1QJX2

Human rhinovirus 16 coat protein in complex with antiviral compound win68934
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
252
structure length
252
Chain Sequence
SDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLDSKMWNSTSKGWWWKLPDALKDMGIFGENMFYHFLGRSGYTVHVQCNASKFHQGTLLVVMIPEHQLATVNKGNVNAGYKYTHPGEAGREVGTQVENEKQPSDDNWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMVRHNNWSLVIIPVCQLQSNNISNIVPITVSISPMCAEFSGARAKTVVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN VP1
publication title Analysis of Three Structurally Related Antiviral Compounds in Complex with Human Rhinovirus 16
pubmed doi rcsb
molecule tags Virus
total genus 60
structure length 252
sequence length 252
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qjx200
4WM8B 4FTSA 1TME2 1RUI2 2HWD3 4RQPB 1PVC1 3ZFEB 4RR3C 3VBFC 5C9AB 1AUYA 3J8F2 2WFF3 2RS13 1AR83 1VBA2 1EV13 3NAPA 4FTEA 1RB8G 2X5IB 1RUH2 5DDJ1 1H8TB 1C8M3 1Z7S1 4IV1A 1AR73 2HWB3 5AC91 3M8LA 4AEDA 1AYM1 5ABJC 1PIV3 4CDQB 2BBVA 1TMF3 1OOPB 1ZBA1 1BMV2 1NCQC 1VBB1 1EAH1 1PGW1 1HRV2 2HWE1 1MQTA 1PVC3 1RVF2 1RUF1 3ZFGC 1AR91 2GSYA 3TN93 1NCRC 1C8NA 5J96B 4GB32 1K5MC 4GH4A 3VBRB 1R082 2R043 5CFCC 1QQP2 4PDWA 1AYN1 1R092 2WLPA 1AYM3 1QJU2 3VBFB 4CDWC 2WS92 2HWE3 1CD3G 3VDDB 5JZGC 1IHMA 4LLFA 1RUF3 4WM7C 1AR93 1AL21 2R072 1FPN1 4WM8A 5ABJB 1ZBE1 1A6CA 1ASJ2 4IV3C 1R1A1 5BNOC 1TMF2 2XBO3 4Q4V1 1NOVA 2MEV3 4RQPA 3ZFEA 3JD73 4Y5Z0 1AYN3 5C9AA 5BNNA 1RHI3 1NCRB 2X5IA 1VBE1 1K5MB 1V9U1 1DDLA 1H8TA 1VBD2 5CFCB 5DDJ2 1F8VA 1AL23 1Z7S2 1MEC3 4CDQA 5AC92 1OOPA 5D8AC 1AYM2 2HWD1 2BFUS 4Q4W2 1HXS3 4CDWB 1BEV1 1R1A3 2RS53 1ZBA2 1PO12 1HX6A 1VBB2 1NY71 1EAH2 1B35B 2WFF1 2HWE2 2RS11 1AR81 1EV11 4RS5C 1RUF2 4WM7B 4CEWC 4FTBA 1AR92 4YVSC 2XPJA 3DPRC 3JB4C 3VBRA 1QJY3 2R062 4N43C 4IV3B 1V9U3 4Q4Y3 5BNOB 2HWB1 5BNPB 3VBUC 5LK7B 1PIV1 4CDUC 1E57A 1FMD3 3VBFA 5K0UC 1AYN2 3ZFFC 1BEV3 1VB4A 3VDDA 1VBC3 3CJIC 1VRH3 4QPIC 3TN91 5C4WC 1RUG1 1AR62 3VBHC 4Q4X2 1AL22 5ABJA 1FPN2 2R041 5D8AB 1RUD3 1ZBE2 2ZAHA 2HWF3 2PLV2 1QJX3 5GKAC 1PGL1 4Q4V2 1HRI1 3VBSC 1BBT3 2ZTNA 1NCRA 4CEWB 4YVSB 1FOD2 1RMU1 1K5MA 1VBE2 1ND3C 5CFCA 2RS33 1RUG3 3VBUB 3NAPC 4CDUB 3VBOA 5C8CC 5K0UB 2XBO1 4CDWA 2MEV1 2HWD2 3JD71 1BEV2 2GH8A 1F2NA 1B35A 4RR3B 4AEDC 1HRI3 3CJIB 1RHI1 1NY72 2BFUL 2WFF2 4WM7A 5C4WB 2RS12 2WZR1 1AR82 5A32B 2QQPA 1EV12 5CFDC 1NA1C 1RMU3 1GFF2 4IV3A 5BNOA 5BNPA 5FMOS 1RUC3 2RM23 1D4M1 1C8M2 2HWC3 1AR72 1MEC1 2HWB2 1COV1 1HXS1 1PIV2 5ACA3 2WWSA 2RS51 2Y26A 1NCQB 3HAGA 5A33B 1PVC2 4BCUA 3ZFGB 1ND3B 5L7OC 1PO21 1W39A 3TN92 2WZR3 1QJY1 5C8CB 3LOBA 5D8AA 4Q4Y1 2R042 1RUE1 4JGZC 1D4M3 1POV3 1FMD1 5J98B 1COV3 1PGL2 4JGYC 4AEDB 1BMV1 1WCDJ 4CDXC 4CEWA 4YVSA 1VBC1 5CFDB 1VRH1 1NA1B 1PGW2 4N53C 5JZGB 1RMU2 4EJRA 5BNNC 1VBA3 3VBUA 1VAKA 1PO23 4CDUA 2X5IC 5K0UA 4YVWC 1R081 1RUD1 4NWWA 2HWF1 1QJX1 2XBO2 1H8TC 1AL0G 2MEV2 1RUE3 4RR3A 1BBT1 3JD72 4CDQC 2FZ1A 4GMP3 5C4WA 5L7OB 5A32A 1RHI2 2ZZQA 2RR11 1HRV3 3IDEA 2WZR2 2RS31 1CJDA 2R071 1ND2C 4JGZB 4QPGC 1NG0A 1ASJ1 1MEC2 1COV2 4JGYB 1R083 3VBRC 1NCQA 4CDXB 1HXS2 5A33A 5FMOL 1QQP3 1R1A2 2RS52 4CEYC 1R093 4RHV1 2FZ2A 1QJU3 4N53B 3ZFGA 3S6PA 1ND3A 4RS5B 5BNNB 2WS93 2RR13 1PO22 5C8CA 3DPRB 3VDDC 4N43B 4YVWB 1QJY2 1RUC1 1VBD1 2RM21 2HWC1 3JBG1 1V9U2 4Q4Y2 1OPOA 5FOJB 1HQNA 2R073 1RUE2 2RMU1 5ACA1 1ASJ3 4Q4W1 1FMD2 1M06G 3ZFFB 1PO11 4IV1C 1RUJ1 5CFDA 1NA1A 4NWVA 5JZGA 4QPIB 1VBC2 2BUKA 2DF7A 1VRH2 4RHV3 1QJZA 3VBHB 1ND2B 2TBVA 4QPGB 1MQTC 2R061 2IZWA 1RUD2 1VBD3 3JBG3 1POV1 5DDJ3 4CEYB 2HWF2 1QJX2 1Z7S3 4FSJA 3VBSB 2RMU3 1TME1 5AC93 3VBOC 1RUI1 4GH4C 4Q4W3 1BBT2 4SBVA 5L7OA 1ZBA3 1PO13 4Y4YA 4PDWC 1RUJ3 1VBB3 1EAH3 2RR12 3J8F1 1B35C 1AR61 1VBA1 2RS32 1RUH1 2VQ0A 4Q4X1 4JGZA 1RUG2 3NAPB 2R063 4JGYA 4CDXA 2PLV1 5BNPC 1POV0 4IV1B 2BPA2 4N53A 4GMP1 3JB8A 4WM8C 1HRI2 1TME3 1OHFA 1RUI3 4RHV2 4RS5A 1HRV1 1RVF1 1FOD1 4RQPC 3DPRA 3ZFEC 1X33A 1MQTB 4N43A 4YVWA 3J8F3 5C9AC 1AR63 1RUC2 4GB31 2RM22 2HWC2 1RUH3 3JBG2 4Q4X3 1FPN3 1VB2A 3VBOB 2RMU2 4GH4B 3ZFFA 1QQP1 5ACA2 1X36A 1ZBE3 4RFT0 2PLV3 1R091 4Q4V3 4PDWB 1QJU1 3CJIA 1RUJ2 4QPIA 4GMP0 1OOPC 2WS91 3FBMA 3VBHA 1ND2A 4QPGA 1RVF3 1FOD3 1VBE3 1C8M1 3ZXAC 4CEYA 1AR71 4GB33 4Z92B 1SMVA 1D4M2 3VBSA 1TMF1
chains in the Genus database with same CATH superfamily
1Q43A 3NVCA 4W4ZA 1GP4A 2VW2A 1TME2 3AFKA 4IXLA 4QT6A 1RUI2 3WUDA 3SXWA 5CYYA 2AYHA 1OF3A 4HKOA 4NHYA 4GALA 3WHTA 1AXYA 1N3OA 2WRAA 3ZFEB 2JB8A 5FMDA 4HXCA 4GKXA 1ST8A 3VBFC 1QOOA 1AUYA 1PMIA 2WT0A 2RS13 4QHZA 2D7FA 2W1UA 1AR83 3V65A 2VVEA 1DP0A 3WDWA 4N9HA 5F3IA 2X5IB 5C33A 3HBKA 1OA4A 4KBZA 4QX5A 3V64A 1C1FA 1VAMA 3B9CA 5DDJ1 3SH5A 1IKPA 1OLRA 2G9GA 4FP3A 3T0AA 3WF2A 2LUWA 1C8M3 1WCKA 1C4RA 1HIXA 1SCRA 3ALQA 3P5BA 2HWB3 4IV1A 4XF9A 1JYWA 5ABJC 1JZ7A 1XNBA 2F17A 2XKOA 5FPAA 1WLDA 1YFWA 3ZXKA 3I3MA 1KRIA 1BMV2 4L97A 1JYNA 1NCQC 2QFEA 1VBB1 3THTA 1NLRA 4MADA 1MQTA 4YZ5A 4FP2A 1OPMA 1FX5A 1DGWA 4XQWA 1UO9A 1YRZA 2VVDA 4B29A 3PL0A 4GXLA 4QQHA 2CAUA 3WHUA 4LA2A 3OGSA 4XMAA 2B45X 1K5MC 3AXEA 2ZEXA 3OSDA 1BLZA 2R043 4YZ4A 5CFCC 3M3QA 1GZTA 5K4LA 1QQP2 2YROA 1LNSA 1VMHA 2P34A 1B09A 3WQ0A 3FX3A 1AYN1 2LM3A 1XC6A 1YQ6A 2QZ3A 3D4KA 2GC3A 2DYCA 4IDZA 4UOJA 3VZOA 4YFZA 3FUOA 5EPAA 2QUOA 5FPXA 2PELA 3AZVA 1D4VB 1LEMA 5KHHA 3IAQA 3OBAA 3VDDB 1ODMA 2VPVA 3KVBA 2R32A 3KT1A 1RUF3 1QNWA 3DYMA 2EICA 1PGSA 2EXKA 2R072 4YZ2A 5LW9A 5M0TA 4WVZA 1UQXA 3GXUA 4WM8A 3RZHA 2HJIA 1TE1B 2LTNA 1ZBE1 2WNVC 1ASJ2 4IV3C 3WDTA 3USUB 4AQTA 2BWCA 2GU9A 2WAOA 2YGMA 3OPWA 3BTAA 2XBO3 4NRMA 1NOVA 5LEJA 3NNMA 2EIDA 3JD73 4Y5Z0 1E5IA 1MS4A 4YWAA 5FPBA 1PK6A 3RYPA 4EE2A 3MW4A 4OMCA 3ZDSA 4DRVA 4AQ6A 3KHBA 1O5LA 2KXLA 1XNAA 1OMIA 3N9OA 4UW4A 3B69A 3M4FA 1NCRB 2JDKA 4IETA 3VZKA 3VUOA 5BPXA 2BV4A 3ELNA 2ZJCA 5JIAA 4OVEA 3TNQA 3VKNA 1NLSA 1H8TA 2VOWA 4LBMA 2CGNA 1ENXA 3S7IA 2ZOEB 2VMGA 4Q29A 2NZ9A 1Z7S2 2OS2A 4E4ZA 5FZDA 3O5SA 5AFEA 3NNGA 4KQ7A 4PJYA 5AC92 5D8AC 4BHPA 1AYM2 1LU2A 2HWD1 3ILRA 1SDDB 3RZMA 1O91A 4XW3A 1H9PA 3FFQA 2XJRA 3SKVA 4AZZA 5FZOA 3ZN4A 5FBJA 3AYAA 1MS8A 1J1LA 1EAH2 1OSGA 1QHDA 4NHXA 5CVRA 5KHKA 5LA0A 3S0MA 2HWE2 3ZPOA 3UJQA 3U4XA 4Q5OA 5B2GB 5FZ6A 1EV11 2AC1A 5KC6A 3INAA 3DXUA 4WZFA 5JPNB 1PVXA 4YVSC 3MIHA 2Z2SB 4CCOA 2GN3A 2VMFA 2XGXA 4NIHA 3OPTA 4FPJA 1QJY3 3ZYBA 3WEZA 3S7EA 2VOVA 4FFGA 1DQ5A 4Y20B 4GWNA 4Q4Y3 1S0IA 2BYVE 3WW2A 5LATA 5BNPB 4ZS3A 4A7YA 4LJHA 5CEHA 5IK8A 2JDAA 1E57A 2JDMA 3LEIA 1JUHA 1CZTA 2YZ4A 5FZKA 3B7MA 2DBNA 2Q0AA 4DXSA 2C0ZA 2JDUA 3S5QA 4CU8A 1OA2A 3LQCA 3N9LA 2YUEA 1P8JA 4OCTA 2VD7A 2ILMA 1MZ6A 1VBC3 3JU9A 4IEYA 4Q2FA 4QPIC 4Y4RA 2JG8A 2BBAA 4XMIA 4YG3A 3CEWA 3DYPA 4LBLA 3J7MA 4UYBA 1ENQA 3MIGA 4Q4X2 1BVP1 1KDMA 1WMEA 1AL22 2DU0A 4NIAA 4CUBA 5A3LA 4K8RB 1FPN2 4EQVA 3ASIA 1QEXA 2ZX4A 2AR6A 1RUD3 4Z8BA 2EIGA 4DUWA 4UBGA 2WA3A 5FV3A 4OI1A 2W0XA 1QJX3 4B3NA 2DVGA 3CF6E 1LECA 1ULFA 1HRI1 2GC2A 2KR2A 4BQ5A 4DUVA 5KHIA 5K7PA 1A34A 5IK5A 3WF1A 1CWPA 3M70A 4ARXA 2VNVA 3I3DA 2OUHA 2CV6A 1HV0A 2BJSA 3E1F1 4P14A 4QPYA 4XBNA 2SLIA 1H0BA 1RMU1 2X09A 3E5QA 1OXCA 4E4HA 5AFBA 3W5NA 2ORZA 2AACA 2J1TA 3ZSMA 5T5JA 2ZBJA 1QJFA 2RS33 1G8WA 3ST7A 3M2MA 2IC1A 2KD7A 2GDFA 1UOJA 1QDCA 3DEMA 4BQ2A 3GZAA 3VBOA 5C8CC 2XG3A 1DQ1A 1YWKA 1S55A 3KGZA 4NAOA 3GALA 5GM0A 1Q8VA 4CP9B 4MUVA 1O4ZA 1REDA 3ZXJA 4Y5SA 4LT5A 1Q3EA 4OI4A 4CP0A 2SBAA 3SISA 4N90A 1JOJA 5FMCA 5I91A 4OYUA 1IZ3A 3GYDA 4RR3B 3PU3A 2XL7A 4XJ9A 5JOZA 3L2YA 1RHI1 5LRRA 1NE6A 2LALA 3BCWA 4WM7A 4AW7A 5C4WB 3J9SA 1NKGA 1D2SA 3BB6A 3E97A 2QDRA 4K1YA 5FZEA 3APBA 4Y1VA 2IXJA 1NZIA 4HK9A 1JUIA 5BNOA 3T2PA 5FMOS 2VECA 1AR72 3RYRA 5KHJA 1PIV2 1SZBA 1DZRA 2B9VA 5A33B 1DYKA 1Y9MA 2J22A 4KBBA 5HCHA 1ZRCA 4NIGA 4QX7A 2B7YA 4HPKB 3V0BB 4Y24A 2A6WA 5FUNA 3AM2A 4HK8A 4OQ8A 2XHNA 2EIBA 2DTWA 4QKDA 3TEXA 5DAWA 4LIUA 5EJ1B 1KEXA 4H7LA 4KWKA 3URFA 3WP4A 1IQAA 1LGCA 2JE9A 2V72A 1YNAA 4IE7A 1XE0A 2XB6C 3LEGA 3HQUA 5DAPA 1XXNA 5T55A 2IFWA 4KH9A 3U10A 4JGZC 1D4M3 1KS5A 4QKFA 1POQA 1FMD1 2WNUA 1OH4A 2YHJA 4FFIA 5HCBA 5KXBA 1PGL2 4RFRB 2JD9A 4OQ9A 1HN1A 4CDXC 3PUQA 4EWAA 3VN4A 3AP9A 4TXWA 1LOAA 4YGEA 3MYXA 3J7HA 2GC1A 1U12A 4V1PA 1L7RA 1NA1B 3AKRA 4XCAA 4XHBA 4X6RB 4CUCA 5FQ0B 5CFDB 2Q30A 5C8WA 1PK6C 2HEWF 2VJXA 3WZ1A 4XF4A 5FO9B 4C8DA 1VBA3 4N8MA 1FNYA 2QDNA 2VU9A 5C5UA 1J59A 2D5HA 3Q8FA 4CDUA 1NXD1 4IEXA 2FDJA 4O61A 3ZMOA 2IXIA 3LPGA 5K0UA 4XCBA 4BMEA 2RDNA 3KV4A 4V2WA 3N9MA 2CYFA 1ULDA 1H8TC 1AL0G 2MEV2 1RUE3 1ALYA 1V6IA 1GNZA 4CXXA 1K12A 3T2QA 2VE1A 1UX6A 2YC2A 3PTYA 3MGUA 3H8OA 5FJKA 3ZYFA 1KGYA 3H1MA 1YEWA 2PHLA 2UYBA 1E5HA 4D3WA 2FDIA 1RITA 1PZ9A 3IDEA 4QWNA 3DYOA 3OTFA 4NO4A 1S2BA 1HKDA 4DXZA 4Z1VA 3O1MA 1DQ0A 4XBLA 4CTEA 2VUCA 1W06A 3U78A 5H9RA 1UIKA 4J6GA 2FDGA 2ZGRA 4IGQA 4QPGC 4XPVA 3AMQA 3WNMA 1W28A 5EJZB 1QXRA 1COV2 3GNEA 4LOTA 4AI3A 5H9SA 3BGAA 1W8UA 3G7DA 3HMYA 4QQPA 4JRLA 1CESA 4BZ4A 4A41A 3LSDA 4RHV1 4AHWA 4DS0A 2GMEA 3ZFGA 2JKXA 1ND3A 4UBHA 4P9WA 1W6MB 4FFHA 1UMHA 3MIDA 3S57A 2DBIA 5FAXA 1JZ8A 1I5PA 1OURA 2VQAA 3ZXLA 2Q4SA 2RG4A 2XOMA 4JHTA 4XXPA 1LULA 1SPPB 3MFCA 1VP6A 4YVWB 5L9VA 3KQRA 4NVPA 1RUC1 3WF3A 3JBG1 1SBFA 3MEPA 1G9BA 2GALA 4QM9A 3VKLA 4CCKA 4ASKA 2PHRA 4M3CF 1SLLA 4BQWA 2XJTA 4YFWA 4C90A 2WO3A 5JOXA 3V0AB 4Q4W1 4BK4A 2BU9A 3KD4A 1FNZA 4YW7A 2IWGB 2RJLA 1X8EA 4EV0A 3ILFA 2GNMA 4AYUA 3WT3A 5FZ3A 2EIEA 3HT2A 1G9AA 1DU3D 2NPIA 4NWVA 1Y9GA 2EF6A 1WW4A 3D5OA 2WYFA 1VRH2 4DOUA 4N7IA 3E5XA 1O5UA 3POBA 1QJZA 1YI7A 4IGPA 2ZZJA 5JI7A 1ND2B 2DVDA 1CJPA 4I3GA 5F32A 2BZDA 5IATA 1V6KA 4XF0A 5D21A 1NLQA 1POV1 5DDJ3 5T5LA 2VUJA 2HYKA 2WYSA 1RTVA 1WLCA 5IFPA 3Q8CA 4NRQA 4FSJA 1DQ6A 2RMU3 1TME1 3VBSB 2WA4A 1BK0A 1RUI1 2ZKLA 3VBOC 4D6RA 4LUKA 3IMNA 1BBT2 2D6PA 3RZZA 1EPZA 4A44A 5IYYA 3OY8B 3PJYA 2HBUA 4L9BA 5EYYA 4UFMA 1VBB3 4COVA 5B4NA 1DF0A 2LROA 2RR12 2A3YA 3HVDA 2W91A 3PUSA 4AVBA 5JXGA 5F7UA 5D1IA 4DO0A 4JV4A 1GICA 1GQPA 1UWWA 3FN9A 4GJYA 4CCJA 4Z2WA 3NQHA 3ETQA 3MO4A 1ZZCA 2DURA 2I74A 5H9PA 3SCHA 4K6BA 2W52A 1JMUB 1W3VA 3WG2A 2R063 4JGYA 2C1FA 3HD8B 5FZIA 4YSFA 5FLHA 5F5IA 2VZ3A 2GNBA 3HT1A 2DCTA 1W6OB 2VW1A 2WZ8A 4AFBA 1OLME 3RJ2X 4ZY9A 3L9JT 4MXWB 5IK4A 2Y0OA 1REEA 4GMP1 1US2A 1HRI2 2XXZA 3NV1A 1OHFA 1WMXA 4RS5A 4A2UA 1W0PA 1WKYA 3FC0A 4BE3A 1CAVB 4CCCA 1UYXA 3DPRA 4IE0A 4MGYE 2JDNA 4N43A 2P6HA 4COZA 3LE0A 4KU7A 1GZWA 2V4AA 5C9AC 5J3UA 4IW3A 1AR63 4B7EA 4J1WA 3M3OA 3ZPYA 5JSOA 5EQUA 5EHDA 2MHFA 2HWC2 3UV9A 1LU1A 4HSJA 4QPWA 3E6DA 2OZ6A 1J83A 1VB2A 4NUBA 3NKGA 3OGGA 1QQP1 5ACA2 1DGLA 1ZBE3 4K20A 4GZ9A 1XE8A 3QD6A 2PLV3 2G9ZA 2E6VA 2NM1A 4HETA 4XDPA 4EWDA 4PDWB 5A7QA 2Z4FA 5GZEA 4MGTA 1ODNA 4IE6A 4XIKA 1OOPC 1RC6A 1XRUA 2EXJA 3M3IA 5C5TA 4R9DA 1WWYA 1O59A 3IT8A 1RVF3 1RL3A 5A3TA 1D7PM 3AMMA 1Z78A 2XDVA 2VUAA 2VQTA 1UOFA 3LAGA 3UT0A 1YFXA 4XFFA 5KBFA 3FHAA 4YM2A 2FCUA 3WSOA 5FXWA 4FTSA 1ENRA 1UZVA 3NKTA 3N7JA 2VZVA 3IPVA 4CPBD 4HG6B 4AL9A 4Q0PA 1W05A 2HWD3 4Q27A 4URTA 1XB9A 3WNOA 3R4SA 4RQPB 1PVC1 1JU3A 4YGCA 5F5AA 5A7SA 4AK3A 4LPLA 2CNAA 1JZ4A 2ZHMA 1LGNA 4FPKA 1DGWX 1EV13 2G19A 3NAPA 4G4FA 5DPNA 1LR5A 1RUH2 1IGOA 4Q0SA 1W2NA 3AVSA 1CQ9A 2XR4A 3KT7A 2E9QA 4R8HA 3PUHA 3TB0A 2FMDA 1XOYA 3Q8EA 1Z7S1 2XKPA 5G04L 4MH0E 3T0BA 3THCA 4A3ZA 4CEYA 2RDSA 5AC91 1W3XA 4AEDA 1AYM1 2Q1MA 3LKJA 3H1WA 3BKZA 3P1IA 4JHZA 1PZ7A 3H3ZA 5FWJA 3ZSJA 4YARA 1EAH1 4XURA 4C0HA 3AZYA 4XAEA 1HRV2 2HWE1 2WLQA 1Q8SA 3A0NA 3OYWB 5J48A 5FY1A 4XFGA 3S30A 3ZFGC 2WINB 1GMMA 3I3QA 4QB2A 4OHVA 2L9LA 4BM8A 1HQWA 5ANNA 2BNMA 4MGZE 4GB32 5GLVA 3WQ7A 3HNYM 2ZEWA 4GH4A 2W92A 2PHUA 4JC1A 2Y33A 3ZSKA 5FLJA 4C91A 3VGIA 3FWEA 5FCCA 4LHKA 2ORXA 3PNAA 1G86A 3FFZA 3UL2A 1BVVA 4DUXA 2UWAA 1WCSA 5HV0A 1R092 1JYTA 3W21A 3VBFB 4CDWC 2JE7A 4LKSA 3FMGA 2YY1A 4IQPA 3MW2A 1GQGA 4FAGA 3WG3A 4YZ3A 2CDOA 4LLFA 4E4DX 1CAWA 3BPZA 5E1RA 5B4XA 4DY3A 1BXHA 1LJ7A 1AR93 1AL21 1LOFA 1W8TA 1X50A 2FMYA 3KGLA 3ZN6A 1CGPA 2YPDA 1FPN1 4ZXKA 5FPUA 2B8MA 2W39A 1Y43B 3CHXA 1XYPA 3KF3A 3Q8AA 5FZ0A 5ABJB 2P4EA 4DZGA 1A6CA 2QVSB 2Y6LA 3OOXA 4Q1RA 4DY5A 3QLQA 4FPFA 2CY6A 1H1MA 1LKNA 3ZFEA 4LUMA 5DAQA 1LODA 2PYTA 4IEZA 2YBPA 1F35A 2PHFA 3J7LA 3P3NA 4NOTA 2E31A 5IW0A 3ZYGA 5C7GA 3BUCA 3K4ZA 1RHI3 3AP7A 4JDMA 4BMBA 1DGRN 4F7ZA 2X5IA 2EAAA 1W0OA 2OUJA 3AX4A 2B39A 4NJ4A 5JPMB 4EZ4A 1K5MB 1V9U1 1V6LA 1DDLA 4X8PA 5E6HA 4DRRA 5CFCB 3P3PA 1L7LA 1O8PA 2ADDA 5FY4A 5KXCA 2WZPP 2JG9C 3NV4A 1N1VA 3IKWA 1UYPA 1WZXA 4RD7A 4FOQA 3AFGA 4Q4W2 4QX8A 5DZGA 5C3PA 1Y9QA 3AKTA 1R1A3 4LE4A 4LITA 2KA3A 2P1BA 1ZBA2 2VCBA 4AG4A 5L9BA 5J37A 1DZQA 1Q8QA 1OUSA 5CKMA 3LFIA 1DYOA 2Z79A 4FOYA 2VZTA 4ZS2A 3SLIA 1J3RA 5BUVA 3SITA 2HLEA 4LTAA 4RS5C 1RUF2 2Y34A 4XUQA 3UGHA 1R64A 2ZGNA 3CL1A 4CEWC 4FTBA 1JU4A 4CYDA 3BIEA 1J84A 4BXSV 1GV9A 2A3XA 3DPRC 3JB4C 4XILA 5FPZA 5T52A 5JSRA 4N43C 2WNVB 3POYA 2GMPA 4IV3B 3W20A 2TUNA 2W94A 2VZOA 3AMHA 1I3HA 1NZCA 1U5XA 1W6QB 3RZLA 3VBUC 5CIRA 1JZ2A 3IAPA 2VG9A 2FDKA 2GP5A 1PIV1 4LE3A 1JZ6A 2Q1ZB 1FMD3 1RINA 3ZOIA 3LOIA 1GOFA 4RGGA 4E9KA 5IVJA 4Q26A 1W8WA 2H0BA 1BEV3 1S2EA 2OA2A 4QDQA 3VDDA 2VXRA 3TOJA 2MNGA 3H0OA 3MW3A 2W3JA 4YM3A 1ZZBA 3AKQA 3U0ZA 2R0FA 1RUG1 2GNTA 1C57A 1YLLA 2B46X 3OUJA 5F3CA 2P5BA 3AJYA 1XYOA 1GQHA 3USUA 4I3PA 5D8AB 4L99A 4AE2A 5ERLA 4PT6A 4XDQA 3C7FA 2WZEA 4XACA 2VO5A 1HDKA 3FHQA 4JQRA 1PGL1 4Q4V2 3KSCA 4FOWA 4H7MA 4OULA 1RJ7A 5AVPA 3KCXA 1UW8A 3ZLIA 4Y22B 4XZPA 4KG0A 2A7AA 1OQEA 1NCRA 4LKEA 3BYWA 4ES9A 4HT1T 5GZDA 2W9XA 4YVSB 1MR5A 4WVMB 1VBE2 4XJ8A 1YXWA 2VVFA 2J1RA 3I7DA 3SH4A 4H55A 1OD5A 4MSVA 1GZ9A 2VTXJ 4GIQA 4DEQA 2YFUA 1WD3A 3PVBB 1LAJA 1DBNA 1V0AA 3NAPC 4M3CE 5A3MA 4LMFA 2MEV1 5GZGA 3DN7A 4MXVA 1MZ5A 4KWJA 3TBDA 4R52A 3ACLA 4XDOA 3WG4A 4ATEA 4A6SA 1H2LA 1PM4A 4JKMA 4CUAA 3OUHA 3AYDA 1F2NA 1MPXA 2WO2A 3RPQA 4BLJA 1FAYA 4AEDC 3VHPA 3POIA 1NT0A 2PQQA 3KMHA 4NROA 2CU5A 2WFF2 5L73A 4D6QA 2J1AA 2JENA 3R6SA 5A32B 5KXDA 3QH7A 3E6CC 1GR3A 2VNGA 2YB7A 3LCPA 3O12A 2Y8KA 4GWJA 2OYZA 4QGMA 3H8XA 3BN6A 4C1XA 3LDRA 4K8FA 2WJSA 4Y20A 5JI9A 3B02A 4MGQA 4IEWA 5BNPA 1RUC3 3I4IA 4EN6B 4Y1ZA 4LQRA 5ISLA 1COV1 1HW5A 1WA6X 4OZXA 4MG2A 4C0BA 4LHLA 4MHUA 4PQQA 1OLQA 4KG8A 4N7UA 5H9QA 1CX1A 3SNMA 3S5AA 3FJSA 2A1XA 4EROA 2PA7A 4TZDA 4BISA 4HOOA 4DFSA 5CKQA 1U5ZA 1PVC2 3MPBA 3W9AA 1SCSA 3J4UH 2JIJA 5L7OC 1O3TA 3TN92 2WZR3 2J1VA 2ZA9A 3OD0A 5IJRA 3R4UA 4BXFA 4CXYA 5C8CB 4KGQA 2LW8A 3HR9A 2JDYA 1HV1A 4IE4A 1ZNPA 3EXUA 3MDPA 2ZX0A 4AVCA 1G9CA 1F5JA 1IG0A 2CDPA 1LOFC 1CZVA 3IN9A 1VIWB 1POV3 4DPNA 1S0EA 1OUXA 2CSGA 1X8MA 4B4QA 5K9YA 2K2SA 4XUTA 1D0HA 1G7YA 5FZ4A 2A73B 1QIQA 4I09A 4AQ2A 4ASLA 5EZWA 3BTYA 4UXAA 5F3EA 3VD5A 2J7MA 4GWMA 1UY1A 1HQLA 4LBJA 1VRH1 2TEPA 3N9QA 4I30A 1ULCA 4N53C 5JZGB 1XSRA 4HKLA 4YW3A 1GZCA 4M00A 2DFBA 2CGOA 3ORJA 4M0NA 1X82A 2XLAA 5LCWL 3VD4A 2ZX2A 1GYKA 1PO23 3T1LA 2X5IC 1MS3A 2D3PA 3I2KA 1R081 4CP9A 3IIAA 2JE8A 2R1DA 2WQ4A 1W04A 2OIIA 4MYEA 3MLJA 1STMA 4Q0UA 4RR3A 1MVEA 3WDVA 3MF6A 1BBT1 3PURA 2XMLA 4TWTA 4D7SA 5JMOA 3O0XA 1IQDC 4GMP3 2FHRA 3QOPA 5C4WA 1K5JA 3ZR6A 1ZRRA 2G1MA 3EHKA 2RR11 2WO1A 4F3JA 1SFNA 2QQOA 2B9UA 4HN1A 4QX1A 1CPMA 3JQWA 5A80A 3H8UA 3RGBA 2P3JA 5LY2A 3VKOA 4KNCA 3GBFA 1CJDA 3WG1A 1XU2A 2DCYA 3PVNA 2EXHA 3ILNA 4IERA 1V6OA 1WMFA 2KM2A 4XHXA 3SEPA 2D97A 1UF2C 1X7NA 1ULGA 2YU1A 4JGZB 4BH9A 3A4UA 1MEC2 3BALA 4E8DA 1REFA 2BTVC 4U36A 1UY3A 4AF9A 4CDXB 1HXS2 4QKBA 5A33A 5FMOL 1QQP3 3RYKA 4CEYC 2RS52 3A23A 3JZVA 4ET7A 5A3PA 4YW5A 3QACA 4XZUG 1LOGA 5KXEA 4HPKA 1O8SA 5IFTA 3V0BA 2BDRA 3FLPA 1JTZX 2FZ2A 2A6VA 2VOXA 1NQDA 1YC61 1PK6B 2VQUA 2XWBB 3PHMA 3MHZA 4LO8A 1UYZA 4WVWA 2WR9A 1QWRA 1W9YA 3I54A 4HVOA 4PHZA 5BV6A 2JKBA 4DB5A 4LULA 4GWIA 2VR4A 3I2JA 3J26N 3AZZA 3T1MA 3VDDC 3AYEA 1FXZA 1VBD1 3AKPA 2HWC1 1I9RA 2OPKA 4P00B 1UU5A 1V9U2 3PU8A 5FOJB 1HQNA 1SACA 2R073 2RDQA 3BODA 1HB1A 4JX0A 1RUE2 3NJZA 1S0DA 2VH9A 5ACA1 3A22A 1ASJ3 1Q56A 4KWUA 1M06G 5I0DA 3ZFFB 3POEA 4FCAA 4BIOA 1PO11 5BYNA 5C71A 4IV1C 1Q8OA 1UPIA 4IL7A 1AXZA 1S0FA 4XQ4A 1NA1A 5CFDA 2FDFA 3SEEA 2YU2A 3AXDA 4QXKA 1HB3A 1YQCA 2DFCA 2H0VA 2BUKA 2DCJA 4LK7A 4OHWA 3CKHA 1QDOA 1UAIA 1XSQA 3GGLA 4H2AA 1BZWA 2VOKA 3VBHB 2TBVA 2ZX3A 2OT7A 4QPGB 1MQTC 4UFLA 5FZLA 1JI6A 3CBNA 5IVBA 4K7JA 3ACGA 2ZCWA 4BQ4A 1ZZ7A 1F9KA 5FYIA 4HFSA 4BQ3A 2HWF2 2AUYA 4XF1A 4BQXA 1KJLA 2GMMA 1Z7S3 2PAEA 3AZWA 3K2OA 5FXXA 1WGPA 4XYXA 4EWEA 5AC93 4SBVA 3PUIA 3T3YA 4BOWA 1WBLA 3VDBA 4Y4YA 1QMJA 2XJUA 1RUJ3 3POFA 5FY7A 1EAH3 3LIGA 3LZZA 2D98A 3PVOA 4GAZA 2GH2A 1W90A 2AEYA 4Y26A 4BIFA 2A3WA 1RUH1 2H6BA 1RUG2 4Q0VA 4LHNA 1RUOA 3MUZ1 4P9XA 4CA9A 3MICA 1APNA 5DAVA 3CO2A 4I2OA 1O6UA 2A71A 3T4HB 3I2DA 5BNPC 3LEKA 3BI3A 5A1AA 3T30A 2BPA2 2UY8A 4CVUA 2Y60A 4PI0A 2YXSA 2ETEA 1OC1A 3NSTA 4WM8C 3UKNA 2WSVA 3M3EA 3AK0A 1HRV1 4EZHA 1UZ0A 4Y1XA 3I49A 1FOD1 5FZMA 3PUAA 5CG9A 1X33A 1SPPA 1TZOA 3FBYA 4YVWA 3JUUA 5A7WB 3EJKA 3J8F3 1GNHA 4QQLA 4DINB 4YZ1A 4FPLA 3AKSA 1UL9A 4YNIA 3ZR5A 4GB31 2E7TA 2RM22 1W9WA 4Q4X3 2XQXA 3C8XA 5JXIA 2Q1FA 1FPN3 2G9FA 1S4CA 3GBWA 2X29A 1EP0A 2EALA 5E89A 2RMU2 3VBOB 2VNRA 1X36A 1SLCA 5C3QA 4RFT0 4D8MA 5LA1A 5A6ZA 3N9PA 1R091 1UYYA 5HPOA 4NIIA 3CJIA 2OZJA 4UFJA 3MPPG 1U5IA 2XONA 4JQTA 4D0QA 3I8TA 3ZXFA 1QKQA 5BXXA 5A70A 1ND2A 2YPJA 1OA3A 3CLPA 4BJ0A 5C6CA 4WBBA 2YMZA 5LRSA 1DCSA 3LB9A 5LBBA 3KCYA 2FCTA 2EXIA 1CIWA 4PBPA 5A7OA 2VMEA 1LHUA 3MV01 1UY0A 1C8M1 2G4IA 5C3RA 4B4PA 4CP2A 1HLCA 4QM8A 3GBGA 2C9KA 3H3LA 3ZSLA 2C4XA 4Z92B 1J58A 3VBSA 3WNNA 4PI2A 3C7EA 2UYAA 4BLIA 3MBWA 1AF9A 1BQPA 4YG0A 1TNRA 2QQLA 3OY8A 1WW6A 4P5YA 2VZQA 4B4RA 3DKWA 5IVEA 4Q8KA 1GWMA 4AAPA 4RR3C 2ET7A 2Q8OA 5SV8A 5C9AB 4UAPA 4QQ2A 2QJVA 3NNJA 4PF1A 4AFCA 2O8OA 2B5HA 1SHWB 3O0WA 5LASA 3POGA 1SFPA 5HBAA 2MPFA 2CWMA 2JG8C 3K3NA 3NRUA 4AI9A 1W6OA 2A6ZA 1YO8A 4D7YA 2HYXA 1AR73 1LOBA 4NRPA 5GJ6A 4BQ1A 2B4KA 3M8LA 4MXWA 4TN7A 4RSUA 2W1WA 2AGSA 5KC5A 4WVVA 1PIV3 4CDQB 2BBVA 1TMF3 1OOPB 1ZBA1 2WN3A 1DLCA 2XJQA 1J3QA 2YFZA 2JICA 4LO4B 1CAVA 4QDSA 2Z42A 1X9TA 4FQ4A 3WR0A 1PGW1 3LA3A 4LORA 2ZMNA 5CZKA 2WAAA 2ZPXA 1RVF2 4OUSA 2QBXA 4TYSA 1MS1A 1RUF1 3DL3A 1ZRDA 3F2ZA 2N7GA 4M4RA 4QGNA 4QAWA 4IGOA 3Q9OA 3J7NA 3UK9A 4BWOA 2V09A 5I8SA 1C8NA 4YW2A 5FDBA 3IDBB 4FPCA 1VJ2A 5J96B 2VUDA 1W8OA 3ROUA 1UY2A 2W2IA 4HKWA 3VBRB 3WCSA 3AP4A 1R082 3HEIA 2Q8DA 1OBNA 4AFMA 3BTZA 3LA7A 4PDWA 1SG3A 3EYPA 2Y0IA 4AI2A 1LENA 4D94A 3JXSA 2V73A 1QJU2 2BGPA 3X29B 3BIWE 4FFFA 1QH6A 1QXPA 3ENRA 2WIIB 1UU4A 1MS5A 2WS92 1AX0A 4L2NA 4RA0A 5LY1A 2VAUA 5IVCA 1OFSA 1HB4A 1XBFA 1CD3G 2XLGA 1QNYA 5FOBB 4LK6A 4XUNA 1IHMA 5JXHA 4XABA 2WDBA 2WWJA 4LBQD 2YGLA 2YC0A 4WM7C 5DZEA 2BWAA 3VHOA 2VZSA 3CJXA 4OUMA 3IMMA 2EVXA 3VDCA 2J1EA 4I0BA 3WNLA 1NX9A 5FP8A 5JMCA 2E7AA 5BNOC 1ULEA 4Q4V1 4COYA 2MEV3 1XE7A 4IEQA 1PZ8A 4RQPA 1XU1A 1BK1A 3N35A 1ZZ6A 5J09A 2NN8A 2DU1A 4XUOA 3AYCA 4UW3A 5I0RA 1AYN3 1AX2A 2D6LX 3KQ4B 5FZFA 2ZHLA 4EN0A 4QX3A 5BNNA 3I2FA 4R9AA 3HQRA 2OQ6A 5FPVA 5CB7A 4AFAA 1GSLA 4A4AA 5FUPA 3USSA 5DMYA 1VBE1 4W6YA 1W9FA 2BQPA 5HI0A 5JIUA 2HEYF 2BOJA 3LFMA 2WC2A 1PNGA 4GULA 1L7QA 2FBEA 3FLRA 2BNNA 1VBD2 1L3JA 4RGAA 1RIRA 5FZ9A 1MZFA 4L92A 5F6KA 5FYBA 1VALA 2VM9A 2ZGTA 3MFAA 3OD4A 5JR2A 4QXCA 5EJ3A 4JRAA 2Z69A 2BFUS 2PFWA 2W95A 4ORFA 4CDWB 5F1RA 1UIJA 1FV2A 4MOAA 3NNLA 2PHWA 1JODA 4XTPA 1PO12 5LBCA 2PXJA 3WDUA 5KR7A 1HX6A 3K77A 5CNAA 1E5SA 2WNUC 3OYWA 4GJZA 1B35B 5G05L 5FZ1A 2WFF1 1JYIA 2OVUA 3B5LB 3I59B 1UXXX 2C26A 3SH3A 4XQDA 2Y6KA 5FK8A 5L9RA 3UGGA 1CX4A 4CZSA 1AR92 5FTTC 1W8HA 1YIPA 3SQOA 1QH7A 1BYHA 2C24A 4ZONA 2I45A 2GNDA 3WQBA 2WL1A 3LPFA 2GZWA 5LWBA 4HMZA 3GDBA 3T2TA 4CDUC 5A6QA 4IEUA 2VY0A 5DG1A 4AHZA 1LTEA 3VBFA 5K0UC 1HJGA 4OHXA 1VPHA 4MLOA 1CAXB 4P08A 2W5FA 2YV8A 3MLKA 3VKMA 3WOGA 3C7OA 5IAVA 2QTWB 1URXA 2A6YA 5F5QA 2IUWA 1VRH3 1T6BX 2F6BA 3CJIC 4UFKA 3ZO0B 3TN91 5HV4A 3OBRA 5EV7A 3AP5A 4YG6A 4XFAA 3HIFA 4JKKA 3WD5A 2IFRA 5A3NA 5ABJA 2JG9B 3DKQA 1IKQA 1YFYA 3B00A 4MGKE 4BPZA 2ZAHA 3FZ3A 5IK7A 1AX1A 3HJRA 1DZTA 2RE9A 3VBSC 1R1ZA 2BRTA 2D6MA 3NW4A 4A3XA 5LA9A 1BBT3 5C3OA 4K1ZA 2ARXA 2ZTNA 5HXVA 1WCQA 2K9ZA 2XQRA 5DXDA 5FZHA 4OUEA 4CEWB 3WF4A 5A1LA 2QNKA 4O7XA 2A70A 1FOD2 3AVRA 1K5MA 4NPMA 3LA2A 3MLLA 3PIJA 5FWEA 3WUCA 1ND3C 4AVVA 2WQ8A 3WNKA 3ETPA 5IUQA 1RXFA 5CFCA 1IS6A 2VXJA 3VBUB 1GWKA 4LO6B 4MVTA 1W2UA 3CNAA 1YI9A 4YM0A 3K4AA 2BGCA 4E2QA 4JVAA 1O4YA 2ENRA 4LO7A 3HPNA 4F8AA 1BEV2 2GH8A 4NR1A 1OQDA 2WNEA 3TYJA 1FYUA 5FY0A 1HRI3 1NY72 2OPWA 1S0JA 2RS12 1UD1A 2UU8A 1AR82 3ZMNA 1GWLA 4RL7A 3PVEA 3H50A 3E6BA 1WA4A 1QXJA 3EB7A 5E8AA 4D69A 1RMU3 2WNVA 3RRDA 2OXBA 1GFF2 1N1YA 4IV3A 2CHHA 1W6QA 5HXMA 1DYPA 2DDUA 1KXGA 2TNFA 5FYCA 3U14A 4M3CB 1S0CA 1F31A 1LOEA 1CAUB 1C8M2 1D4M1 2HWC3 2P2KA 5FYSA 4LNVA 3TNPB 2HWB2 1MEC1 4QX0A 3RDIA 3M7AA 4QDRA 4XE9A 1A78A 4MGSA 4B7KA 1HXS1 1C28A 5ACA3 1XNTA 2BEOA 2RS51 2WWSA 5HCFA 4CP1A 1YQ2A 1NCQB 4LBQB 3HAGA 3ME2A 5IAXA 2OKXA 3W58A 3WNPA 3WXPA 4MV2A 2ZMLA 1W6NB 3CQOA 4BCUA 1SDWA 2P17A 4FI9A 5GLZA 3OUIA 1KFXL 2JEMA 3NV3A 5FKCA 3THDA 3ZKYA 1W39A 2QQIA 4K9SA 4COWA 1CONA 3U37A 2R0HA 1YJLA 3K48A 3LIHA 3OJBA 2XH6A 3LOBA 5D8AA 1LHVA 5FBZA 2ZEZA 3WLUA 2R042 1RUE1 3JCIA 3VHRA 2PAKA 4FPOB 3SCGA 3G6JB 4ASMB 5T50A 4KU8A 2NP0A 3T09A 4UW5A 4EN7B 4JGYC 4AEDB 3KHCA 3I2GA 1WCDJ 4AQSA 1OFNA 1UKRA 4GQ7A 1MACA 5EWSA 5J7MA 3B93A 4FOVA 4YVSA 3K75B 3UYJA 4WVMA 4LXLA 1PGW2 4YLZA 2XWJB 1XPWA 1K45A 1UMZA 2JDPA 4UT5A 4URAA 4ITCA 5L36A 5BNNC 1SLTA 5FXZA 3AL5A 4YW6A 1T2XA 1OKOA 1WW7A 2YBSA 1XYNA 1W6PB 2HEVF 5IVFA 4E27A 2VCCA 1W03A 5BY5A 2D5FA 3KCCA 2HWF1 3FE5A 2XBO2 4GD4A 3NWKA 5FLIA 1SQ4A 4AWDA 3K4DA 3SCFA 1W8NA 3IIIA 3JD72 4P02B 4R4XA 4W65A 3FL7A 2W68A 4I0WB 3ZYRA 3FUQA 2FZ1A 4XJAA 3I2OA 1H1AA 1PX3A 2WBKA 5L7OB 1HJFA 3BOWA 5A32A 2ZZQA 1XNCA 2UWCA 1HRV3 3A0KA 3QCWA 3WW1A 5JUVA 2WZR2 2JECA 2P3YA 3H7YA 4Y33A 4P9IA 4WZCA 2Q8EA 4YM1A 1UKGA 3AB0A 2XVGA 3WV6A 2IXCA 1IS5A 1NG0A 2VBDA 5F3GA 2ZGLA 2XVKA 4XOGA 2BP6A 5GZFA 4AAXA 4QB6A 3R4DB 5CBLA 1S1AA 1JHJA 3PMEA 2VZUA 4HL0A 3BPSA 4HVQA 5KHGA 2VTXA 3B3QE 3SMHA 1KD7A 3KVAA 2R7EB 3WP6A 4S2DA 4Z2AA 1R093 2Y38A 4YW1A 4ZZ8A 3O7OA 4N53B 1WCUA 3QH6A 3S6PA 1DIWA 3KV6A 4JDOA 2UY9A 5J1XA 1IS4A 2ARBA 3O0VA 3B94A 3VHNA 1PO22 1AVBA 5C8CA 1I5ZA 1MZEA 2GC0A 2WT1A 1I6XA 2HBTA 4GKYA 1GUIA 4CU9A 4DNYA 1QJY2 3DV8A 4LLOA 3WNXA 5KWRA 2RM21 1G9DA 1G9FA 1DQ4A 4Q4Y2 2ZGSA 1OVPA 5A7NA 3O1RA 3OGJA 2RMU1 2ZX1A 3NL1A 4KL1A 2J1SA 4AGGA 3POJA 1UX7A 5JWPA 1RYYA 3ZSEA 2ADEA 5DN2A 3DUIA 4INDA 3VD9A 2ZGKA 5GLUA 4FAHA 1LCLA 5JZGA 3ZYPA 4QPIB 1VBC2 3WW4A 1YYNA 3GJAA 4RHV3 5F5CA 5JXJA 4L8QA 4G9SB 1V6MA 3GHNA 3ZIWA 3I2HA 4YGBA 1EPWA 2PQSA 1NAEA 2CWSA 2ZXQA 4KWLA 4O9EA 2R061 1U0AA 5JCTA 1FI2A 3NMBA 4UFHA 2NMNA 2IZWA 3GCWA 5FY9A 4DIQA 2E53A 1SLIA 1RUD2 4M0HA 4YPJA 3AMNA 3JBG3 4G3YC 1Q5OA 1TQ5A 3AJZA 4P9JA 4CEYB 1E5RA 4BQYA 1QJX2 4DXRA 1RUNA 3OGVA 4UF0B 2JJ6A 5JSPA 4AGVA 4GH4C 4OHYA 5GLWA 4IUGA 4Q4W3 5LBEA 4CU6A 1OD3A 1D0GA 5A6XA 5EYXA 4OI0A 1WBFA 4R4ZA 1ZBA3 5A7PA 3UKVA 5FJHA 2CGPA 5FZBA 3TEZA 5DUVA 3MUY1 3N4MA 2E51A 1JHNA 4HANA 4XETA 5APAA 1AR61 3IWZA 4K40A 1W8ZA 1O3RA 2VTFA 2RS32 2NQYA 1SBDA 4JGZA 4J25A 2DCZA 3O1PA 5C70A 3GM8A 3FHIB 3U75A 1DHKB 2W46A 5CU1A 2X53S 3K51A 4QX2A 2Q8CA 4CDXA 5LZ6A 2PLV1 3SHRA 1XNDA 2X10A 4XIOA 2WNOA 1POV0 1SFYA 4IV1B 3SKJE 4AXOA 1W9TA 1GP6A 2WUHA 2X8KA 4NE9A 1W0NA 2AH2A 2UWBA 3JB8A 1DLLA 3LDKA 1TME3 3BTXA 1RUI3 2DVAA 4FPGA 1UOGA 5FMBA 1N3PA 5DG2A 5T5PA 2H6CA 1RVF1 2X05A 2W1SA 3U1XA 3ZFEC 1KFUL 4EN9B 1MQTB 5BNQA 3RS6A 3MZHA 2ZHKA 2ERFA 2EA7A 4Q8LA 4XF3A 4AVAA 1IPSA 2P3KA 3MIFA 1JZ5A 1S2KA 2O8QA 3RQ0A 1T6GC 5E88A 1KITA 4QHBA 4I01A 1KS4A 3NJYA 2VULA 4IESA 3RI9A 2FDHA 3ZFFA 4S2GA 2R16A 3CZJA 4LO5B 3H3UA 1C5IA 2WQZC 1WLTA 3WINE 2ZHNA 3B9IA 5CADA 4Q4V3 1QJU1 3AP6A 3POSA 1RUJ2 2CTVA 1PM7A 4LEJA 4CUGA 4E8CA 4GMP0 4LBOA 3NJVA 2WS91 4OFGA 3RVHA 1W9SA 3TRSB 4XTMA 3FBMA 4MGIE 3VBHA 5FYZA 3VZMA 4Q0QA 4E2SA 4QPGA 3JQXA 3WY6A 2QZ2A 4RN5A 1VBE3 4JAAA 4ZKTB 2VL4A 1YQ5A 2PHXA 5FY8A 3VL8A 1Z0HA 3RSJA 1OVSA 5I93A 1RXGA 1F15A 3PIGA 5EXOA 2WT2A 1JH5A 2QQVA 4FQZA 4S2HA 1SMVA 1D4M2 3LGRA 4ZU5A 1VRBA 2CAVA 4CE8A 1YQ8A 4S2FA 2B42B 3HN1A 2XJSA 4W8JA 2OW4A 4WM8B 3C7HA 3ATGA 4NN0A 2DTYA 2WSUA 1G6NA 1OKQA 4OZOA 4QXBA 5FY5A 4NHLA 5IVVA 2D6OX 4AGRA 3MIBA 4UFIA 4KI5M 2RV9A 4GA9A 2VMIA 4MX3A 5DQ0A 1AHSA 1LHOA 1JXNA 4AHYA 1SEFA 3J8F2 2BW8A 2WFF3 1RGSA 1XJAA 3PDQA 1N47A 5DUXA 1VBA2 3RMXA 4FTEA 2QKDA 1CPNA 1O4TA 1RB8G 4O9GA 4D7TA 3EQEA 1RJ8A 1JW6A 2PHDA 1H6XA 3ACIA 1H8TB 1AXKA 1BJQA 3D3AA 4QB1A 4AR2A 3ZIXA 4ONUA 4M01A 2VNOA 2JB4A 3C3VA 1H2KA 5FO8B 4FXGB 3K3OA 4TLFA 1M4WA 1W2TA 3IZOA 4AOCA 1ACCA 4B8EA 5FQ0A 2R30A 3IDCB 1PMJX 5A7WA 1PVC3 1OH3A 3LD8A 3KV5A 5FZOB 5GZCA 4CRQA 3LWCA 2VMHA 4I0AA 4HVRA 2O1QA 3VD3A 4ES8A 1AR91 2BVBA 2GSYA 3TN93 1NCRC 1ZM1A 1JYVA 3KT4A 4XXAA 3WP5A 4H14A 5CA6A 4MZUA 1QOTA 3O14A 3VZJA 2F4PA 1OLMA 3OEBA 2A75A 4L11A 1K42A 2VC9A 3ON7A 4Y3OA 4MHRA 4QGLA 3KWVA 3RJRA 1H4HA 1UPSA 4XBQA 1OF4A 4AFDA 4JKLA 2WLPA 2C6SA 1AYM3 4QKNA 4MO3M 1ZZ9A 2A6XA 3D82A 4ZPIA 2JX9A 3I3EA 1OQ1A 2I2SA 2NLRA 1YJKA 2VZPA 4XAAA 2D93A 4AVSA 2QQKA 4XFIA 1JN2P 2HWE3 4HSLA 2IVJA 2XL9A 3T4VA 5JZGC 2J1UA 3ZX7A 4QMAA 5EP9A 5I8TA 3Q8BA 2JG8B 1N1TA 1LHWA 1CVNA 4KGGA 1JYXA 2VCAA 2OQ7A 4L0PA 2O14A 2VW0A 2RJ2A 2WWUA 3QBQA 1DGRA 2E26A 1TNFA 4A42A 1ZVFA 2V4VA 1S0BA 2PMWB 2VGDA 5LK5A 4CCEA 5T5OA 4BB3A 3GZTB 1R1A1 1TMF2 1MVQA 3BVCA 3N9NA 2XUMA 3H7JA 3RFRA 2WABA 2AZ5A 1LGBA 1W6MA 3ZYHA 5C9AA 4A45A 2J42A 3AC0A 4FO9A 1UMIA 3OCPA 1GLHA 1ULOA 4KMQA 4QD2A 4Y5TA 3GZUC 1NUKA 2C5DA 3B01A 3ECQA 3U11A 5A1FA 5HCAA 1H1IA 5FP7A 4AVTA 5DABA 4BK5A 1VMJA 2XJVA 5F9TA 1JZ3A 2BOIA 1WUVA 4ISRA 5DDJ2 1F8VA 1N1SA 1AL23 1KJRA 2XUEA 1ZA7A 3PMSA 1EY2A 2VZ1A 3ZDVA 4JDNA 3V0AA 1ULPA 1MEC3 2QQWA 4XJZA 5F8PA 2BERA 4CDQA 1OOPA 1QGLA 2HKXA 5FIXA 1ZYBA 1HXS3 1IPKA 1BEV1 2RS53 4HN0A 3NNFA 3WQ1A 5L19A 4A7ZA 1VBB2 3KB5A 2Z5WA 1NY71 1QJEA 3N7KA 3R05A 2ET1A 3ES1A 2D43A 2P37A 2RS11 1BHGA 2R49A 1AR81 2IXLA 4OI2A 3C2UA 2PHTA 4J1XA 3LF7A 4Q1PA 3A21A 4WM7B 5CISA 3ZYIB 1H4GA 2XPJA 1PX4A 1LB2A 2ZGMA 4XC9A 3TWIA 4LHSA 3HNBM 3VBRA 4W6XA 2R062 4AI8A 5IT6A 3O1VA 4AEKA 1V9U3 2E33A 4SLIA 5F6LB 2HWB1 2YDEA 5BNOB 1O3QA 3U07A 5JAXA 1NQJA 5FREA 5LK7B 4LIVA 4XJWA 5F2SA 1GNYA 1UY4A 3OBTA 5FZ8A 4DEVA 5F39A 1XNKA 1AYN2 4PIYA 3CMGA 3ZFFC 4ZZ5A 5CKNA 2JXAA 3MF9A 5JR7B 2K46A 5A3WA 4K3UA 5LBFA 5A6YA 1HN0A 1VB4A 2QQUA 2QQJA 3DCQA 2ZACA 4OLLA 2C9AA 3HOBA 4PCRA 5I0SA 3KZ4C 2GP3A 1Y4WA 1MS0A 5C4WC 3GHMA 1AR62 2R1BA 5F2WA 3VBHC 2Y6JA 5FZAA 4O65A 2HH9A 1WLWA 2R041 2VBPA 4UW6A 4HZFA 2ZAAA 4AHXA 1ZBE2 3WW3A 2HWF3 2PLV2 5GKAC 3UKTA 4H3WA 3VV1A 2P6CA 2WNUB 1J3PA 3KF5A 1PNFA 1QY4A 1SLBA 1UN1A 3NO8A 5K8SA 5FK7A 4PQ9A 3V56A 1ZA4A 3O1UA 2V5DA 2ZMKA 4C1WA 4EYUA 1Q8PA 2ZGPA 3VZLA 3DXTA 3O1SA 2VMCA 4ARYA 1GBGA 3M1HA 1LEDA 4CSWA 1JOBA 3OF1A 1EYBA 3UETA 1RUG3 4EN8B 5J36A 3H9AA 4AI0A 4QU2A 5FYMA 4NIDA 4CDUB 3RZJA 1GOGA 5K0UB 2XBO1 3OBZA 4LOSA 1K3IA 1UCXA 1YCIA 4X6QB 4CDWA 5FYVA 1CZSA 2XHKA 2HWD2 2IXKA 3JD71 3NJXA 4TSVA 4LKFA 1V70A 3W59A 2V5YA 4ATFA 3D6EA 2WN2A 1B35A 5FO7B 3E5UA 2WFPA 1FT9A 1ZRIA 1WW5A 2XVLA 3I59A 3ZN5A 3CJIB 4DQAA 1CIYA 5I8YA 3ACFA 2CL2A 4N9IA 2BFUL 3ZM8A 1GANA 2WZR1 3WCRA 4IEOA 2QQPA 1US3A 1EV12 5CFDC 1NA1C 4XUPA 1MS9A 1UZYA 2ZGOA 4CU7A 5LA2A 1UU6A 4TLGA 3DGTA 2BGOA 1JOPA 2W47A 4BDVB 2R6QA 4RYDA 1GU3A 2ZEYA 3IM0A 2RM23 2BVVA 3FLTA 3O1OA 1O3SA 3N7MA 2YC4A 1KDKA 3HBZA 2I07B 4PLMA 4X8NA 5FYTA 3VDAA 1IG3A 5FFOC 3UNPA 1CAXA 4PF5A 4CCMA 2Y26A 4WV8A 3IBMA 4XFBA 2O0OA 4BA6A 4JZRA 5LEKA 3C7GA 4Y1UA 1VE0A 5FZGA 5T3NA 3I2IA 4BU2A 2LS6A 1IPJA 5JVVA 1AJOA 3LDBA 1A8MA 4HLTA 3ZFGB 1ZRFA 5SV5A 1ND3B 2JWPA 1PO21 2E32A 4BYYA 5CG8A 1ZX5A 1QF3A 3D0JA 2JG9A 1QJY1 1FATA 1ONAA 1H9WA 3CZUA 5JLVA 2ATFA 4B1MA 4Q4Y1 1PHMA 1YHFA 4JTNA 4QHOA 1F5FA 1H2NA 1H8VA 3GJBA 4NHKA 4AEMA 4ZU7A 3PJQA 2D3SA 3SC7X 3ACHA 5IVYA 5J98B 2DVFA 1COV3 2ARCA 1TVGA 1BMV1 2GAUA 3IDAA 5JOWA 2FD8A 4CEWA 1VBC1 1U5YA 3ZXEA 3HWJA 1J1TA 5FZ7A 2IVIB 4OHZA 1RMU2 1ENSA 4EJRA 1PMHX 3ZKUA 3ZXGA 4FPYA 1N3QA 1A3KA 1EUUA 3VBUA 3WDYA 3WVJA 1VAKA 2RHPA 4PLNA 1UXZA 4OMDA 4Y1YA 4ZHNA 4CCDA 1OI6A 4YVWC 1RUD1 3HNMA 5I0UA 4NWWA 2DV9A 2K0GA 1QJX1 2DUOA 1UZZA 4NAMA 1UZWA 5E16A 1C5HA 2FCVA 1SBEA 1YIFA 2BNOA 2WO7A 1JBCA 3GF6A 5DUUA 4CDQC 5F37A 4E2GA 3OPZA 1RHI2 5EFUA 2JIGA 4M4PA 4UWDA 4ZXEA 4R9BA 3K46A 3MIEA 3RZKA 3AL6A 3VKFC 3POWA 4LBNA 2RS31 1VAVA 4NPLA 1W2OA 4RGKA 5GLTA 3HN3A 4M3CA 5FP3A 3RI8A 3UESA 2VZRA 1CAUA 2R071 1LHNA 5CAZA 1ND2C 4PIZA 2ZGUA 4XEZA 5GALA 5FP4A 3D8CA 1ASJ1 4PLOA 4AI1A 4D6SA 3T0DA 4JGYB 3WP3A 1R083 3VBRC 4CCNA 1NCQA 2XJPA 4LBQA 3R0RA 4COUA 3WDXA 4CXWA 1R1A2 3D0SA 2Y64A 3ABZA 5T54A 3BOPA 1IOAA 2W08A 2Q5TA 1W6NA 3N36A 3OB8A 1JYCA 2PTMA 5EIYB 3H8RA 5IHRA 4LKDA 1QJU3 3LSEA 3ZXDA 3VD7A 1W2AX 2IXHA 4UI9L 4RS5B 1X9PA 3T2OA 3N3HA 5BNNB 2WS93 2ZABA 1QU0A 2LRPA 3GZEA 1SLAA 2ID4A 2RR13 4HONA 2DVBA 3DPRB 4IE5A 1DFQA 1C3HA 4N43B 2WKKA 3KV9A 5I0TA 5JOYA 1GZWB 1A8DA 4DXTA 1OPOA 1GOHA 1HB2A 4FVVA 1F4AA 1LOCA 1VMFA 4Z07A 3RZGA 4V2VA 5A3OA 1W99A 4ZU4A 3EMRA 4QU1A 1W8FA 3N7LA 4DMIA 1UOBA 1WD4A 1FMD2 3LEMA 4PBOA 1C1LA 5FUIA 2ARAA 1TG7A 3H42B 4XVHA 3IB3A 4YW4A 2JDZA 3RNSA 1RUJ1 1YUDA 2GN7A 2VOTA 1S0GA 2Y6HA 2ZKNA 3PTRB 4LBKA 4P5HA 5FYHA 3GCXA 5DZFA 2DCKA 2QE3A 3NV2A 3T08A 2RJKA 2DF7A 3AMPA 1Y3TA 3CIHA 4LA3A 1JS9A 5AVAA 1LRHA 2E63A 2ZGQA 1ZZ8A 2FQPA 1VLNA 2JDHA 4K21A 1H30A 4A6OA 2A5ZA 1XQNA 3ES4A 3VLBB 5C3SA 3CDZB 1W6PA 3RWKX 3ZYJB 3HQXA 4YGDA 1EUTA 2PN5A 1BCXA 4CCLA 3P6BA 3TEYA 2EAKA 3RG0A 4TTGA 1CN1A 2P3IA 1VBD3 2D6NA 5D2AA 3TAYA 2QQNA 2D6KA 3EO6A 4XJUA 2UURA 4JCKA 2QCSB 2NMOA 1NYWA 3M3CA 5L7OA 2Y6FA 1DQ2A 1YFUA 3A7QA 3IPVB 4FPEA 5DAXA 5FZCA 3I97A 2D40A 1PO13 2F4LA 4B1LA 4PDWC 5FP9A 2VMDA 3WX5A 1GP5A 3J8F1 1B35C 5LB6A 4CPBA 3VZNA 3O1TA 3UGFA 1VBA1 5DUWA 5A3UA 4META 4XFHA 1GKBA 2YYOA 3U4SA 2VQ0A 2D3RA 4Q4X1 4FBFA 3OGRA 2D44A 3NAPB 3MV11 2AREA 4YYOA 3OG2A 3BU0A 2DUPA 4IEVA 2JD4A 2YBKA 4PIXA 5FYUA 4IEPA 4QQOA 3TEWA 3I3BA 3H1YA 1V6NA 3BU7A 1V00A 2VCMA 1IS3A 4NHMA 3F95A 2VBBA 1WMDA 1KQRA 2QQMA 4N53A 2DUQA 2XLFA 4P9LA 4Y22A 4Z82A 5FKBA 5FPLA 3VL9A 3WF0A 1V6JA 4FXKB 4RHV2 2NYYA 2E7QA 4AEJA 1FV3A 3VB9A 4LR4A 3MI8A 1BKZA 3CU7A 2ES3A 4RQPC 4F83A 4NMIA 4ISQA 1F4HA 2RVAA 2RDRA 1NE4A 5FXVA 1RUC2 2PAMA 3JBG2 1RUH3 1H6YA 4U2AA 3RMYA 1VR3A 2DWRA 4P9YA 4XFCA 4FPHA 4GH4B 4HBNA 3DF0A 4W50A 1UNBA 1I1EA 1CR7A 4JTOA 3KS7A 1TEIA 4NPRA 4YRDA 2W1QA 2ZS6B 1H2MA 1ZREA 2W87A 4QPIA 1NXMA 1D2QA 2AENA 2OX0A 5IWFA 2YG0A 4FT8A 3DECA 4E4SA 3W5MA 3OEAA 5TSWA 1AZDA 3KLSA 3RWNA 3UJOA 1FOD3 1LESA 5FRAA 3EBRA 1Y7BA 1QOSA 1AJKA 2Y6GA 4P9GA 3THPA 1CAWB 3ITQA 1DG6A 4R9CA 3ZXAC 1AR71 1O7FA 2AEZA 3KM5A 3PLQA 5ANQA 4W6WA 4GB33 3ZVXA 3AZXA 4QXHA 5FYYA 3ZN6B 4A7KA 5JDBA 3L2HA 1OT5A 4UF0A 4I02A 5FR3A 1TMF1
chains in the Genus database with same CATH topology
1Q43A 3NVCA 2VW2A 1TME2 3AFKA 4IXLA 4QT6A 1RUI2 3WUDA 3SXWA 2AYHA 4HKOA 3WHTA 4GALA 1AXYA 1N3OA 3ZFEB 4GKXA 3VBFC 1QOOA 1AUYA 1PMIA 2WT0A 2RS13 2D7FA 1AR83 3V65A 2VVEA 3WDWA 4N9HA 2X5IB 5C33A 1OA4A 4QX5A 3V64A 1C1FA 1VAMA 3B9CA 5DDJ1 3SH5A 1IKPA 1OLRA 2G9GA 4FP3A 4B3NA 5J37A 2LUWA 1C8M3 1WCKA 1C4RA 1HIXA 1SCRA 3ALQA 4IV1A 2HWB3 4XF9A 5SV5A 5ABJC 1XNBA 2XKOA 1KRIA 1WLDA 1YFWA 3ZXKA 1BMV2 4L97A 1NCQC 2QFEA 1VBB1 3THTA 1NLRA 1MQTA 4YZ5A 4FP2A 1OPMA 1FX5A 1DGWA 4XQWA 1YRZA 2VVDA 4B29A 4GXLA 4QQHA 2CAUA 3WHUA 4LA2A 4XMAA 2B45X 1K5MC 3AXEA 2R043 4YZ4A 5CFCC 3M3QA 1QQP2 2YROA 2P34A 1B09A 3WQ0A 3FX3A 1AYN1 2LM3A 2QZ3A 3D4KA 2GC3A 2DYCA 3VZOA 4YFZA 3FUOA 2QUOA 5FPXA 2PELA 3AZVA 1D4VB 1LEMA 5KHHA 3VDDB 2VPVA 2R32A 3KT1A 1RUF3 1QNWA 1PGSA 2EXKA 2R072 4YZ2A 4WVZA 4WM8A 2HJIA 1TE1B 2LTNA 1ZBE1 2WNVC 1ASJ2 4IV3C 3WDTA 3USUB 4AQTA 2BWCA 2GU9A 2YGMA 3BTAA 2XBO3 1NOVA 5LEJA 3JD73 4Y5Z0 1MS4A 3RYPA 1PK6A 3MW4A 3ZDSA 4DRVA 4AQ6A 1O5LA 2KXLA 1OMIA 4UW4A 3B69A 3M4FA 1NCRB 4IETA 3VZKA 3VUOA 5BPXA 3ELNA 2ZJCA 5JIAA 4OVEA 3TNQA 3VKNA 1NLSA 1H8TA 2VOWA 4LBMA 2CGNA 1ENXA 3S7IA 2ZOEB 2VMGA 4Q29A 2NZ9A 1Z7S2 4E4ZA 3O5SA 5AFEA 4KQ7A 4PJYA 5AC92 5D8AC 4BHPA 1AYM2 1LU2A 2HWD1 3ILRA 1O91A 4XW3A 1H9PA 3FFQA 2XJRA 3ZN4A 3AYAA 1MS8A 1J1LA 1EAH2 1OSGA 1QHDA 5CVRA 5KHKA 3S0MA 3U4XA 2HWE2 3UJQA 5B2GB 1EV11 5KC6A 3INAA 4WZFA 5JPNB 1PVXA 4YVSC 3MIHA 2Z2SB 2GN3A 2XGXA 4FPJA 1QJY3 3S7EA 2VOVA 4Y20B 1DQ5A 4GWNA 4Q4Y3 1S0IA 2BYVE 3WW2A 5BNPB 4A7YA 5IK8A 1E57A 1JUHA 2YZ4A 3B7MA 2Q0AA 2C0ZA 1OA2A 2YUEA 2ILMA 1MZ6A 1VBC3 3JU9A 4IEYA 4Q2FA 4QPIC 2JG8A 4XMIA 4YG3A 3CEWA 4LBLA 1ENQA 3MIGA 4Q4X2 1BVP1 1KDMA 1WMEA 1AL22 2DU0A 5A3LA 1FPN2 3ASIA 2ZX4A 2AR6A 1RUD3 4Z8BA 2EIGA 4UBGA 2WA3A 4OI1A 2W0XA 1QJX3 2DVGA 3CF6E 1LECA 1ULFA 1HRI1 2GC2A 5KHIA 5K7PA 5IK5A 3M70A 2OUHA 2CV6A 1HV0A 4P14A 4QPYA 4XBNA 2SLIA 1H0BA 1RMU1 3E5QA 5AFBA 3ZSMA 5T5JA 2ZBJA 2RS33 1G8WA 3ST7A 3M2MA 2IC1A 2GDFA 1QDCA 3GZAA 3VBOA 5C8CC 2XG3A 1DQ1A 1YWKA 1S55A 3KGZA 3GALA 5GM0A 1Q8VA 4MUVA 1O4ZA 1REDA 3ZXJA 4LT5A 1Q3EA 4OI4A 4CP0A 2SBAA 3SISA 4N90A 1JOJA 5I91A 1IZ3A 3GYDA 4RR3B 2XL7A 4XJ9A 5JOZA 3L2YA 1RHI1 5LRRA 1NE6A 2LALA 3BCWA 4WM7A 4AW7A 5C4WB 3J9SA 1D2SA 3BB6A 3E97A 2QDRA 4K1YA 3APBA 4Y1VA 2IXJA 4HK9A 5BNOA 1JUIA 5FMOS 2VECA 1AR72 3RYRA 5KHJA 1PIV2 1DZRA 5A33B 1DYKA 4KBBA 1ZRCA 2B7YA 4HPKB 3V0BB 4Y24A 2A6WA 3AM2A 4HK8A 2DTWA 4H7LA 4KWKA 3URFA 3WP4A 1IQAA 1LGCA 2JE9A 1YNAA 2XB6C 1XXNA 5T55A 2IFWA 4KH9A 3U10A 4JGZC 1D4M3 1KS5A 1FMD1 2WNUA 5HCBA 2YHJA 5KXBA 1PGL2 4CDXC 4EWAA 3VN4A 3AP9A 1LOAA 4YGEA 3MYXA 2GC1A 1U12A 4V1PA 4XHBA 1NA1B 3AKRA 5CFDB 4X6RB 5FQ0B 2Q30A 5C8WA 1PK6C 2HEWF 3WZ1A 4XF4A 5FO9B 1VBA3 1FNYA 2QDNA 1J59A 2D5HA 4CDUA 1NXD1 4IEXA 3ZMOA 2IXIA 5K0UA 4BMEA 2CYFA 1ULDA 1H8TC 1AL0G 2MEV2 1RUE3 1ALYA 1V6IA 1GNZA 1UX6A 3PTYA 3MGUA 3H1MA 4D3WA 2PHLA 2UYBA 1RITA 1PZ9A 3IDEA 3OTFA 4NO4A 1S2BA 1HKDA 4DXZA 4Z1VA 1DQ0A 4XBLA 4CTEA 5H9RA 1UIKA 4J6GA 2ZGRA 4XPVA 4QPGC 3AMQA 1QXRA 1COV2 3GNEA 4AI3A 5H9SA 3G7DA 4QQPA 3HMYA 4JRLA 1CESA 4BZ4A 3LSDA 4RHV1 4AHWA 4DS0A 2GMEA 3ZFGA 1ND3A 4UBHA 4P9WA 1W6MB 3MIDA 5FAXA 2VQAA 3ZXLA 2Q4SA 4XXPA 1LULA 3MFCA 1VP6A 4YVWB 3KQRA 4NVPA 1RUC1 3JBG1 1SBFA 3MEPA 1G9BA 2GALA 4QM9A 3VKLA 2PHRA 4M3CF 1SLLA 2XJTA 4YFWA 4C90A 5JOXA 3V0AB 4Q4W1 3KD4A 1FNZA 2IWGB 2RJLA 1X8EA 4EV0A 3ILFA 2GNMA 4AYUA 3WT3A 3HT2A 1G9AA 1DU3D 2NPIA 4NWVA 1WW4A 2EF6A 3D5OA 4DOUA 1VRH2 4N7IA 3E5XA 1O5UA 1QJZA 1YI7A 2ZZJA 5JI7A 1ND2B 2DVDA 1CJPA 4I3GA 1V6KA 4XF0A 1POV1 5DDJ3 5T5LA 2VUJA 2HYKA 1RTVA 1WLCA 4FSJA 1DQ6A 2RMU3 1TME1 3VBSB 2WA4A 2ZKLA 1RUI1 3VBOC 4LUKA 3IMNA 1BBT2 2D6PA 3RZZA 1EPZA 3OY8B 3PJYA 4L9BA 5EYYA 4COVA 1VBB3 1DF0A 2RR12 2A3YA 4AVBA 5D1IA 4JV4A 1GICA 4Z2WA 3ETQA 1ZZCA 2DURA 2I74A 5H9PA 3SCHA 4K6BA 2W52A 3WG2A 2R063 4JGYA 2C1FA 3HD8B 4YSFA 5FLHA 2GNBA 3HT1A 2DCTA 1W6OB 2VW1A 4AFBA 3RJ2X 3L9JT 4MXWB 5IK4A 2Y0OA 1REEA 4GMP1 1HRI2 3NV1A 1OHFA 4RS5A 4A2UA 1W0PA 3FC0A 4BE3A 1CAVB 3DPRA 4MGYE 4N43A 4COZA 4KU7A 1GZWA 5C9AC 5J3UA 1AR63 4B7EA 4J1WA 3M3OA 3ZPYA 5JSOA 2MHFA 2HWC2 3UV9A 1LU1A 4HSJA 3E6DA 2OZ6A 1VB2A 3NKGA 3OGGA 1QQP1 5ACA2 1DGLA 1ZBE3 4K20A 1XE8A 3QD6A 2PLV3 2E6VA 2NM1A 4HETA 4EWDA 4PDWB 5GZEA 4XIKA 1OOPC 1RC6A 1XRUA 2EXJA 3M3IA 4R9DA 3IT8A 1RVF3 1RL3A 3AMMA 1Z78A 2VUAA 3LAGA 1YFXA 4XFFA 5KBFA 4YM2A 4FTSA 1ENRA 3NKTA 3N7JA 3IPVA 4Q0PA 2HWD3 4Q27A 4URTA 3R4SA 4RQPB 1PVC1 4YGCA 4AK3A 2CNAA 2ZHMA 1LGNA 4FPKA 1DGWX 1EV13 3NAPA 4G4FA 1LR5A 1RUH2 1IGOA 4Q0SA 1CQ9A 3KT7A 2E9QA 4R8HA 3TB0A 2FMDA 1Z7S1 2XKPA 4MH0E 5AC91 4AEDA 1AYM1 2Q1MA 3LKJA 3H1WA 1PZ7A 3H3ZA 3ZSJA 4YARA 1EAH1 4C0HA 3AZYA 1HRV2 2HWE1 2WLQA 1Q8SA 3A0NA 3OYWB 5J48A 4XFGA 3S30A 3ZFGC 2WINB 4BM8A 4OHVA 1HQWA 2BNMA 4MGZE 4GB32 5GLVA 3WQ7A 4GH4A 2PHUA 4JC1A 3ZSKA 5FLJA 4C91A 3VGIA 3FWEA 5FCCA 4LHKA 3PNAA 1G86A 3FFZA 3UL2A 1BVVA 2UWAA 1WCSA 1R092 3VBFB 4CDWC 2JE7A 3FMGA 2YY1A 4IQPA 3MW2A 1GQGA 4FAGA 3WG3A 4YZ3A 4LLFA 4E4DX 1CAWA 3BPZA 5E1RA 4DY3A 1BXHA 1LJ7A 1AR93 1AL21 1LOFA 1X50A 2FMYA 3KGLA 3ZN6A 1CGPA 4ZXKA 1FPN1 2B8MA 2W39A 1Y43B 1XYPA 5ABJB 4DZGA 1A6CA 2QVSB 4Q1RA 4DY5A 3QLQA 4FPFA 2CY6A 1H1MA 1LKNA 3ZFEA 4LUMA 1LODA 2PYTA 4IEZA 2PHFA 3P3NA 4NOTA 3ZYGA 1RHI3 3AP7A 4JDMA 4BMBA 1DGRN 2X5IA 2EAAA 1W0OA 2OUJA 3AX4A 2B39A 5JPMB 1K5MB 1V9U1 1V6LA 1DDLA 4X8PA 4DRRA 5CFCB 3P3PA 5KXCA 2WZPP 2JG9C 3NV4A 1N1VA 3IKWA 4RD7A 4FOQA 3AFGA 4Q4W2 5DZGA 1Y9QA 3AKTA 1R1A3 4LE4A 2KA3A 1ZBA2 4AG4A 1DZQA 1Q8QA 2Z79A 4FOYA 3SLIA 5BUVA 1J3RA 3SITA 4LTAA 4RS5C 1RUF2 2ZGNA 3CL1A 4CEWC 4FTBA 4CYDA 1GV9A 2A3XA 3DPRC 3JB4C 4XILA 5FPZA 5T52A 5JSRA 4N43C 2WNVB 3POYA 2GMPA 4IV3B 2TUNA 3AMHA 1I3HA 1NZCA 1U5XA 1W6QB 3VBUC 5CIRA 2VG9A 1PIV1 4LE3A 2Q1ZB 1FMD3 1RINA 3LOIA 4RGGA 4E9KA 4Q26A 2H0BA 1BEV3 2OA2A 3VDDA 2VXRA 3TOJA 2MNGA 3H0OA 3MW3A 4YM3A 1ZZBA 3AKQA 3U0ZA 2R0FA 1RUG1 2GNTA 1C57A 1YLLA 2B46X 3AJYA 1XYOA 1GQHA 3USUA 4I3PA 5D8AB 4L99A 4AE2A 4XDQA 1HDKA 4JQRA 1PGL1 4Q4V2 3KSCA 4FOWA 4H7MA 4OULA 1RJ7A 5AVPA 3KCXA 1UW8A 4Y22B 4XZPA 4KG0A 2A7AA 1OQEA 1NCRA 4ES9A 4HT1T 5GZDA 4YVSB 1MR5A 4WVMB 1VBE2 4XJ8A 1YXWA 2VVFA 3I7DA 3SH4A 4H55A 1OD5A 4MSVA 1GZ9A 4GIQA 1WD3A 3PVBB 1DBNA 3NAPC 4M3CE 5A3MA 2MEV1 5GZGA 3DN7A 4MXVA 1MZ5A 4KWJA 3TBDA 4R52A 3ACLA 3WG4A 4ATEA 1H2LA 3AYDA 1F2NA 3RPQA 4BLJA 1FAYA 4AEDC 3VHPA 2PQQA 3KMHA 5L73A 2WFF2 2JENA 3R6SA 5A32B 5KXDA 3QH7A 3E6CC 1GR3A 2VNGA 3LCPA 3O12A 2OYZA 4QGMA 4C1XA 4K8FA 4Y20A 2WJSA 5JI9A 3B02A 4IEWA 5BNPA 1RUC3 3I4IA 4EN6B 4Y1ZA 1COV1 1HW5A 4OZXA 4C0BA 4LHLA 1OLQA 4KG8A 4N7UA 5H9QA 3SNMA 3FJSA 4EROA 2PA7A 4TZDA 4DFSA 1U5ZA 1PVC2 3MPBA 3W9AA 1SCSA 3J4UH 5L7OC 1O3TA 3TN92 2WZR3 2ZA9A 3OD0A 3R4UA 5C8CB 4KGQA 4AVCA 3HR9A 1G9CA 1HV1A 1ZNPA 3EXUA 3MDPA 2ZX0A 1F5JA 1LOFC 3IN9A 1VIWB 1POV3 4DPNA 1S0EA 1X8MA 5K9YA 2K2SA 1D0HA 1G7YA 4AQ2A 2A73B 4I09A 4ASLA 5EZWA 4UXAA 4GWMA 1HQLA 4LBJA 1VRH1 2TEPA 4I30A 1ULCA 4N53C 5JZGB 4HKLA 4YW3A 1GZCA 4M00A 2DFBA 2CGOA 4M0NA 1X82A 2XLAA 2ZX2A 1GYKA 1PO23 3T1LA 2X5IC 1MS3A 2D3PA 1R081 3IIAA 2R1DA 2WQ4A 2OIIA 4MYEA 3MLJA 4Q0UA 4RR3A 1MVEA 3WDVA 3MF6A 1BBT1 4TWTA 4D7SA 3O0XA 4GMP3 2FHRA 3QOPA 5C4WA 1ZRRA 3EHKA 2RR11 4F3JA 1SFNA 4HN1A 2B9UA 1CPMA 3JQWA 3H8UA 2P3JA 3VKOA 4KNCA 3GBFA 1CJDA 3WG1A 1XU2A 2DCYA 3PVNA 2EXHA 3ILNA 4IERA 1V6OA 1WMFA 2KM2A 4XHXA 2D97A 1UF2C 1X7NA 1ULGA 4JGZB 4BH9A 3A4UA 1MEC2 3BALA 1REFA 2BTVC 4U36A 4AF9A 4CDXB 1HXS2 5A33A 5FMOL 1QQP3 3RYKA 4CEYC 2RS52 3JZVA 5KXEA 4YW5A 3QACA 1LOGA 4HPKA 3V0BA 3FLPA 1JTZX 2FZ2A 2A6VA 2VOXA 1NQDA 1PK6B 2XWBB 3PHMA 4LO8A 4WVWA 1QWRA 3I54A 4HVOA 5BV6A 2JKBA 4DB5A 4LULA 3J26N 3AZZA 3T1MA 3VDDC 3AYEA 1FXZA 1VBD1 3AKPA 2HWC1 1I9RA 2OPKA 1UU5A 1V9U2 5FOJB 1HQNA 1SACA 2R073 3BODA 1RUE2 3NJZA 1S0DA 2VH9A 5ACA1 1ASJ3 1Q56A 1M06G 3ZFFB 4FCAA 4BIOA 1PO11 5BYNA 4IV1C 1Q8OA 1UPIA 4IL7A 1AXZA 1S0FA 4XQ4A 1NA1A 5CFDA 3AXDA 4QXKA 2DFCA 2H0VA 2BUKA 2DCJA 4OHWA 1QDOA 1UAIA 1BZWA 2VOKA 3VBHB 2TBVA 2ZX3A 4QPGB 1MQTC 4K7JA 2ZCWA 1ZZ7A 1F9KA 4HFSA 4F7ZA 2HWF2 2AUYA 4XF1A 1KJLA 2GMMA 1Z7S3 2PAEA 3AZWA 1WGPA 4XYXA 4EWEA 5AC93 4SBVA 4BOWA 1WBLA 4Y4YA 1QMJA 2XJUA 1RUJ3 1EAH3 3LZZA 2D98A 3PVOA 2GH2A 4Y26A 4BIFA 2A3WA 1RUH1 2H6BA 1RUG2 4Q0VA 4LHNA 1RUOA 4P9XA 3MICA 1APNA 3CO2A 4I2OA 2A71A 3I2DA 5BNPC 2BPA2 2UY8A 2YXSA 2ETEA 3NSTA 4WM8C 3UKNA 2WSVA 3M3EA 3AK0A 1HRV1 4Y1XA 1FOD1 5CG9A 1X33A 3FBYA 4YVWA 3JUUA 3EJKA 3J8F3 1GNHA 4QQLA 4DINB 4YZ1A 4FPLA 3AKSA 1UL9A 4YNIA 4GB31 2E7TA 2RM22 4Q4X3 1FPN3 2G9FA 3GBWA 2X29A 1EP0A 2EALA 5E89A 2RMU2 3VBOB 2VNRA 1X36A 1SLCA 4RFT0 1R091 3CJIA 2OZJA 3MPPG 1U5IA 3I8TA 3ZXFA 1QKQA 5BXXA 1ND2A 2YPJA 1OA3A 3CLPA 5C6CA 4WBBA 2YMZA 5LRSA 3LB9A 3KCYA 2EXIA 1CIWA 4PBPA 1LHUA 2G4IA 1C8M1 4B4PA 4CP2A 1HLCA 4QM8A 3GBGA 3ZSLA 4Z92B 1J58A 3VBSA 2UYAA 4BLIA 1AF9A 1BQPA 4YG0A 1TNRA 3OY8A 1WW6A 4B4RA 3DKWA 4Q8KA 4RR3C 2ET7A 2Q8OA 5SV8A 5C9AB 4QQ2A 2QJVA 4AFCA 2O8OA 2B5HA 3O0WA 5HBAA 2MPFA 2CWMA 2JG8C 1W6OA 2A6ZA 1YO8A 4D7YA 5GJ6A 1AR73 1LOBA 4BQ1A 4MXWA 3M8LA 4RSUA 2AGSA 5KC5A 4WVVA 1PIV3 4CDQB 2BBVA 1TMF3 1OOPB 1ZBA1 2XJQA 4LO4B 1J3QA 2JICA 1CAVA 2Z42A 4FQ4A 3WR0A 1PGW1 3LA3A 2ZMNA 2ZPXA 1RVF2 4OUSA 4TYSA 1MS1A 1RUF1 3DL3A 1ZRDA 2N7GA 4QGNA 3Q9OA 3UK9A 4BWOA 2V09A 5I8SA 1C8NA 4YW2A 5FDBA 3IDBB 4FPCA 1VJ2A 5J96B 3ROUA 4HKWA 3VBRB 3WCSA 3AP4A 1R082 4AFMA 3LA7A 4PDWA 2Y0IA 4AI2A 1LENA 4D94A 2V73A 1QJU2 3X29B 3BIWE 1QH6A 1QXPA 3ENRA 2WIIB 1UU4A 1MS5A 2WS92 1AX0A 4L2NA 4RA0A 1OFSA 1CD3G 2XLGA 1QNYA 5FOBB 1IHMA 4LBQD 2YGLA 2YC0A 4WM7C 5DZEA 2BWAA 3VHOA 3CJXA 4OUMA 2EVXA 4I0BA 5JMCA 2E7AA 5BNOC 1ULEA 4Q4V1 4COYA 2MEV3 1XE7A 4IEQA 1PZ8A 4RQPA 1XU1A 1BK1A 3N35A 1ZZ6A 5J09A 2NN8A 2DU1A 3AYCA 4UW3A 5I0RA 1AYN3 1AX2A 2D6LX 5BNNA 4EN0A 2ZHLA 4R9AA 4AFAA 5CB7A 1GSLA 3USSA 1VBE1 4W6YA 2BQPA 5HI0A 5JIUA 2HEYF 2WC2A 1PNGA 4GULA 2FBEA 3FLRA 2BNNA 1VBD2 1L3JA 4RGAA 1RIRA 1MZFA 4L92A 5F6KA 1VALA 2ZGTA 3MFAA 3OD4A 5EJ3A 4JRAA 2Z69A 2BFUS 2PFWA 4ORFA 4CDWB 5F1RA 1UIJA 1FV2A 2PHWA 4XTPA 1PO12 3WDUA 1HX6A 5CNAA 2WNUC 3OYWA 1B35B 2WFF1 1JYIA 2OVUA 3B5LB 3I59B 3SH3A 4XQDA 1CX4A 4CZSA 1AR92 5FTTC 1YIPA 1QH7A 1BYHA 2I45A 2GNDA 2WL1A 2GZWA 4HMZA 3T2TA 4CDUC 4IEUA 2VY0A 5DG1A 4AHZA 1LTEA 3VBFA 5K0UC 4OHXA 4MLOA 1CAXB 2YV8A 3MLKA 3VKMA 3WOGA 1URXA 2A6YA 5F5QA 3CJIC 1VRH3 2F6BA 3ZO0B 3TN91 3OBRA 5EV7A 3AP5A 4YG6A 4XFAA 3HIFA 3WD5A 2IFRA 5ABJA 2JG9B 1IKQA 1YFYA 3B00A 4MGKE 4BPZA 2ZAHA 3FZ3A 5IK7A 1AX1A 1DZTA 2RE9A 3VBSC 1R1ZA