1QKBA

Oligo-peptide binding protein (oppa) complexed with kvk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
publication title Crystallographic and Calorimetric Analysis of Peptide Binding to Oppa Protein
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Protein transport
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1qkbA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qkbA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1qkbA02
4ZE9A 4QRZA 5EYFA 3R6UA 3R26A 1IXHA 3H6VA 3PD9A 1XS5A 2P1SA 3B6QA 2XXVA 2WOLA 3IOVA 1N3WA 3FGSA 4KYSA 1ELJA 3E3KA 3G3GA 1A40A 5H8HA 1N7WA 4GQOA 3PUVE 3HV1A 1XVXA 1PB9A 3TEPA 1SBPA 3H03A 3TYHA 1D3KA 4OETA 1S50A 1OLAA 3KSJA 4ISUA 1F9BA 2UVGA 2OCUA 5FHNA 4GL0A 5AA2A 1NNFA 4NF5B 4NE4A 1B7HA 2O1MA 2VOZA 1D9YA 2F34A 4EXKA 2ZMBA 1OVTA 2VP1A 3H3GA 3OO8A 3PPNA 3W15C 5I56B 3EN3A 5CM6A 1FTMA 4IY6A 4YB6A 1SQYA 4Z7EA 4MH5A 4ESXA 1N76A 2XXYA 3C33A 3UGWA 1ZJLA 3FXQA 1MY2A 3MVZA 1GV8A 3P7IA 1M5DA 4IGTA 3KOTA 2THIA 3LSLA 4Q8RA 3VLVA 3JZJA 2Q89A 4DXBA 2I4BA 3UP9A 5J1DA 3RPWA 5M2VA 3MP8A 4NF6B 2A5TB 1B9JA 3PPOA 1JW1A 2O69A 2NXOA 3RY3A 2VD3A 4UACA 2QRYA 4R2BA 2W7YA 3O6GA 3S9MC 3V89B 3RYAA 2RCAA 2ANJA 2AL4A 1A8EA 3PPRA 3H6TA 3PGFA 1N04A 3K2DA 2Z23A 5TP9B 2H5YA 2DYXA 4IO5A 1QULA 4WEPA 5H8SA 3MUQA 3ZKKA 2YJPA 1ZU0A 4ESWA 3CR9A 3T9XB 1P1QA 2IA4A 3CSBA 1DTGA 3RNNA 3M3KA 1SI0A 4IO4A 4ZEFA 1Z7ME 3RLFE 1BLFA 4JB7A 3PPQA 2AL5A 3OOAA 4OVJA 4EQBA 4QFOA 2ONSA 3IOUA 3DRFA 1MY4A 4QFKA 3KJTA 4OFLA 5ICQA 4GLIA 4QSEA 1QKAA 4JWOA 5B70A 1NNPA 3VDFA 5AA4B 4ZZEA 1AL3A 1EZOA 3ILTB 3W9WA 3H4ZA 3HPIA 1LAHE 3K01A 3CHGA 1Y3QA 3FVOA 4PFTA 2XD2A 2OWSA 1H45A 3FTOA 4LATA 4G68B 4NTLA 4P11A 5EHSA 4LZ5A 1MDP1 2B3BA 1PDAA 4NMYA 4F1YA 4EDPA 4KR5A 3G3IA 1BTJA 3B7DA 3TTMA 4LP2B 4IY5A 1MXUA 1TWYA 1P1WA 5ISUA 3FJGA 1P1NA 1YPNA 3DM0A 1J1NA 5HM4B 3R7XA 3DELB 2UYFA 4LQ5A 2F97A 3CFLA 1EU8A 1B51A 5AA1A 3O28A 3TMGA 4PQJA 2DP8A 1FTOA 5TPAB 2ZNSA 4UA8A 2B4MA 1MQJA 4BDOA 3N5LA 3DRJA 4X1BA 4ONYA 4EXLA 2F6PA 5H8FA 1LBBA 2OLBA 5I58A 3M8UA 4GF8A 3RGYA 3PUYE 2XX7A 3T96B 4NF8A 3FATA 2ZYOA 5KDTB 5I57A 3USDA 4JBZA 1QVSA 3TKDA 3CG3A 2H25A 1B5HA 4MLQA 1HSEA 3QAXA 3DRKA 3VXBA 5DVJA 3UK4A 1B6HA 3IB2A 1NNTA 2D3IA 3KN7A 4DXCA 1DMBA 3EHSA 2Y84A 2FYIA 4JWXA 1QKBA 2I6EA 1MH4A 2Z8EA 2F5XA 3O97A 3TCGA 2HZLA 5CMKA 2QS2A 4OTEA 1VR5A 1MY1A 3G3FA 3N26A 5L8DA 4L17A 3W9VA 3MP1A 3TFLA 1RYXA 3SESA 5CRYA 4NWCA 1AIVA 2G93A 4BDNA 4YU0A 3I5OA 5I2NA 1P1UA 4GXSB 2V93A 1M5FA 3QXMA 4G8MA 1S9TA 3EF7A 4WXJA 3TTNA 3DP8A 4OFJA 3S4UA 2X7PA 5BUUA 3SETA 4WEDA 2HEUA 2V3UA 4OESA 4F39A 1GTKA 2Q9TA 4BDMA 5DVFA 3MC2A 1B3FA 1MXXA 2OWTA 3IK6B 2DWHA 3MVXA 1H43A 3G3JA 5F1QA 1UIUA 4ZEKA 4F31B 1B5IA 3IO6A 2REJA 4H5GA 4YAHX 1B4HA 4O3CA 4ZE8A 5ITOA 3G3KA 2ONKE 3T9HB 4HCWA 3K6UA 3SEXA 4YB5A 4ZECA 3VVEA 2DQVA 1FCKA 2PMSA 4U1ZA 2O68A 1TXFA 1JEUA 1US5A 2FNCA 3BFTA 1IUDA 3D4GA 1Y9UA 1B32A 1MH3A 2DE4A 5L9MA 4QFPA 3K6VA 2B3FA 3N94A 3VFJA 3KGCA 2I0BA 2LAOA 2Q2AA 1BIYA 2RC8A 3IB0A 5I2KA 1USYE 1DPEA 1MM7A 4P0IA 5CMCA 3SKPA 3QUFA 3MZ1A 5CI5A 1B5JA 3TCFA 3UA8A 2DVZA 4OENA 2O7UA 2Z8FA 4LVQA 2Q2CA 4HTGA 4ZZAA 3FJMA 1T0KA 2F6GA 2NUVA 1MQIA 1FTKA 3WAFA 3OENA 1URGA 3IL1B 4GXAA 4R9FA 3MBPA 5TU0A 3DRGA 2R6GE 1OQHA 5JTYB 2Q88A 3T66A 3ONMA 3S9LC 1ZLQA 2F7BA 1IXIA 5KZTA 3HHGA 4JSOA 1PC3A 1SYIA 4NF5A 1DPPA 4U23A 2I48A 3LSFB 4OXVA 5DYHA 2NOOA 3H6WA 1MM6A 3U8QA 1PB8A 1NH8A 1OQGA 1POTA 3TPAA 2GRVA 3MVYA 5I56A 1NH7A 4DXUA 2F8DA 1MY0A 4G2ZA 2Y7KA 1LCTA 3K00A 3MPLA 1GR2A 1FQFA 2R9JA 3MWBA 1MXVA 3Q27A 2ALUA 4FJPA 2QMWA 3TCHA 1NNKA 1TFAA 2H9BA 4E0WA 2UVJA 5FHOA 3N6TA 3BKIB 4R75A 4OWDA 1LAGE 4NF6A 1B3HA 2A5TA 3SEVA 1II5A 3MW0A 4XKPA 4JWYA 1MG1A 4R72A 1R1NA 3K1PA 2GHBA 4YICA 2I0CA 2WKYA 1US4A 4ZS9A 3ODBA 2A5SA 3TODA 4H0WA 3MVWA 3FVNA 2XXTA 5TP9A 3S2VA 3RN8A 3SDFA 4TLLB 4FAJA 4PE5B 3C32A 1A54A 1LB9A 1JETA 4AB5A 4ELOA 3TAJA 4ZEDA 1CE2A 4U4XA 4EQ9A 2GFEA 5DEXB 3OXNA 4XKRA 2O84X 3IJXB 1LB8A 4BDRA 3PAMA 4NEDA 4U21A 5FTIA 5IKBA 2DSFA 3RYBA 2HAVA 1PEBA 1R6ZA 2XXUA 3OSRA 4M4GA 1MXZA 3C9HA 4Q0CA 5K2YA 5AA4A 1XT8A 4C1UA 2O6AA 4R9GA 3ZS6A 1N3XA 3H7MA 3RTFB 3QIMA 4K3FA 1JVYA 3F11A 4M1VA 5LOMA 4QHQA 2AIXA 4G68A 1FQAA 3SEUA 4EF2A 1QW0A 3C31A 4F2OA 4GIZA 1MPCA 4KD5A 1EH3A 1SVXB 3SERA 2Y7IA 1DTZA 1MDQA 3TTKA 3C34A 2ZYNA 4GL8A 2D5WA 3JV9A 3L6GA 4HS7A 3IORA 3CSGA 1AOVA 2FA7A 1VFEA 2XHDA 4RYAA 3RT8A 4DZ1A 1Y1ZA 4KQPA 2Y7WA 5H8NB 2HCAA 4XIGQ 1B40A 5A5XB 1IQ7A 3GZGA 2QSXA 1MRPA 2UYEA 2VGQA 3DP6A 4YKJA 5AA2D 1HSLA 2RF1A 3UN6A 4BDQA 5TPAA 1RYOA 3FVKA 5CC2A 5I84A 3O9PA 1URDA 4H1XA 4MF3A 4RNSA 3PMXA 4TQUQ 4BLAA 4KHZE 4PFYA 2XXIA 4F2QA 5HPQA 1MQDA 1TFDA 3PU5A 3WAEA 3K0VA 3VVFA 4F3BA 1P1OA 1PBQA 4KYEA 2BJJX 2VD2A 3EQ1A 2OK2A 3PV0E 3LBSA 2H98A 1POY1 1ZIUA 1B0HA 3CFZA 5KDTA 1JVXA 3KBRA 1B3EA 3EHTA 4QFNA 3G3HA 1N84A 4PETA 3MP6A 2DS9A 3U94A 3BFUA 2P0SA 1YCJA 2F35A 1NMUA 2M8CA 2I49A 1UTHB 1QUJA 4GD5A 3IOTA 1MQGA 3U72A 1I69A 3T9UA 2G29A 1I6AA 1ZKBA 4Z0IA 3OSQA 4F3GA 4F18A 4QSCA 4PP0A 3MAMA 4I62A 4FE8A 3UIFA 1DSNA 3PD8A 3C36A 4EF1A 2F36A 4IO2A 2NWJA 3G7WA 2AYSA 3QSLA 5B7DA 1UTBB 4HW8A 1B05A 2PX1A 2QJEA 1IIWA 3MZ9A 4RPNA 4DE8A 1WDNA 2XXPA 4NWDA 5AE4A 3E4RA 5H8QB 3IR1A 2DVCA 4H65A 3KJ7A 1B4ZA 3GBBA 1BKAA 3FXUA 1Y1MA 4ND9A 1VSOA 1N7XA 1JW4A 1MY3A 3K4UA 2R71A 5KCJB 2V3TA 4GOTA 2PT1A 4C1TA 1FW0A 3CI8A 2ZXTA 4F1VA 4DLDA 4PFUA 3GBAA 3PPPA 4FORA 1FQDA 4AQ4A 3LSWA 3CIJA 3TQWA 4KCDA 4FECA 3THIA 3TDJA 2GH9A 4R74A 5CMBA 1QUKA 4RK2A 3Q28A 4X48A 3B6TA 4LUBA 4HCYA 4XKQA 1B1XA 2DE2A 4O3AA 2WOPA 2QS4A 3H6UA 4FEBA 3HHFA 2H4IA 3FVGA 3FD3A 3ECRA 3CVGA 2QPQA 5ICTA 3LVUA 1YTVA 3MJNA 4PFWA 3QK6A 1ZBMA 3K1NA 4KFQA 4C0RA 1IITA 3MQ9A 2Y7RA 3L6HA 4F1UA 4OEUA 1LAXA 4NF4B 2PBWA 4WKMA 4DCYA 2QL3A 3SEYA 4F29A 3ILUB 2HAUA 3RTWB 3U1OA 4YKIA 4O3BA 4LONB 5CBRA 4OYVA 3KG2A 4Q30B 3T93B 3OO9A 2F78A 4ZEIA 5CBSA 2DE3A 2P2AA 2XXXA 2YLNA 4DCXA 3EPEA 1H76A 3SEWA 3HSTA 4OERA 1FQBA 4DIGA 1QJMA 3U93A 1GVCA 2CMOA 4POXA 1ZMGA 4OQOA 1AH5A 1OVBA 5I59B 4FIMA 2RC7A 5JTYA 2B65A 4X9TA 5JEIA 3LUYA 4IB2A 5FTHA 3B6WA 4X1DA 3VE1B 2HZKA 3LC8A 4GVOA 2XX9A 4RPOA 1M5EA 4QSDA 2Q8JA 4GRKA 5DVIA 4G77A 4LQ2A 4OFOA 1OLCA 3FJ7A 2V84A 3IO4A 4ELPA 1EZ9A 3KZGA 3O29A 5H8HB 5K2XA 3TELA 1UIVA 1NL5A 3TTRA 4H8JA 4G8NA 1B3LA 3PUWE 3ZSFA 1QUIA 2ZNUA 3OO6A 3I6VA 4U1OA 3FUZA 3O6HA 3TZAA 2I3WA 1CB6A 5AA2B 4E0XA 3O2AA 2REGA 1FTLA 5L9SA 2DWJA 1H44A 1PBPA 2HQ0A 4TOZA 1USYH 3H06B 1D9VA 2DOJA 2I4CA 3VLUA 2ESNA 4YKPA 2XXWA 1B7ZA 3Q29A 1LBCA 4KI0E 5EHMA 4R6YA 1B7UA 3O6PA 1A99A 2QS3A 3M3FA 3UORA 2DWIA 1B2HA 3FZVA 1URSA 3S9EA 4YZZA 3KOSA 1M5CA 1Q1KA 3V5AA 3VLWA 5IAIA 2QMXA 5DEXA 2Z8DA 1LFIA 1SW4A 1KWHA 1NFTA 4H8IA 1L5TA 3HO7A 4N6PA 1P99A 5BWJA 1A8FA 2X7QA 4GWOA 1H3DA 2ZYKA 4R73A 2UXAA 2O51A 4FEDA 1O7TA 5ITPA 1MXYA 3DLNA 3IB1A 3I3VA 2UVIA 4I8CA 2XXQA 3D4CA 3PUXE 4RK9A 1XHYA 2Z22A 1A7LA 1Y4CA 1IEJA 3C35A 1LFGA 1MQHA 3K1MA 3S9NC 4DDDA 3ZKLA 2O1LA 4U22A 4F19A 4XXUA 4R6KA 3C4MA 3O6IA 3OMBA 5DT6A 3FV1A 3JYRA 2ABHA 3T22A 4R2FA 2ONRA 2OBGA 4MFIA 3FV2A 4R6HA 4F3SA 4H67A 1IZ1A 5H8NA 3GXAA 1M5BA 5A5XA 5JK4A 2VHAA 3VXCA 1VFDA 3OEKA 1LGBC 3Q26A 4N13A 2ZYMA 3K6XA 4GFRA 4OMBA 3HN0A 4YMAA 4QF9A 2V3QA 3PUZE 3OELA 2PT2A 4ECFA 2RC9A 2WOKA 3MZBA 2H99A 1AMFA 2PYYA 3VV5A 4LA9A 1SD3A 3QUJA 1N0TA 1O63A 2D21A 3HCQA 1EZPA 1IXGA 1PB7A 1NKXA 4H6DA 1JW5A 3TQLA 1WODA 4ELRA 3FIRA 1OMPA 3TUSA 4Q5TA 4OEVA 1Y4TA 3DRHA 3FASA 4ELQA 3IJOB 2DXYA 1HSJA 2DXRA 1FQCA 3OD7A 1Q35A 1R9QA 2F7AA 3CG1A 5H8FB 5ELVA 5I58B 2ZNTA 4G68C 1UTHA 2I58A 2Y7PA 3KEIA 4F3PA 2V25A 4XTCQ 1FQEA 2X26A 2KLFA 4NF8B 3VVDA 4RA1A 1ZTYA 4XKNA 4KPTA 4TLMB 4I9DA 5I57B 3V8XB 1B58A 3GLBA 1B52A 4KCCA 4BDLA 1BP5A 2YPNA 4OHNA 3KFMA 1I6BA 1MS7A 4JXIA 4MBPA 1S7YA 1SW1A 3OO7A 3KN3A 1UTBA 4YKKA 2DWAA 1Z7NE 2NVUB 4LZ7A 1Y3NA 5DTBA 4U2RA 3IAZA 2XXHA 4RJZA 2B4LA 1LCFA 3CRBA 5H8QA 4RXLA 3LR1A 1B1HA 5FHMA 2RCBA 3N6UA 2XD3A 1DOTA 3A3UA 3AXFA 1SDXA 4IO3A 4THIA 3RUMA 5KCJA 3RQTA 1MPBA 2F7CA 2I3VA 4N07A 1MPDA 5L9OA 3U92A 5I2NB 3PMWA 4FATA 4JDFA 1SW2A 3V83A 3O66A 1R9LA 4POWA 1SI1A 2IEEA 1B46A 2OZZA 1TT1A 5AA3A 3FXRA 1FTJA 1XOCA 4YMBA 5F7VA 1Y20A 4YB7A 2GHAA 3K6WA 4H5FA 4LZ8A 3T9VA 2CZLA 4QFLA 1LLSA 2XX8A 2E1SA 2QS1A 3EHUA 1LAFE 3E13X 2O7IA 5CMMA 1D4NA 1VE4A 2PVUA 4MLVA 3E9XA 2HXWA 2HFBA 3KN8A 5HBCA 3TTLA 1OIBA 1YAEA 1O64A 2OJTA 4I1DA 1LFHA 1XVYA 4ZEBA 3BBRA 2XXRA 3IX1A 3K02A 1RKMA 1UQWA 2UVHA 3PMVA 4IO7A 3DRIA 2E0SA 4RY1A 3IOWA 3LSXA 1Y3PA 4EQ7A 3Q25A 4NF4A 4P0GA 4U4SA 1A55A 1IXCA 3DP4A 1ANFA 1I6QA 4G4PA 1B3GA 1LSTA 3CFXA 4OZ9A 1WVJA 1XC1A 4AB6A 1JEVA 3MPKA 3KSXA 2RKMA 4EUOA 1ATGA 1JQFA 4IGRA 2RINA 3OEMA 3RT6B 3A09A 3M3LA 1B0LA 1GGGA 3QYTA 1SYHA 4G8HA 4IO6A 1JNFA 4KYDA 1MXWA 1SW5A 3A3CA 5I2KB 5I59A 4ZDMA 4JSDA 4F22A
chains in the Genus database with same CATH superfamily
4ZE9A 4GWZA 1FBEA 4QRZA 5EYFA 3R6UA 3R26A 1IXHA 3H6VA 3PD9A 1XS5A 2CEXA 2P1SA 3B6QA 2XXVA 2WOLA 3IOVA 1N3WA 3FGSA 4OVRA 3ISPA 4KYSA 1ELJA 3E3KA 3G3GA 1A40A 5H8HA 1N7WA 4GQOA 3PUVE 3HV1A 1XVXA 1PB9A 3TEPA 1SBPA 3H03A 3TYHA 1D3KA 4OETA 1S50A 1OLAA 3KSJA 4ISUA 1F9BA 2PFZA 4NN3A 2UVGA 2OCUA 5FHNA 4GL0A 5AA2A 1NNFA 4NF5B 4NE4A 1B7HA 2O1MA 2VT5A 2VOZA 1D9YA 2F34A 4EXKA 2ZMBA 4X8RA 1OVTA 2VP1A 1LBXA 3H3GA 4PFBA 4MCOA 3OO8A 3PPNA 3W15C 1Q9DA 4P8BA 5I56B 3EN3A 5CM6A 1FTMA 4IY6A 4YB6A 1SQYA 4Z7EA 4MH5A 4ESXA 3B8BA 1N76A 2XXYA 1NV2A 3C33A 3UGWA 4HE1A 1ZJLA 3FXQA 1MY2A 3MVZA 1GV8A 4MNIA 3P7IA 1M5DA 4IGTA 3KOTA 2THIA 3LSLA 4Q8RA 3VLVA 3JZJA 2Q89A 4DXBA 2I4BA 3UP9A 5J1DA 3RPWA 5M2VA 3MP8A 4NF6B 2A5TB 1B9JA 3PPOA 1JW1A 2O69A 2NXOA 3RY3A 2VD3A 4UACA 2QRYA 4R2BA 2W7YA 3O6GA 1CNQA 2XWIA 3S9MC 3V89B 3RYAA 4MX6A 2RCAA 2ANJA 2AL4A 1A8EA 3PPRA 3H6TA 3PGFA 1N04A 3K2DA 2Z23A 5TP9B 1FPKA 2H5YA 4PAFA 2DYXA 4IO5A 1QULA 4WEPA 5H8SA 3MUQA 3ZKKA 2YJPA 1ZU0A 1AWBA 4ESWA 3CR9A 3T9XB 1P1QA 2IA4A 3CSBA 1DTGA 3RNNA 3M3KA 1SI0A 4IO4A 4P47A 4ZEFA 1Z7ME 3RLFE 1EYKA 1BLFA 4JB7A 3PPQA 2AL5A 3OOAA 4OVJA 4EQBA 4QFOA 2ONSA 3IOUA 1INPA 3DRFA 1MY4A 4MAGA 4QFKA 3KJTA 5I5PA 4OFLA 2XA5A 5ICQA 4MNPA 4GLIA 4QSEA 1QKAA 4JWOA 5B70A 1NNPA 3VDFA 5AA4B 4ZZEA 1AL3A 5EQ7A 3ILTB 1EZOA 3W9WA 3H4ZA 3HPIA 1LAHE 3K01A 3CHGA 4PE3A 1IMCA 1Y3QA 3FVOA 4PFTA 2XD2A 2OWSA 1H45A 3FTOA 3PTYA 4LATA 4G68B 4NTLA 4P11A 5EHSA 4LZ5A 1MDP1 2B3BA 3SZPA 1PDAA 4NMYA 4F1YA 4EDPA 4PAKA 4KR5A 3G3IA 2Q8MA 1BTJA 3B7DA 3TTMA 4LP2B 4IY5A 1MXUA 1TWYA 4MMPA 1P1WA 5ISUA 1FBCA 3FJGA 4HE0A 3GYYA 1P1NA 1YPNA 3DM0A 1J1NA 2JJKA 3T0JA 5HM4B 3R7XA 2QVVA 3DELB 2UYFA 4LQ5A 2F3DA 2F97A 3CFLA 1EU8A 1B51A 5AA1A 4NGUA 3O28A 3TMGA 1KA1A 4PQJA 2DP8A 4P9KA 1FTOA 5TPAB 2ZNSA 4O8MA 4UA8A 2B4MA 1MQJA 4BDOA 2WYKA 2XWVA 2XXKA 3N5LA 3DRJA 4X1BA 3KBZA 4ONYA 4GWYA 4N6DA 1NV3A 5IZ3A 4EXLA 2F6PA 5H8FA 1LBBA 2OLBA 5I58A 3M8UA 4GF8A 3RGYA 3PUYE 2XX7A 2QFLA 3QMFA 3T96B 4NF8A 3FATA 2ZYOA 5KDTB 5I57A 3USDA 4JBZA 1QVSA 3TKDA 3CG3A 2H25A 1B5HA 4MLQA 1HSEA 3QAXA 3DRKA 3RPLA 3VXBA 5DVJA 3UK4A 1B6HA 2QVRA 3IB2A 4MEVA 1NNTA 4N8YA 2D3IA 3KN7A 4P3LA 4DXCA 1LBVA 1DMBA 3EHSA 2Y84A 2FYIA 4JWXA 1QKBA 4P56A 2I6EA 1MH4A 2Z8EA 1EYIA 2F5XA 3O97A 3TCGA 2HZLA 5CMKA 2QS2A 4OTEA 1VR5A 1MY1A 2VPNA 1G0IA 3G3FA 3N26A 5L8DA 4L17A 3W9VA 3MP1A 2CZIA 3TFLA 1RYXA 3SESA 5CRYA 1FBPA 4NWCA 1AIVA 2WX9A 2G93A 4BDNA 4YU0A 3I5OA 5I2NA 1P1UA 3FXBA 4GXSB 2V93A 1M5FA 3QXMA 4G8MA 1S9TA 3EF7A 4WXJA 3D1RA 3TTNA 3DP8A 5ESYA 1NV6A 4OFJA 3S4UA 2X7PA 5BUUA 3SETA 4WEDA 3MYUA 1LBZA 4MHFA 2HEUA 2V3UA 4MNCA 4NG7A 4OESA 4F39A 1GTKA 4QXDA 2Q9TA 4BDMA 5LTCA 5DVFA 3MC2A 1B3FA 1MXXA 2OWTA 4JVIA 3IK6B 2DWHA 3MVXA 1H43A 3G3JA 5F1QA 1LBWA 1UIUA 4ZEKA 2Y5KA 4XEQA 4F31B 1B5IA 3IO6A 2REJA 4H5GA 4YAHX 1B4HA 4O3CA 5ET5A 4ZE8A 1NV1A 5ITOA 3G3KA 2ONKE 3T9HB 5A5LA 4HCWA 3K6UA 3SEXA 4YB5A 4ZECA 1YYZA 5ET7A 3VVEA 2DQVA 1FCKA 2PMSA 4U1ZA 2O68A 1TXFA 1JEUA 1KZ8A 1US5A 2FNCA 3BFTA 1IUDA 3D4GA 1Y9UA 1B32A 1MH3A 2DE4A 5L9MA 4QFPA 3K6VA 2B3FA 3N94A 3VFJA 3KGCA 4PTKA 2I0BA 2LAOA 2Q2AA 1BIYA 2RC8A 3IB0A 5I2KA 1USYE 1DPEA 1MM7A 2BJIA 4P0IA 5CMCA 3SKPA 3QUFA 1BK4A 3MZ1A 5CI5A 1B5JA 3TCFA 3UA8A 5EQAA 1RDXA 2DVZA 4P1EA 4OENA 2O7UA 2Z8FA 4LVQA 1FPFA 2Q2CA 4HTGA 4OA4A 4ZZAA 3FJMA 1T0KA 1K9ZA 2CZKA 2F6GA 2NUVA 1MQIA 1FTKA 3WAFA 3OENA 1URGA 3IL1B 4GXAA 4H46A 4R9FA 3MBPA 5TU0A 3DRGA 2R6GE 1OQHA 5JTYB 2Q88A 3T66A 3ONMA 3S9LC 1ZLQA 2F7BA 1IXIA 4UABA 5KZTA 3HHGA 4JSOA 1PC3A 1SYIA 4NF5A 1DPPA 4U23A 2I48A 3LSFB 4OXVA 5DYHA 2NOOA 1IMFA 3H6WA 1MM6A 3U8QA 1PB8A 1NH8A 1OQGA 1POTA 3TPAA 4O94A 2GRVA 3MVYA 5I56A 1NH7A 4DXUA 2F8DA 1MY0A 4G2ZA 2Y7KA 4N8GA 1LCTA 3K00A 4MJOA 3MPLA 1GR2A 1FQFA 2HXRA 2R9JA 3B50A 1FPJA 2V4CA 3MWBA 1MXVA 3Q27A 2ALUA 4FJPA 5EYGA 2QMWA 3TCHA 4O7MA 1NNKA 1TFAA 2H9BA 4E0WA 2UVJA 4I3EA 1YXIA 5FHOA 3N6TA 3BKIB 4R75A 4OWDA 5IGAA 1LAGE 4NF6A 1B3HA 2A5TA 3SEVA 1II5A 3MW0A 4XKPA 4JWYA 1MG1A 4R72A 1R1NA 3K1PA 2GHBA 4YICA 2I0CA 2WKYA 1US4A 4ZS9A 3ODBA 4PBQA 2A5SA 3TODA 4H0WA 3MVWA 3FVNA 1IMDA 2XXTA 5TP9A 1D9QA 2XWOA 3S2VA 3RN8A 3SDFA 4TLLB 4FAJA 4PE5B 3C32A 1A54A 1LB9A 1JETA 5EQ8A 4AB5A 4ELOA 3TAJA 4ZEDA 1CE2A 4U4XA 4EQ9A 1DK4A 2GFEA 5DEXB 3OXNA 4XKRA 2O84X 3IJXB 1LB8A 4BDRA 3PAMA 4NEDA 4U21A 5FTIA 4N6KA 2DSFA 5IKBA 3RYBA 2HAVA 1PEBA 1R6ZA 2XXUA 3OSRA 4N15A 4M4GA 1MXZA 3C9HA 4Q0CA 5K2YA 5AA4A 4XFEA 1XT8A 4C1UA 2O6AA 4R9GA 3ZS6A 1N3XA 3H7MA 3RTFB 3QIMA 4K3FA 1JVYA 3F11A 4M1VA 5LOMA 4QHQA 2AIXA 4G68A 1FQAA 3SEUA 4EF2A 1QW0A 3C31A 4F2OA 4GIZA 1MPCA 2WBBA 4KD5A 1EH3A 1SVXB 3SERA 2Y7IA 1MDQA 1DTZA 3TTKA 3C34A 4FBPA 2ZYNA 4GL8A 2D5WA 4OVSA 3JV9A 3L6GA 4HS7A 3IORA 3CSGA 1AOVA 1FBFA 2FA7A 1VFEA 2XHDA 4RYAA 3RT8A 4DZ1A 2DDKA 1Y1ZA 4KQPA 2Y7WA 5H8NB 2HCAA 4XIGQ 1B40A 5A5XB 2P3VA 1IQ7A 3GZGA 2QSXA 1MRPA 2UYEA 2VGQA 3DP6A 4YKJA 2HPGA 5AA2D 1HSLA 2RF1A 3UN6A 4BDQA 5TPAA 3RYDA 1RYOA 3FVKA 5CC2A 5T3JA 5I84A 3O9PA 1URDA 4H1XA 4MF3A 4RNSA 3PMXA 4TQUQ 4BLAA 1DCUA 4KHZE 4PFYA 1LEVA 2XXIA 4F2QA 5HPQA 1MQDA 1TFDA 4PCDA 3PU5A 3WAEA 3K0VA 3VVFA 4F3BA 4HXVA 1P1OA 1PBQA 2CEYA 4KYEA 2BJJX 2VD2A 3EQ1A 2OK2A 3PV0E 3LBSA 2H98A 1FBHA 1POY1 1ZIUA 1B0HA 4OVQA 3CFZA 5KDTA 1JVXA 1NI9A 2R8TA 3KBRA 1B3EA 3EHTA 1FPDA 4QFNA 3G3HA 2Y5LA 1N84A 4PETA 3MP6A 2DS9A 2MKZA 4G61A 3KC1A 3U94A 4IR8A 3BFUA 2P0SA 1YCJA 2F35A 1NMUA 2M8CA 2I49A 1UTHB 1QGXA 1QUJA 4GD5A 3IOTA 1MQGA 3U72A 1I69A 3T9UA 4OVTA 1FPBA 2G29A 1I6AA 1ZKBA 4Z0IA 3OSQA 4F3GA 4F18A 4GWWA 4QSCA 4PP0A 1EYJA 3MAMA 4I62A 4FE8A 3UIFA 1DSNA 3PD8A 3C36A 4EF1A 2F36A 4IO2A 2NWJA 3G7WA 4N81A 2AYSA 1RDZA 3QSLA 5B7DA 1UTBB 4HW8A 1B05A 2PX1A 2QJEA 4AS4A 1IIWA 3MZ9A 4RPNA 4DE8A 4AS5A 1WDNA 2XXPA 4NWDA 5AE4A 3E4RA 5H8QB 4I3YA 3IR1A 2DVCA 4H65A 3KJ7A 1B4ZA 3GBBA 1BKAA 3FXUA 1Y1MA 4PF8A 4ND9A 1VSOA 1XI6A 1N7XA 1JW4A 1MY3A 2L5VA 3K4UA 2R71A 5KCJB 2V3TA 4GOTA 2PT1A 1FJ6A 1FBDA 1FPEA 4C1TA 1FW0A 3CI8A 2ZXTA 4F1VA 4DLDA 4PFUA 3GBAA 3PPPA 4FORA 4JVDA 1FQDA 4AQ4A 3LSWA 3CIJA 2FIXA 3TQWA 2VPOA 4KCDA 1FBGA 4FECA 3THIA 3TDJA 2GH9A 3EKIA 4R74A 5CMBA 5IM2A 1QUKA 4RK2A 5I3SA 3Q28A 4X48A 3B6TA 4LUBA 4HCYA 4XKQA 1B1XA 2DE2A 4O3AA 2OX3A 2WOPA 4NHBA 2QS4A 3H6UA 4FEBA 3HHFA 2H4IA 3FVGA 3FD3A 3ECRA 1IMEA 4GX3A 4OANA 3CVGA 2QPQA 5ICTA 3LVUA 1YTVA 3MJNA 4PFWA 3QK6A 1ZBMA 3K1NA 4KFQA 4NF0A 4C0RA 1IITA 3MQ9A 2Y7RA 3L6HA 4F1UA 4OEUA 3LUZA 1LAXA 4NF4B 2PBWA 4WKMA 5I7IA 4DCYA 2QL3A 3SEYA 4F29A 3ILUB 2HAUA 3RTWB 3U1OA 4YKIA 2ZZXA 4O3BA 1NV4A 4LONB 1NV5A 5CBRA 4OYVA 3KG2A 4Q30B 2KR0A 5LDZA 3T93B 3OO9A 2F78A 4ZEIA 5CBSA 2DE3A 2P2AA 2XXXA 2YLNA 4DCXA 3EPEA 4GWUA 1H76A 3SEWA 3HSTA 4OERA 1FQBA 4DIGA 1NV7A 1QJMA 3U93A 1GVCA 1FPGA 2CMOA 4H45A 1ZMGA 4OQOA 3FBPA 1AH5A 1OVBA 4POXA 5I59B 4FIMA 2RC7A 4NQ8A 3KC0A 5JTYA 2B65A 4X9TA 5JEIA 3LUYA 4IB2A 5FTHA 3B6WA 4X1DA 3VE1B 2HZKA 3LC8A 4GVOA 2XX9A 4P1LA 4RPOA 1M5EA 4GBVA 4QSDA 2Q8JA 3ROJA 4GRKA 5DVIA 4N17A 4G77A 4KXPA 4LQ2A 4OFOA 1OLCA 3FJ7A 2V84A 3IO4A 4ELPA 1EZ9A 3KZGA 3O29A 5H8HB 5K2XA 3TELA 1UIVA 1NL5A 3TTRA 4H8JA 4G8NA 1B3LA 3PUWE 3ZSFA 1QUIA 2ZNUA 3E79A 3OO6A 3I6VA 4U1OA 3FUZA 5IZ1A 3O6HA 3TZAA 2I3WA 1CB6A 5AA2B 4E0XA 3O2AA 2REGA 1FTLA 5L9SA 2DWJA 1H44A 1PBPA 2HQ0A 4TOZA 1USYH 3H06B 1D9VA 2DOJA 5FBPA 2WBDA 2I4CA 3VLUA 2ESNA 4YKPA 2XXWA 1G0HA 1B7ZA 3Q29A 1LBCA 4KI0E 5EHMA 1FRPA 4R6YA 3IFAA 1B7UA 3O6PA 1A99A 2QS3A 3M3FA 4LN5A 3UORA 2DWIA 1IMBA 1B2HA 3FZVA 1URSA 3S9EA 1FJ9A 4YZZA 3BIGA 3KOSA 1M5CA 1Q1KA 3V5AA 2ZZWA 3VLWA 1FPIA 5IAIA 2QMXA 1LBYA 5DEXA 2Z8DA 1LFIA 4OVPA 1SW4A 1KWHA 1NFTA 4H8IA 1L5TA 2HHMA 3HO7A 4N6PA 1P99A 5BWJA 1A8FA 2X7QA 4GBWA 4GWOA 4PBHA 1H3DA 2ZYKA 4PF6A 4R73A 2FVZA 4PGPA 2UXAA 2O51A 4GX6A 4MIJA 4FEDA 1O7TA 5ITPA 1MXYA 3DLNA 3IB1A 3I3VA 4JVCA 2UVIA 4I8CA 4HE2A 2XXQA 3D4CA 3PUXE 4RK9A 1XHYA 2Z22A 1A7LA 1Y4CA 1IEJA 3C35A 2PFYA 3BIHA 1LFGA 1MQHA 3K1MA 3S9NC 3MSTA 4DDDA 1IMAA 3ZKLA 2O1LA 4U22A 4F19A 4XXUA 4R6KA 1FTAA 3C4MA 3O6IA 5ET6A 4GX4A 3OMBA 5DT6A 3FV1A 3JYRA 2ABHA 3T22A 4R2FA 2ONRA 2OBGA 4MFIA 3FV2A 4R6HA 4F3SA 1RDYA 4H67A 1IZ1A 5H8NA 3GXAA 1M5BA 5A5XA 5JK4A 2VHAA 1VFDA 3OEKA 3VXCA 1LGBC 3Q26A 4DI4B 4N13A 2ZYMA 5EYHA 3K6XA 4GFRA 4OMBA 3E78A 3HN0A 4YMAA 4QF9A 2V3QA 3PUZE 3OELA 2PT2A 4ECFA 2RC9A 2WOKA 3MZBA 1VDWA 2H99A 1AMFA 1DBZA 2PYYA 2Q74A 3VV5A 4LA9A 1SD3A 3QUJA 1KA0A 1N0TA 1O63A 2D21A 3HCQA 1EZPA 1IXGA 1PB7A 1NKXA 4H6DA 1NUZA 4NX1A 1JW5A 3TQLA 4PC9A 1WODA 4ELRA 1JP4A 3FIRA 4O7IA 1OMPA 3TUSA 4Q5TA 4OEVA 1Y4TA 3DRHA 3FASA 4ELQA 3IJOB 2DXYA 3LV0A 1HSJA 2DXRA 1FQCA 3OD7A 3HFUA 4PFRA 1Q35A 4PAIA 1R9QA 5IZ3B 5F24A 2F7AA 3CG1A 3U65A 5H8FB 5ELVA 5I58B 2ZNTA 4G68C 1UTHA 2I58A 2Y7PA 3KEIA 4F3PA 2V25A 4XTCQ 1FQEA 2X26A 2CZHA 2KLFA 4NF8B 3VVDA 1NUXA 4RA1A 1ZTYA 4XKNA 4KPTA 4TLMB 4I9DA 5I57B 3V8XB 1B58A 3GLBA 1B52A 3NOHA 4GWXA 4KCCA 4BDLA 4X04A 1BP5A 2YPNA 3RPLB 4OHNA 3KFMA 1I6BA 1MS7A 4JXIA 2WYPA 4MBPA 1S7YA 1SW1A 3OO7A 3KN3A 1UTBA 4YKKA 2ZZVA 2DWAA 1Z7NE 2NVUB 4LZ7A 1Y3NA 5DTBA 3IFCA 4U2RA 4XF5A 3IAZA 2XXHA 4RJZA 2B4LA 1LCFA 3CRBA 4DI3D 5H8QA 2KQZA 4N4UA 2F3BA 2PCRA 4RXLA 1FPLA 3LR1A 1B1HA 5FHMA 5J16A 4I40A 2RCBA 5DW8A 3N6UA 2XD3A 1DOTA 2P3NA 3A3UA 3AXFA 1K9YA 1SDXA 4IO3A 4THIA 3RUMA 5KCJA 3RQTA 1MPBA 2F7CA 2I3VA 4N07A 1MPDA 5L9OA 2FIEA 3U92A 5I2NB 3PMWA 4FATA 4JDFA 5ET8A 1SW2A 3V83A 3O66A 1R9LA 4POWA 1SI1A 2IEEA 1B46A 2OZZA 1TT1A 4PDDA 5AA3A 3FXRA 1FTJA 1XOCA 4YMBA 5F7VA 1Y20A 4YB7A 2GHAA 3K6WA 4H5FA 4LZ8A 3T9VA 2CZLA 4PFIA 4QFLA 1FSAA 1LLSA 2XX8A 2E1SA 2QS1A 3EHUA 1LAFE 3E13X 2O7IA 5CMMA 1D4NA 1VE4A 2PVUA 4MLVA 3E9XA 2FBPA 2HXWA 2HFBA 3KN8A 5HBCA 3T1BA 4PGNA 3TTLA 1OIBA 1YAEA 5IZZA 1O64A 2WEFA 2OJTA 4I1DA 1LFHA 1XVYA 4ZEBA 1NUYA 3BBRA 2XXRA 3IX1A 3K02A 2XWKA 1RKMA 1UQWA 2UVHA 3PMVA 4IO7A 3DRIA 2E0SA 4RY1A 3IOWA 3A29A 3LSXA 1Y3PA 4GWSA 4EQ7A 3Q25A 4NF4A 4P0GA 4U4SA 1A55A 1IXCA 2OWZA 3DP4A 1ANFA 1I6QA 4G4PA 1YZ0A 1B3GA 1LSTA 3CFXA 4OZ9A 1WVJA 1XC1A 4AB6A 1JEVA 4QBAA 3MPKA 3KSXA 1NUWA 2RKMA 4EUOA 1ATGA 1JQFA 1NV0A 4IGRA 2RINA 3OEMA 5EQ9A 3RT6B 3A09A 3M3LA 2FHYA 1B0LA 1GGGA 3QYTA 4NAPA 4PDHA 1SYHA 4G8HA 4IO6A 4N91A 1JNFA 4KYDA 1MXWA 1SW5A 3A3CA 5I2KB 5I59A 2GQ1A 4ZDMA 4JSDA 4F22A 1SPIA 2QVUA
chains in the Genus database with same CATH topology
4ZE9A 4QRZA 5EYFA 3R6UA 3R26A 1IXHA 3H6VA 3PD9A 1XS5A 2P1SA 3B6QA 2XXVA 2WOLA 3IOVA 1N3WA 3FGSA 4KYSA 1ELJA 3E3KA 3G3GA 1A40A 5H8HA 1N7WA 4GQOA 3PUVE 3HV1A 1XVXA 1PB9A 3TEPA 1SBPA 3H03A 3TYHA 1D3KA 4OETA 1S50A 1OLAA 3KSJA 4ISUA 1F9BA 2UVGA 2OCUA 5FHNA 4GL0A 5AA2A 1NNFA 4NF5B 4NE4A 1B7HA 2O1MA 2VOZA 1D9YA 2F34A 4EXKA 2ZMBA 1OVTA 2VP1A 3H3GA 3OO8A 3PPNA 3W15C 5I56B 3EN3A 5CM6A 1FTMA 4IY6A 4YB6A 1SQYA 4Z7EA 4MH5A 4ESXA 1N76A 2XXYA 3C33A 3UGWA 1ZJLA 3FXQA 1MY2A 3MVZA 1GV8A 3P7IA 1M5DA 4IGTA 3KOTA 2THIA 3LSLA 4Q8RA 3VLVA 3JZJA 2Q89A 4DXBA 2I4BA 3UP9A 5J1DA 3RPWA 5M2VA 3MP8A 4NF6B 2A5TB 1B9JA 3PPOA 1JW1A 2O69A 2NXOA 3RY3A 2VD3A 4UACA 2QRYA 4R2BA 2W7YA 3O6GA 3S9MC 3V89B 3RYAA 2RCAA 2ANJA 2AL4A 1A8EA 3PPRA 3H6TA 3PGFA 1N04A 3K2DA 2Z23A 5TP9B 2H5YA 2DYXA 4IO5A 1QULA 4WEPA 5H8SA 3MUQA 3ZKKA 2YJPA 1ZU0A 4ESWA 3CR9A 3T9XB 1P1QA 2IA4A 3CSBA 1DTGA 3RNNA 3M3KA 1SI0A 4IO4A 4ZEFA 1Z7ME 3RLFE 1BLFA 4JB7A 3PPQA 2AL5A 3OOAA 4OVJA 4EQBA 4QFOA 2ONSA 3IOUA 3DRFA 1MY4A 4QFKA 3KJTA 4OFLA 5ICQA 4GLIA 4QSEA 1QKAA 4JWOA 5B70A 1NNPA 3VDFA 5AA4B 4ZZEA 1AL3A 1EZOA 3ILTB 3W9WA 3H4ZA 3HPIA 1LAHE 3K01A 3CHGA 1Y3QA 3FVOA 4PFTA 2XD2A 2OWSA 1H45A 3FTOA 4LATA 4G68B 4NTLA 4P11A 5EHSA 4LZ5A 1MDP1 2B3BA 1PDAA 4NMYA 4F1YA 4EDPA 4KR5A 3G3IA 1BTJA 3B7DA 3TTMA 4LP2B 4IY5A 1MXUA 1TWYA 1P1WA 5ISUA 3FJGA 1P1NA 1YPNA 3DM0A 1J1NA 5HM4B 3R7XA 3DELB 2UYFA 4LQ5A 2F97A 3CFLA 1EU8A 1B51A 5AA1A 3O28A 3TMGA 4PQJA 2DP8A 1FTOA 5TPAB 2ZNSA 4UA8A 2B4MA 1MQJA 4BDOA 3N5LA 3DRJA 4X1BA 4ONYA 4EXLA 2F6PA 5H8FA 1LBBA 2OLBA 5I58A 3M8UA 4GF8A 3RGYA 3PUYE 2XX7A 3T96B 4NF8A 3FATA 2ZYOA 5KDTB 5I57A 3USDA 4JBZA 1QVSA 3TKDA 3CG3A 2H25A 1B5HA 4MLQA 1HSEA 3QAXA 3DRKA 3VXBA 5DVJA 3UK4A 1B6HA 3IB2A 1NNTA 2D3IA 3KN7A 4DXCA 1DMBA 3EHSA 2Y84A 2FYIA 4JWXA 1QKBA 2I6EA 1MH4A 2Z8EA 2F5XA 3O97A 3TCGA 2HZLA 5CMKA 2QS2A 4OTEA 1VR5A 1MY1A 3G3FA 3N26A 5L8DA 4L17A 3W9VA 3MP1A 3TFLA 1RYXA 3SESA 5CRYA 4NWCA 1AIVA 2G93A 4BDNA 4YU0A 3I5OA 5I2NA 1P1UA 4GXSB 2V93A 1M5FA 3QXMA 4G8MA 1S9TA 3EF7A 4WXJA 3TTNA 3DP8A 4OFJA 3S4UA 2X7PA 5BUUA 3SETA 4WEDA 2HEUA 2V3UA 4OESA 4F39A 1GTKA 2Q9TA 4BDMA 5DVFA 3MC2A 1B3FA 1MXXA 2OWTA 3IK6B 2DWHA 3MVXA 1H43A 3G3JA 5F1QA 1UIUA 4ZEKA 4F31B 1B5IA 3IO6A 2REJA 4H5GA 4YAHX 1B4HA 4O3CA 4ZE8A 5ITOA 3G3KA 2ONKE 3T9HB 4HCWA 3K6UA 3SEXA 4YB5A 4ZECA 3VVEA 2DQVA 1FCKA 2PMSA 4U1ZA 2O68A 1TXFA 1JEUA 1US5A 2FNCA 3BFTA 1IUDA 3D4GA 1Y9UA 1B32A 1MH3A 2DE4A 5L9MA 4QFPA 3K6VA 2B3FA 3N94A 3VFJA 3KGCA 2I0BA 2LAOA 2Q2AA 1BIYA 2RC8A 3IB0A 5I2KA 1USYE 1DPEA 1MM7A 4P0IA 5CMCA 3SKPA 3QUFA 3MZ1A 5CI5A 1B5JA 3TCFA 3UA8A 2DVZA 4OENA 2O7UA 2Z8FA 4LVQA 2Q2CA 4HTGA 4ZZAA 3FJMA 1T0KA 2F6GA 2NUVA 1MQIA 1FTKA 3WAFA 3OENA 1URGA 3IL1B 4GXAA 4R9FA 3MBPA 5TU0A 3DRGA 2R6GE 1OQHA 5JTYB 2Q88A 3T66A 3ONMA 3S9LC 1ZLQA 2F7BA 1IXIA 5KZTA 3HHGA 4JSOA 1PC3A 1SYIA 4NF5A 1DPPA 4U23A 2I48A 3LSFB 4OXVA 5DYHA 2NOOA 3H6WA 1MM6A 3U8QA 1PB8A 1NH8A 1OQGA 1POTA 3TPAA 2GRVA 3MVYA 5I56A 1NH7A 4DXUA 2F8DA 1MY0A 4G2ZA 2Y7KA 1LCTA 3K00A 3MPLA 1GR2A 1FQFA 2R9JA 3MWBA 1MXVA 3Q27A 2ALUA 4FJPA 2QMWA 3TCHA 1NNKA 1TFAA 2H9BA 4E0WA 2UVJA 5FHOA 3N6TA 3BKIB 4R75A 4OWDA 1LAGE 4NF6A 1B3HA 2A5TA 3SEVA 1II5A 3MW0A 4XKPA 4JWYA 1MG1A 4R72A 1R1NA 3K1PA 2GHBA 4YICA 2I0CA 2WKYA 1US4A 4ZS9A 3ODBA 2A5SA 3TODA 4H0WA 3MVWA 3FVNA 2XXTA 5TP9A 3S2VA 3RN8A 3SDFA 4TLLB 4FAJA 4PE5B 3C32A 1A54A 1LB9A 1JETA 4AB5A 4ELOA 3TAJA 4ZEDA 1CE2A 4U4XA 4EQ9A 2GFEA 5DEXB 3OXNA 4XKRA 2O84X 3IJXB 1LB8A 4BDRA 3PAMA 4NEDA 4U21A 5FTIA 5IKBA 2DSFA 3RYBA 2HAVA 1PEBA 1R6ZA 2XXUA 3OSRA 4M4GA 1MXZA 3C9HA 4Q0CA 5K2YA 5AA4A 1XT8A 4C1UA 2O6AA 4R9GA 3ZS6A 1N3XA 3H7MA 3RTFB 3QIMA 4K3FA 1JVYA 3F11A 4M1VA 5LOMA 4QHQA 2AIXA 4G68A 1FQAA 3SEUA 4EF2A 1QW0A 3C31A 4F2OA 4GIZA 1MPCA 4KD5A 1EH3A 1SVXB 3SERA 2Y7IA 1DTZA 1MDQA 3TTKA 3C34A 2ZYNA 4GL8A 2D5WA 3JV9A 3L6GA 4HS7A 3IORA 3CSGA 1AOVA 2FA7A 1VFEA 2XHDA 4RYAA 3RT8A 4DZ1A 1Y1ZA 4KQPA 2Y7WA 5H8NB 2HCAA 4XIGQ 1B40A 5A5XB 1IQ7A 3GZGA 2QSXA 1MRPA 2UYEA 2VGQA 3DP6A 4YKJA 5AA2D 1HSLA 2RF1A 3UN6A 4BDQA 5TPAA 1RYOA 3FVKA 5CC2A 5I84A 3O9PA 1URDA 4H1XA 4MF3A 4RNSA 3PMXA 4TQUQ 4BLAA 4KHZE 4PFYA 2XXIA 4F2QA 5HPQA 1MQDA 1TFDA 3PU5A 3WAEA 3K0VA 3VVFA 4F3BA 1P1OA 1PBQA 4KYEA 2BJJX 2VD2A 3EQ1A 2OK2A 3PV0E 3LBSA 2H98A 1POY1 1ZIUA 1B0HA 3CFZA 5KDTA 1JVXA 3KBRA 1B3EA 3EHTA 4QFNA 3G3HA 1N84A 4PETA 3MP6A 2DS9A 3U94A 3BFUA 2P0SA 1YCJA 2F35A 1NMUA 2M8CA 2I49A 1UTHB 1QUJA 4GD5A 3IOTA 1MQGA 3U72A 1I69A 3T9UA 2G29A 1I6AA 1ZKBA 4Z0IA 3OSQA 4F3GA 4F18A 4QSCA 4PP0A 3MAMA 4I62A 4FE8A 3UIFA 1DSNA 3PD8A 3C36A 4EF1A 2F36A 4IO2A 2NWJA 3G7WA 2AYSA 3QSLA 5B7DA 1UTBB 4HW8A 1B05A 2PX1A 2QJEA 1IIWA 3MZ9A 4RPNA 4DE8A 1WDNA 2XXPA 4NWDA 5AE4A 3E4RA 5H8QB 3IR1A 2DVCA 4H65A 3KJ7A 1B4ZA 3GBBA 1BKAA 3FXUA 1Y1MA 4ND9A 1VSOA 1N7XA 1JW4A 1MY3A 3K4UA 2R71A 5KCJB 2V3TA 4GOTA 2PT1A 4C1TA 1FW0A 3CI8A 2ZXTA 4F1VA 4DLDA 4PFUA 3GBAA 3PPPA 4FORA 1FQDA 4AQ4A 3LSWA 3CIJA 3TQWA 4KCDA 4FECA 3THIA 3TDJA 2GH9A 4R74A 5CMBA 1QUKA 4RK2A 3Q28A 4X48A 3B6TA 4LUBA 4HCYA 4XKQA 1B1XA 2DE2A 4O3AA 2WOPA 2QS4A 3H6UA 4FEBA 3HHFA 2H4IA 3FVGA 3FD3A 3ECRA 3CVGA 2QPQA 5ICTA 3LVUA 1YTVA 3MJNA 4PFWA 3QK6A 1ZBMA 3K1NA 4KFQA 4C0RA 1IITA 3MQ9A 2Y7RA 3L6HA 4F1UA 4OEUA 1LAXA 4NF4B 2PBWA 4WKMA 4DCYA 2QL3A 3SEYA 4F29A 3ILUB 2HAUA 3RTWB 3U1OA 4YKIA 4O3BA 4LONB 5CBRA 4OYVA 3KG2A 4Q30B 3T93B 3OO9A 2F78A 4ZEIA 5CBSA 2DE3A 2P2AA 2XXXA 2YLNA 4DCXA 3EPEA 1H76A 3SEWA 3HSTA 4OERA 1FQBA 4DIGA 1QJMA 3U93A 1GVCA 2CMOA 4POXA 1ZMGA 4OQOA 1AH5A 1OVBA 5I59B 4FIMA 2RC7A 5JTYA 2B65A 4X9TA 5JEIA 3LUYA 4IB2A 5FTHA 3B6WA 4X1DA 3VE1B 2HZKA 3LC8A 4GVOA 2XX9A 4RPOA 1M5EA 4QSDA 2Q8JA 4GRKA 5DVIA 4G77A 4LQ2A 4OFOA 1OLCA 3FJ7A 2V84A 3IO4A 4ELPA 1EZ9A 3KZGA 3O29A 5H8HB 5K2XA 3TELA 1UIVA 1NL5A 3TTRA 4H8JA 4G8NA 1B3LA 3PUWE 3ZSFA 1QUIA 2ZNUA 3OO6A 3I6VA 4U1OA 3FUZA 3O6HA 3TZAA 2I3WA 1CB6A 5AA2B 4E0XA 3O2AA 2REGA 1FTLA 5L9SA 2DWJA 1H44A 1PBPA 2HQ0A 4TOZA 1USYH 3H06B 1D9VA 2DOJA 2I4CA 3VLUA 2ESNA 4YKPA 2XXWA 1B7ZA 3Q29A 1LBCA 4KI0E 5EHMA 4R6YA 1B7UA 3O6PA 1A99A 2QS3A 3M3FA 3UORA 2DWIA 1B2HA 3FZVA 1URSA 3S9EA 4YZZA 3KOSA 1M5CA 1Q1KA 3V5AA 3VLWA 5IAIA 2QMXA 5DEXA 2Z8DA 1LFIA 1SW4A 1KWHA 1NFTA 4H8IA 1L5TA 3HO7A 4N6PA 1P99A 5BWJA 1A8FA 2X7QA 4GWOA 1H3DA 2ZYKA 4R73A 2UXAA 2O51A 4FEDA 1O7TA 5ITPA 1MXYA 3DLNA 3IB1A 3I3VA 2UVIA 4I8CA 2XXQA 3D4CA 3PUXE 4RK9A 1XHYA 2Z22A 1A7LA 1Y4CA 1IEJA 3C35A 1LFGA 1MQHA 3K1MA 3S9NC 4DDDA 3ZKLA 2O1LA 4U22A 4F19A 4XXUA 4R6KA 3C4MA 3O6IA 3OMBA 5DT6A 3FV1A 3JYRA 2ABHA 3T22A 4R2FA 2ONRA 2OBGA 4MFIA 3FV2A 4R6HA 4F3SA 4H67A 1IZ1A 5H8NA 3GXAA 1M5BA 5A5XA 5JK4A 2VHAA 3VXCA 1VFDA 3OEKA 1LGBC 3Q26A 4N13A 2ZYMA 3K6XA 4GFRA 4OMBA 3HN0A 4YMAA 4QF9A 2V3QA 3PUZE 3OELA 2PT2A 4ECFA 2RC9A 2WOKA 3MZBA 2H99A 1AMFA 2PYYA 3VV5A 4LA9A 1SD3A 3QUJA 1N0TA 1O63A 2D21A 3HCQA 1EZPA 1IXGA 1PB7A 1NKXA 4H6DA 1JW5A 3TQLA 1WODA 4ELRA 3FIRA 1OMPA 3TUSA 4Q5TA 4OEVA 1Y4TA 3DRHA 3FASA 4ELQA 3IJOB 2DXYA 1HSJA 2DXRA 1FQCA 3OD7A 1Q35A 1R9QA 2F7AA 3CG1A 5H8FB 5ELVA 5I58B 2ZNTA 4G68C 1UTHA 2I58A 2Y7PA 3KEIA 4F3PA 2V25A 4XTCQ 1FQEA 2X26A 2KLFA 4NF8B 3VVDA 4RA1A 1ZTYA 4XKNA 4KPTA 4TLMB 4I9DA 5I57B 3V8XB 1B58A 3GLBA 1B52A 4KCCA 4BDLA 1BP5A 2YPNA 4OHNA 3KFMA 1I6BA 1MS7A 4JXIA 4MBPA 1S7YA 1SW1A 3OO7A 3KN3A 1UTBA 4YKKA 2DWAA 1Z7NE 2NVUB 4LZ7A 1Y3NA 5DTBA 4U2RA 3IAZA 2XXHA 4RJZA 2B4LA 1LCFA 3CRBA 5H8QA 4RXLA 3LR1A 1B1HA 5FHMA 2RCBA 3N6UA 2XD3A 1DOTA 3A3UA 3AXFA 1SDXA 4IO3A 4THIA 3RUMA 5KCJA 3RQTA 1MPBA 2F7CA 2I3VA 4N07A 1MPDA 5L9OA 3U92A 5I2NB 3PMWA 4FATA 4JDFA 1SW2A 3V83A 3O66A 1R9LA 4POWA 1SI1A 2IEEA 1B46A 2OZZA 1TT1A 5AA3A 3FXRA 1FTJA 1XOCA 4YMBA 5F7VA 1Y20A 4YB7A 2GHAA 3K6WA 4H5FA 4LZ8A 3T9VA 2CZLA 4QFLA 1LLSA 2XX8A 2E1SA 2QS1A 3EHUA 1LAFE 3E13X 2O7IA 5CMMA 1D4NA 1VE4A 2PVUA 4MLVA 3E9XA 2HXWA 2HFBA 3KN8A 5HBCA 3TTLA 1OIBA 1YAEA 1O64A 2OJTA 4I1DA 1LFHA 1XVYA 4ZEBA 3BBRA 2XXRA 3IX1A 3K02A 1RKMA 1UQWA 2UVHA 3PMVA 4IO7A 3DRIA 2E0SA 4RY1A 3IOWA 3LSXA 1Y3PA 4EQ7A 3Q25A 4NF4A 4P0GA 4U4SA 1A55A 1IXCA 3DP4A 1ANFA 1I6QA 4G4PA 1B3GA 1LSTA 3CFXA 4OZ9A 1WVJA 1XC1A 4AB6A 1JEVA 3MPKA 3KSXA 2RKMA 4EUOA 1ATGA 1JQFA 4IGRA 2RINA 3OEMA 3RT6B 3A09A 3M3LA 1B0LA 1GGGA 3QYTA 1SYHA 4G8HA 4IO6A 1JNFA 4KYDA 1MXWA 1SW5A 3A3CA 5I2KB 5I59A 4ZDMA 4JSDA 4F22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZE9 A;  4QRZ A;  5EYF A;  3R6U A;  3R26 A;  1IXH A;  3H6V A;  3PD9 A;  1XS5 A;  2P1S A;  3B6Q A;  2XXV A;  2WOL A;  3IOV A;  1N3W A;  3FGS A;  4KYS A;  1ELJ A;  3E3K A;  3G3G A;  1A40 A;  5H8H A;  1N7W A;  4GQO A;  3PUV E;  3HV1 A;  1XVX A;  1PB9 A;  3TEP A;  1SBP A;  3H03 A;  3TYH A;  1D3K A;  4OET A;  1S50 A;  1OLA A;  3KSJ A;  4ISU A;  1F9B A;  2UVG A;  2OCU A;  5FHN A;  4GL0 A;  5AA2 A;  1NNF A;  4NF5 B;  4NE4 A;  1B7H A;  2O1M A;  2VOZ A;  1D9Y A;  2F34 A;  4EXK A;  2ZMB A;  1OVT A;  2VP1 A;  3H3G A;  3OO8 A;  3PPN A;  3W15 C;  5I56 B;  3EN3 A;  5CM6 A;  1FTM A;  4IY6 A;  4YB6 A;  1SQY A;  4Z7E A;  4MH5 A;  4ESX A;  1N76 A;  2XXY A;  3C33 A;  3UGW A;  1ZJL A;  3FXQ A;  1MY2 A;  3MVZ A;  1GV8 A;  3P7I A;  1M5D A;  4IGT A;  3KOT A;  2THI A;  3LSL A;  4Q8R A;  3VLV A;  3JZJ A;  2Q89 A;  4DXB A;  2I4B A;  3UP9 A;  5J1D A;  3RPW A;  5M2V A;  3MP8 A;  4NF6 B;  2A5T B;  1B9J A;  3PPO A;  1JW1 A;  2O69 A;  2NXO A;  3RY3 A;  2VD3 A;  4UAC A;  2QRY A;  4R2B A;  2W7Y A;  3O6G A;  3S9M C;  3V89 B;  3RYA A;  2RCA A;  2ANJ A;  2AL4 A;  1A8E A;  3PPR A;  3H6T A;  3PGF A;  1N04 A;  3K2D A;  2Z23 A;  5TP9 B;  2H5Y A;  2DYX A;  4IO5 A;  1QUL A;  4WEP A;  5H8S A;  3MUQ A;  3ZKK A;  2YJP A;  1ZU0 A;  4ESW A;  3CR9 A;  3T9X B;  1P1Q A;  2IA4 A;  3CSB A;  1DTG A;  3RNN A;  3M3K A;  1SI0 A;  4IO4 A;  4ZEF A;  1Z7M E;  3RLF E;  1BLF A;  4JB7 A;  3PPQ A;  2AL5 A;  3OOA A;  4OVJ A;  4EQB A;  4QFO A;  2ONS A;  3IOU A;  3DRF A;  1MY4 A;  4QFK A;  3KJT A;  4OFL A;  5ICQ A;  4GLI A;  4QSE A;  1QKA A;  4JWO A;  5B70 A;  1NNP A;  3VDF A;  5AA4 B;  4ZZE A;  1AL3 A;  1EZO A;  3ILT B;  3W9W A;  3H4Z A;  3HPI A;  1LAH E;  3K01 A;  3CHG A;  1Y3Q A;  3FVO A;  4PFT A;  2XD2 A;  2OWS A;  1H45 A;  3FTO A;  4LAT A;  4G68 B;  4NTL A;  4P11 A;  5EHS A;  4LZ5 A;  1MDP 1;  2B3B A;  1PDA A;  4NMY A;  4F1Y A;  4EDP A;  4KR5 A;  3G3I A;  1BTJ A;  3B7D A;  3TTM A;  4LP2 B;  4IY5 A;  1MXU A;  1TWY A;  1P1W A;  5ISU A;  3FJG A;  1P1N A;  1YPN A;  3DM0 A;  1J1N A;  5HM4 B;  3R7X A;  3DEL B;  2UYF A;  4LQ5 A;  2F97 A;  3CFL A;  1EU8 A;  1B51 A;  5AA1 A;  3O28 A;  3TMG A;  4PQJ A;  2DP8 A;  1FTO A;  5TPA B;  2ZNS A;  4UA8 A;  2B4M A;  1MQJ A;  4BDO A;  3N5L A;  3DRJ A;  4X1B A;  4ONY A;  4EXL A;  2F6P A;  5H8F A;  1LBB A;  2OLB A;  5I58 A;  3M8U A;  4GF8 A;  3RGY A;  3PUY E;  2XX7 A;  3T96 B;  4NF8 A;  3FAT A;  2ZYO A;  5KDT B;  5I57 A;  3USD A;  4JBZ A;  1QVS A;  3TKD A;  3CG3 A;  2H25 A;  1B5H A;  4MLQ A;  1HSE A;  3QAX A;  3DRK A;  3VXB A;  5DVJ A;  3UK4 A;  1B6H A;  3IB2 A;  1NNT A;  2D3I A;  3KN7 A;  4DXC A;  1DMB A;  3EHS A;  2Y84 A;  2FYI A;  4JWX A;  1QKB A;  2I6E A;  1MH4 A;  2Z8E A;  2F5X A;  3O97 A;  3TCG A;  2HZL A;  5CMK A;  2QS2 A;  4OTE A;  1VR5 A;  1MY1 A;  3G3F A;  3N26 A;  5L8D A;  4L17 A;  3W9V A;  3MP1 A;  3TFL A;  1RYX A;  3SES A;  5CRY A;  4NWC A;  1AIV A;  2G93 A;  4BDN A;  4YU0 A;  3I5O A;  5I2N A;  1P1U A;  4GXS B;  2V93 A;  1M5F A;  3QXM A;  4G8M A;  1S9T A;  3EF7 A;  4WXJ A;  3TTN A;  3DP8 A;  4OFJ A;  3S4U A;  2X7P A;  5BUU A;  3SET A;  4WED A;  2HEU A;  2V3U A;  4OES A;  4F39 A;  1GTK A;  2Q9T A;  4BDM A;  5DVF A;  3MC2 A;  1B3F A;  1MXX A;  2OWT A;  3IK6 B;  2DWH A;  3MVX A;  1H43 A;  3G3J A;  5F1Q A;  1UIU A;  4ZEK A;  4F31 B;  1B5I A;  3IO6 A;  2REJ A;  4H5G A;  4YAH X;  1B4H A;  4O3C A;  4ZE8 A;  5ITO A;  3G3K A;  2ONK E;  3T9H B;  4HCW A;  3K6U A;  3SEX A;  4YB5 A;  4ZEC A;  3VVE A;  2DQV A;  1FCK A;  2PMS A;  4U1Z A;  2O68 A;  1TXF A;  1JEU A;  1US5 A;  2FNC A;  3BFT A;  1IUD A;  3D4G A;  1Y9U A;  1B32 A;  1MH3 A;  2DE4 A;  5L9M A;  4QFP A;  3K6V A;  2B3F A;  3N94 A;  3VFJ A;  3KGC A;  2I0B A;  2LAO A;  2Q2A A;  1BIY A;  2RC8 A;  3IB0 A;  5I2K A;  1USY E;  1DPE A;  1MM7 A;  4P0I A;  5CMC A;  3SKP A;  3QUF A;  3MZ1 A;  5CI5 A;  1B5J A;  3TCF A;  3UA8 A;  2DVZ A;  4OEN A;  2O7U A;  2Z8F A;  4LVQ A;  2Q2C A;  4HTG A;  4ZZA A;  3FJM A;  1T0K A;  2F6G A;  2NUV A;  1MQI A;  1FTK A;  3WAF A;  3OEN A;  1URG A;  3IL1 B;  4GXA A;  4R9F A;  3MBP A;  5TU0 A;  3DRG A;  2R6G E;  1OQH A;  5JTY B;  2Q88 A;  3T66 A;  3ONM A;  3S9L C;  1ZLQ A;  2F7B A;  1IXI A;  5KZT A;  3HHG A;  4JSO A;  1PC3 A;  1SYI A;  4NF5 A;  1DPP A;  4U23 A;  2I48 A;  3LSF B;  4OXV A;  5DYH A;  2NOO A;  3H6W A;  1MM6 A;  3U8Q A;  1PB8 A;  1NH8 A;  1OQG A;  1POT A;  3TPA A;  2GRV A;  3MVY A;  5I56 A;  1NH7 A;  4DXU A;  2F8D A;  1MY0 A;  4G2Z A;  2Y7K A;  1LCT A;  3K00 A;  3MPL A;  1GR2 A;  1FQF A;  2R9J A;  3MWB A;  1MXV A;  3Q27 A;  2ALU A;  4FJP A;  2QMW A;  3TCH A;  1NNK A;  1TFA A;  2H9B A;  4E0W A;  2UVJ A;  5FHO A;  3N6T A;  3BKI B;  4R75 A;  4OWD A;  1LAG E;  4NF6 A;  1B3H A;  2A5T A;  3SEV A;  1II5 A;  3MW0 A;  4XKP A;  4JWY A;  1MG1 A;  4R72 A;  1R1N A;  3K1P A;  2GHB A;  4YIC A;  2I0C A;  2WKY A;  1US4 A;  4ZS9 A;  3ODB A;  2A5S A;  3TOD A;  4H0W A;  3MVW A;  3FVN A;  2XXT A;  5TP9 A;  3S2V A;  3RN8 A;  3SDF A;  4TLL B;  4FAJ A;  4PE5 B;  3C32 A;  1A54 A;  1LB9 A;  1JET A;  4AB5 A;  4ELO A;  3TAJ A;  4ZED A;  1CE2 A;  4U4X A;  4EQ9 A;  2GFE A;  5DEX B;  3OXN A;  4XKR A;  2O84 X;  3IJX B;  1LB8 A;  4BDR A;  3PAM A;  4NED A;  4U21 A;  5FTI A;  5IKB A;  2DSF A;  3RYB A;  2HAV A;  1PEB A;  1R6Z A;  2XXU A;  3OSR A;  4M4G A;  1MXZ A;  3C9H A;  4Q0C A;  5K2Y A;  5AA4 A;  1XT8 A;  4C1U A;  2O6A A;  4R9G A;  3ZS6 A;  1N3X A;  3H7M A;  3RTF B;  3QIM A;  4K3F A;  1JVY A;  3F11 A;  4M1V A;  5LOM A;  4QHQ A;  2AIX A;  4G68 A;  1FQA A;  3SEU A;  4EF2 A;  1QW0 A;  3C31 A;  4F2O A;  4GIZ A;  1MPC A;  4KD5 A;  1EH3 A;  1SVX B;  3SER A;  2Y7I A;  1DTZ A;  1MDQ A;  3TTK A;  3C34 A;  2ZYN A;  4GL8 A;  2D5W A;  3JV9 A;  3L6G A;  4HS7 A;  3IOR A;  3CSG A;  1AOV A;  2FA7 A;  1VFE A;  2XHD A;  4RYA A;  3RT8 A;  4DZ1 A;  1Y1Z A;  4KQP A;  2Y7W A;  5H8N B;  2HCA A;  4XIG Q;  1B40 A;  5A5X B;  1IQ7 A;  3GZG A;  2QSX A;  1MRP A;  2UYE A;  2VGQ A;  3DP6 A;  4YKJ A;  5AA2 D;  1HSL A;  2RF1 A;  3UN6 A;  4BDQ A;  5TPA A;  1RYO A;  3FVK A;  5CC2 A;  5I84 A;  3O9P A;  1URD A;  4H1X A;  4MF3 A;  4RNS A;  3PMX A;  4TQU Q;  4BLA A;  4KHZ E;  4PFY A;  2XXI A;  4F2Q A;  5HPQ A;  1MQD A;  1TFD A;  3PU5 A;  3WAE A;  3K0V A;  3VVF A;  4F3B A;  1P1O A;  1PBQ A;  4KYE A;  2BJJ X;  2VD2 A;  3EQ1 A;  2OK2 A;  3PV0 E;  3LBS A;  2H98 A;  1POY 1;  1ZIU A;  1B0H A;  3CFZ A;  5KDT A;  1JVX A;  3KBR A;  1B3E A;  3EHT A;  4QFN A;  3G3H A;  1N84 A;  4PET A;  3MP6 A;  2DS9 A;  3U94 A;  3BFU A;  2P0S A;  1YCJ A;  2F35 A;  1NMU A;  2M8C A;  2I49 A;  1UTH B;  1QUJ A;  4GD5 A;  3IOT A;  1MQG A;  3U72 A;  1I69 A;  3T9U A;  2G29 A;  1I6A A;  1ZKB A;  4Z0I A;  3OSQ A;  4F3G A;  4F18 A;  4QSC A;  4PP0 A;  3MAM A;  4I62 A;  4FE8 A;  3UIF A;  1DSN A;  3PD8 A;  3C36 A;  4EF1 A;  2F36 A;  4IO2 A;  2NWJ A;  3G7W A;  2AYS A;  3QSL A;  5B7D A;  1UTB B;  4HW8 A;  1B05 A;  2PX1 A;  2QJE A;  1IIW A;  3MZ9 A;  4RPN A;  4DE8 A;  1WDN A;  2XXP A;  4NWD A;  5AE4 A;  3E4R A;  5H8Q B;  3IR1 A;  2DVC A;  4H65 A;  3KJ7 A;  1B4Z A;  3GBB A;  1BKA A;  3FXU A;  1Y1M A;  4ND9 A;  1VSO A;  1N7X A;  1JW4 A;  1MY3 A;  3K4U A;  2R71 A;  5KCJ B;  2V3T A;  4GOT A;  2PT1 A;  4C1T A;  1FW0 A;  3CI8 A;  2ZXT A;  4F1V A;  4DLD A;  4PFU A;  3GBA A;  3PPP A;  4FOR A;  1FQD A;  4AQ4 A;  3LSW A;  3CIJ A;  3TQW A;  4KCD A;  4FEC A;  3THI A;  3TDJ A;  2GH9 A;  4R74 A;  5CMB A;  1QUK A;  4RK2 A;  3Q28 A;  4X48 A;  3B6T A;  4LUB A;  4HCY A;  4XKQ A;  1B1X A;  2DE2 A;  4O3A A;  2WOP A;  2QS4 A;  3H6U A;  4FEB A;  3HHF A;  2H4I A;  3FVG A;  3FD3 A;  3ECR A;  3CVG A;  2QPQ A;  5ICT A;  3LVU A;  1YTV A;  3MJN A;  4PFW A;  3QK6 A;  1ZBM A;  3K1N A;  4KFQ A;  4C0R A;  1IIT A;  3MQ9 A;  2Y7R A;  3L6H A;  4F1U A;  4OEU A;  1LAX A;  4NF4 B;  2PBW A;  4WKM A;  4DCY A;  2QL3 A;  3SEY A;  4F29 A;  3ILU B;  2HAU A;  3RTW B;  3U1O A;  4YKI A;  4O3B A;  4LON B;  5CBR A;  4OYV A;  3KG2 A;  4Q30 B;  3T93 B;  3OO9 A;  2F78 A;  4ZEI A;  5CBS A;  2DE3 A;  2P2A A;  2XXX A;  2YLN A;  4DCX A;  3EPE A;  1H76 A;  3SEW A;  3HST A;  4OER A;  1FQB A;  4DIG A;  1QJM A;  3U93 A;  1GVC A;  2CMO A;  4POX A;  1ZMG A;  4OQO A;  1AH5 A;  1OVB A;  5I59 B;  4FIM A;  2RC7 A;  5JTY A;  2B65 A;  4X9T A;  5JEI A;  3LUY A;  4IB2 A;  5FTH A;  3B6W A;  4X1D A;  3VE1 B;  2HZK A;  3LC8 A;  4GVO A;  2XX9 A;  4RPO A;  1M5E A;  4QSD A;  2Q8J A;  4GRK A;  5DVI A;  4G77 A;  4LQ2 A;  4OFO A;  1OLC A;  3FJ7 A;  2V84 A;  3IO4 A;  4ELP A;  1EZ9 A;  3KZG A;  3O29 A;  5H8H B;  5K2X A;  3TEL A;  1UIV A;  1NL5 A;  3TTR A;  4H8J A;  4G8N A;  1B3L A;  3PUW E;  3ZSF A;  1QUI A;  2ZNU A;  3OO6 A;  3I6V A;  4U1O A;  3FUZ A;  3O6H A;  3TZA A;  2I3W A;  1CB6 A;  5AA2 B;  4E0X A;  3O2A A;  2REG A;  1FTL A;  5L9S A;  2DWJ A;  1H44 A;  1PBP A;  2HQ0 A;  4TOZ A;  1USY H;  3H06 B;  1D9V A;  2DOJ A;  2I4C A;  3VLU A;  2ESN A;  4YKP A;  2XXW A;  1B7Z A;  3Q29 A;  1LBC A;  4KI0 E;  5EHM A;  4R6Y A;  1B7U A;  3O6P A;  1A99 A;  2QS3 A;  3M3F A;  3UOR A;  2DWI A;  1B2H A;  3FZV A;  1URS A;  3S9E A;  4YZZ A;  3KOS A;  1M5C A;  1Q1K A;  3V5A A;  3VLW A;  5IAI A;  2QMX A;  5DEX A;  2Z8D A;  1LFI A;  1SW4 A;  1KWH A;  1NFT A;  4H8I A;  1L5T A;  3HO7 A;  4N6P A;  1P99 A;  5BWJ A;  1A8F A;  2X7Q A;  4GWO A;  1H3D A;  2ZYK A;  4R73 A;  2UXA A;  2O51 A;  4FED A;  1O7T A;  5ITP A;  1MXY A;  3DLN A;  3IB1 A;  3I3V A;  2UVI A;  4I8C A;  2XXQ A;  3D4C A;  3PUX E;  4RK9 A;  1XHY A;  2Z22 A;  1A7L A;  1Y4C A;  1IEJ A;  3C35 A;  1LFG A;  1MQH A;  3K1M A;  3S9N C;  4DDD A;  3ZKL A;  2O1L A;  4U22 A;  4F19 A;  4XXU A;  4R6K A;  3C4M A;  3O6I A;  3OMB A;  5DT6 A;  3FV1 A;  3JYR A;  2ABH A;  3T22 A;  4R2F A;  2ONR A;  2OBG A;  4MFI A;  3FV2 A;  4R6H A;  4F3S A;  4H67 A;  1IZ1 A;  5H8N A;  3GXA A;  1M5B A;  5A5X A;  5JK4 A;  2VHA A;  3VXC A;  1VFD A;  3OEK A;  1LGB C;  3Q26 A;  4N13 A;  2ZYM A;  3K6X A;  4GFR A;  4OMB A;  3HN0 A;  4YMA A;  4QF9 A;  2V3Q A;  3PUZ E;  3OEL A;  2PT2 A;  4ECF A;  2RC9 A;  2WOK A;  3MZB A;  2H99 A;  1AMF A;  2PYY A;  3VV5 A;  4LA9 A;  1SD3 A;  3QUJ A;  1N0T A;  1O63 A;  2D21 A;  3HCQ A;  1EZP A;  1IXG A;  1PB7 A;  1NKX A;  4H6D A;  1JW5 A;  3TQL A;  1WOD A;  4ELR A;  3FIR A;  1OMP A;  3TUS A;  4Q5T A;  4OEV A;  1Y4T A;  3DRH A;  3FAS A;  4ELQ A;  3IJO B;  2DXY A;  1HSJ A;  2DXR A;  1FQC A;  3OD7 A;  1Q35 A;  1R9Q A;  2F7A A;  3CG1 A;  5H8F B;  5ELV A;  5I58 B;  2ZNT A;  4G68 C;  1UTH A;  2I58 A;  2Y7P A;  3KEI A;  4F3P A;  2V25 A;  4XTC Q;  1FQE A;  2X26 A;  2KLF A;  4NF8 B;  3VVD A;  4RA1 A;  1ZTY A;  4XKN A;  4KPT A;  4TLM B;  4I9D A;  5I57 B;  3V8X B;  1B58 A;  3GLB A;  1B52 A;  4KCC A;  4BDL A;  1BP5 A;  2YPN A;  4OHN A;  3KFM A;  1I6B A;  1MS7 A;  4JXI A;  4MBP A;  1S7Y A;  1SW1 A;  3OO7 A;  3KN3 A;  1UTB A;  4YKK A;  2DWA A;  1Z7N E;  2NVU B;  4LZ7 A;  1Y3N A;  5DTB A;  4U2R A;  3IAZ A;  2XXH A;  4RJZ A;  2B4L A;  1LCF A;  3CRB A;  5H8Q A;  4RXL A;  3LR1 A;  1B1H A;  5FHM A;  2RCB A;  3N6U A;  2XD3 A;  1DOT A;  3A3U A;  3AXF A;  1SDX A;  4IO3 A;  4THI A;  3RUM A;  5KCJ A;  3RQT A;  1MPB A;  2F7C A;  2I3V A;  4N07 A;  1MPD A;  5L9O A;  3U92 A;  5I2N B;  3PMW A;  4FAT A;  4JDF A;  1SW2 A;  3V83 A;  3O66 A;  1R9L A;  4POW A;  1SI1 A;  2IEE A;  1B46 A;  2OZZ A;  1TT1 A;  5AA3 A;  3FXR A;  1FTJ A;  1XOC A;  4YMB A;  5F7V A;  1Y20 A;  4YB7 A;  2GHA A;  3K6W A;  4H5F A;  4LZ8 A;  3T9V A;  2CZL A;  4QFL A;  1LLS A;  2XX8 A;  2E1S A;  2QS1 A;  3EHU A;  1LAF E;  3E13 X;  2O7I A;  5CMM A;  1D4N A;  1VE4 A;  2PVU A;  4MLV A;  3E9X A;  2HXW A;  2HFB A;  3KN8 A;  5HBC A;  3TTL A;  1OIB A;  1YAE A;  1O64 A;  2OJT A;  4I1D A;  1LFH A;  1XVY A;  4ZEB A;  3BBR A;  2XXR A;  3IX1 A;  3K02 A;  1RKM A;  1UQW A;  2UVH A;  3PMV A;  4IO7 A;  3DRI A;  2E0S A;  4RY1 A;  3IOW A;  3LSX A;  1Y3P A;  4EQ7 A;  3Q25 A;  4NF4 A;  4P0G A;  4U4S A;  1A55 A;  1IXC A;  3DP4 A;  1ANF A;  1I6Q A;  4G4P A;  1B3G A;  1LST A;  3CFX A;  4OZ9 A;  1WVJ A;  1XC1 A;  4AB6 A;  1JEV A;  3MPK A;  3KSX A;  2RKM A;  4EUO A;  1ATG A;  1JQF A;  4IGR A;  2RIN A;  3OEM A;  3RT6 B;  3A09 A;  3M3L A;  1B0L A;  1GGG A;  3QYT A;  1SYH A;  4G8H A;  4IO6 A;  1JNF A;  4KYD A;  1MXW A;  1SW5 A;  3A3C A;  5I2K B;  5I59 A;  4ZDM A;  4JSD A;  4F22 A; 
#chains in the Genus database with same CATH topology
 4ZE9 A;  4GWZ A;  1FBE A;  4QRZ A;  5EYF A;  3R6U A;  3R26 A;  1IXH A;  3H6V A;  3PD9 A;  1XS5 A;  2CEX A;  2P1S A;  3B6Q A;  2XXV A;  2WOL A;  3IOV A;  1N3W A;  3FGS A;  4OVR A;  3ISP A;  4KYS A;  1ELJ A;  3E3K A;  3G3G A;  1A40 A;  5H8H A;  1N7W A;  4GQO A;  3PUV E;  3HV1 A;  1XVX A;  1PB9 A;  3TEP A;  1SBP A;  3H03 A;  3TYH A;  1D3K A;  4OET A;  1S50 A;  1OLA A;  3KSJ A;  4ISU A;  1F9B A;  2PFZ A;  4NN3 A;  2UVG A;  2OCU A;  5FHN A;  4GL0 A;  5AA2 A;  1NNF A;  4NF5 B;  4NE4 A;  1B7H A;  2O1M A;  2VT5 A;  2VOZ A;  1D9Y A;  2F34 A;  4EXK A;  2ZMB A;  4X8R A;  1OVT A;  2VP1 A;  1LBX A;  3H3G A;  4PFB A;  4MCO A;  3OO8 A;  3PPN A;  3W15 C;  1Q9D A;  4P8B A;  5I56 B;  3EN3 A;  5CM6 A;  1FTM A;  4IY6 A;  4YB6 A;  1SQY A;  4Z7E A;  4MH5 A;  4ESX A;  3B8B A;  1N76 A;  2XXY A;  1NV2 A;  3C33 A;  3UGW A;  4HE1 A;  1ZJL A;  3FXQ A;  1MY2 A;  3MVZ A;  1GV8 A;  4MNI A;  3P7I A;  1M5D A;  4IGT A;  3KOT A;  2THI A;  3LSL A;  4Q8R A;  3VLV A;  3JZJ A;  2Q89 A;  4DXB A;  2I4B A;  3UP9 A;  5J1D A;  3RPW A;  5M2V A;  3MP8 A;  4NF6 B;  2A5T B;  1B9J A;  3PPO A;  1JW1 A;  2O69 A;  2NXO A;  3RY3 A;  2VD3 A;  4UAC A;  2QRY A;  4R2B A;  2W7Y A;  3O6G A;  1CNQ A;  2XWI A;  3S9M C;  3V89 B;  3RYA A;  4MX6 A;  2RCA A;  2ANJ A;  2AL4 A;  1A8E A;  3PPR A;  3H6T A;  3PGF A;  1N04 A;  3K2D A;  2Z23 A;  5TP9 B;  1FPK A;  2H5Y A;  4PAF A;  2DYX A;  4IO5 A;  1QUL A;  4WEP A;  5H8S A;  3MUQ A;  3ZKK A;  2YJP A;  1ZU0 A;  1AWB A;  4ESW A;  3CR9 A;  3T9X B;  1P1Q A;  2IA4 A;  3CSB A;  1DTG A;  3RNN A;  3M3K A;  1SI0 A;  4IO4 A;  4P47 A;  4ZEF A;  1Z7M E;  3RLF E;  1EYK A;  1BLF A;  4JB7 A;  3PPQ A;  2AL5 A;  3OOA A;  4OVJ A;  4EQB A;  4QFO A;  2ONS A;  3IOU A;  1INP A;  3DRF A;  1MY4 A;  4MAG A;  4QFK A;  3KJT A;  5I5P A;  4OFL A;  2XA5 A;  5ICQ A;  4MNP A;  4GLI A;  4QSE A;  1QKA A;  4JWO A;  5B70 A;  1NNP A;  3VDF A;  5AA4 B;  4ZZE A;  1AL3 A;  5EQ7 A;  3ILT B;  1EZO A;  3W9W A;  3H4Z A;  3HPI A;  1LAH E;  3K01 A;  3CHG A;  4PE3 A;  1IMC A;  1Y3Q A;  3FVO A;  4PFT A;  2XD2 A;  2OWS A;  1H45 A;  3FTO A;  3PTY A;  4LAT A;  4G68 B;  4NTL A;  4P11 A;  5EHS A;  4LZ5 A;  1MDP 1;  2B3B A;  3SZP A;  1PDA A;  4NMY A;  4F1Y A;  4EDP A;  4PAK A;  4KR5 A;  3G3I A;  2Q8M A;  1BTJ A;  3B7D A;  3TTM A;  4LP2 B;  4IY5 A;  1MXU A;  1TWY A;  4MMP A;  1P1W A;  5ISU A;  1FBC A;  3FJG A;  4HE0 A;  3GYY A;  1P1N A;  1YPN A;  3DM0 A;  1J1N A;  2JJK A;  3T0J A;  5HM4 B;  3R7X A;  2QVV A;  3DEL B;  2UYF A;  4LQ5 A;  2F3D A;  2F97 A;  3CFL A;  1EU8 A;  1B51 A;  5AA1 A;  4NGU A;  3O28 A;  3TMG A;  1KA1 A;  4PQJ A;  2DP8 A;  4P9K A;  1FTO A;  5TPA B;  2ZNS A;  4O8M A;  4UA8 A;  2B4M A;  1MQJ A;  4BDO A;  2WYK A;  2XWV A;  2XXK A;  3N5L A;  3DRJ A;  4X1B A;  3KBZ A;  4ONY A;  4GWY A;  4N6D A;  1NV3 A;  5IZ3 A;  4EXL A;  2F6P A;  5H8F A;  1LBB A;  2OLB A;  5I58 A;  3M8U A;  4GF8 A;  3RGY A;  3PUY E;  2XX7 A;  2QFL A;  3QMF A;  3T96 B;  4NF8 A;  3FAT A;  2ZYO A;  5KDT B;  5I57 A;  3USD A;  4JBZ A;  1QVS A;  3TKD A;  3CG3 A;  2H25 A;  1B5H A;  4MLQ A;  1HSE A;  3QAX A;  3DRK A;  3RPL A;  3VXB A;  5DVJ A;  3UK4 A;  1B6H A;  2QVR A;  3IB2 A;  4MEV A;  1NNT A;  4N8Y A;  2D3I A;  3KN7 A;  4P3L A;  4DXC A;  1LBV A;  1DMB A;  3EHS A;  2Y84 A;  2FYI A;  4JWX A;  1QKB A;  4P56 A;  2I6E A;  1MH4 A;  2Z8E A;  1EYI A;  2F5X A;  3O97 A;  3TCG A;  2HZL A;  5CMK A;  2QS2 A;  4OTE A;  1VR5 A;  1MY1 A;  2VPN A;  1G0I A;  3G3F A;  3N26 A;  5L8D A;  4L17 A;  3W9V A;  3MP1 A;  2CZI A;  3TFL A;  1RYX A;  3SES A;  5CRY A;  1FBP A;  4NWC A;  1AIV A;  2WX9 A;  2G93 A;  4BDN A;  4YU0 A;  3I5O A;  5I2N A;  1P1U A;  3FXB A;  4GXS B;  2V93 A;  1M5F A;  3QXM A;  4G8M A;  1S9T A;  3EF7 A;  4WXJ A;  3D1R A;  3TTN A;  3DP8 A;  5ESY A;  1NV6 A;  4OFJ A;  3S4U A;  2X7P A;  5BUU A;  3SET A;  4WED A;  3MYU A;  1LBZ A;  4MHF A;  2HEU A;  2V3U A;  4MNC A;  4NG7 A;  4OES A;  4F39 A;  1GTK A;  4QXD A;  2Q9T A;  4BDM A;  5LTC A;  5DVF A;  3MC2 A;  1B3F A;  1MXX A;  2OWT A;  4JVI A;  3IK6 B;  2DWH A;  3MVX A;  1H43 A;  3G3J A;  5F1Q A;  1LBW A;  1UIU A;  4ZEK A;  2Y5K A;  4XEQ A;  4F31 B;  1B5I A;  3IO6 A;  2REJ A;  4H5G A;  4YAH X;  1B4H A;  4O3C A;  5ET5 A;  4ZE8 A;  1NV1 A;  5ITO A;  3G3K A;  2ONK E;  3T9H B;  5A5L A;  4HCW A;  3K6U A;  3SEX A;  4YB5 A;  4ZEC A;  1YYZ A;  5ET7 A;  3VVE A;  2DQV A;  1FCK A;  2PMS A;  4U1Z A;  2O68 A;  1TXF A;  1JEU A;  1KZ8 A;  1US5 A;  2FNC A;  3BFT A;  1IUD A;  3D4G A;  1Y9U A;  1B32 A;  1MH3 A;  2DE4 A;  5L9M A;  4QFP A;  3K6V A;  2B3F A;  3N94 A;  3VFJ A;  3KGC A;  4PTK A;  2I0B A;  2LAO A;  2Q2A A;  1BIY A;  2RC8 A;  3IB0 A;  5I2K A;  1USY E;  1DPE A;  1MM7 A;  2BJI A;  4P0I A;  5CMC A;  3SKP A;  3QUF A;  1BK4 A;  3MZ1 A;  5CI5 A;  1B5J A;  3TCF A;  3UA8 A;  5EQA A;  1RDX A;  2DVZ A;  4P1E A;  4OEN A;  2O7U A;  2Z8F A;  4LVQ A;  1FPF A;  2Q2C A;  4HTG A;  4OA4 A;  4ZZA A;  3FJM A;  1T0K A;  1K9Z A;  2CZK A;  2F6G A;  2NUV A;  1MQI A;  1FTK A;  3WAF A;  3OEN A;  1URG A;  3IL1 B;  4GXA A;  4H46 A;  4R9F A;  3MBP A;  5TU0 A;  3DRG A;  2R6G E;  1OQH A;  5JTY B;  2Q88 A;  3T66 A;  3ONM A;  3S9L C;  1ZLQ A;  2F7B A;  1IXI A;  4UAB A;  5KZT A;  3HHG A;  4JSO A;  1PC3 A;  1SYI A;  4NF5 A;  1DPP A;  4U23 A;  2I48 A;  3LSF B;  4OXV A;  5DYH A;  2NOO A;  1IMF A;  3H6W A;  1MM6 A;  3U8Q A;  1PB8 A;  1NH8 A;  1OQG A;  1POT A;  3TPA A;  4O94 A;  2GRV A;  3MVY A;  5I56 A;  1NH7 A;  4DXU A;  2F8D A;  1MY0 A;  4G2Z A;  2Y7K A;  4N8G A;  1LCT A;  3K00 A;  4MJO A;  3MPL A;  1GR2 A;  1FQF A;  2HXR A;  2R9J A;  3B50 A;  1FPJ A;  2V4C A;  3MWB A;  1MXV A;  3Q27 A;  2ALU A;  4FJP A;  5EYG A;  2QMW A;  3TCH A;  4O7M A;  1NNK A;  1TFA A;  2H9B A;  4E0W A;  2UVJ A;  4I3E A;  1YXI A;  5FHO A;  3N6T A;  3BKI B;  4R75 A;  4OWD A;  5IGA A;  1LAG E;  4NF6 A;  1B3H A;  2A5T A;  3SEV A;  1II5 A;  3MW0 A;  4XKP A;  4JWY A;  1MG1 A;  4R72 A;  1R1N A;  3K1P A;  2GHB A;  4YIC A;  2I0C A;  2WKY A;  1US4 A;  4ZS9 A;  3ODB A;  4PBQ A;  2A5S A;  3TOD A;  4H0W A;  3MVW A;  3FVN A;  1IMD A;  2XXT A;  5TP9 A;  1D9Q A;  2XWO A;  3S2V A;  3RN8 A;  3SDF A;  4TLL B;  4FAJ A;  4PE5 B;  3C32 A;  1A54 A;  1LB9 A;  1JET A;  5EQ8 A;  4AB5 A;  4ELO A;  3TAJ A;  4ZED A;  1CE2 A;  4U4X A;  4EQ9 A;  1DK4 A;  2GFE A;  5DEX B;  3OXN A;  4XKR A;  2O84 X;  3IJX B;  1LB8 A;  4BDR A;  3PAM A;  4NED A;  4U21 A;  5FTI A;  4N6K A;  2DSF A;  5IKB A;  3RYB A;  2HAV A;  1PEB A;  1R6Z A;  2XXU A;  3OSR A;  4N15 A;  4M4G A;  1MXZ A;  3C9H A;  4Q0C A;  5K2Y A;  5AA4 A;  4XFE A;  1XT8 A;  4C1U A;  2O6A A;  4R9G A;  3ZS6 A;  1N3X A;  3H7M A;  3RTF B;  3QIM A;  4K3F A;  1JVY A;  3F11 A;  4M1V A;  5LOM A;  4QHQ A;  2AIX A;  4G68 A;  1FQA A;  3SEU A;  4EF2 A;  1QW0 A;  3C31 A;  4F2O A;  4GIZ A;  1MPC A;  2WBB A;  4KD5 A;  1EH3 A;  1SVX B;  3SER A;  2Y7I A;  1MDQ A;  1DTZ A;  3TTK A;  3C34 A;  4FBP A;  2ZYN A;  4GL8 A;  2D5W A;  4OVS A;  3JV9 A;  3L6G A;  4HS7 A;  3IOR A;  3CSG A;  1AOV A;  1FBF A;  2FA7 A;  1VFE A;  2XHD A;  4RYA A;  3RT8 A;  4DZ1 A;  2DDK A;  1Y1Z A;  4KQP A;  2Y7W A;  5H8N B;  2HCA A;  4XIG Q;  1B40 A;  5A5X B;  2P3V A;  1IQ7 A;  3GZG A;  2QSX A;  1MRP A;  2UYE A;  2VGQ A;  3DP6 A;  4YKJ A;  2HPG A;  5AA2 D;  1HSL A;  2RF1 A;  3UN6 A;  4BDQ A;  5TPA A;  3RYD A;  1RYO A;  3FVK A;  5CC2 A;  5T3J A;  5I84 A;  3O9P A;  1URD A;  4H1X A;  4MF3 A;  4RNS A;  3PMX A;  4TQU Q;  4BLA A;  1DCU A;  4KHZ E;  4PFY A;  1LEV A;  2XXI A;  4F2Q A;  5HPQ A;  1MQD A;  1TFD A;  4PCD A;  3PU5 A;  3WAE A;  3K0V A;  3VVF A;  4F3B A;  4HXV A;  1P1O A;  1PBQ A;  2CEY A;  4KYE A;  2BJJ X;  2VD2 A;  3EQ1 A;  2OK2 A;  3PV0 E;  3LBS A;  2H98 A;  1FBH A;  1POY 1;  1ZIU A;  1B0H A;  4OVQ A;  3CFZ A;  5KDT A;  1JVX A;  1NI9 A;  2R8T A;  3KBR A;  1B3E A;  3EHT A;  1FPD A;  4QFN A;  3G3H A;  2Y5L A;  1N84 A;  4PET A;  3MP6 A;  2DS9 A;  2MKZ A;  4G61 A;  3KC1 A;  3U94 A;  4IR8 A;  3BFU A;  2P0S A;  1YCJ A;  2F35 A;  1NMU A;  2M8C A;  2I49 A;  1UTH B;  1QGX A;  1QUJ A;  4GD5 A;  3IOT A;  1MQG A;  3U72 A;  1I69 A;  3T9U A;  4OVT A;  1FPB A;  2G29 A;  1I6A A;  1ZKB A;  4Z0I A;  3OSQ A;  4F3G A;  4F18 A;  4GWW A;  4QSC A;  4PP0 A;  1EYJ A;  3MAM A;  4I62 A;  4FE8 A;  3UIF A;  1DSN A;  3PD8 A;  3C36 A;  4EF1 A;  2F36 A;  4IO2 A;  2NWJ A;  3G7W A;  4N81 A;  2AYS A;  1RDZ A;  3QSL A;  5B7D A;  1UTB B;  4HW8 A;  1B05 A;  2PX1 A;  2QJE A;  4AS4 A;  1IIW A;  3MZ9 A;  4RPN A;  4DE8 A;  4AS5 A;  1WDN A;  2XXP A;  4NWD A;  5AE4 A;  3E4R A;  5H8Q B;  4I3Y A;  3IR1 A;  2DVC A;  4H65 A;  3KJ7 A;  1B4Z A;  3GBB A;  1BKA A;  3FXU A;  1Y1M A;  4PF8 A;  4ND9 A;  1VSO A;  1XI6 A;  1N7X A;  1JW4 A;  1MY3 A;  2L5V A;  3K4U A;  2R71 A;  5KCJ B;  2V3T A;  4GOT A;  2PT1 A;  1FJ6 A;  1FBD A;  1FPE A;  4C1T A;  1FW0 A;  3CI8 A;  2ZXT A;  4F1V A;  4DLD A;  4PFU A;  3GBA A;  3PPP A;  4FOR A;  4JVD A;  1FQD A;  4AQ4 A;  3LSW A;  3CIJ A;  2FIX A;  3TQW A;  2VPO A;  4KCD A;  1FBG A;  4FEC A;  3THI A;  3TDJ A;  2GH9 A;  3EKI A;  4R74 A;  5CMB A;  5IM2 A;  1QUK A;  4RK2 A;  5I3S A;  3Q28 A;  4X48 A;  3B6T A;  4LUB A;  4HCY A;  4XKQ A;  1B1X A;  2DE2 A;  4O3A A;  2OX3 A;  2WOP A;  4NHB A;  2QS4 A;  3H6U A;  4FEB A;  3HHF A;  2H4I A;  3FVG A;  3FD3 A;  3ECR A;  1IME A;  4GX3 A;  4OAN A;  3CVG A;  2QPQ A;  5ICT A;  3LVU A;  1YTV A;  3MJN A;  4PFW A;  3QK6 A;  1ZBM A;  3K1N A;  4KFQ A;  4NF0 A;  4C0R A;  1IIT A;  3MQ9 A;  2Y7R A;  3L6H A;  4F1U A;  4OEU A;  3LUZ A;  1LAX A;  4NF4 B;  2PBW A;  4WKM A;  5I7I A;  4DCY A;  2QL3 A;  3SEY A;  4F29 A;  3ILU B;  2HAU A;  3RTW B;  3U1O A;  4YKI A;  2ZZX A;  4O3B A;  1NV4 A;  4LON B;  1NV5 A;  5CBR A;  4OYV A;  3KG2 A;  4Q30 B;  2KR0 A;  5LDZ A;  3T93 B;  3OO9 A;  2F78 A;  4ZEI A;  5CBS A;  2DE3 A;  2P2A A;  2XXX A;  2YLN A;  4DCX A;  3EPE A;  4GWU A;  1H76 A;  3SEW A;  3HST A;  4OER A;  1FQB A;  4DIG A;  1NV7 A;  1QJM A;  3U93 A;  1GVC A;  1FPG A;  2CMO A;  4H45 A;  1ZMG A;  4OQO A;  3FBP A;  1AH5 A;  1OVB A;  4POX A;  5I59 B;  4FIM A;  2RC7 A;  4NQ8 A;  3KC0 A;  5JTY A;  2B65 A;  4X9T A;  5JEI A;  3LUY A;  4IB2 A;  5FTH A;  3B6W A;  4X1D A;  3VE1 B;  2HZK A;  3LC8 A;  4GVO A;  2XX9 A;  4P1L A;  4RPO A;  1M5E A;  4GBV A;  4QSD A;  2Q8J A;  3ROJ A;  4GRK A;  5DVI A;  4N17 A;  4G77 A;  4KXP A;  4LQ2 A;  4OFO A;  1OLC A;  3FJ7 A;  2V84 A;  3IO4 A;  4ELP A;  1EZ9 A;  3KZG A;  3O29 A;  5H8H B;  5K2X A;  3TEL A;  1UIV A;  1NL5 A;  3TTR A;  4H8J A;  4G8N A;  1B3L A;  3PUW E;  3ZSF A;  1QUI A;  2ZNU A;  3E79 A;  3OO6 A;  3I6V A;  4U1O A;  3FUZ A;  5IZ1 A;  3O6H A;  3TZA A;  2I3W A;  1CB6 A;  5AA2 B;  4E0X A;  3O2A A;  2REG A;  1FTL A;  5L9S A;  2DWJ A;  1H44 A;  1PBP A;  2HQ0 A;  4TOZ A;  1USY H;  3H06 B;  1D9V A;  2DOJ A;  5FBP A;  2WBD A;  2I4C A;  3VLU A;  2ESN A;  4YKP A;  2XXW A;  1G0H A;  1B7Z A;  3Q29 A;  1LBC A;  4KI0 E;  5EHM A;  1FRP A;  4R6Y A;  3IFA A;  1B7U A;  3O6P A;  1A99 A;  2QS3 A;  3M3F A;  4LN5 A;  3UOR A;  2DWI A;  1IMB A;  1B2H A;  3FZV A;  1URS A;  3S9E A;  1FJ9 A;  4YZZ A;  3BIG A;  3KOS A;  1M5C A;  1Q1K A;  3V5A A;  2ZZW A;  3VLW A;  1FPI A;  5IAI A;  2QMX A;  1LBY A;  5DEX A;  2Z8D A;  1LFI A;  4OVP A;  1SW4 A;  1KWH A;  1NFT A;  4H8I A;  1L5T A;  2HHM A;  3HO7 A;  4N6P A;  1P99 A;  5BWJ A;  1A8F A;  2X7Q A;  4GBW A;  4GWO A;  4PBH A;  1H3D A;  2ZYK A;  4PF6 A;  4R73 A;  2FVZ A;  4PGP A;  2UXA A;  2O51 A;  4GX6 A;  4MIJ A;  4FED A;  1O7T A;  5ITP A;  1MXY A;  3DLN A;  3IB1 A;  3I3V A;  4JVC A;  2UVI A;  4I8C A;  4HE2 A;  2XXQ A;  3D4C A;  3PUX E;  4RK9 A;  1XHY A;  2Z22 A;  1A7L A;  1Y4C A;  1IEJ A;  3C35 A;  2PFY A;  3BIH A;  1LFG A;  1MQH A;  3K1M A;  3S9N C;  3MST A;  4DDD A;  1IMA A;  3ZKL A;  2O1L A;  4U22 A;  4F19 A;  4XXU A;  4R6K A;  1FTA A;  3C4M A;  3O6I A;  5ET6 A;  4GX4 A;  3OMB A;  5DT6 A;  3FV1 A;  3JYR A;  2ABH A;  3T22 A;  4R2F A;  2ONR A;  2OBG A;  4MFI A;  3FV2 A;  4R6H A;  4F3S A;  1RDY A;  4H67 A;  1IZ1 A;  5H8N A;  3GXA A;  1M5B A;  5A5X A;  5JK4 A;  2VHA A;  1VFD A;  3OEK A;  3VXC A;  1LGB C;  3Q26 A;  4DI4 B;  4N13 A;  2ZYM A;  5EYH A;  3K6X A;  4GFR A;  4OMB A;  3E78 A;  3HN0 A;  4YMA A;  4QF9 A;  2V3Q A;  3PUZ E;  3OEL A;  2PT2 A;  4ECF A;  2RC9 A;  2WOK A;  3MZB A;  1VDW A;  2H99 A;  1AMF A;  1DBZ A;  2PYY A;  2Q74 A;  3VV5 A;  4LA9 A;  1SD3 A;  3QUJ A;  1KA0 A;  1N0T A;  1O63 A;  2D21 A;  3HCQ A;  1EZP A;  1IXG A;  1PB7 A;  1NKX A;  4H6D A;  1NUZ A;  4NX1 A;  1JW5 A;  3TQL A;  4PC9 A;  1WOD A;  4ELR A;  1JP4 A;  3FIR A;  4O7I A;  1OMP A;  3TUS A;  4Q5T A;  4OEV A;  1Y4T A;  3DRH A;  3FAS A;  4ELQ A;  3IJO B;  2DXY A;  3LV0 A;  1HSJ A;  2DXR A;  1FQC A;  3OD7 A;  3HFU A;  4PFR A;  1Q35 A;  4PAI A;  1R9Q A;  5IZ3 B;  5F24 A;  2F7A A;  3CG1 A;  3U65 A;  5H8F B;  5ELV A;  5I58 B;  2ZNT A;  4G68 C;  1UTH A;  2I58 A;  2Y7P A;  3KEI A;  4F3P A;  2V25 A;  4XTC Q;  1FQE A;  2X26 A;  2CZH A;  2KLF A;  4NF8 B;  3VVD A;  1NUX A;  4RA1 A;  1ZTY A;  4XKN A;  4KPT A;  4TLM B;  4I9D A;  5I57 B;  3V8X B;  1B58 A;  3GLB A;  1B52 A;  3NOH A;  4GWX A;  4KCC A;  4BDL A;  4X04 A;  1BP5 A;  2YPN A;  3RPL B;  4OHN A;  3KFM A;  1I6B A;  1MS7 A;  4JXI A;  2WYP A;  4MBP A;  1S7Y A;  1SW1 A;  3OO7 A;  3KN3 A;  1UTB A;  4YKK A;  2ZZV A;  2DWA A;  1Z7N E;  2NVU B;  4LZ7 A;  1Y3N A;  5DTB A;  3IFC A;  4U2R A;  4XF5 A;  3IAZ A;  2XXH A;  4RJZ A;  2B4L A;  1LCF A;  3CRB A;  4DI3 D;  5H8Q A;  2KQZ A;  4N4U A;  2F3B A;  2PCR A;  4RXL A;  1FPL A;  3LR1 A;  1B1H A;  5FHM A;  5J16 A;  4I40 A;  2RCB A;  5DW8 A;  3N6U A;  2XD3 A;  1DOT A;  2P3N A;  3A3U A;  3AXF A;  1K9Y A;  1SDX A;  4IO3 A;  4THI A;  3RUM A;  5KCJ A;  3RQT A;  1MPB A;  2F7C A;  2I3V A;  4N07 A;  1MPD A;  5L9O A;  2FIE A;  3U92 A;  5I2N B;  3PMW A;  4FAT A;  4JDF A;  5ET8 A;  1SW2 A;  3V83 A;  3O66 A;  1R9L A;  4POW A;  1SI1 A;  2IEE A;  1B46 A;  2OZZ A;  1TT1 A;  4PDD A;  5AA3 A;  3FXR A;  1FTJ A;  1XOC A;  4YMB A;  5F7V A;  1Y20 A;  4YB7 A;  2GHA A;  3K6W A;  4H5F A;  4LZ8 A;  3T9V A;  2CZL A;  4PFI A;  4QFL A;  1FSA A;  1LLS A;  2XX8 A;  2E1S A;  2QS1 A;  3EHU A;  1LAF E;  3E13 X;  2O7I A;  5CMM A;  1D4N A;  1VE4 A;  2PVU A;  4MLV A;  3E9X A;  2FBP A;  2HXW A;  2HFB A;  3KN8 A;  5HBC A;  3T1B A;  4PGN A;  3TTL A;  1OIB A;  1YAE A;  5IZZ A;  1O64 A;  2WEF A;  2OJT A;  4I1D A;  1LFH A;  1XVY A;  4ZEB A;  1NUY A;  3BBR A;  2XXR A;  3IX1 A;  3K02 A;  2XWK A;  1RKM A;  1UQW A;  2UVH A;  3PMV A;  4IO7 A;  3DRI A;  2E0S A;  4RY1 A;  3IOW A;  3A29 A;  3LSX A;  1Y3P A;  4GWS A;  4EQ7 A;  3Q25 A;  4NF4 A;  4P0G A;  4U4S A;  1A55 A;  1IXC A;  2OWZ A;  3DP4 A;  1ANF A;  1I6Q A;  4G4P A;  1YZ0 A;  1B3G A;  1LST A;  3CFX A;  4OZ9 A;  1WVJ A;  1XC1 A;  4AB6 A;  1JEV A;  4QBA A;  3MPK A;  3KSX A;  1NUW A;  2RKM A;  4EUO A;  1ATG A;  1JQF A;  1NV0 A;  4IGR A;  2RIN A;  3OEM A;  5EQ9 A;  3RT6 B;  3A09 A;  3M3L A;  2FHY A;  1B0L A;  1GGG A;  3QYT A;  4NAP A;  4PDH A;  1SYH A;  4G8H A;  4IO6 A;  4N91 A;  1JNF A;  4KYD A;  1MXW A;  1SW5 A;  3A3C A;  5I2K B;  5I59 A;  2GQ1 A;  4ZDM A;  4JSD A;  4F22 A;  1SPI A;  2QVU A; 
#chains in the Genus database with same CATH homology
 4ZE9 A;  4QRZ A;  5EYF A;  3R6U A;  3R26 A;  1IXH A;  3H6V A;  3PD9 A;  1XS5 A;  2P1S A;  3B6Q A;  2XXV A;  2WOL A;  3IOV A;  1N3W A;  3FGS A;  4KYS A;  1ELJ A;  3E3K A;  3G3G A;  1A40 A;  5H8H A;  1N7W A;  4GQO A;  3PUV E;  3HV1 A;  1XVX A;  1PB9 A;  3TEP A;  1SBP A;  3H03 A;  3TYH A;  1D3K A;  4OET A;  1S50 A;  1OLA A;  3KSJ A;  4ISU A;  1F9B A;  2UVG A;  2OCU A;  5FHN A;  4GL0 A;  5AA2 A;  1NNF A;  4NF5 B;  4NE4 A;  1B7H A;  2O1M A;  2VOZ A;  1D9Y A;  2F34 A;  4EXK A;  2ZMB A;  1OVT A;  2VP1 A;  3H3G A;  3OO8 A;  3PPN A;  3W15 C;  5I56 B;  3EN3 A;  5CM6 A;  1FTM A;  4IY6 A;  4YB6 A;  1SQY A;  4Z7E A;  4MH5 A;  4ESX A;  1N76 A;  2XXY A;  3C33 A;  3UGW A;  1ZJL A;  3FXQ A;  1MY2 A;  3MVZ A;  1GV8 A;  3P7I A;  1M5D A;  4IGT A;  3KOT A;  2THI A;  3LSL A;  4Q8R A;  3VLV A;  3JZJ A;  2Q89 A;  4DXB A;  2I4B A;  3UP9 A;  5J1D A;  3RPW A;  5M2V A;  3MP8 A;  4NF6 B;  2A5T B;  1B9J A;  3PPO A;  1JW1 A;  2O69 A;  2NXO A;  3RY3 A;  2VD3 A;  4UAC A;  2QRY A;  4R2B A;  2W7Y A;  3O6G A;  3S9M C;  3V89 B;  3RYA A;  2RCA A;  2ANJ A;  2AL4 A;  1A8E A;  3PPR A;  3H6T A;  3PGF A;  1N04 A;  3K2D A;  2Z23 A;  5TP9 B;  2H5Y A;  2DYX A;  4IO5 A;  1QUL A;  4WEP A;  5H8S A;  3MUQ A;  3ZKK A;  2YJP A;  1ZU0 A;  4ESW A;  3CR9 A;  3T9X B;  1P1Q A;  2IA4 A;  3CSB A;  1DTG A;  3RNN A;  3M3K A;  1SI0 A;  4IO4 A;  4ZEF A;  1Z7M E;  3RLF E;  1BLF A;  4JB7 A;  3PPQ A;  2AL5 A;  3OOA A;  4OVJ A;  4EQB A;  4QFO A;  2ONS A;  3IOU A;  3DRF A;  1MY4 A;  4QFK A;  3KJT A;  4OFL A;  5ICQ A;  4GLI A;  4QSE A;  1QKA A;  4JWO A;  5B70 A;  1NNP A;  3VDF A;  5AA4 B;  4ZZE A;  1AL3 A;  1EZO A;  3ILT B;  3W9W A;  3H4Z A;  3HPI A;  1LAH E;  3K01 A;  3CHG A;  1Y3Q A;  3FVO A;  4PFT A;  2XD2 A;  2OWS A;  1H45 A;  3FTO A;  4LAT A;  4G68 B;  4NTL A;  4P11 A;  5EHS A;  4LZ5 A;  1MDP 1;  2B3B A;  1PDA A;  4NMY A;  4F1Y A;  4EDP A;  4KR5 A;  3G3I A;  1BTJ A;  3B7D A;  3TTM A;  4LP2 B;  4IY5 A;  1MXU A;  1TWY A;  1P1W A;  5ISU A;  3FJG A;  1P1N A;  1YPN A;  3DM0 A;  1J1N A;  5HM4 B;  3R7X A;  3DEL B;  2UYF A;  4LQ5 A;  2F97 A;  3CFL A;  1EU8 A;  1B51 A;  5AA1 A;  3O28 A;  3TMG A;  4PQJ A;  2DP8 A;  1FTO A;  5TPA B;  2ZNS A;  4UA8 A;  2B4M A;  1MQJ A;  4BDO A;  3N5L A;  3DRJ A;  4X1B A;  4ONY A;  4EXL A;  2F6P A;  5H8F A;  1LBB A;  2OLB A;  5I58 A;  3M8U A;  4GF8 A;  3RGY A;  3PUY E;  2XX7 A;  3T96 B;  4NF8 A;  3FAT A;  2ZYO A;  5KDT B;  5I57 A;  3USD A;  4JBZ A;  1QVS A;  3TKD A;  3CG3 A;  2H25 A;  1B5H A;  4MLQ A;  1HSE A;  3QAX A;  3DRK A;  3VXB A;  5DVJ A;  3UK4 A;  1B6H A;  3IB2 A;  1NNT A;  2D3I A;  3KN7 A;  4DXC A;  1DMB A;  3EHS A;  2Y84 A;  2FYI A;  4JWX A;  1QKB A;  2I6E A;  1MH4 A;  2Z8E A;  2F5X A;  3O97 A;  3TCG A;  2HZL A;  5CMK A;  2QS2 A;  4OTE A;  1VR5 A;  1MY1 A;  3G3F A;  3N26 A;  5L8D A;  4L17 A;  3W9V A;  3MP1 A;  3TFL A;  1RYX A;  3SES A;  5CRY A;  4NWC A;  1AIV A;  2G93 A;  4BDN A;  4YU0 A;  3I5O A;  5I2N A;  1P1U A;  4GXS B;  2V93 A;  1M5F A;  3QXM A;  4G8M A;  1S9T A;  3EF7 A;  4WXJ A;  3TTN A;  3DP8 A;  4OFJ A;  3S4U A;  2X7P A;  5BUU A;  3SET A;  4WED A;  2HEU A;  2V3U A;  4OES A;  4F39 A;  1GTK A;  2Q9T A;  4BDM A;  5DVF A;  3MC2 A;  1B3F A;  1MXX A;  2OWT A;  3IK6 B;  2DWH A;  3MVX A;  1H43 A;  3G3J A;  5F1Q A;  1UIU A;  4ZEK A;  4F31 B;  1B5I A;  3IO6 A;  2REJ A;  4H5G A;  4YAH X;  1B4H A;  4O3C A;  4ZE8 A;  5ITO A;  3G3K A;  2ONK E;  3T9H B;  4HCW A;  3K6U A;  3SEX A;  4YB5 A;  4ZEC A;  3VVE A;  2DQV A;  1FCK A;  2PMS A;  4U1Z A;  2O68 A;  1TXF A;  1JEU A;  1US5 A;  2FNC A;  3BFT A;  1IUD A;  3D4G A;  1Y9U A;  1B32 A;  1MH3 A;  2DE4 A;  5L9M A;  4QFP A;  3K6V A;  2B3F A;  3N94 A;  3VFJ A;  3KGC A;  2I0B A;  2LAO A;  2Q2A A;  1BIY A;  2RC8 A;  3IB0 A;  5I2K A;  1USY E;  1DPE A;  1MM7 A;  4P0I A;  5CMC A;  3SKP A;  3QUF A;  3MZ1 A;  5CI5 A;  1B5J A;  3TCF A;  3UA8 A;  2DVZ A;  4OEN A;  2O7U A;  2Z8F A;  4LVQ A;  2Q2C A;  4HTG A;  4ZZA A;  3FJM A;  1T0K A;  2F6G A;  2NUV A;  1MQI A;  1FTK A;  3WAF A;  3OEN A;  1URG A;  3IL1 B;  4GXA A;  4R9F A;  3MBP A;  5TU0 A;  3DRG A;  2R6G E;  1OQH A;  5JTY B;  2Q88 A;  3T66 A;  3ONM A;  3S9L C;  1ZLQ A;  2F7B A;  1IXI A;  5KZT A;  3HHG A;  4JSO A;  1PC3 A;  1SYI A;  4NF5 A;  1DPP A;  4U23 A;  2I48 A;  3LSF B;  4OXV A;  5DYH A;  2NOO A;  3H6W A;  1MM6 A;  3U8Q A;  1PB8 A;  1NH8 A;  1OQG A;  1POT A;  3TPA A;  2GRV A;  3MVY A;  5I56 A;  1NH7 A;  4DXU A;  2F8D A;  1MY0 A;  4G2Z A;  2Y7K A;  1LCT A;  3K00 A;  3MPL A;  1GR2 A;  1FQF A;  2R9J A;  3MWB A;  1MXV A;  3Q27 A;  2ALU A;  4FJP A;  2QMW A;  3TCH A;  1NNK A;  1TFA A;  2H9B A;  4E0W A;  2UVJ A;  5FHO A;  3N6T A;  3BKI B;  4R75 A;  4OWD A;  1LAG E;  4NF6 A;  1B3H A;  2A5T A;  3SEV A;  1II5 A;  3MW0 A;  4XKP A;  4JWY A;  1MG1 A;  4R72 A;  1R1N A;  3K1P A;  2GHB A;  4YIC A;  2I0C A;  2WKY A;  1US4 A;  4ZS9 A;  3ODB A;  2A5S A;  3TOD A;  4H0W A;  3MVW A;  3FVN A;  2XXT A;  5TP9 A;  3S2V A;  3RN8 A;  3SDF A;  4TLL B;  4FAJ A;  4PE5 B;  3C32 A;  1A54 A;  1LB9 A;  1JET A;  4AB5 A;  4ELO A;  3TAJ A;  4ZED A;  1CE2 A;  4U4X A;  4EQ9 A;  2GFE A;  5DEX B;  3OXN A;  4XKR A;  2O84 X;  3IJX B;  1LB8 A;  4BDR A;  3PAM A;  4NED A;  4U21 A;  5FTI A;  5IKB A;  2DSF A;  3RYB A;  2HAV A;  1PEB A;  1R6Z A;  2XXU A;  3OSR A;  4M4G A;  1MXZ A;  3C9H A;  4Q0C A;  5K2Y A;  5AA4 A;  1XT8 A;  4C1U A;  2O6A A;  4R9G A;  3ZS6 A;  1N3X A;  3H7M A;  3RTF B;  3QIM A;  4K3F A;  1JVY A;  3F11 A;  4M1V A;  5LOM A;  4QHQ A;  2AIX A;  4G68 A;  1FQA A;  3SEU A;  4EF2 A;  1QW0 A;  3C31 A;  4F2O A;  4GIZ A;  1MPC A;  4KD5 A;  1EH3 A;  1SVX B;  3SER A;  2Y7I A;  1DTZ A;  1MDQ A;  3TTK A;  3C34 A;  2ZYN A;  4GL8 A;  2D5W A;  3JV9 A;  3L6G A;  4HS7 A;  3IOR A;  3CSG A;  1AOV A;  2FA7 A;  1VFE A;  2XHD A;  4RYA A;  3RT8 A;  4DZ1 A;  1Y1Z A;  4KQP A;  2Y7W A;  5H8N B;  2HCA A;  4XIG Q;  1B40 A;  5A5X B;  1IQ7 A;  3GZG A;  2QSX A;  1MRP A;  2UYE A;  2VGQ A;  3DP6 A;  4YKJ A;  5AA2 D;  1HSL A;  2RF1 A;  3UN6 A;  4BDQ A;  5TPA A;  1RYO A;  3FVK A;  5CC2 A;  5I84 A;  3O9P A;  1URD A;  4H1X A;  4MF3 A;  4RNS A;  3PMX A;  4TQU Q;  4BLA A;  4KHZ E;  4PFY A;  2XXI A;  4F2Q A;  5HPQ A;  1MQD A;  1TFD A;  3PU5 A;  3WAE A;  3K0V A;  3VVF A;  4F3B A;  1P1O A;  1PBQ A;  4KYE A;  2BJJ X;  2VD2 A;  3EQ1 A;  2OK2 A;  3PV0 E;  3LBS A;  2H98 A;  1POY 1;  1ZIU A;  1B0H A;  3CFZ A;  5KDT A;  1JVX A;  3KBR A;  1B3E A;  3EHT A;  4QFN A;  3G3H A;  1N84 A;  4PET A;  3MP6 A;  2DS9 A;  3U94 A;  3BFU A;  2P0S A;  1YCJ A;  2F35 A;  1NMU A;  2M8C A;  2I49 A;  1UTH B;  1QUJ A;  4GD5 A;  3IOT A;  1MQG A;  3U72 A;  1I69 A;  3T9U A;  2G29 A;  1I6A A;  1ZKB A;  4Z0I A;  3OSQ A;  4F3G A;  4F18 A;  4QSC A;  4PP0 A;  3MAM A;  4I62 A;  4FE8 A;  3UIF A;  1DSN A;  3PD8 A;  3C36 A;  4EF1 A;  2F36 A;  4IO2 A;  2NWJ A;  3G7W A;  2AYS A;  3QSL A;  5B7D A;  1UTB B;  4HW8 A;  1B05 A;  2PX1 A;  2QJE A;  1IIW A;  3MZ9 A;  4RPN A;  4DE8 A;  1WDN A;  2XXP A;  4NWD A;  5AE4 A;  3E4R A;  5H8Q B;  3IR1 A;  2DVC A;  4H65 A;  3KJ7 A;  1B4Z A;  3GBB A;  1BKA A;  3FXU A;  1Y1M A;  4ND9 A;  1VSO A;  1N7X A;  1JW4 A;  1MY3 A;  3K4U A;  2R71 A;  5KCJ B;  2V3T A;  4GOT A;  2PT1 A;  4C1T A;  1FW0 A;  3CI8 A;  2ZXT A;  4F1V A;  4DLD A;  4PFU A;  3GBA A;  3PPP A;  4FOR A;  1FQD A;  4AQ4 A;  3LSW A;  3CIJ A;  3TQW A;  4KCD A;  4FEC A;  3THI A;  3TDJ A;  2GH9 A;  4R74 A;  5CMB A;  1QUK A;  4RK2 A;  3Q28 A;  4X48 A;  3B6T A;  4LUB A;  4HCY A;  4XKQ A;  1B1X A;  2DE2 A;  4O3A A;  2WOP A;  2QS4 A;  3H6U A;  4FEB A;  3HHF A;  2H4I A;  3FVG A;  3FD3 A;  3ECR A;  3CVG A;  2QPQ A;  5ICT A;  3LVU A;  1YTV A;  3MJN A;  4PFW A;  3QK6 A;  1ZBM A;  3K1N A;  4KFQ A;  4C0R A;  1IIT A;  3MQ9 A;  2Y7R A;  3L6H A;  4F1U A;  4OEU A;  1LAX A;  4NF4 B;  2PBW A;  4WKM A;  4DCY A;  2QL3 A;  3SEY A;  4F29 A;  3ILU B;  2HAU A;  3RTW B;  3U1O A;  4YKI A;  4O3B A;  4LON B;  5CBR A;  4OYV A;  3KG2 A;  4Q30 B;  3T93 B;  3OO9 A;  2F78 A;  4ZEI A;  5CBS A;  2DE3 A;  2P2A A;  2XXX A;  2YLN A;  4DCX A;  3EPE A;  1H76 A;  3SEW A;  3HST A;  4OER A;  1FQB A;  4DIG A;  1QJM A;  3U93 A;  1GVC A;  2CMO A;  4POX A;  1ZMG A;  4OQO A;  1AH5 A;  1OVB A;  5I59 B;  4FIM A;  2RC7 A;  5JTY A;  2B65 A;  4X9T A;  5JEI A;  3LUY A;  4IB2 A;  5FTH A;  3B6W A;  4X1D A;  3VE1 B;  2HZK A;  3LC8 A;  4GVO A;  2XX9 A;  4RPO A;  1M5E A;  4QSD A;  2Q8J A;  4GRK A;  5DVI A;  4G77 A;  4LQ2 A;  4OFO A;  1OLC A;  3FJ7 A;  2V84 A;  3IO4 A;  4ELP A;  1EZ9 A;  3KZG A;  3O29 A;  5H8H B;  5K2X A;  3TEL A;  1UIV A;  1NL5 A;  3TTR A;  4H8J A;  4G8N A;  1B3L A;  3PUW E;  3ZSF A;  1QUI A;  2ZNU A;  3OO6 A;  3I6V A;  4U1O A;  3FUZ A;  3O6H A;  3TZA A;  2I3W A;  1CB6 A;  5AA2 B;  4E0X A;  3O2A A;  2REG A;  1FTL A;  5L9S A;  2DWJ A;  1H44 A;  1PBP A;  2HQ0 A;  4TOZ A;  1USY H;  3H06 B;  1D9V A;  2DOJ A;  2I4C A;  3VLU A;  2ESN A;  4YKP A;  2XXW A;  1B7Z A;  3Q29 A;  1LBC A;  4KI0 E;  5EHM A;  4R6Y A;  1B7U A;  3O6P A;  1A99 A;  2QS3 A;  3M3F A;  3UOR A;  2DWI A;  1B2H A;  3FZV A;  1URS A;  3S9E A;  4YZZ A;  3KOS A;  1M5C A;  1Q1K A;  3V5A A;  3VLW A;  5IAI A;  2QMX A;  5DEX A;  2Z8D A;  1LFI A;  1SW4 A;  1KWH A;  1NFT A;  4H8I A;  1L5T A;  3HO7 A;  4N6P A;  1P99 A;  5BWJ A;  1A8F A;  2X7Q A;  4GWO A;  1H3D A;  2ZYK A;  4R73 A;  2UXA A;  2O51 A;  4FED A;  1O7T A;  5ITP A;  1MXY A;  3DLN A;  3IB1 A;  3I3V A;  2UVI A;  4I8C A;  2XXQ A;  3D4C A;  3PUX E;  4RK9 A;  1XHY A;  2Z22 A;  1A7L A;  1Y4C A;  1IEJ A;  3C35 A;  1LFG A;  1MQH A;  3K1M A;  3S9N C;  4DDD A;  3ZKL A;  2O1L A;  4U22 A;  4F19 A;  4XXU A;  4R6K A;  3C4M A;  3O6I A;  3OMB A;  5DT6 A;  3FV1 A;  3JYR A;  2ABH A;  3T22 A;  4R2F A;  2ONR A;  2OBG A;  4MFI A;  3FV2 A;  4R6H A;  4F3S A;  4H67 A;  1IZ1 A;  5H8N A;  3GXA A;  1M5B A;  5A5X A;  5JK4 A;  2VHA A;  3VXC A;  1VFD A;  3OEK A;  1LGB C;  3Q26 A;  4N13 A;  2ZYM A;  3K6X A;  4GFR A;  4OMB A;  3HN0 A;  4YMA A;  4QF9 A;  2V3Q A;  3PUZ E;  3OEL A;  2PT2 A;  4ECF A;  2RC9 A;  2WOK A;  3MZB A;  2H99 A;  1AMF A;  2PYY A;  3VV5 A;  4LA9 A;  1SD3 A;  3QUJ A;  1N0T A;  1O63 A;  2D21 A;  3HCQ A;  1EZP A;  1IXG A;  1PB7 A;  1NKX A;  4H6D A;  1JW5 A;  3TQL A;  1WOD A;  4ELR A;  3FIR A;  1OMP A;  3TUS A;  4Q5T A;  4OEV A;  1Y4T A;  3DRH A;  3FAS A;  4ELQ A;  3IJO B;  2DXY A;  1HSJ A;  2DXR A;  1FQC A;  3OD7 A;  1Q35 A;  1R9Q A;  2F7A A;  3CG1 A;  5H8F B;  5ELV A;  5I58 B;  2ZNT A;  4G68 C;  1UTH A;  2I58 A;  2Y7P A;  3KEI A;  4F3P A;  2V25 A;  4XTC Q;  1FQE A;  2X26 A;  2KLF A;  4NF8 B;  3VVD A;  4RA1 A;  1ZTY A;  4XKN A;  4KPT A;  4TLM B;  4I9D A;  5I57 B;  3V8X B;  1B58 A;  3GLB A;  1B52 A;  4KCC A;  4BDL A;  1BP5 A;  2YPN A;  4OHN A;  3KFM A;  1I6B A;  1MS7 A;  4JXI A;  4MBP A;  1S7Y A;  1SW1 A;  3OO7 A;  3KN3 A;  1UTB A;  4YKK A;  2DWA A;  1Z7N E;  2NVU B;  4LZ7 A;  1Y3N A;  5DTB A;  4U2R A;  3IAZ A;  2XXH A;  4RJZ A;  2B4L A;  1LCF A;  3CRB A;  5H8Q A;  4RXL A;  3LR1 A;  1B1H A;  5FHM A;  2RCB A;  3N6U A;  2XD3 A;  1DOT A;  3A3U A;  3AXF A;  1SDX A;  4IO3 A;  4THI A;  3RUM A;  5KCJ A;  3RQT A;  1MPB A;  2F7C A;  2I3V A;  4N07 A;  1MPD A;  5L9O A;  3U92 A;  5I2N B;  3PMW A;  4FAT A;  4JDF A;  1SW2 A;  3V83 A;  3O66 A;  1R9L A;  4POW A;  1SI1 A;  2IEE A;  1B46 A;  2OZZ A;  1TT1 A;  5AA3 A;  3FXR A;  1FTJ A;  1XOC A;  4YMB A;  5F7V A;  1Y20 A;  4YB7 A;  2GHA A;  3K6W A;  4H5F A;  4LZ8 A;  3T9V A;  2CZL A;  4QFL A;  1LLS A;  2XX8 A;  2E1S A;  2QS1 A;  3EHU A;  1LAF E;  3E13 X;  2O7I A;  5CMM A;  1D4N A;  1VE4 A;  2PVU A;  4MLV A;  3E9X A;  2HXW A;  2HFB A;  3KN8 A;  5HBC A;  3TTL A;  1OIB A;  1YAE A;  1O64 A;  2OJT A;  4I1D A;  1LFH A;  1XVY A;  4ZEB A;  3BBR A;  2XXR A;  3IX1 A;  3K02 A;  1RKM A;  1UQW A;  2UVH A;  3PMV A;  4IO7 A;  3DRI A;  2E0S A;  4RY1 A;  3IOW A;  3LSX A;  1Y3P A;  4EQ7 A;  3Q25 A;  4NF4 A;  4P0G A;  4U4S A;  1A55 A;  1IXC A;  3DP4 A;  1ANF A;  1I6Q A;  4G4P A;  1B3G A;  1LST A;  3CFX A;  4OZ9 A;  1WVJ A;  1XC1 A;  4AB6 A;  1JEV A;  3MPK A;  3KSX A;  2RKM A;  4EUO A;  1ATG A;  1JQF A;  4IGR A;  2RIN A;  3OEM A;  3RT6 B;  3A09 A;  3M3L A;  1B0L A;  1GGG A;  3QYT A;  1SYH A;  4G8H A;  4IO6 A;  1JNF A;  4KYD A;  1MXW A;  1SW5 A;  3A3C A;  5I2K B;  5I59 A;  4ZDM A;  4JSD A;  4F22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...