BXW A;  4D5U A;  4N58 A;  4XNK A;  1Q9F A;  3NSG A;  4O4U A;  1IZN B;  3AA1 A;  2M07 A;  3AA7 A;  1ZHT A;  3O0E A;  2Y0L A;  2PRN A;  3AAA B;  1MM5 A;  3HOE A;  3LK3 A;  4GHB A;  2FGR A;  4KR8 A;  1H6S 1;  2QTK A;  4AFK A;  3QRA A;  5PRN A;  5FVN A;  2X27 X;  2XMX A;  4Z3T A;  4FZM A;  1QJ8 A;  1ORM A;  1ZHX A;  3LK4 1;  5D5D A;  2W80 C;  1P4T A;  2KXP A;  2MHL A;  3T20 A;  4FT6 A;  5AFU L;  3VY8 X;  5DL5 A;  4N59 A;  4AYI D;  4FZN A;  2ODJ A;  4FES A;  3GP6 A;  4FSO A;  5G26 A;  3AAE A;  4G76 A;  2ZFG A;  3JTY A;  4AKM A;  7PRN A;  3AA6 A;  3AA0 B;  1BH3 A;  4KRA A;  1IZN A;  1GFO A;  3SZD A;  3EMN X;  1MPF A;  2F1T A;  3SYB A;  4PUX A;  3K19 A;  2K0L A;  4LSH A;  2N2M A;  4JCH A;  3A2S X;  3VY9 X;  3UPG A;  2YNK A;  4AUI A;  4KR4 A;  2KC0 A;  5IYU A;  4AKR A;  2XE3 A;  3PQU A;  4GF4 A;  3VZU X;  1HXU A;  2XE1 A;  3DA3 A;  2M06 A;  4U9C A;  2KZ7 A;  2F1V A;  4O3W A;  4XNL A;  2XTR A;  3VE1 A;  1G90 A;  1QJ9 A;  1THQ A;  4AYE C;  4AZL A;  4O49 A;  2Y2X A;  1OSM A;  4LSF A;  2K4T A;  5DL6 A;  1ZHZ A;  3VZT X;  2KXP B;  5ADX K;  4AYD C;  3PQS A;  4LSE A;  3LK2 B;  1YS5 A;  3POR A;  1GFN A;  2O4V A;  2POR A;  1HXX A;  3HOL A;  1Q9G A;  1QJP A;  2FGQ X;  4RJW A;  3WI5 A;  4E1S A;  5JDP A;  3T24 A;  1GFQ A;  4RLB A;  4FRX A;  4LSI A;  4FZL A;  4AYM C;  3V8U A;  3SYS A;  2J4U P;  3KVD D;  4GCP A;  2ZLD A;  4C69 X;  2MNH A;  3POU A;  2XE5 A;  3TZG A;  1BT9 A;  3AAE B;  4FRT A;  4AYN A;  5EE2 A;  4FOZ A;  3RBH A;  3AA6 B;  3QRC A;  2N2L A;  3VZW X;  5ADX L;  1E54 A;  3AA0 A;  4FSP A;  2LHF A;  3C5O A;  2YPV A;  4GCQ A;  2KZ7 B;  6PRN A;  5DL8 A;  4QQ1 A;  1HXT A;  3AA7 B;  3SZV A;  8PRN A;  4FUV A;  3LK3 B;  4RL9 A;  3SY9 A;  4BUM X;  2Y0H A;  2ERV A;  4RJX A;  4O3X B;  2J1N A;  2GE4 A;  4FMS A;  2KDY A;  4AKR B;  1ZHY A;  3LK2 A;  1GFP A;  3HW9 A;  2Y0K A;  3AA1 B;  3POQ A;  3WI4 A;  3DA4 A;  1OPF A;  4D65 A;  2LFU A;  3VE2 A;  4B61 A;  1PHO A;  3AAA A;  4JFB A;  4G75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...