1QKBA

Oligo-peptide binding protein (oppa) complexed with kvk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
publication title Crystallographic and Calorimetric Analysis of Peptide Binding to Oppa Protein
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Protein transport
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1qkbA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qkbA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1qkbA02
4Z0IA 3RUMA 2V3TA 1MY1A 1EZ9A 1N76A 1JW4A 1MY4A 1RYOA 3A09A 5AA2D 3HHGA 3EN3A 3T96B 3TCHA 2OBGA 2NVUB 1OQGA 2CZLA 2XXQA 4U4XA 2VD2A 3CSBA 2AL5A 1H44A 4ELRA 5CBRA 1B5IA 3EPEA 1B5JA 1NKXA 1SW2A 1B40A 1SVXB 3TMGA 4P11A 4R2BA 1MH4A 3CHGA 1UTHA 3MZ9A 1MPDA 4THIA 2QRYA 1B4ZA 4QF9A 1Q1KA 2OJTA 3O6PA 2DWJA 2YPNA 2F6GA 3G7WA 4DE8A 2F34A 4I9DA 2DE3A 4DXUA 2O1LA 1N3XA 3O66A 4ZEBA 4LATA 4OHNA 2A5SA 2I0CA 2PBWA 3K6UA 2ZMBA 3HPIA 4BDMA 4G4PA 3RLFE 2F8DA 3UIFA 1RYXA 5AA2A 4PFWA 4WEDA 4ND9A 3RPWA 1GTKA 4OFLA 3N6TA 4G77A 4DCYA 1B3LA 1NFTA 3SESA 1JNFA 3U93A 3UN6A 4QFKA 3BBRA 1QVSA 3CVGA 1MPCA 2HEUA 4OVJA 1R1NA 1NNKA 3MP1A 3VDFA 2XXPA 4AB5A 4ZZAA 4ZZEA 3TTRA 4NF6A 1LFGA 1MY2A 1JEUA 3CRBA 1QJMA 4TLLB 4RNSA 3EHTA 2HXWA 1QKAA 3VVFA 3KN7A 4KYEA 1Y1MA 1B7ZA 2Q2AA 2QJEA 4BDOA 3IOWA 1NNFA 1IUDA 1MDQA 3L6GA 3I3VA 3K01A 4BDLA 4ESWA 4YU0A 1URSA 4H5GA 4NF4A 3LUYA 4P0IA 3PPPA 3RT6B 3PUXE 3T93B 5L9OA 4F3GA 1A99A 3QSLA 3H6TA 1BLFA 4HS7A 4R6HA 5TPAB 3PPOA 1MS7A 1H45A 1BIYA 2Q9TA 2D3IA 5H8QB 1M5EA 4NF5A 3N5LA 2X7QA 4GIZA 1VE4A 4RXLA 1LAGE 4ZDMA 3TDJA 4JXIA 2H9BA 3AXFA 2Z8EA 2ABHA 3CG3A 2ZNTA 3IAZA 2HAUA 2HCAA 2VP1A 2O68A 4PFTA 4NWCA 1MQDA 1YAEA 1MXUA 2Z8FA 4RK9A 3Q25A 5AA1A 3G3HA 4HTGA 4TOZA 1B3FA 3G3JA 2QPQA 2B3FA 1D9YA 1MXWA 2OWSA 4JWOA 1XT8A 4F39A 3OO9A 4I1DA 4E0WA 3FIRA 4KHZE 3H6VA 5CM6A 1LAHE 4H6DA 1SW1A 1CB6A 3M8UA 4FAJA 3TQLA 3E3KA 3FJ7A 2O1MA 1XVYA 3H6WA 3EHSA 3PD9A 3K6XA 4QFLA 3E4RA 1FTOA 2RCAA 5JK4A 1OLAA 1I6AA 4IO3A 2ONKE 2X7PA 4ZE9A 3B6WA 2F36A 4ZEKA 2LAOA 4OETA 3T9VA 4LQ2A 1Y1ZA 5BUUA 4PQJA 1JETA 4WEPA 1LB9A 4H67A 1S9TA 2I49A 1Y3PA 2FA7A 4FEDA 1DSNA 2M8CA 4R6KA 2XXXA 3B6TA 2W7YA 1TXFA 3WAEA 3UORA 3TCFA 1MY3A 2DXRA 2O84X 2IA4A 4DDDA 1B4HA 5L8DA 1VFDA 1ZIUA 1A8EA 4RK2A 3Q27A 1RKMA 3PMWA 2I4BA 5DEXB 3DRGA 2GRVA 2ONSA 3PUZE 2UYEA 2O69A 3DP8A 4G68B 1MG1A 3IB2A 4IO7A 1IZ1A 2YJPA 2QL3A 4QFPA 1B7HA 3RT8A 3OMBA 4EXKA 4M1VA 1MY0A 3DLNA 3OENA 4KCCA 1EH3A 1VSOA 4OYVA 2A5TA 1URGA 5I56A 2I58A 4AQ4A 3T9UA 3IOUA 5DVJA 4YB7A 5CMKA 1IEJA 4U4SA 4LZ7A 1DPEA 3Q28A 4BDNA 4MF3A 1MQJA 2Y84A 3CFXA 1IQ7A 1Y20A 2ZXTA 2GFEA 2BJJX 1J1NA 1EU8A 2THIA 5AA3A 2E1SA 1PBPA 4GOTA 3TQWA 4F2QA 4R9FA 5TP9B 4N13A 1MPBA 3E9XA 3O2AA 3RN8A 2XX9A 3VVEA 2VOZA 5H8HB 2V25A 4KCDA 4QSCA 4YB6A 3M3FA 4OENA 1XVXA 1TFAA 5F1QA 2FYIA 2D5WA 3B7DA 3HV1A 1JQFA 5CMCA 4XXUA 5B7DA 3DRFA 3DP4A 1PBQA 2VD3A 3IX1A 3M3LA 4EUOA 4UACA 1UIVA 3R6UA 4U21A 1QW0A 4XKQA 3VLWA 2QS3A 4GRKA 3FD3A 4YICA 3IK6B 4G8HA 5DVFA 4DXBA 1YCJA 3DM0A 3S9MC 3OOAA 4LP2B 3O6HA 1II5A 2O51A 4XKPA 3RTWB 3PUWE 3H03A 2ANJA 4LA9A 4RYAA 1QKBA 5CMMA 1I6BA 2HFBA 3LC8A 3A3CA 1N7WA 4ELPA 3CFLA 4X9TA 4EF2A 3FVKA 1PDAA 3SEWA 4PP0A 3MZBA 4KYDA 2I48A 3KZGA 2KLFA 3JZJA 1DPPA 1FQCA 5EHMA 3H7MA 5M2VA 2XXIA 3TODA 4BDRA 4F1YA 2I4CA 2DE4A 4YKJA 1QUIA 3SEUA 1HSJA 3K1MA 2DS9A 2B65A 2XXWA 3RGYA 4YMAA 3LVUA 5ITPA 1FQFA 4GF8A 3DRJA 3HN0A 4O3BA 1UTBB 1D3KA 3D4GA 2DSFA 1A40A 3CI8A 2F35A 4RJZA 3O6IA 3K02A 4IGRA 3CG1A 2Y7IA 3OSQA 3MC2A 2NWJA 4FIMA 3IB0A 3U1OA 3C35A 4DZ1A 3FGSA 3PPRA 1B1XA 2UVHA 3K4UA 2OCUA 5FHMA 3IJOB 4FATA 3HCQA 4EQ9A 3LSXA 1N3WA 1I69A 5A5XB 1LBBA 2H98A 2DOJA 4FORA 5KZTA 3U94A 1SYHA 1ZLQA 4U2RA 4POXA 3TYHA 4H8IA 3S4UA 1NNPA 1IXIA 5TPAA 3TPAA 4JWXA 2V84A 5CBSA 3IO6A 3ECRA 4EQBA 5AA4B 4R6YA 1Y3QA 5H8QA 3FZVA 3C4MA 4KFQA 1FCKA 1XHYA 3ONMA 2ESNA 4U23A 4F1VA 1US5A 2V93A 4C0RA 1SD3A 5I58B 3FATA 2Y7RA 2DWHA 4N07A 3MP8A 3C31A 4OERA 1SDXA 1O64A 3R7XA 1UTHB 2HZLA 2P2AA 3CIJA 3TTNA 2RF1A 3MQ9A 4Q8RA 1B1HA 1B3EA 1GGGA 5I2KB 2F7BA 1F9BA 3KN3A 2OWTA 3UGWA 1FQDA 3PUVE 2H4IA 5L9SA 2O7IA 3S9NC 5FTHA 1MQGA 1LCFA 2DQVA 2XXRA 4U1ZA 3FJGA 4DIGA 1LAXA 2IEEA 4EXLA 2F5XA 3VV5A 1M5DA 2NXOA 2Z8DA 5I2NB 3O28A 1B51A 2ZYKA 1LFIA 4F29A 2DYXA 1ANFA 5I57B 4JDFA 1SW5A 4PE5B 3KOTA 3OEKA 4LONB 4GXAA 1USYE 2GHAA 3KG2A 1SI1A 3FVOA 5H8FB 3K6VA 3DRIA 4HCYA 1OVBA 1JVYA 1FQBA 3KBRA 1OVTA 1AIVA 2REGA 5LOMA 1ZTYA 2H99A 1US4A 3KSJA 3I6VA 1M5FA 3U8QA 3RQTA 1MXZA 1B46A 1BTJA 3D4CA 5DEXA 2F7CA 1QUKA 4WXJA 1XS5A 4RY1A 4JSOA 1N04A 2I3WA 3PPQA 3V89B 3EQ1A 4R2FA 1USYH 4QHQA 3FVGA 5EYFA 2DVZA 2UYFA 3JV9A 4G68A 3PD8A 1L5TA 3TAJA 3THIA 2CMOA 3TCGA 2RINA 1TFDA 3K1PA 1R9QA 3VLVA 5DVIA 3FV2A 3PV0E 1ATGA 3W9VA 4JWYA 2NUVA 4KI0E 3PMXA 4H1XA 2I6EA 3Q26A 1VFEA 5HBCA 1Y4CA 1MRPA 3EHUA 2RKMA 2Z23A 3KFMA 4G2ZA 1Z7ME 3CFZA 4UA8A 3ZSFA 1GR2A 3W9WA 2PYYA 4GL0A 2F97A 4OTEA 1JEVA 4IO6A 4F31B 1FTMA 2YLNA 4ZE8A 3U92A 1FTJA 2F78A 1PB8A 3H3GA 3VLUA 2GHBA 3K0VA 3OXNA 3QAXA 1LLSA 4E0XA 4MH5A 5TP9A 3DRKA 1OLCA 3LR1A 2O6AA 3O9PA 5I59B 5H8HA 3GLBA 1LBCA 3MPKA 1O63A 3SKPA 1H76A 1ZKBA 4KR5A 3H6UA 2RCBA 2QMXA 1AL3A 1TWYA 4ECFA 5K2YA 4OQOA 4NEDA 4F1UA 3I5OA 1SQYA 1S7YA 4OFJA 1MH3A 2B4MA 5KCJB 3UK4A 4IO5A 1B5HA 2PVUA 3SERA 3OO8A 3TZAA 3IO4A 1M5BA 4IY6A 4IY5A 3G3FA 3VXBA 4JBZA 4OEUA 1LGBC 2UVGA 4DCXA 3PUYE 2RC8A 1GV8A 3QUFA 2QMWA 1ZJLA 1NMUA 3QYTA 3FJMA 3KGCA 3KJTA 4FEBA 1B0LA 5CC2A 3GBAA 3V8XB 2QS1A 2F6PA 3O29A 3JYRA 3LSWA 2WOPA 5FTIA 4I8CA 4IGTA 3DRHA 2D21A 3USDA 4F2OA 4YZZA 4NF8B 3T22A 1SI0A 4ZECA 3RYBA 5ELVA 1H3DA 1NL5A 3SDFA 3FUZA 3QXMA 1KWHA 3L6HA 4POWA 1UTBA 4GQOA 1PEBA 3VFJA 4GWOA 4YMBA 3TFLA 4IO2A 2R71A 5JTYB 3T66A 3B6QA 3KSXA 2DVCA 3V83A 3SEXA 4MBPA 5CI5A 1R9LA 1B7UA 3FASA 4KD5A 1P99A 4OMBA 4ESXA 4K3FA 5ITOA 4QRZA 4ZEIA 4F3SA 3FXQA 5A5XA 3IOVA 2ZYMA 2XX7A 3QIMA 4P0GA 2XXVA 3S9LC 3RY3A 2QSXA 1OIBA 3ILUB 1FQEA 5H8NB 4RPNA 4ELOA 3E13X 2P0SA 3TEPA 5DYHA 2Y7KA 2UVIA 4IB2A 1OMPA 3OSRA 4F19A 1O7TA 4BDQA 5AA4A 2RC9A 4U1OA 3W15C 1NH7A 3MVYA 4F3BA 1MDP1 2R9JA 1AMFA 2O7UA 4XKRA 4ONYA 3F11A 5I58A 2PX1A 1B9JA 5EHSA 4X48A 3MPLA 1N0TA 1P1OA 4OZ9A 3MVWA 3TUSA 1UQWA 4FE8A 1N84A 1R6ZA 3FV1A 5KDTB 1H43A 2B4LA 3IB1A 3ZKLA 3TTMA 2XX8A 4F22A 3DELB 3RYAA 4TQUQ 5I2KA 3GZGA 4GL8A 1A8FA 4NMYA 1DOTA 4ELQA 1XOCA 3RNNA 4WKMA 1P1NA 2FNCA 1B2HA 4QSEA 5ISUA 3SEYA 4LQ5A 4FECA 3LBSA 2X26A 1WVJA 3LSFB 2AYSA 1MXVA 4HCWA 3MAMA 3HHFA 3RTFB 3HSTA 4R73A 3C34A 4LUBA 4OESA 1JW5A 2DP8A 2Q8JA 5I2NA 2OK2A 4ZEFA 4F18A 3OO7A 3V5AA 4R9GA 1D4NA 4Q30B 5I57A 2ALUA 4ISUA 4HW8A 1FW0A 3CSGA 4NTLA 1I6QA 1JVXA 4GXSB 3A3UA 1N7XA 2HAVA 4R75A 1Y9UA 5H8FA 3KN8A 2PMSA 4XTCQ 5HPQA 2R6GE 3ODBA 1LB8A 2ZYOA 2V3UA 3FTOA 1IXGA 3U72A 3TTKA 1LCTA 2DXYA 3ZS6A 4O3CA 3MBPA 3OELA 1P1QA 4G8NA 2B3BA 3M3KA 1M5CA 4RPOA 4ZEDA 5K2XA 1MM7A 1FTLA 2I0BA 4KYSA 4EQ7A 1VR5A 2XHDA 1IITA 3IOTA 5JEIA 4GFRA 4EDPA 3N6UA 1Q35A 1CE2A 2QS2A 4N6PA 4OFOA 3QK6A 2XXYA 3FXUA 1ZBMA 2G29A 2WOKA 2HQ0A 4RA1A 4X1BA 5AA2B 3PU5A 4LVQA 4G68C 3GBBA 4DLDA 3K6WA 4R74A 3MVZA 1YPNA 4IO4A 5AE4A 4M4GA 3TKDA 1MQHA 2H5YA 1MQIA 4KPTA 3K2DA 3FXRA 3IL1B 5FHOA 3MVXA 3O97A 5BWJA 3TTLA 4MLQA 2DWAA 4KQPA 2OLBA 1IIWA 4YB5A 4YKIA 4OEVA 4MFIA 5CMBA 4Q5TA 1HSEA 4NF6B 3MWBA 5I84A 3KOSA 4JSDA 1A54A 1IXHA 3PPNA 2UXAA 1FQAA 4R72A 4O3AA 2AL4A 1MXXA 4PFUA 5I59A 4H0WA 1LFHA 5IKBA 4H5FA 3HO7A 1XC1A 2OZZA 4C1UA 5TU0A 3N26A 1SBPA 2V3QA 1WODA 4NF4B 5B70A 1TT1A 3KEIA 1DTZA 4YKPA 3IJXB 3LSLA 5CRYA 4GLIA 5ICQA 3IR1A 3MUQA 3T9HB 4NE4A 3K00A 2HZKA 4XKNA 5HM4B 2WKYA 5KCJA 1B05A 1YTVA 2G93A 1SYIA 1BKAA 4NF5B 5IAIA 4H8JA 1B52A 4MLVA 4H65A 1QUJA 1LAFE 1Y3NA 1D9VA 2XD3A 3FVNA 4QSDA 5H8SA 1DMBA 3OO6A 2QS4A 3G3GA 2Y7WA 4DXCA 1B58A 3G3KA 3T9XB 3WAFA 4X1DA 2E0SA 2Q88A 4YAHX 2ZNSA 1QULA 2RC7A 3UP9A 3N94A 4AB6A 3MJNA 1LSTA 3GXAA 5DTBA 3QUJA 1UIUA 4FJPA 4GD5A 1B3HA 3K1NA 4G8MA 5J1DA 1NH8A 3EF7A 3G3IA 3BKIB 4NF8A 3CR9A 1B32A 4EF1A 1IXCA 2F7AA 4XIGQ 2DE2A 3VXCA 1DTGA 2WOLA 1JW1A 1AH5A 2ZYNA 3ILTB 3OEMA 5JTYA 1GVCA 1WDNA 2GH9A 3SETA 2Q2CA 5L9MA 2P1SA 1B0HA 3C32A 2XXUA 2NOOA 2AIXA 3C9HA 5DT6A 5FHNA 2DWIA 1OQHA 4C1TA 2I3VA 4PFYA 3UA8A 1FTKA 3VVDA 3C33A 1POTA 2ZNUA 2PT2A 1MXYA 4ZS9A 2ONRA 1B6HA 1POY1 4I62A 4LZ5A 5H8NA 1AOVA 2H25A 4Z7EA 1A55A 3S2VA 2XXTA 4BLAA 1PC3A 4OWDA 1T0KA 3BFTA 4Q0CA 2UVJA 1P1WA 4QFNA 4GVOA 2XXHA 3BFUA 3KJ7A 3DP6A 1EZOA 3SEVA 3PMVA 1EZPA 3PGFA 1PB7A 4JB7A 2Q89A 3H4ZA 1Z7NE 2VHAA 3S9EA 3VE1B 3ZKKA 4QFOA 2VGQA 3P7IA 4YKKA 2Y7PA 1ZU0A 2Z22A 3O6GA 4TLMB 4PETA 1MM6A 1Y4TA 1NNTA 3OD7A 5KDTA 4L17A 2REJA 2A5TB 2PT1A 1A7LA 3C36A 5I56B 1SW4A 1HSLA 1URDA 3Q29A 5F7VA 1BP5A 3MZ1A 3IORA 3TELA 3MW0A 4F3PA 3R26A 1S50A 4U22A 3H06B 4NWDA 1PB9A 5ICTA 4OXVA 3MP6A 3PAMA 1P1UA 2XD2A 4LZ8A 1B3GA 1ZMGA 1ELJA
chains in the Genus database with same CATH superfamily
1BK4A 4Z0IA 3RUMA 2V3TA 1MY1A 1EZ9A 1KZ8A 1N76A 4PFIA 1JW4A 4XF5A 1MY4A 1RYOA 3A09A 4PCDA 5AA2D 3HHGA 3EN3A 3T96B 3TCHA 2OBGA 4PAFA 2NVUB 1OQGA 2CZLA 2XXQA 4U4XA 2VD2A 3CSBA 2AL5A 4N81A 1H44A 4ELRA 5CBRA 1DK4A 1B5IA 3EPEA 5I7IA 1B5JA 1NKXA 1SW2A 1B40A 1SVXB 3TMGA 4P11A 4R2BA 1MH4A 3CHGA 1UTHA 3MZ9A 4O7IA 1MPDA 4THIA 2QRYA 1B4ZA 4QF9A 1Q1KA 2OJTA 3O6PA 2DWJA 2YPNA 2F6GA 3G7WA 4DE8A 2F34A 4I9DA 2DE3A 4DXUA 2O1LA 1N3XA 3O66A 4ZEBA 2JJKA 4LATA 4OHNA 2ZZXA 2A5SA 2KR0A 1YZ0A 2I0CA 4O8MA 2PBWA 4PFRA 3K6UA 2ZMBA 1JP4A 3HPIA 4BDMA 4PBQA 1EYJA 4G4PA 3RLFE 3RPLA 2F8DA 3UIFA 3D1RA 1RYXA 5AA2A 4PFWA 4WEDA 3MYUA 4ND9A 3RPWA 1GTKA 4OFLA 3N6TA 4N4UA 4G77A 4DCYA 1B3LA 1NFTA 1FPFA 3SESA 1JNFA 3U93A 3UN6A 4QFKA 4MJOA 3BBRA 1QVSA 3CVGA 1MPCA 1D9QA 2HEUA 4OVJA 1R1NA 1NNKA 3MP1A 3VDFA 2XXPA 4AB5A 4ZZAA 4ZZEA 3TTRA 4NF6A 1LFGA 1MY2A 1JEUA 3CRBA 1QJMA 4TLLB 3PTYA 4RNSA 3EHTA 2OWZA 5A5LA 2HXWA 1QKAA 3VVFA 3KN7A 4KYEA 1Y1MA 1B7ZA 2Q2AA 2QJEA 1LEVA 4BDOA 3IOWA 1NNFA 1FPKA 1IUDA 1MDQA 2FIEA 3L6GA 4NQ8A 3I3VA 3K01A 4BDLA 4ESWA 3FBPA 4YU0A 1URSA 4H5GA 4NF4A 3LUYA 4P0IA 3PPPA 3RT6B 3PUXE 3T93B 5L9OA 4F3GA 1A99A 3QSLA 3H6TA 1BLFA 4HS7A 2WYKA 4R6HA 3PPOA 5TPAB 2HPGA 1MS7A 1IMEA 1LBXA 1H45A 1BIYA 2Q9TA 2D3IA 2HXRA 1RDXA 5H8QB 1M5EA 4NF5A 2WX9A 3N5LA 2X7QA 4PFBA 4GIZA 1VE4A 4RXLA 1LAGE 4ZDMA 3TDJA 4JXIA 2H9BA 4MNCA 3AXFA 5IZZA 2Z8EA 2ABHA 3CG3A 2ZNTA 4PF8A 3IAZA 2HAUA 2XWVA 2HCAA 4OVSA 2VP1A 2O68A 4PFTA 4NWCA 1MQDA 1YAEA 1MXUA 3EKIA 2Z8FA 4RK9A 3Q25A 5AA1A 3G3HA 4HTGA 4TOZA 1B3FA 3G3JA 2QPQA 2B3FA 1D9YA 1MXWA 2OWSA 4JWOA 1XT8A 1NUZA 4F39A 3OO9A 4I1DA 4E0WA 3FIRA 4KHZE 3BIHA 3H6VA 5CM6A 1LAHE 2P3VA 4H6DA 1SW1A 1CB6A 1FSAA 3M8UA 4FAJA 3TQLA 2QVRA 3E3KA 3FJ7A 2O1MA 1XVYA 3H6WA 3EHSA 3PD9A 3K6XA 4QFLA 3E4RA 1FTOA 2RCAA 5JK4A 1OLAA 1I6AA 4IO3A 2ONKE 2X7PA 4ZE9A 3B6WA 2PFZA 2F36A 4ZEKA 2LAOA 4OETA 3T9VA 4LQ2A 1Y1ZA 5BUUA 4N91A 5EYHA 4PQJA 1JETA 4WEPA 1LB9A 4H67A 1S9TA 2I49A 1Y3PA 2FA7A 4FEDA 1FTAA 4HE1A 1DSNA 2M8CA 4R6KA 2XXXA 5LDZA 3B6TA 4G61A 4N6DA 2W7YA 2CZHA 1TXFA 3WAEA 3UORA 2O84X 3TCFA 1MY3A 2DXRA 2IA4A 4DDDA 1B4HA 5L8DA 1VFDA 1Q9DA 1ZIUA 1A8EA 4RK2A 3Q27A 1RKMA 3PMWA 4I3YA 2I4BA 1FBHA 5DEXB 4KXPA 3DRGA 4MCOA 2GRVA 1NUWA 4N8YA 5ESYA 1VDWA 2ONSA 3PUZE 2UYEA 2O69A 4QBAA 3DP8A 4G68B 1MG1A 4H46A 3KBZA 3IB2A 2Y5KA 4IO7A 1IZ1A 4OVTA 2YJPA 2QL3A 4QFPA 1B7HA 4QXDA 3RT8A 2FIXA 3OMBA 4EXKA 4M1VA 1MY0A 3DLNA 3OENA 4KCCA 1EH3A 5ET8A 1VSOA 4OYVA 2A5TA 1URGA 5I56A 4PAKA 2WBDA 2I58A 4AQ4A 3T9UA 3IOUA 5DVJA 3GYYA 4YB7A 3KC0A 5CMKA 1IEJA 1NV6A 4U4SA 4LZ7A 1DPEA 3Q28A 4GWUA 4BDNA 4MF3A 1MQJA 2Y84A 3CFXA 1IQ7A 1Y20A 1FPIA 2ZXTA 2GFEA 1IMFA 2BJJX 1J1NA 1EU8A 1NUXA 2THIA 5AA3A 2E1SA 4DI4B 1PBPA 4GOTA 2BJIA 3TQWA 4F2QA 4R9FA 5TP9B 4N13A 1MPBA 3E9XA 3O2AA 3RN8A 2XX9A 3VVEA 2VOZA 5H8HB 2V25A 4KCDA 4QSCA 4YB6A 3M3FA 1NV5A 4OENA 1XVXA 1TFAA 5F1QA 2FYIA 1FBFA 2D5WA 3B7DA 3HV1A 1JQFA 5CMCA 4XXUA 1QGXA 5B7DA 3DRFA 3DP4A 1PBQA 2VD3A 3IX1A 3M3LA 4EUOA 1G0HA 4UACA 1UIVA 3R6UA 3KC1A 4U21A 1QW0A 2F3BA 5I3SA 4XKQA 3VLWA 2QS3A 4GRKA 3FD3A 4YICA 3IK6B 4G8HA 5DVFA 4DXBA 1YCJA 3DM0A 3S9MC 3OOAA 4LP2B 3O6HA 4O94A 1II5A 2O51A 4XKPA 3RTWB 3PUWE 3H03A 2ANJA 4LA9A 4RYAA 1QKBA 5CMMA 1I6BA 2HFBA 3LC8A 3A3CA 1N7WA 5EQ7A 4ELPA 3CFLA 4X9TA 4EF2A 3FVKA 1PDAA 3SEWA 4PP0A 3MZBA 4I40A 4KYDA 2I48A 3KZGA 2KLFA 3JZJA 1DPPA 1FQCA 5IM2A 5EHMA 3H7MA 5M2VA 2XXIA 3TODA 4BDRA 4F1YA 2I4CA 2DE4A 4YKJA 1QUIA 3SEUA 1HSJA 3K1MA 2DS9A 2B65A 2XXWA 3RGYA 4YMAA 2WBBA 3LVUA 5ITPA 1FQFA 4GF8A 3DRJA 3HN0A 4O3BA 1UTBB 1D3KA 4FBPA 3D4GA 2DSFA 1A40A 3CI8A 2F35A 4RJZA 3O6IA 2CEYA 3K02A 4IGRA 3B50A 3CG1A 3U65A 2Y7IA 2XWKA 3OSQA 1IMDA 3MC2A 5T3JA 2NWJA 4FIMA 3IB0A 3U1OA 3C35A 4DZ1A 3FGSA 3PPRA 3LUZA 1B1XA 2UVHA 3K4UA 2OCUA 5FHMA 3IJOB 4FATA 3HCQA 4EQ9A 3LSXA 1N3WA 2Y5LA 4MIJA 1I69A 5A5XB 1LBBA 2H98A 2DOJA 4FORA 5KZTA 1FPJA 3U94A 1SYHA 5IZ3B 1ZLQA 4U2RA 4OA4A 4POXA 3TYHA 4H8IA 3S4UA 1NNPA 4MNPA 1FPEA 1IXIA 5TPAA 1IMCA 2MKZA 3TPAA 4JWXA 2V84A 5CBSA 3IO6A 3SZPA 3ECRA 4EQBA 5AA4B 4R6YA 5ET5A 1Y3QA 4PTKA 5H8QA 5J16A 3FZVA 3C4MA 4KFQA 1FCKA 1XHYA 3ONMA 2ESNA 4U23A 1LBYA 4F1VA 2QVVA 1US5A 2V93A 4C0RA 1FJ6A 1SD3A 1SPIA 5I58B 3FATA 2Y7RA 2DWHA 4N07A 3MP8A 3C31A 4OERA 1SDXA 1O64A 3R7XA 1UTHB 2HZLA 2P2AA 3CIJA 1G0IA 3TTNA 2WEFA 2RF1A 3MQ9A 4Q8RA 1B1HA 1B3EA 4GWXA 1GGGA 5I2KB 2F7BA 1F9BA 2F3DA 3ROJA 4NG7A 3KN3A 2OWTA 3UGWA 2XA5A 1FQDA 3PUVE 2H4IA 5L9SA 2O7IA 3S9NC 5FTHA 1MQGA 4MX6A 1LCFA 2DQVA 2XXRA 4U1ZA 3FJGA 4DIGA 1LAXA 2IEEA 4EXLA 1NV0A 2F5XA 3VV5A 2PCRA 1M5DA 2NXOA 2Z8DA 5IZ1A 5I2NB 3O28A 1B51A 2ZYKA 1LFIA 4F29A 1YXIA 2DYXA 1ANFA 2QVUA 5I57B 1FJ9A 4JDFA 4N6KA 4HXVA 1SW5A 4PE5B 4AS4A 3KOTA 3OEKA 4LONB 4GXAA 1DBZA 1USYE 2GHAA 3KG2A 1SI1A 2R8TA 3FVOA 5H8FB 3K6VA 3DRIA 4HCYA 1OVBA 1JVYA 1FQBA 3KBRA 1OVTA 1AIVA 2REGA 5LOMA 1ZTYA 2H99A 1US4A 1YYZA 3KSJA 3I6VA 1M5FA 3U8QA 3RQTA 1XI6A 1MXZA 3E78A 1B46A 1BTJA 3D4CA 1NV1A 2F7CA 5DEXA 1QUKA 4WXJA 1XS5A 4RY1A 1INPA 4GWWA 4JSOA 1N04A 2I3WA 3PPQA 3V89B 3EQ1A 4NGUA 4R2FA 1USYH 4QHQA 2FHYA 3FVGA 1FRPA 5EYFA 2DVZA 2UYFA 3JV9A 4G68A 3PD8A 1L5TA 3TAJA 3THIA 2CMOA 3TCGA 2RINA 1TFDA 3K1PA 1R9QA 3VLVA 5DVIA 3FV2A 3PV0E 1ATGA 3W9VA 5IGAA 4JWYA 2NUVA 4KI0E 3PMXA 4PGNA 4H1XA 2I6EA 3Q26A 1VFEA 5HBCA 1Y4CA 1MRPA 3EHUA 2VPOA 2RKMA 2Z23A 3KFMA 4G2ZA 1Z7ME 3CFZA 4N8GA 4UA8A 3ZSFA 1GR2A 3W9WA 1LBWA 2PYYA 4GL0A 2F97A 4OTEA 1JEVA 4IO6A 4MAGA 4MEVA 4F31B 1FTMA 1CNQA 2PFYA 2YLNA 4ZE8A 4GX4A 3U92A 1FTJA 2F78A 1PB8A 3H3GA 3VLUA 2GHBA 3K0VA 3OXNA 3QAXA 1LLSA 4E0XA 4MH5A 3IFCA 5TP9A 3DRKA 1OLCA 1FPDA 3LR1A 1IMAA 2O6AA 3O9PA 5I59B 5H8HA 3GLBA 1LBCA 3MPKA 3E79A 1O63A 4MMPA 3SKPA 1H76A 4HE2A 1ZKBA 4KR5A 3H6UA 2RCBA 2QMXA 1AL3A 1TWYA 4ECFA 5K2YA 4OQOA 4NEDA 4GWSA 4F1UA 3I5OA 4IR8A 1SQYA 1S7YA 4OFJA 1MH3A 2KQZA 2B4MA 5KCJB 3UK4A 4IO5A 1B5HA 2PVUA 1IMBA 3SERA 3OO8A 3TZAA 3NOHA 1LBZA 3IO4A 1M5BA 4IY6A 4IY5A 3G3FA 3VXBA 4JBZA 4OEUA 1FPBA 1RDZA 1LGBC 2UVGA 4DCXA 3PUYE 2RC8A 1GV8A 2L5VA 3QUFA 2QMWA 1ZJLA 1NMUA 3QYTA 3FJMA 3KGCA 3KJTA 4FEBA 1B0LA 5CC2A 3GBAA 3V8XB 2QS1A 2F6PA 4LN5A 3O29A 3JYRA 1RDYA 3LSWA 2WOPA 5FTIA 4I8CA 4IGTA 3DRHA 5ET6A 2D21A 3USDA 4F2OA 4YZZA 4NF8B 3T22A 1SI0A 4ZECA 3RYBA 4AS5A 5ELVA 1H3DA 1NL5A 3SDFA 3FUZA 3QXMA 1KWHA 3L6HA 4POWA 1UTBA 4GQOA 1PEBA 4X04A 3VFJA 4GWOA 4NN3A 4YMBA 3TFLA 4IO2A 2R71A 5JTYB 3T66A 3B6QA 3KSXA 2DVCA 3V83A 4I3EA 5F24A 3SEXA 4MBPA 5CI5A 1R9LA 1B7UA 3FASA 2Q8MA 4KD5A 1P99A 3FXBA 4OMBA 4ESXA 2FVZA 4K3FA 5EQ8A 5ITOA 4QRZA 4ZEIA 4F3SA 4P8BA 3FXQA 4JVDA 2ZZVA 5A5XA 3IOVA 2FBPA 2ZYMA 2XX7A 3QIMA 4P0GA 2XXVA 3S9LC 3RY3A 2QSXA 1OIBA 3ILUB 5IZ3A 4OANA 1FQEA 3T0JA 5H8NB 4RPNA 4ELOA 1EYIA 3E13X 2P0SA 3TEPA 5DYHA 2Y7KA 2UVIA 4IB2A 4H45A 1OMPA 3OSRA 4GX3A 4F19A 1O7TA 4BDQA 5AA4A 2RC9A 4U1OA 3W15C 3T1BA 1NH7A 3MVYA 4F3BA 4MHFA 5EQAA 1MDP1 2R9JA 1AMFA 2O7UA 4XKRA 4ONYA 3F11A 5I58A 2PX1A 1B9JA 5EHSA 4X48A 3MPLA 1N0TA 1P1OA 4OZ9A 2CZIA 3MVWA 3TUSA 1UQWA 4FE8A 2GQ1A 1N84A 1R6ZA 3FV1A 4JVIA 5KDTB 1H43A 2B4LA 3IB1A 1KA1A 4PBHA 3ZKLA 4NF0A 3TTMA 2XX8A 4F22A 3DELB 3RYAA 4TQUQ 5I2KA 3GZGA 4GL8A 4GBWA 1A8FA 4NMYA 1DOTA 4ELQA 1XOCA 3RNNA 2CEXA 4WKMA 1P1NA 2FNCA 1B2HA 4QSEA 5ISUA 3SEYA 4LQ5A 4P56A 4FECA 3LBSA 2X26A 1KA0A 1WVJA 3LSFB 2AYSA 1MXVA 4HCWA 3MAMA 3HHFA 3RTFB 2WYPA 3HSTA 4R73A 3C34A 4GWZA 4LUBA 4MNIA 4OESA 1NUYA 5EQ9A 1JW5A 5EYGA 2DP8A 2Q8JA 5I2NA 2OK2A 4ZEFA 4F18A 3MSTA 3OO7A 3V5AA 4R9GA 1D4NA 4Q30B 5I57A 2ALUA 4ISUA 4HW8A 1FW0A 1NV2A 2XWOA 3CSGA 1NV7A 4NTLA 1I6QA 1JVXA 4GXSB 3A3UA 1N7XA 2HAVA 4R75A 1Y9UA 4UABA 5H8FA 3KN8A 2PMSA 4XTCQ 4OVPA 5HPQA 2R6GE 3ODBA 1LB8A 2ZYOA 2V3UA 3FTOA 4OVQA 3QMFA 1IXGA 3U72A 3TTKA 1LCTA 1AWBA 2DXYA 3ZS6A 4O3CA 3MBPA 3OELA 1P1QA 4G8NA 4JVCA 2B3BA 3M3KA 4P1LA 1M5CA 4RPOA 4ZEDA 1K9YA 5K2XA 1MM7A 1FTLA 2I0BA 4KYSA 4P1EA 4EQ7A 1VR5A 2XHDA 1IITA 3IOTA 4N15A 5JEIA 4GFRA 4EDPA 3N6UA 1Q35A 1CE2A 2QS2A 4N6PA 4OFOA 3QK6A 2XXYA 3FXUA 1ZBMA 2G29A 2WOKA 1FBCA 1NV4A 4RA1A 2HQ0A 2Q74A 3RPLB 4X1BA 5AA2B 3PU5A 4LVQA 4G68C 4GWYA 3GBBA 4DLDA 3K6WA 4R74A 3MVZA 1YPNA 4IO4A 5AE4A 4M4GA 3TKDA 1MQHA 4P3LA 2H5YA 1MQIA 3A29A 2P3NA 1LBVA 5FBPA 4KPTA 3K2DA 3FXRA 3IL1B 5FHOA 2ZZWA 3MVXA 3IFAA 3O97A 5BWJA 3TTLA 4MLQA 2DWAA 4KQPA 2OLBA 1IIWA 4YB5A 4YKIA 1FPLA 4OEVA 4MFIA 5CMBA 4Q5TA 1HSEA 4NF6B 3MWBA 5I84A 3KOSA 4NHBA 5ET7A 4JSDA 4GBVA 1A54A 1IXHA 3PPNA 2UXAA 1FQAA 4R72A 4O3AA 2AL4A 1MXXA 4PC9A 4PFUA 5I59A 5LTCA 4H0WA 4XEQA 1LFHA 5IKBA 4H5FA 2HHMA 4NX1A 3HO7A 4NAPA 1XC1A 2OZZA 4C1UA 5TU0A 3N26A 1DCUA 1SBPA 2V3QA 1NI9A 1WODA 4NF4B 5B70A 1TT1A 3KEIA 4PF6A 1DTZA 4P9KA 4YKPA 3IJXB 3LSLA 5CRYA 4GLIA 4PAIA 5ICQA 3IR1A 2XXKA 3MUQA 3T9HB 2VT5A 4NE4A 2VPNA 3K00A 2HZKA 2CZKA 4XKNA 5HM4B 2DDKA 2WKYA 5KCJA 1B05A 1YTVA 2G93A 1SYIA 1BKAA 4GX6A 1FBPA 4NF5B 5IAIA 2QFLA 4H8JA 1B52A 4MLVA 4H65A 1QUJA 1LAFE 1Y3NA 1D9VA 2XD3A 3FVNA 4QSDA 5H8SA 1DMBA 3OO6A 1FBEA 2QS4A 3G3GA 2Y7WA 4DXCA 1B58A 3G3KA 3T9XB 3ISPA 3WAFA 4X1DA 2E0SA 2Q88A 4YAHX 2ZNSA 1QULA 2RC7A 3UP9A 3N94A 4AB6A 3MJNA 1LSTA 3GXAA 5DTBA 3QUJA 1UIUA 4FJPA 4GD5A 1B3HA 3K1NA 4G8MA 5J1DA 1NH8A 3EF7A 3G3IA 3BKIB 4NF8A 3CR9A 1B32A 4EF1A 4N17A 5DW8A 4PGPA 1IXCA 3LV0A 2F7AA 4XIGQ 2DE2A 3VXCA 1DTGA 2WOLA 1JW1A 1AH5A 2ZYNA 3ILTB 3OEMA 5JTYA 1K9ZA 3HFUA 1GVCA 1WDNA 2GH9A 3SETA 2Q2CA 5L9MA 2P1SA 1B0HA 3C32A 1NV3A 2OX3A 3B8BA 2XXUA 2NOOA 2AIXA 3C9HA 5DT6A 4DI3D 5FHNA 2DWIA 1OQHA 4C1TA 4O7MA 2I3VA 4PFYA 3UA8A 1FTKA 3VVDA 3C33A 1POTA 2ZNUA 2PT2A 1MXYA 4ZS9A 2ONRA 1B6HA 1POY1 4I62A 4LZ5A 4PDHA 5H8NA 1AOVA 2H25A 4Z7EA 1A55A 3S2VA 1FBGA 3RYDA 2XXTA 4BLAA 1FBDA 1PC3A 4HE0A 4OWDA 1T0KA 3BFTA 4Q0CA 2UVJA 1P1WA 1EYKA 4QFNA 4GVOA 2XXHA 3BFUA 3KJ7A 3DP6A 4P47A 1EZOA 3SEVA 3PMVA 1EZPA 3PGFA 1PB7A 4JB7A 2Q89A 3H4ZA 1Z7NE 5I5PA 2VHAA 3S9EA 3VE1B 3BIGA 4X8RA 3ZKKA 4QFOA 2VGQA 3P7IA 4YKKA 2Y7PA 1ZU0A 2Z22A 3O6GA 4PETA 1MM6A 4TLMB 1Y4TA 1NNTA 4PDDA 3OD7A 5KDTA 4L17A 1FPGA 2REJA 2A5TB 2PT1A 1A7LA 3C36A 4XFEA 5I56B 1SW4A 1HSLA 1URDA 3Q29A 5F7VA 1BP5A 3MZ1A 3IORA 3TELA 3MW0A 4F3PA 3R26A 1S50A 2V4CA 4U22A 3H06B 4NWDA 1PB9A 5ICTA 2XWIA 4OXVA 3MP6A 3PAMA 1P1UA 4OVRA 4PE3A 2XD2A 4LZ8A 1B3GA 1ZMGA 1ELJA
chains in the Genus database with same CATH topology
4Z0IA 3RUMA 2V3TA 1MY1A 1EZ9A 1N76A 1JW4A 1MY4A 1RYOA 3A09A 5AA2D 3HHGA 3EN3A 3T96B 3TCHA 2OBGA 2NVUB 1OQGA 2CZLA 2XXQA 4U4XA 2VD2A 3CSBA 2AL5A 1H44A 4ELRA 5CBRA 1B5IA 3EPEA 1B5JA 1NKXA 1SW2A 1B40A 1SVXB 3TMGA 4P11A 4R2BA 1MH4A 3CHGA 1UTHA 3MZ9A 1MPDA 4THIA 2QRYA 1B4ZA 4QF9A 1Q1KA 2OJTA 3O6PA 2DWJA 2YPNA 2F6GA 3G7WA 4DE8A 2F34A 4I9DA 2DE3A 4DXUA 2O1LA 1N3XA 3O66A 4ZEBA 4LATA 4OHNA 2A5SA 2I0CA 2PBWA 3K6UA 2ZMBA 3HPIA 4BDMA 4G4PA 3RLFE 2F8DA 3UIFA 1RYXA 5AA2A 4PFWA 4WEDA 4ND9A 3RPWA 1GTKA 4OFLA 3N6TA 4G77A 4DCYA 1B3LA 1NFTA 3SESA 1JNFA 3U93A 3UN6A 4QFKA 3BBRA 1QVSA 3CVGA 1MPCA 2HEUA 4OVJA 1R1NA 1NNKA 3MP1A 3VDFA 2XXPA 4AB5A 4ZZAA 4ZZEA 3TTRA 4NF6A 1LFGA 1MY2A 1JEUA 3CRBA 1QJMA 4TLLB 4RNSA 3EHTA 2HXWA 1QKAA 3VVFA 3KN7A 4KYEA 1Y1MA 1B7ZA 2Q2AA 2QJEA 4BDOA 3IOWA 1NNFA 1IUDA 1MDQA 3L6GA 3I3VA 3K01A 4BDLA 4ESWA 4YU0A 1URSA 4H5GA 4NF4A 3LUYA 4P0IA 3PPPA 3RT6B 3PUXE 3T93B 5L9OA 4F3GA 1A99A 3QSLA 3H6TA 1BLFA 4HS7A 4R6HA 5TPAB 3PPOA 1MS7A 1H45A 1BIYA 2Q9TA 2D3IA 5H8QB 1M5EA 4NF5A 3N5LA 2X7QA 4GIZA 1VE4A 4RXLA 1LAGE 4ZDMA 3TDJA 4JXIA 2H9BA 3AXFA 2Z8EA 2ABHA 3CG3A 2ZNTA 3IAZA 2HAUA 2HCAA 2VP1A 2O68A 4PFTA 4NWCA 1MQDA 1YAEA 1MXUA 2Z8FA 4RK9A 3Q25A 5AA1A 3G3HA 4HTGA 4TOZA 1B3FA 3G3JA 2QPQA 2B3FA 1D9YA 1MXWA 2OWSA 4JWOA 1XT8A 4F39A 3OO9A 4I1DA 4E0WA 3FIRA 4KHZE 3H6VA 5CM6A 1LAHE 4H6DA 1SW1A 1CB6A 3M8UA 4FAJA 3TQLA 3E3KA 3FJ7A 2O1MA 1XVYA 3H6WA 3EHSA 3PD9A 3K6XA 4QFLA 3E4RA 1FTOA 2RCAA 5JK4A 1OLAA 1I6AA 4IO3A 2ONKE 2X7PA 4ZE9A 3B6WA 2F36A 4ZEKA 2LAOA 4OETA 3T9VA 4LQ2A 1Y1ZA 5BUUA 4PQJA 1JETA 4WEPA 1LB9A 4H67A 1S9TA 2I49A 1Y3PA 2FA7A 4FEDA 1DSNA 2M8CA 4R6KA 2XXXA 3B6TA 2W7YA 1TXFA 3WAEA 3UORA 3TCFA 1MY3A 2DXRA 2O84X 2IA4A 4DDDA 1B4HA 5L8DA 1VFDA 1ZIUA 1A8EA 4RK2A 3Q27A 1RKMA 3PMWA 2I4BA 5DEXB 3DRGA 2GRVA 2ONSA 3PUZE 2UYEA 2O69A 3DP8A 4G68B 1MG1A 3IB2A 4IO7A 1IZ1A 2YJPA 2QL3A 4QFPA 1B7HA 3RT8A 3OMBA 4EXKA 4M1VA 1MY0A 3DLNA 3OENA 4KCCA 1EH3A 1VSOA 4OYVA 2A5TA 1URGA 5I56A 2I58A 4AQ4A 3T9UA 3IOUA 5DVJA 4YB7A 5CMKA 1IEJA 4U4SA 4LZ7A 1DPEA 3Q28A 4BDNA 4MF3A 1MQJA 2Y84A 3CFXA 1IQ7A 1Y20A 2ZXTA 2GFEA 2BJJX 1J1NA 1EU8A 2THIA 5AA3A 2E1SA 1PBPA 4GOTA 3TQWA 4F2QA 4R9FA 5TP9B 4N13A 1MPBA 3E9XA 3O2AA 3RN8A 2XX9A 3VVEA 2VOZA 5H8HB 2V25A 4KCDA 4QSCA 4YB6A 3M3FA 4OENA 1XVXA 1TFAA 5F1QA 2FYIA 2D5WA 3B7DA 3HV1A 1JQFA 5CMCA 4XXUA 5B7DA 3DRFA 3DP4A 1PBQA 2VD3A 3IX1A 3M3LA 4EUOA 4UACA 1UIVA 3R6UA 4U21A 1QW0A 4XKQA 3VLWA 2QS3A 4GRKA 3FD3A 4YICA 3IK6B 4G8HA 5DVFA 4DXBA 1YCJA 3DM0A 3S9MC 3OOAA 4LP2B 3O6HA 1II5A 2O51A 4XKPA 3RTWB 3PUWE 3H03A 2ANJA 4LA9A 4RYAA 1QKBA 5CMMA 1I6BA 2HFBA 3LC8A 3A3CA 1N7WA 4ELPA 3CFLA 4X9TA 4EF2A 3FVKA 1PDAA 3SEWA 4PP0A 3MZBA 4KYDA 2I48A 3KZGA 2KLFA 3JZJA 1DPPA 1FQCA 5EHMA 3H7MA 5M2VA 2XXIA 3TODA 4BDRA 4F1YA 2I4CA 2DE4A 4YKJA 1QUIA 3SEUA 1HSJA 3K1MA 2DS9A 2B65A 2XXWA 3RGYA 4YMAA 3LVUA 5ITPA 1FQFA 4GF8A 3DRJA 3HN0A 4O3BA 1UTBB 1D3KA 3D4GA 2DSFA 1A40A 3CI8A 2F35A 4RJZA 3O6IA 3K02A 4IGRA 3CG1A 2Y7IA 3OSQA 3MC2A 2NWJA 4FIMA 3IB0A 3U1OA 3C35A 4DZ1A 3FGSA 3PPRA 1B1XA 2UVHA 3K4UA 2OCUA 5FHMA 3IJOB 4FATA 3HCQA 4EQ9A 3LSXA 1N3WA 1I69A 5A5XB 1LBBA 2H98A 2DOJA 4FORA 5KZTA 3U94A 1SYHA 1ZLQA 4U2RA 4POXA 3TYHA 4H8IA 3S4UA 1NNPA 1IXIA 5TPAA 3TPAA 4JWXA 2V84A 5CBSA 3IO6A 3ECRA 4EQBA 5AA4B 4R6YA 1Y3QA 5H8QA 3FZVA 3C4MA 4KFQA 1FCKA 1XHYA 3ONMA 2ESNA 4U23A 4F1VA 1US5A 2V93A 4C0RA 1SD3A 5I58B 3FATA 2Y7RA 2DWHA 4N07A 3MP8A 3C31A 4OERA 1SDXA 1O64A 3R7XA 1UTHB 2HZLA 2P2AA 3CIJA 3TTNA 2RF1A 3MQ9A 4Q8RA 1B1HA 1B3EA 1GGGA 5I2KB 2F7BA 1F9BA 3KN3A 2OWTA 3UGWA 1FQDA 3PUVE 2H4IA 5L9SA 2O7IA 3S9NC 5FTHA 1MQGA 1LCFA 2DQVA 2XXRA 4U1ZA 3FJGA 4DIGA 1LAXA 2IEEA 4EXLA 2F5XA 3VV5A 1M5DA 2NXOA 2Z8DA 5I2NB 3O28A 1B51A 2ZYKA 1LFIA 4F29A 2DYXA 1ANFA 5I57B 4JDFA 1SW5A 4PE5B 3KOTA 3OEKA 4LONB 4GXAA 1USYE 2GHAA 3KG2A 1SI1A 3FVOA 5H8FB 3K6VA 3DRIA 4HCYA 1OVBA 1JVYA 1FQBA 3KBRA 1OVTA 1AIVA 2REGA 5LOMA 1ZTYA 2H99A 1US4A 3KSJA 3I6VA 1M5FA 3U8QA 3RQTA 1MXZA 1B46A 1BTJA 3D4CA 5DEXA 2F7CA 1QUKA 4WXJA 1XS5A 4RY1A 4JSOA 1N04A 2I3WA 3PPQA 3V89B 3EQ1A 4R2FA 1USYH 4QHQA 3FVGA 5EYFA 2DVZA 2UYFA 3JV9A 4G68A 3PD8A 1L5TA 3TAJA 3THIA 2CMOA 3TCGA 2RINA 1TFDA 3K1PA 1R9QA 3VLVA 5DVIA 3FV2A 3PV0E 1ATGA 3W9VA 4JWYA 2NUVA 4KI0E 3PMXA 4H1XA 2I6EA 3Q26A 1VFEA 5HBCA 1Y4CA 1MRPA 3EHUA 2RKMA 2Z23A 3KFMA 4G2ZA 1Z7ME 3CFZA 4UA8A 3ZSFA 1GR2A 3W9WA 2PYYA 4GL0A 2F97A 4OTEA 1JEVA 4IO6A 4F31B 1FTMA 2YLNA 4ZE8A 3U92A 1FTJA 2F78A 1PB8A 3H3GA 3VLUA 2GHBA 3K0VA 3OXNA 3QAXA 1LLSA 4E0XA 4MH5A 5TP9A 3DRKA 1OLCA 3LR1A 2O6AA 3O9PA 5I59B 5H8HA 3GLBA 1LBCA 3MPKA 1O63A 3SKPA 1H76A 1ZKBA 4KR5A 3H6UA 2RCBA 2QMXA 1AL3A 1TWYA 4ECFA 5K2YA 4OQOA 4NEDA 4F1UA 3I5OA 1SQYA 1S7YA 4OFJA 1MH3A 2B4MA 5KCJB 3UK4A 4IO5A 1B5HA 2PVUA 3SERA 3OO8A 3TZAA 3IO4A 1M5BA 4IY6A 4IY5A 3G3FA 3VXBA 4JBZA 4OEUA 1LGBC 2UVGA 4DCXA 3PUYE 2RC8A 1GV8A 3QUFA 2QMWA 1ZJLA 1NMUA 3QYTA 3FJMA 3KGCA 3KJTA 4FEBA 1B0LA 5CC2A 3GBAA 3V8XB 2QS1A 2F6PA 3O29A 3JYRA 3LSWA 2WOPA 5FTIA 4I8CA 4IGTA 3DRHA 2D21A 3USDA 4F2OA 4YZZA 4NF8B 3T22A 1SI0A 4ZECA 3RYBA 5ELVA 1H3DA 1NL5A 3SDFA 3FUZA 3QXMA 1KWHA 3L6HA 4POWA 1UTBA 4GQOA 1PEBA 3VFJA 4GWOA 4YMBA 3TFLA 4IO2A 2R71A 5JTYB 3T66A 3B6QA 3KSXA 2DVCA 3V83A 3SEXA 4MBPA 5CI5A 1R9LA 1B7UA 3FASA 4KD5A 1P99A 4OMBA 4ESXA 4K3FA 5ITOA 4QRZA 4ZEIA 4F3SA 3FXQA 5A5XA 3IOVA 2ZYMA 2XX7A 3QIMA 4P0GA 2XXVA 3S9LC 3RY3A 2QSXA 1OIBA 3ILUB 1FQEA 5H8NB 4RPNA 4ELOA 3E13X 2P0SA 3TEPA 5DYHA 2Y7KA 2UVIA 4IB2A 1OMPA 3OSRA 4F19A 1O7TA 4BDQA 5AA4A 2RC9A 4U1OA 3W15C 1NH7A 3MVYA 4F3BA 1MDP1 2R9JA 1AMFA 2O7UA 4XKRA 4ONYA 3F11A 5I58A 2PX1A 1B9JA 5EHSA 4X48A 3MPLA 1N0TA 1P1OA 4OZ9A 3MVWA 3TUSA 1UQWA 4FE8A 1N84A 1R6ZA 3FV1A 5KDTB 1H43A 2B4LA 3IB1A 3ZKLA 3TTMA 2XX8A 4F22A 3DELB 3RYAA 4TQUQ 5I2KA 3GZGA 4GL8A 1A8FA 4NMYA 1DOTA 4ELQA 1XOCA 3RNNA 4WKMA 1P1NA 2FNCA 1B2HA 4QSEA 5ISUA 3SEYA 4LQ5A 4FECA 3LBSA 2X26A 1WVJA 3LSFB 2AYSA 1MXVA 4HCWA 3MAMA 3HHFA 3RTFB 3HSTA 4R73A 3C34A 4LUBA 4OESA 1JW5A 2DP8A 2Q8JA 5I2NA 2OK2A 4ZEFA 4F18A 3OO7A 3V5AA 4R9GA 1D4NA 4Q30B 5I57A 2ALUA 4ISUA 4HW8A 1FW0A 3CSGA 4NTLA 1I6QA 1JVXA 4GXSB 3A3UA 1N7XA 2HAVA 4R75A 1Y9UA 5H8FA 3KN8A 2PMSA 4XTCQ 5HPQA 2R6GE 3ODBA 1LB8A 2ZYOA 2V3UA 3FTOA 1IXGA 3U72A 3TTKA 1LCTA 2DXYA 3ZS6A 4O3CA 3MBPA 3OELA 1P1QA 4G8NA 2B3BA 3M3KA 1M5CA 4RPOA 4ZEDA 5K2XA 1MM7A 1FTLA 2I0BA 4KYSA 4EQ7A 1VR5A 2XHDA 1IITA 3IOTA 5JEIA 4GFRA 4EDPA 3N6UA 1Q35A 1CE2A 2QS2A 4N6PA 4OFOA 3QK6A 2XXYA 3FXUA 1ZBMA 2G29A 2WOKA 2HQ0A 4RA1A 4X1BA 5AA2B 3PU5A 4LVQA 4G68C 3GBBA 4DLDA 3K6WA 4R74A 3MVZA 1YPNA 4IO4A 5AE4A 4M4GA 3TKDA 1MQHA 2H5YA 1MQIA 4KPTA 3K2DA 3FXRA 3IL1B 5FHOA 3MVXA 3O97A 5BWJA 3TTLA 4MLQA 2DWAA 4KQPA 2OLBA 1IIWA 4YB5A 4YKIA 4OEVA 4MFIA 5CMBA 4Q5TA 1HSEA 4NF6B 3MWBA 5I84A 3KOSA 4JSDA 1A54A 1IXHA 3PPNA 2UXAA 1FQAA 4R72A 4O3AA 2AL4A 1MXXA 4PFUA 5I59A 4H0WA 1LFHA 5IKBA 4H5FA 3HO7A 1XC1A 2OZZA 4C1UA 5TU0A 3N26A 1SBPA 2V3QA 1WODA 4NF4B 5B70A 1TT1A 3KEIA 1DTZA 4YKPA 3IJXB 3LSLA 5CRYA 4GLIA 5ICQA 3IR1A 3MUQA 3T9HB 4NE4A 3K00A 2HZKA 4XKNA 5HM4B 2WKYA 5KCJA 1B05A 1YTVA 2G93A 1SYIA 1BKAA 4NF5B 5IAIA 4H8JA 1B52A 4MLVA 4H65A 1QUJA 1LAFE 1Y3NA 1D9VA 2XD3A 3FVNA 4QSDA 5H8SA 1DMBA 3OO6A 2QS4A 3G3GA 2Y7WA 4DXCA 1B58A 3G3KA 3T9XB 3WAFA 4X1DA 2E0SA 2Q88A 4YAHX 2ZNSA 1QULA 2RC7A 3UP9A 3N94A 4AB6A 3MJNA 1LSTA 3GXAA 5DTBA 3QUJA 1UIUA 4FJPA 4GD5A 1B3HA 3K1NA 4G8MA 5J1DA 1NH8A 3EF7A 3G3IA 3BKIB 4NF8A 3CR9A 1B32A 4EF1A 1IXCA 2F7AA 4XIGQ 2DE2A 3VXCA 1DTGA 2WOLA 1JW1A 1AH5A 2ZYNA 3ILTB 3OEMA 5JTYA 1GVCA 1WDNA 2GH9A 3SETA 2Q2CA 5L9MA 2P1SA 1B0HA 3C32A 2XXUA 2NOOA 2AIXA 3C9HA 5DT6A 5FHNA 2DWIA 1OQHA 4C1TA 2I3VA 4PFYA 3UA8A 1FTKA 3VVDA 3C33A 1POTA 2ZNUA 2PT2A 1MXYA 4ZS9A 2ONRA 1B6HA 1POY1 4I62A 4LZ5A 5H8NA 1AOVA 2H25A 4Z7EA 1A55A 3S2VA 2XXTA 4BLAA 1PC3A 4OWDA 1T0KA 3BFTA 4Q0CA 2UVJA 1P1WA 4QFNA 4GVOA 2XXHA 3BFUA 3KJ7A 3DP6A 1EZOA 3SEVA 3PMVA 1EZPA 3PGFA 1PB7A 4JB7A 2Q89A 3H4ZA 1Z7NE 2VHAA 3S9EA 3VE1B 3ZKKA 4QFOA 2VGQA 3P7IA 4YKKA 2Y7PA 1ZU0A 2Z22A 3O6GA 4TLMB 4PETA 1MM6A 1Y4TA 1NNTA 3OD7A 5KDTA 4L17A 2REJA 2A5TB 2PT1A 1A7LA 3C36A 5I56B 1SW4A 1HSLA 1URDA 3Q29A 5F7VA 1BP5A 3MZ1A 3IORA 3TELA 3MW0A 4F3PA 3R26A 1S50A 4U22A 3H06B 4NWDA 1PB9A 5ICTA 4OXVA 3MP6A 3PAMA 1P1UA 2XD2A 4LZ8A 1B3GA 1ZMGA 1ELJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z0I A;  3RUM A;  2V3T A;  1MY1 A;  1EZ9 A;  1N76 A;  1JW4 A;  1MY4 A;  1RYO A;  3A09 A;  5AA2 D;  3HHG A;  3EN3 A;  3T96 B;  3TCH A;  2OBG A;  2NVU B;  1OQG A;  2CZL A;  2XXQ A;  4U4X A;  2VD2 A;  3CSB A;  2AL5 A;  1H44 A;  4ELR A;  5CBR A;  1B5I A;  3EPE A;  1B5J A;  1NKX A;  1SW2 A;  1B40 A;  1SVX B;  3TMG A;  4P11 A;  4R2B A;  1MH4 A;  3CHG A;  1UTH A;  3MZ9 A;  1MPD A;  4THI A;  2QRY A;  1B4Z A;  4QF9 A;  1Q1K A;  2OJT A;  3O6P A;  2DWJ A;  2YPN A;  2F6G A;  3G7W A;  4DE8 A;  2F34 A;  4I9D A;  2DE3 A;  4DXU A;  2O1L A;  1N3X A;  3O66 A;  4ZEB A;  4LAT A;  4OHN A;  2A5S A;  2I0C A;  2PBW A;  3K6U A;  2ZMB A;  3HPI A;  4BDM A;  4G4P A;  3RLF E;  2F8D A;  3UIF A;  1RYX A;  5AA2 A;  4PFW A;  4WED A;  4ND9 A;  3RPW A;  1GTK A;  4OFL A;  3N6T A;  4G77 A;  4DCY A;  1B3L A;  1NFT A;  3SES A;  1JNF A;  3U93 A;  3UN6 A;  4QFK A;  3BBR A;  1QVS A;  3CVG A;  1MPC A;  2HEU A;  4OVJ A;  1R1N A;  1NNK A;  3MP1 A;  3VDF A;  2XXP A;  4AB5 A;  4ZZA A;  4ZZE A;  3TTR A;  4NF6 A;  1LFG A;  1MY2 A;  1JEU A;  3CRB A;  1QJM A;  4TLL B;  4RNS A;  3EHT A;  2HXW A;  1QKA A;  3VVF A;  3KN7 A;  4KYE A;  1Y1M A;  1B7Z A;  2Q2A A;  2QJE A;  4BDO A;  3IOW A;  1NNF A;  1IUD A;  1MDQ A;  3L6G A;  3I3V A;  3K01 A;  4BDL A;  4ESW A;  4YU0 A;  1URS A;  4H5G A;  4NF4 A;  3LUY A;  4P0I A;  3PPP A;  3RT6 B;  3PUX E;  3T93 B;  5L9O A;  4F3G A;  1A99 A;  3QSL A;  3H6T A;  1BLF A;  4HS7 A;  4R6H A;  5TPA B;  3PPO A;  1MS7 A;  1H45 A;  1BIY A;  2Q9T A;  2D3I A;  5H8Q B;  1M5E A;  4NF5 A;  3N5L A;  2X7Q A;  4GIZ A;  1VE4 A;  4RXL A;  1LAG E;  4ZDM A;  3TDJ A;  4JXI A;  2H9B A;  3AXF A;  2Z8E A;  2ABH A;  3CG3 A;  2ZNT A;  3IAZ A;  2HAU A;  2HCA A;  2VP1 A;  2O68 A;  4PFT A;  4NWC A;  1MQD A;  1YAE A;  1MXU A;  2Z8F A;  4RK9 A;  3Q25 A;  5AA1 A;  3G3H A;  4HTG A;  4TOZ A;  1B3F A;  3G3J A;  2QPQ A;  2B3F A;  1D9Y A;  1MXW A;  2OWS A;  4JWO A;  1XT8 A;  4F39 A;  3OO9 A;  4I1D A;  4E0W A;  3FIR A;  4KHZ E;  3H6V A;  5CM6 A;  1LAH E;  4H6D A;  1SW1 A;  1CB6 A;  3M8U A;  4FAJ A;  3TQL A;  3E3K A;  3FJ7 A;  2O1M A;  1XVY A;  3H6W A;  3EHS A;  3PD9 A;  3K6X A;  4QFL A;  3E4R A;  1FTO A;  2RCA A;  5JK4 A;  1OLA A;  1I6A A;  4IO3 A;  2ONK E;  2X7P A;  4ZE9 A;  3B6W A;  2F36 A;  4ZEK A;  2LAO A;  4OET A;  3T9V A;  4LQ2 A;  1Y1Z A;  5BUU A;  4PQJ A;  1JET A;  4WEP A;  1LB9 A;  4H67 A;  1S9T A;  2I49 A;  1Y3P A;  2FA7 A;  4FED A;  1DSN A;  2M8C A;  4R6K A;  2XXX A;  3B6T A;  2W7Y A;  1TXF A;  3WAE A;  3UOR A;  3TCF A;  1MY3 A;  2DXR A;  2O84 X;  2IA4 A;  4DDD A;  1B4H A;  5L8D A;  1VFD A;  1ZIU A;  1A8E A;  4RK2 A;  3Q27 A;  1RKM A;  3PMW A;  2I4B A;  5DEX B;  3DRG A;  2GRV A;  2ONS A;  3PUZ E;  2UYE A;  2O69 A;  3DP8 A;  4G68 B;  1MG1 A;  3IB2 A;  4IO7 A;  1IZ1 A;  2YJP A;  2QL3 A;  4QFP A;  1B7H A;  3RT8 A;  3OMB A;  4EXK A;  4M1V A;  1MY0 A;  3DLN A;  3OEN A;  4KCC A;  1EH3 A;  1VSO A;  4OYV A;  2A5T A;  1URG A;  5I56 A;  2I58 A;  4AQ4 A;  3T9U A;  3IOU A;  5DVJ A;  4YB7 A;  5CMK A;  1IEJ A;  4U4S A;  4LZ7 A;  1DPE A;  3Q28 A;  4BDN A;  4MF3 A;  1MQJ A;  2Y84 A;  3CFX A;  1IQ7 A;  1Y20 A;  2ZXT A;  2GFE A;  2BJJ X;  1J1N A;  1EU8 A;  2THI A;  5AA3 A;  2E1S A;  1PBP A;  4GOT A;  3TQW A;  4F2Q A;  4R9F A;  5TP9 B;  4N13 A;  1MPB A;  3E9X A;  3O2A A;  3RN8 A;  2XX9 A;  3VVE A;  2VOZ A;  5H8H B;  2V25 A;  4KCD A;  4QSC A;  4YB6 A;  3M3F A;  4OEN A;  1XVX A;  1TFA A;  5F1Q A;  2FYI A;  2D5W A;  3B7D A;  3HV1 A;  1JQF A;  5CMC A;  4XXU A;  5B7D A;  3DRF A;  3DP4 A;  1PBQ A;  2VD3 A;  3IX1 A;  3M3L A;  4EUO A;  4UAC A;  1UIV A;  3R6U A;  4U21 A;  1QW0 A;  4XKQ A;  3VLW A;  2QS3 A;  4GRK A;  3FD3 A;  4YIC A;  3IK6 B;  4G8H A;  5DVF A;  4DXB A;  1YCJ A;  3DM0 A;  3S9M C;  3OOA A;  4LP2 B;  3O6H A;  1II5 A;  2O51 A;  4XKP A;  3RTW B;  3PUW E;  3H03 A;  2ANJ A;  4LA9 A;  4RYA A;  1QKB A;  5CMM A;  1I6B A;  2HFB A;  3LC8 A;  3A3C A;  1N7W A;  4ELP A;  3CFL A;  4X9T A;  4EF2 A;  3FVK A;  1PDA A;  3SEW A;  4PP0 A;  3MZB A;  4KYD A;  2I48 A;  3KZG A;  2KLF A;  3JZJ A;  1DPP A;  1FQC A;  5EHM A;  3H7M A;  5M2V A;  2XXI A;  3TOD A;  4BDR A;  4F1Y A;  2I4C A;  2DE4 A;  4YKJ A;  1QUI A;  3SEU A;  1HSJ A;  3K1M A;  2DS9 A;  2B65 A;  2XXW A;  3RGY A;  4YMA A;  3LVU A;  5ITP A;  1FQF A;  4GF8 A;  3DRJ A;  3HN0 A;  4O3B A;  1UTB B;  1D3K A;  3D4G A;  2DSF A;  1A40 A;  3CI8 A;  2F35 A;  4RJZ A;  3O6I A;  3K02 A;  4IGR A;  3CG1 A;  2Y7I A;  3OSQ A;  3MC2 A;  2NWJ A;  4FIM A;  3IB0 A;  3U1O A;  3C35 A;  4DZ1 A;  3FGS A;  3PPR A;  1B1X A;  2UVH A;  3K4U A;  2OCU A;  5FHM A;  3IJO B;  4FAT A;  3HCQ A;  4EQ9 A;  3LSX A;  1N3W A;  1I69 A;  5A5X B;  1LBB A;  2H98 A;  2DOJ A;  4FOR A;  5KZT A;  3U94 A;  1SYH A;  1ZLQ A;  4U2R A;  4POX A;  3TYH A;  4H8I A;  3S4U A;  1NNP A;  1IXI A;  5TPA A;  3TPA A;  4JWX A;  2V84 A;  5CBS A;  3IO6 A;  3ECR A;  4EQB A;  5AA4 B;  4R6Y A;  1Y3Q A;  5H8Q A;  3FZV A;  3C4M A;  4KFQ A;  1FCK A;  1XHY A;  3ONM A;  2ESN A;  4U23 A;  4F1V A;  1US5 A;  2V93 A;  4C0R A;  1SD3 A;  5I58 B;  3FAT A;  2Y7R A;  2DWH A;  4N07 A;  3MP8 A;  3C31 A;  4OER A;  1SDX A;  1O64 A;  3R7X A;  1UTH B;  2HZL A;  2P2A A;  3CIJ A;  3TTN A;  2RF1 A;  3MQ9 A;  4Q8R A;  1B1H A;  1B3E A;  1GGG A;  5I2K B;  2F7B A;  1F9B A;  3KN3 A;  2OWT A;  3UGW A;  1FQD A;  3PUV E;  2H4I A;  5L9S A;  2O7I A;  3S9N C;  5FTH A;  1MQG A;  1LCF A;  2DQV A;  2XXR A;  4U1Z A;  3FJG A;  4DIG A;  1LAX A;  2IEE A;  4EXL A;  2F5X A;  3VV5 A;  1M5D A;  2NXO A;  2Z8D A;  5I2N B;  3O28 A;  1B51 A;  2ZYK A;  1LFI A;  4F29 A;  2DYX A;  1ANF A;  5I57 B;  4JDF A;  1SW5 A;  4PE5 B;  3KOT A;  3OEK A;  4LON B;  4GXA A;  1USY E;  2GHA A;  3KG2 A;  1SI1 A;  3FVO A;  5H8F B;  3K6V A;  3DRI A;  4HCY A;  1OVB A;  1JVY A;  1FQB A;  3KBR A;  1OVT A;  1AIV A;  2REG A;  5LOM A;  1ZTY A;  2H99 A;  1US4 A;  3KSJ A;  3I6V A;  1M5F A;  3U8Q A;  3RQT A;  1MXZ A;  1B46 A;  1BTJ A;  3D4C A;  5DEX A;  2F7C A;  1QUK A;  4WXJ A;  1XS5 A;  4RY1 A;  4JSO A;  1N04 A;  2I3W A;  3PPQ A;  3V89 B;  3EQ1 A;  4R2F A;  1USY H;  4QHQ A;  3FVG A;  5EYF A;  2DVZ A;  2UYF A;  3JV9 A;  4G68 A;  3PD8 A;  1L5T A;  3TAJ A;  3THI A;  2CMO A;  3TCG A;  2RIN A;  1TFD A;  3K1P A;  1R9Q A;  3VLV A;  5DVI A;  3FV2 A;  3PV0 E;  1ATG A;  3W9V A;  4JWY A;  2NUV A;  4KI0 E;  3PMX A;  4H1X A;  2I6E A;  3Q26 A;  1VFE A;  5HBC A;  1Y4C A;  1MRP A;  3EHU A;  2RKM A;  2Z23 A;  3KFM A;  4G2Z A;  1Z7M E;  3CFZ A;  4UA8 A;  3ZSF A;  1GR2 A;  3W9W A;  2PYY A;  4GL0 A;  2F97 A;  4OTE A;  1JEV A;  4IO6 A;  4F31 B;  1FTM A;  2YLN A;  4ZE8 A;  3U92 A;  1FTJ A;  2F78 A;  1PB8 A;  3H3G A;  3VLU A;  2GHB A;  3K0V A;  3OXN A;  3QAX A;  1LLS A;  4E0X A;  4MH5 A;  5TP9 A;  3DRK A;  1OLC A;  3LR1 A;  2O6A A;  3O9P A;  5I59 B;  5H8H A;  3GLB A;  1LBC A;  3MPK A;  1O63 A;  3SKP A;  1H76 A;  1ZKB A;  4KR5 A;  3H6U A;  2RCB A;  2QMX A;  1AL3 A;  1TWY A;  4ECF A;  5K2Y A;  4OQO A;  4NED A;  4F1U A;  3I5O A;  1SQY A;  1S7Y A;  4OFJ A;  1MH3 A;  2B4M A;  5KCJ B;  3UK4 A;  4IO5 A;  1B5H A;  2PVU A;  3SER A;  3OO8 A;  3TZA A;  3IO4 A;  1M5B A;  4IY6 A;  4IY5 A;  3G3F A;  3VXB A;  4JBZ A;  4OEU A;  1LGB C;  2UVG A;  4DCX A;  3PUY E;  2RC8 A;  1GV8 A;  3QUF A;  2QMW A;  1ZJL A;  1NMU A;  3QYT A;  3FJM A;  3KGC A;  3KJT A;  4FEB A;  1B0L A;  5CC2 A;  3GBA A;  3V8X B;  2QS1 A;  2F6P A;  3O29 A;  3JYR A;  3LSW A;  2WOP A;  5FTI A;  4I8C A;  4IGT A;  3DRH A;  2D21 A;  3USD A;  4F2O A;  4YZZ A;  4NF8 B;  3T22 A;  1SI0 A;  4ZEC A;  3RYB A;  5ELV A;  1H3D A;  1NL5 A;  3SDF A;  3FUZ A;  3QXM A;  1KWH A;  3L6H A;  4POW A;  1UTB A;  4GQO A;  1PEB A;  3VFJ A;  4GWO A;  4YMB A;  3TFL A;  4IO2 A;  2R71 A;  5JTY B;  3T66 A;  3B6Q A;  3KSX A;  2DVC A;  3V83 A;  3SEX A;  4MBP A;  5CI5 A;  1R9L A;  1B7U A;  3FAS A;  4KD5 A;  1P99 A;  4OMB A;  4ESX A;  4K3F A;  5ITO A;  4QRZ A;  4ZEI A;  4F3S A;  3FXQ A;  5A5X A;  3IOV A;  2ZYM A;  2XX7 A;  3QIM A;  4P0G A;  2XXV A;  3S9L C;  3RY3 A;  2QSX A;  1OIB A;  3ILU B;  1FQE A;  5H8N B;  4RPN A;  4ELO A;  3E13 X;  2P0S A;  3TEP A;  5DYH A;  2Y7K A;  2UVI A;  4IB2 A;  1OMP A;  3OSR A;  4F19 A;  1O7T A;  4BDQ A;  5AA4 A;  2RC9 A;  4U1O A;  3W15 C;  1NH7 A;  3MVY A;  4F3B A;  1MDP 1;  2R9J A;  1AMF A;  2O7U A;  4XKR A;  4ONY A;  3F11 A;  5I58 A;  2PX1 A;  1B9J A;  5EHS A;  4X48 A;  3MPL A;  1N0T A;  1P1O A;  4OZ9 A;  3MVW A;  3TUS A;  1UQW A;  4FE8 A;  1N84 A;  1R6Z A;  3FV1 A;  5KDT B;  1H43 A;  2B4L A;  3IB1 A;  3ZKL A;  3TTM A;  2XX8 A;  4F22 A;  3DEL B;  3RYA A;  4TQU Q;  5I2K A;  3GZG A;  4GL8 A;  1A8F A;  4NMY A;  1DOT A;  4ELQ A;  1XOC A;  3RNN A;  4WKM A;  1P1N A;  2FNC A;  1B2H A;  4QSE A;  5ISU A;  3SEY A;  4LQ5 A;  4FEC A;  3LBS A;  2X26 A;  1WVJ A;  3LSF B;  2AYS A;  1MXV A;  4HCW A;  3MAM A;  3HHF A;  3RTF B;  3HST A;  4R73 A;  3C34 A;  4LUB A;  4OES A;  1JW5 A;  2DP8 A;  2Q8J A;  5I2N A;  2OK2 A;  4ZEF A;  4F18 A;  3OO7 A;  3V5A A;  4R9G A;  1D4N A;  4Q30 B;  5I57 A;  2ALU A;  4ISU A;  4HW8 A;  1FW0 A;  3CSG A;  4NTL A;  1I6Q A;  1JVX A;  4GXS B;  3A3U A;  1N7X A;  2HAV A;  4R75 A;  1Y9U A;  5H8F A;  3KN8 A;  2PMS A;  4XTC Q;  5HPQ A;  2R6G E;  3ODB A;  1LB8 A;  2ZYO A;  2V3U A;  3FTO A;  1IXG A;  3U72 A;  3TTK A;  1LCT A;  2DXY A;  3ZS6 A;  4O3C A;  3MBP A;  3OEL A;  1P1Q A;  4G8N A;  2B3B A;  3M3K A;  1M5C A;  4RPO A;  4ZED A;  5K2X A;  1MM7 A;  1FTL A;  2I0B A;  4KYS A;  4EQ7 A;  1VR5 A;  2XHD A;  1IIT A;  3IOT A;  5JEI A;  4GFR A;  4EDP A;  3N6U A;  1Q35 A;  1CE2 A;  2QS2 A;  4N6P A;  4OFO A;  3QK6 A;  2XXY A;  3FXU A;  1ZBM A;  2G29 A;  2WOK A;  2HQ0 A;  4RA1 A;  4X1B A;  5AA2 B;  3PU5 A;  4LVQ A;  4G68 C;  3GBB A;  4DLD A;  3K6W A;  4R74 A;  3MVZ A;  1YPN A;  4IO4 A;  5AE4 A;  4M4G A;  3TKD A;  1MQH A;  2H5Y A;  1MQI A;  4KPT A;  3K2D A;  3FXR A;  3IL1 B;  5FHO A;  3MVX A;  3O97 A;  5BWJ A;  3TTL A;  4MLQ A;  2DWA A;  4KQP A;  2OLB A;  1IIW A;  4YB5 A;  4YKI A;  4OEV A;  4MFI A;  5CMB A;  4Q5T A;  1HSE A;  4NF6 B;  3MWB A;  5I84 A;  3KOS A;  4JSD A;  1A54 A;  1IXH A;  3PPN A;  2UXA A;  1FQA A;  4R72 A;  4O3A A;  2AL4 A;  1MXX A;  4PFU A;  5I59 A;  4H0W A;  1LFH A;  5IKB A;  4H5F A;  3HO7 A;  1XC1 A;  2OZZ A;  4C1U A;  5TU0 A;  3N26 A;  1SBP A;  2V3Q A;  1WOD A;  4NF4 B;  5B70 A;  1TT1 A;  3KEI A;  1DTZ A;  4YKP A;  3IJX B;  3LSL A;  5CRY A;  4GLI A;  5ICQ A;  3IR1 A;  3MUQ A;  3T9H B;  4NE4 A;  3K00 A;  2HZK A;  4XKN A;  5HM4 B;  2WKY A;  5KCJ A;  1B05 A;  1YTV A;  2G93 A;  1SYI A;  1BKA A;  4NF5 B;  5IAI A;  4H8J A;  1B52 A;  4MLV A;  4H65 A;  1QUJ A;  1LAF E;  1Y3N A;  1D9V A;  2XD3 A;  3FVN A;  4QSD A;  5H8S A;  1DMB A;  3OO6 A;  2QS4 A;  3G3G A;  2Y7W A;  4DXC A;  1B58 A;  3G3K A;  3T9X B;  3WAF A;  4X1D A;  2E0S A;  2Q88 A;  4YAH X;  2ZNS A;  1QUL A;  2RC7 A;  3UP9 A;  3N94 A;  4AB6 A;  3MJN A;  1LST A;  3GXA A;  5DTB A;  3QUJ A;  1UIU A;  4FJP A;  4GD5 A;  1B3H A;  3K1N A;  4G8M A;  5J1D A;  1NH8 A;  3EF7 A;  3G3I A;  3BKI B;  4NF8 A;  3CR9 A;  1B32 A;  4EF1 A;  1IXC A;  2F7A A;  4XIG Q;  2DE2 A;  3VXC A;  1DTG A;  2WOL A;  1JW1 A;  1AH5 A;  2ZYN A;  3ILT B;  3OEM A;  5JTY A;  1GVC A;  1WDN A;  2GH9 A;  3SET A;  2Q2C A;  5L9M A;  2P1S A;  1B0H A;  3C32 A;  2XXU A;  2NOO A;  2AIX A;  3C9H A;  5DT6 A;  5FHN A;  2DWI A;  1OQH A;  4C1T A;  2I3V A;  4PFY A;  3UA8 A;  1FTK A;  3VVD A;  3C33 A;  1POT A;  2ZNU A;  2PT2 A;  1MXY A;  4ZS9 A;  2ONR A;  1B6H A;  1POY 1;  4I62 A;  4LZ5 A;  5H8N A;  1AOV A;  2H25 A;  4Z7E A;  1A55 A;  3S2V A;  2XXT A;  4BLA A;  1PC3 A;  4OWD A;  1T0K A;  3BFT A;  4Q0C A;  2UVJ A;  1P1W A;  4QFN A;  4GVO A;  2XXH A;  3BFU A;  3KJ7 A;  3DP6 A;  1EZO A;  3SEV A;  3PMV A;  1EZP A;  3PGF A;  1PB7 A;  4JB7 A;  2Q89 A;  3H4Z A;  1Z7N E;  2VHA A;  3S9E A;  3VE1 B;  3ZKK A;  4QFO A;  2VGQ A;  3P7I A;  4YKK A;  2Y7P A;  1ZU0 A;  2Z22 A;  3O6G A;  4TLM B;  4PET A;  1MM6 A;  1Y4T A;  1NNT A;  3OD7 A;  5KDT A;  4L17 A;  2REJ A;  2A5T B;  2PT1 A;  1A7L A;  3C36 A;  5I56 B;  1SW4 A;  1HSL A;  1URD A;  3Q29 A;  5F7V A;  1BP5 A;  3MZ1 A;  3IOR A;  3TEL A;  3MW0 A;  4F3P A;  3R26 A;  1S50 A;  4U22 A;  3H06 B;  4NWD A;  1PB9 A;  5ICT A;  4OXV A;  3MP6 A;  3PAM A;  1P1U A;  2XD2 A;  4LZ8 A;  1B3G A;  1ZMG A;  1ELJ A; 
#chains in the Genus database with same CATH topology
 1BK4 A;  4Z0I A;  3RUM A;  2V3T A;  1MY1 A;  1EZ9 A;  1KZ8 A;  1N76 A;  4PFI A;  1JW4 A;  4XF5 A;  1MY4 A;  1RYO A;  3A09 A;  4PCD A;  5AA2 D;  3HHG A;  3EN3 A;  3T96 B;  3TCH A;  2OBG A;  4PAF A;  2NVU B;  1OQG A;  2CZL A;  2XXQ A;  4U4X A;  2VD2 A;  3CSB A;  2AL5 A;  4N81 A;  1H44 A;  4ELR A;  5CBR A;  1DK4 A;  1B5I A;  3EPE A;  5I7I A;  1B5J A;  1NKX A;  1SW2 A;  1B40 A;  1SVX B;  3TMG A;  4P11 A;  4R2B A;  1MH4 A;  3CHG A;  1UTH A;  3MZ9 A;  4O7I A;  1MPD A;  4THI A;  2QRY A;  1B4Z A;  4QF9 A;  1Q1K A;  2OJT A;  3O6P A;  2DWJ A;  2YPN A;  2F6G A;  3G7W A;  4DE8 A;  2F34 A;  4I9D A;  2DE3 A;  4DXU A;  2O1L A;  1N3X A;  3O66 A;  4ZEB A;  2JJK A;  4LAT A;  4OHN A;  2ZZX A;  2A5S A;  2KR0 A;  1YZ0 A;  2I0C A;  4O8M A;  2PBW A;  4PFR A;  3K6U A;  2ZMB A;  1JP4 A;  3HPI A;  4BDM A;  4PBQ A;  1EYJ A;  4G4P A;  3RLF E;  3RPL A;  2F8D A;  3UIF A;  3D1R A;  1RYX A;  5AA2 A;  4PFW A;  4WED A;  3MYU A;  4ND9 A;  3RPW A;  1GTK A;  4OFL A;  3N6T A;  4N4U A;  4G77 A;  4DCY A;  1B3L A;  1NFT A;  1FPF A;  3SES A;  1JNF A;  3U93 A;  3UN6 A;  4QFK A;  4MJO A;  3BBR A;  1QVS A;  3CVG A;  1MPC A;  1D9Q A;  2HEU A;  4OVJ A;  1R1N A;  1NNK A;  3MP1 A;  3VDF A;  2XXP A;  4AB5 A;  4ZZA A;  4ZZE A;  3TTR A;  4NF6 A;  1LFG A;  1MY2 A;  1JEU A;  3CRB A;  1QJM A;  4TLL B;  3PTY A;  4RNS A;  3EHT A;  2OWZ A;  5A5L A;  2HXW A;  1QKA A;  3VVF A;  3KN7 A;  4KYE A;  1Y1M A;  1B7Z A;  2Q2A A;  2QJE A;  1LEV A;  4BDO A;  3IOW A;  1NNF A;  1FPK A;  1IUD A;  1MDQ A;  2FIE A;  3L6G A;  4NQ8 A;  3I3V A;  3K01 A;  4BDL A;  4ESW A;  3FBP A;  4YU0 A;  1URS A;  4H5G A;  4NF4 A;  3LUY A;  4P0I A;  3PPP A;  3RT6 B;  3PUX E;  3T93 B;  5L9O A;  4F3G A;  1A99 A;  3QSL A;  3H6T A;  1BLF A;  4HS7 A;  2WYK A;  4R6H A;  3PPO A;  5TPA B;  2HPG A;  1MS7 A;  1IME A;  1LBX A;  1H45 A;  1BIY A;  2Q9T A;  2D3I A;  2HXR A;  1RDX A;  5H8Q B;  1M5E A;  4NF5 A;  2WX9 A;  3N5L A;  2X7Q A;  4PFB A;  4GIZ A;  1VE4 A;  4RXL A;  1LAG E;  4ZDM A;  3TDJ A;  4JXI A;  2H9B A;  4MNC A;  3AXF A;  5IZZ A;  2Z8E A;  2ABH A;  3CG3 A;  2ZNT A;  4PF8 A;  3IAZ A;  2HAU A;  2XWV A;  2HCA A;  4OVS A;  2VP1 A;  2O68 A;  4PFT A;  4NWC A;  1MQD A;  1YAE A;  1MXU A;  3EKI A;  2Z8F A;  4RK9 A;  3Q25 A;  5AA1 A;  3G3H A;  4HTG A;  4TOZ A;  1B3F A;  3G3J A;  2QPQ A;  2B3F A;  1D9Y A;  1MXW A;  2OWS A;  4JWO A;  1XT8 A;  1NUZ A;  4F39 A;  3OO9 A;  4I1D A;  4E0W A;  3FIR A;  4KHZ E;  3BIH A;  3H6V A;  5CM6 A;  1LAH E;  2P3V A;  4H6D A;  1SW1 A;  1CB6 A;  1FSA A;  3M8U A;  4FAJ A;  3TQL A;  2QVR A;  3E3K A;  3FJ7 A;  2O1M A;  1XVY A;  3H6W A;  3EHS A;  3PD9 A;  3K6X A;  4QFL A;  3E4R A;  1FTO A;  2RCA A;  5JK4 A;  1OLA A;  1I6A A;  4IO3 A;  2ONK E;  2X7P A;  4ZE9 A;  3B6W A;  2PFZ A;  2F36 A;  4ZEK A;  2LAO A;  4OET A;  3T9V A;  4LQ2 A;  1Y1Z A;  5BUU A;  4N91 A;  5EYH A;  4PQJ A;  1JET A;  4WEP A;  1LB9 A;  4H67 A;  1S9T A;  2I49 A;  1Y3P A;  2FA7 A;  4FED A;  1FTA A;  4HE1 A;  1DSN A;  2M8C A;  4R6K A;  2XXX A;  5LDZ A;  3B6T A;  4G61 A;  4N6D A;  2W7Y A;  2CZH A;  1TXF A;  3WAE A;  3UOR A;  2O84 X;  3TCF A;  1MY3 A;  2DXR A;  2IA4 A;  4DDD A;  1B4H A;  5L8D A;  1VFD A;  1Q9D A;  1ZIU A;  1A8E A;  4RK2 A;  3Q27 A;  1RKM A;  3PMW A;  4I3Y A;  2I4B A;  1FBH A;  5DEX B;  4KXP A;  3DRG A;  4MCO A;  2GRV A;  1NUW A;  4N8Y A;  5ESY A;  1VDW A;  2ONS A;  3PUZ E;  2UYE A;  2O69 A;  4QBA A;  3DP8 A;  4G68 B;  1MG1 A;  4H46 A;  3KBZ A;  3IB2 A;  2Y5K A;  4IO7 A;  1IZ1 A;  4OVT A;  2YJP A;  2QL3 A;  4QFP A;  1B7H A;  4QXD A;  3RT8 A;  2FIX A;  3OMB A;  4EXK A;  4M1V A;  1MY0 A;  3DLN A;  3OEN A;  4KCC A;  1EH3 A;  5ET8 A;  1VSO A;  4OYV A;  2A5T A;  1URG A;  5I56 A;  4PAK A;  2WBD A;  2I58 A;  4AQ4 A;  3T9U A;  3IOU A;  5DVJ A;  3GYY A;  4YB7 A;  3KC0 A;  5CMK A;  1IEJ A;  1NV6 A;  4U4S A;  4LZ7 A;  1DPE A;  3Q28 A;  4GWU A;  4BDN A;  4MF3 A;  1MQJ A;  2Y84 A;  3CFX A;  1IQ7 A;  1Y20 A;  1FPI A;  2ZXT A;  2GFE A;  1IMF A;  2BJJ X;  1J1N A;  1EU8 A;  1NUX A;  2THI A;  5AA3 A;  2E1S A;  4DI4 B;  1PBP A;  4GOT A;  2BJI A;  3TQW A;  4F2Q A;  4R9F A;  5TP9 B;  4N13 A;  1MPB A;  3E9X A;  3O2A A;  3RN8 A;  2XX9 A;  3VVE A;  2VOZ A;  5H8H B;  2V25 A;  4KCD A;  4QSC A;  4YB6 A;  3M3F A;  1NV5 A;  4OEN A;  1XVX A;  1TFA A;  5F1Q A;  2FYI A;  1FBF A;  2D5W A;  3B7D A;  3HV1 A;  1JQF A;  5CMC A;  4XXU A;  1QGX A;  5B7D A;  3DRF A;  3DP4 A;  1PBQ A;  2VD3 A;  3IX1 A;  3M3L A;  4EUO A;  1G0H A;  4UAC A;  1UIV A;  3R6U A;  3KC1 A;  4U21 A;  1QW0 A;  2F3B A;  5I3S A;  4XKQ A;  3VLW A;  2QS3 A;  4GRK A;  3FD3 A;  4YIC A;  3IK6 B;  4G8H A;  5DVF A;  4DXB A;  1YCJ A;  3DM0 A;  3S9M C;  3OOA A;  4LP2 B;  3O6H A;  4O94 A;  1II5 A;  2O51 A;  4XKP A;  3RTW B;  3PUW E;  3H03 A;  2ANJ A;  4LA9 A;  4RYA A;  1QKB A;  5CMM A;  1I6B A;  2HFB A;  3LC8 A;  3A3C A;  1N7W A;  5EQ7 A;  4ELP A;  3CFL A;  4X9T A;  4EF2 A;  3FVK A;  1PDA A;  3SEW A;  4PP0 A;  3MZB A;  4I40 A;  4KYD A;  2I48 A;  3KZG A;  2KLF A;  3JZJ A;  1DPP A;  1FQC A;  5IM2 A;  5EHM A;  3H7M A;  5M2V A;  2XXI A;  3TOD A;  4BDR A;  4F1Y A;  2I4C A;  2DE4 A;  4YKJ A;  1QUI A;  3SEU A;  1HSJ A;  3K1M A;  2DS9 A;  2B65 A;  2XXW A;  3RGY A;  4YMA A;  2WBB A;  3LVU A;  5ITP A;  1FQF A;  4GF8 A;  3DRJ A;  3HN0 A;  4O3B A;  1UTB B;  1D3K A;  4FBP A;  3D4G A;  2DSF A;  1A40 A;  3CI8 A;  2F35 A;  4RJZ A;  3O6I A;  2CEY A;  3K02 A;  4IGR A;  3B50 A;  3CG1 A;  3U65 A;  2Y7I A;  2XWK A;  3OSQ A;  1IMD A;  3MC2 A;  5T3J A;  2NWJ A;  4FIM A;  3IB0 A;  3U1O A;  3C35 A;  4DZ1 A;  3FGS A;  3PPR A;  3LUZ A;  1B1X A;  2UVH A;  3K4U A;  2OCU A;  5FHM A;  3IJO B;  4FAT A;  3HCQ A;  4EQ9 A;  3LSX A;  1N3W A;  2Y5L A;  4MIJ A;  1I69 A;  5A5X B;  1LBB A;  2H98 A;  2DOJ A;  4FOR A;  5KZT A;  1FPJ A;  3U94 A;  1SYH A;  5IZ3 B;  1ZLQ A;  4U2R A;  4OA4 A;  4POX A;  3TYH A;  4H8I A;  3S4U A;  1NNP A;  4MNP A;  1FPE A;  1IXI A;  5TPA A;  1IMC A;  2MKZ A;  3TPA A;  4JWX A;  2V84 A;  5CBS A;  3IO6 A;  3SZP A;  3ECR A;  4EQB A;  5AA4 B;  4R6Y A;  5ET5 A;  1Y3Q A;  4PTK A;  5H8Q A;  5J16 A;  3FZV A;  3C4M A;  4KFQ A;  1FCK A;  1XHY A;  3ONM A;  2ESN A;  4U23 A;  1LBY A;  4F1V A;  2QVV A;  1US5 A;  2V93 A;  4C0R A;  1FJ6 A;  1SD3 A;  1SPI A;  5I58 B;  3FAT A;  2Y7R A;  2DWH A;  4N07 A;  3MP8 A;  3C31 A;  4OER A;  1SDX A;  1O64 A;  3R7X A;  1UTH B;  2HZL A;  2P2A A;  3CIJ A;  1G0I A;  3TTN A;  2WEF A;  2RF1 A;  3MQ9 A;  4Q8R A;  1B1H A;  1B3E A;  4GWX A;  1GGG A;  5I2K B;  2F7B A;  1F9B A;  2F3D A;  3ROJ A;  4NG7 A;  3KN3 A;  2OWT A;  3UGW A;  2XA5 A;  1FQD A;  3PUV E;  2H4I A;  5L9S A;  2O7I A;  3S9N C;  5FTH A;  1MQG A;  4MX6 A;  1LCF A;  2DQV A;  2XXR A;  4U1Z A;  3FJG A;  4DIG A;  1LAX A;  2IEE A;  4EXL A;  1NV0 A;  2F5X A;  3VV5 A;  2PCR A;  1M5D A;  2NXO A;  2Z8D A;  5IZ1 A;  5I2N B;  3O28 A;  1B51 A;  2ZYK A;  1LFI A;  4F29 A;  1YXI A;  2DYX A;  1ANF A;  2QVU A;  5I57 B;  1FJ9 A;  4JDF A;  4N6K A;  4HXV A;  1SW5 A;  4PE5 B;  4AS4 A;  3KOT A;  3OEK A;  4LON B;  4GXA A;  1DBZ A;  1USY E;  2GHA A;  3KG2 A;  1SI1 A;  2R8T A;  3FVO A;  5H8F B;  3K6V A;  3DRI A;  4HCY A;  1OVB A;  1JVY A;  1FQB A;  3KBR A;  1OVT A;  1AIV A;  2REG A;  5LOM A;  1ZTY A;  2H99 A;  1US4 A;  1YYZ A;  3KSJ A;  3I6V A;  1M5F A;  3U8Q A;  3RQT A;  1XI6 A;  1MXZ A;  3E78 A;  1B46 A;  1BTJ A;  3D4C A;  1NV1 A;  2F7C A;  5DEX A;  1QUK A;  4WXJ A;  1XS5 A;  4RY1 A;  1INP A;  4GWW A;  4JSO A;  1N04 A;  2I3W A;  3PPQ A;  3V89 B;  3EQ1 A;  4NGU A;  4R2F A;  1USY H;  4QHQ A;  2FHY A;  3FVG A;  1FRP A;  5EYF A;  2DVZ A;  2UYF A;  3JV9 A;  4G68 A;  3PD8 A;  1L5T A;  3TAJ A;  3THI A;  2CMO A;  3TCG A;  2RIN A;  1TFD A;  3K1P A;  1R9Q A;  3VLV A;  5DVI A;  3FV2 A;  3PV0 E;  1ATG A;  3W9V A;  5IGA A;  4JWY A;  2NUV A;  4KI0 E;  3PMX A;  4PGN A;  4H1X A;  2I6E A;  3Q26 A;  1VFE A;  5HBC A;  1Y4C A;  1MRP A;  3EHU A;  2VPO A;  2RKM A;  2Z23 A;  3KFM A;  4G2Z A;  1Z7M E;  3CFZ A;  4N8G A;  4UA8 A;  3ZSF A;  1GR2 A;  3W9W A;  1LBW A;  2PYY A;  4GL0 A;  2F97 A;  4OTE A;  1JEV A;  4IO6 A;  4MAG A;  4MEV A;  4F31 B;  1FTM A;  1CNQ A;  2PFY A;  2YLN A;  4ZE8 A;  4GX4 A;  3U92 A;  1FTJ A;  2F78 A;  1PB8 A;  3H3G A;  3VLU A;  2GHB A;  3K0V A;  3OXN A;  3QAX A;  1LLS A;  4E0X A;  4MH5 A;  3IFC A;  5TP9 A;  3DRK A;  1OLC A;  1FPD A;  3LR1 A;  1IMA A;  2O6A A;  3O9P A;  5I59 B;  5H8H A;  3GLB A;  1LBC A;  3MPK A;  3E79 A;  1O63 A;  4MMP A;  3SKP A;  1H76 A;  4HE2 A;  1ZKB A;  4KR5 A;  3H6U A;  2RCB A;  2QMX A;  1AL3 A;  1TWY A;  4ECF A;  5K2Y A;  4OQO A;  4NED A;  4GWS A;  4F1U A;  3I5O A;  4IR8 A;  1SQY A;  1S7Y A;  4OFJ A;  1MH3 A;  2KQZ A;  2B4M A;  5KCJ B;  3UK4 A;  4IO5 A;  1B5H A;  2PVU A;  1IMB A;  3SER A;  3OO8 A;  3TZA A;  3NOH A;  1LBZ A;  3IO4 A;  1M5B A;  4IY6 A;  4IY5 A;  3G3F A;  3VXB A;  4JBZ A;  4OEU A;  1FPB A;  1RDZ A;  1LGB C;  2UVG A;  4DCX A;  3PUY E;  2RC8 A;  1GV8 A;  2L5V A;  3QUF A;  2QMW A;  1ZJL A;  1NMU A;  3QYT A;  3FJM A;  3KGC A;  3KJT A;  4FEB A;  1B0L A;  5CC2 A;  3GBA A;  3V8X B;  2QS1 A;  2F6P A;  4LN5 A;  3O29 A;  3JYR A;  1RDY A;  3LSW A;  2WOP A;  5FTI A;  4I8C A;  4IGT A;  3DRH A;  5ET6 A;  2D21 A;  3USD A;  4F2O A;  4YZZ A;  4NF8 B;  3T22 A;  1SI0 A;  4ZEC A;  3RYB A;  4AS5 A;  5ELV A;  1H3D A;  1NL5 A;  3SDF A;  3FUZ A;  3QXM A;  1KWH A;  3L6H A;  4POW A;  1UTB A;  4GQO A;  1PEB A;  4X04 A;  3VFJ A;  4GWO A;  4NN3 A;  4YMB A;  3TFL A;  4IO2 A;  2R71 A;  5JTY B;  3T66 A;  3B6Q A;  3KSX A;  2DVC A;  3V83 A;  4I3E A;  5F24 A;  3SEX A;  4MBP A;  5CI5 A;  1R9L A;  1B7U A;  3FAS A;  2Q8M A;  4KD5 A;  1P99 A;  3FXB A;  4OMB A;  4ESX A;  2FVZ A;  4K3F A;  5EQ8 A;  5ITO A;  4QRZ A;  4ZEI A;  4F3S A;  4P8B A;  3FXQ A;  4JVD A;  2ZZV A;  5A5X A;  3IOV A;  2FBP A;  2ZYM A;  2XX7 A;  3QIM A;  4P0G A;  2XXV A;  3S9L C;  3RY3 A;  2QSX A;  1OIB A;  3ILU B;  5IZ3 A;  4OAN A;  1FQE A;  3T0J A;  5H8N B;  4RPN A;  4ELO A;  1EYI A;  3E13 X;  2P0S A;  3TEP A;  5DYH A;  2Y7K A;  2UVI A;  4IB2 A;  4H45 A;  1OMP A;  3OSR A;  4GX3 A;  4F19 A;  1O7T A;  4BDQ A;  5AA4 A;  2RC9 A;  4U1O A;  3W15 C;  3T1B A;  1NH7 A;  3MVY A;  4F3B A;  4MHF A;  5EQA A;  1MDP 1;  2R9J A;  1AMF A;  2O7U A;  4XKR A;  4ONY A;  3F11 A;  5I58 A;  2PX1 A;  1B9J A;  5EHS A;  4X48 A;  3MPL A;  1N0T A;  1P1O A;  4OZ9 A;  2CZI A;  3MVW A;  3TUS A;  1UQW A;  4FE8 A;  2GQ1 A;  1N84 A;  1R6Z A;  3FV1 A;  4JVI A;  5KDT B;  1H43 A;  2B4L A;  3IB1 A;  1KA1 A;  4PBH A;  3ZKL A;  4NF0 A;  3TTM A;  2XX8 A;  4F22 A;  3DEL B;  3RYA A;  4TQU Q;  5I2K A;  3GZG A;  4GL8 A;  4GBW A;  1A8F A;  4NMY A;  1DOT A;  4ELQ A;  1XOC A;  3RNN A;  2CEX A;  4WKM A;  1P1N A;  2FNC A;  1B2H A;  4QSE A;  5ISU A;  3SEY A;  4LQ5 A;  4P56 A;  4FEC A;  3LBS A;  2X26 A;  1KA0 A;  1WVJ A;  3LSF B;  2AYS A;  1MXV A;  4HCW A;  3MAM A;  3HHF A;  3RTF B;  2WYP A;  3HST A;  4R73 A;  3C34 A;  4GWZ A;  4LUB A;  4MNI A;  4OES A;  1NUY A;  5EQ9 A;  1JW5 A;  5EYG A;  2DP8 A;  2Q8J A;  5I2N A;  2OK2 A;  4ZEF A;  4F18 A;  3MST A;  3OO7 A;  3V5A A;  4R9G A;  1D4N A;  4Q30 B;  5I57 A;  2ALU A;  4ISU A;  4HW8 A;  1FW0 A;  1NV2 A;  2XWO A;  3CSG A;  1NV7 A;  4NTL A;  1I6Q A;  1JVX A;  4GXS B;  3A3U A;  1N7X A;  2HAV A;  4R75 A;  1Y9U A;  4UAB A;  5H8F A;  3KN8 A;  2PMS A;  4XTC Q;  4OVP A;  5HPQ A;  2R6G E;  3ODB A;  1LB8 A;  2ZYO A;  2V3U A;  3FTO A;  4OVQ A;  3QMF A;  1IXG A;  3U72 A;  3TTK A;  1LCT A;  1AWB A;  2DXY A;  3ZS6 A;  4O3C A;  3MBP A;  3OEL A;  1P1Q A;  4G8N A;  4JVC A;  2B3B A;  3M3K A;  4P1L A;  1M5C A;  4RPO A;  4ZED A;  1K9Y A;  5K2X A;  1MM7 A;  1FTL A;  2I0B A;  4KYS A;  4P1E A;  4EQ7 A;  1VR5 A;  2XHD A;  1IIT A;  3IOT A;  4N15 A;  5JEI A;  4GFR A;  4EDP A;  3N6U A;  1Q35 A;  1CE2 A;  2QS2 A;  4N6P A;  4OFO A;  3QK6 A;  2XXY A;  3FXU A;  1ZBM A;  2G29 A;  2WOK A;  1FBC A;  1NV4 A;  4RA1 A;  2HQ0 A;  2Q74 A;  3RPL B;  4X1B A;  5AA2 B;  3PU5 A;  4LVQ A;  4G68 C;  4GWY A;  3GBB A;  4DLD A;  3K6W A;  4R74 A;  3MVZ A;  1YPN A;  4IO4 A;  5AE4 A;  4M4G A;  3TKD A;  1MQH A;  4P3L A;  2H5Y A;  1MQI A;  3A29 A;  2P3N A;  1LBV A;  5FBP A;  4KPT A;  3K2D A;  3FXR A;  3IL1 B;  5FHO A;  2ZZW A;  3MVX A;  3IFA A;  3O97 A;  5BWJ A;  3TTL A;  4MLQ A;  2DWA A;  4KQP A;  2OLB A;  1IIW A;  4YB5 A;  4YKI A;  1FPL A;  4OEV A;  4MFI A;  5CMB A;  4Q5T A;  1HSE A;  4NF6 B;  3MWB A;  5I84 A;  3KOS A;  4NHB A;  5ET7 A;  4JSD A;  4GBV A;  1A54 A;  1IXH A;  3PPN A;  2UXA A;  1FQA A;  4R72 A;  4O3A A;  2AL4 A;  1MXX A;  4PC9 A;  4PFU A;  5I59 A;  5LTC A;  4H0W A;  4XEQ A;  1LFH A;  5IKB A;  4H5F A;  2HHM A;  4NX1 A;  3HO7 A;  4NAP A;  1XC1 A;  2OZZ A;  4C1U A;  5TU0 A;  3N26 A;  1DCU A;  1SBP A;  2V3Q A;  1NI9 A;  1WOD A;  4NF4 B;  5B70 A;  1TT1 A;  3KEI A;  4PF6 A;  1DTZ A;  4P9K A;  4YKP A;  3IJX B;  3LSL A;  5CRY A;  4GLI A;  4PAI A;  5ICQ A;  3IR1 A;  2XXK A;  3MUQ A;  3T9H B;  2VT5 A;  4NE4 A;  2VPN A;  3K00 A;  2HZK A;  2CZK A;  4XKN A;  5HM4 B;  2DDK A;  2WKY A;  5KCJ A;  1B05 A;  1YTV A;  2G93 A;  1SYI A;  1BKA A;  4GX6 A;  1FBP A;  4NF5 B;  5IAI A;  2QFL A;  4H8J A;  1B52 A;  4MLV A;  4H65 A;  1QUJ A;  1LAF E;  1Y3N A;  1D9V A;  2XD3 A;  3FVN A;  4QSD A;  5H8S A;  1DMB A;  3OO6 A;  1FBE A;  2QS4 A;  3G3G A;  2Y7W A;  4DXC A;  1B58 A;  3G3K A;  3T9X B;  3ISP A;  3WAF A;  4X1D A;  2E0S A;  2Q88 A;  4YAH X;  2ZNS A;  1QUL A;  2RC7 A;  3UP9 A;  3N94 A;  4AB6 A;  3MJN A;  1LST A;  3GXA A;  5DTB A;  3QUJ A;  1UIU A;  4FJP A;  4GD5 A;  1B3H A;  3K1N A;  4G8M A;  5J1D A;  1NH8 A;  3EF7 A;  3G3I A;  3BKI B;  4NF8 A;  3CR9 A;  1B32 A;  4EF1 A;  4N17 A;  5DW8 A;  4PGP A;  1IXC A;  3LV0 A;  2F7A A;  4XIG Q;  2DE2 A;  3VXC A;  1DTG A;  2WOL A;  1JW1 A;  1AH5 A;  2ZYN A;  3ILT B;  3OEM A;  5JTY A;  1K9Z A;  3HFU A;  1GVC A;  1WDN A;  2GH9 A;  3SET A;  2Q2C A;  5L9M A;  2P1S A;  1B0H A;  3C32 A;  1NV3 A;  2OX3 A;  3B8B A;  2XXU A;  2NOO A;  2AIX A;  3C9H A;  5DT6 A;  4DI3 D;  5FHN A;  2DWI A;  1OQH A;  4C1T A;  4O7M A;  2I3V A;  4PFY A;  3UA8 A;  1FTK A;  3VVD A;  3C33 A;  1POT A;  2ZNU A;  2PT2 A;  1MXY A;  4ZS9 A;  2ONR A;  1B6H A;  1POY 1;  4I62 A;  4LZ5 A;  4PDH A;  5H8N A;  1AOV A;  2H25 A;  4Z7E A;  1A55 A;  3S2V A;  1FBG A;  3RYD A;  2XXT A;  4BLA A;  1FBD A;  1PC3 A;  4HE0 A;  4OWD A;  1T0K A;  3BFT A;  4Q0C A;  2UVJ A;  1P1W A;  1EYK A;  4QFN A;  4GVO A;  2XXH A;  3BFU A;  3KJ7 A;  3DP6 A;  4P47 A;  1EZO A;  3SEV A;  3PMV A;  1EZP A;  3PGF A;  1PB7 A;  4JB7 A;  2Q89 A;  3H4Z A;  1Z7N E;  5I5P A;  2VHA A;  3S9E A;  3VE1 B;  3BIG A;  4X8R A;  3ZKK A;  4QFO A;  2VGQ A;  3P7I A;  4YKK A;  2Y7P A;  1ZU0 A;  2Z22 A;  3O6G A;  4PET A;  1MM6 A;  4TLM B;  1Y4T A;  1NNT A;  4PDD A;  3OD7 A;  5KDT A;  4L17 A;  1FPG A;  2REJ A;  2A5T B;  2PT1 A;  1A7L A;  3C36 A;  4XFE A;  5I56 B;  1SW4 A;  1HSL A;  1URD A;  3Q29 A;  5F7V A;  1BP5 A;  3MZ1 A;  3IOR A;  3TEL A;  3MW0 A;  4F3P A;  3R26 A;  1S50 A;  2V4C A;  4U22 A;  3H06 B;  4NWD A;  1PB9 A;  5ICT A;  2XWI A;  4OXV A;  3MP6 A;  3PAM A;  1P1U A;  4OVR A;  4PE3 A;  2XD2 A;  4LZ8 A;  1B3G A;  1ZMG A;  1ELJ A; 
#chains in the Genus database with same CATH homology
 4Z0I A;  3RUM A;  2V3T A;  1MY1 A;  1EZ9 A;  1N76 A;  1JW4 A;  1MY4 A;  1RYO A;  3A09 A;  5AA2 D;  3HHG A;  3EN3 A;  3T96 B;  3TCH A;  2OBG A;  2NVU B;  1OQG A;  2CZL A;  2XXQ A;  4U4X A;  2VD2 A;  3CSB A;  2AL5 A;  1H44 A;  4ELR A;  5CBR A;  1B5I A;  3EPE A;  1B5J A;  1NKX A;  1SW2 A;  1B40 A;  1SVX B;  3TMG A;  4P11 A;  4R2B A;  1MH4 A;  3CHG A;  1UTH A;  3MZ9 A;  1MPD A;  4THI A;  2QRY A;  1B4Z A;  4QF9 A;  1Q1K A;  2OJT A;  3O6P A;  2DWJ A;  2YPN A;  2F6G A;  3G7W A;  4DE8 A;  2F34 A;  4I9D A;  2DE3 A;  4DXU A;  2O1L A;  1N3X A;  3O66 A;  4ZEB A;  4LAT A;  4OHN A;  2A5S A;  2I0C A;  2PBW A;  3K6U A;  2ZMB A;  3HPI A;  4BDM A;  4G4P A;  3RLF E;  2F8D A;  3UIF A;  1RYX A;  5AA2 A;  4PFW A;  4WED A;  4ND9 A;  3RPW A;  1GTK A;  4OFL A;  3N6T A;  4G77 A;  4DCY A;  1B3L A;  1NFT A;  3SES A;  1JNF A;  3U93 A;  3UN6 A;  4QFK A;  3BBR A;  1QVS A;  3CVG A;  1MPC A;  2HEU A;  4OVJ A;  1R1N A;  1NNK A;  3MP1 A;  3VDF A;  2XXP A;  4AB5 A;  4ZZA A;  4ZZE A;  3TTR A;  4NF6 A;  1LFG A;  1MY2 A;  1JEU A;  3CRB A;  1QJM A;  4TLL B;  4RNS A;  3EHT A;  2HXW A;  1QKA A;  3VVF A;  3KN7 A;  4KYE A;  1Y1M A;  1B7Z A;  2Q2A A;  2QJE A;  4BDO A;  3IOW A;  1NNF A;  1IUD A;  1MDQ A;  3L6G A;  3I3V A;  3K01 A;  4BDL A;  4ESW A;  4YU0 A;  1URS A;  4H5G A;  4NF4 A;  3LUY A;  4P0I A;  3PPP A;  3RT6 B;  3PUX E;  3T93 B;  5L9O A;  4F3G A;  1A99 A;  3QSL A;  3H6T A;  1BLF A;  4HS7 A;  4R6H A;  5TPA B;  3PPO A;  1MS7 A;  1H45 A;  1BIY A;  2Q9T A;  2D3I A;  5H8Q B;  1M5E A;  4NF5 A;  3N5L A;  2X7Q A;  4GIZ A;  1VE4 A;  4RXL A;  1LAG E;  4ZDM A;  3TDJ A;  4JXI A;  2H9B A;  3AXF A;  2Z8E A;  2ABH A;  3CG3 A;  2ZNT A;  3IAZ A;  2HAU A;  2HCA A;  2VP1 A;  2O68 A;  4PFT A;  4NWC A;  1MQD A;  1YAE A;  1MXU A;  2Z8F A;  4RK9 A;  3Q25 A;  5AA1 A;  3G3H A;  4HTG A;  4TOZ A;  1B3F A;  3G3J A;  2QPQ A;  2B3F A;  1D9Y A;  1MXW A;  2OWS A;  4JWO A;  1XT8 A;  4F39 A;  3OO9 A;  4I1D A;  4E0W A;  3FIR A;  4KHZ E;  3H6V A;  5CM6 A;  1LAH E;  4H6D A;  1SW1 A;  1CB6 A;  3M8U A;  4FAJ A;  3TQL A;  3E3K A;  3FJ7 A;  2O1M A;  1XVY A;  3H6W A;  3EHS A;  3PD9 A;  3K6X A;  4QFL A;  3E4R A;  1FTO A;  2RCA A;  5JK4 A;  1OLA A;  1I6A A;  4IO3 A;  2ONK E;  2X7P A;  4ZE9 A;  3B6W A;  2F36 A;  4ZEK A;  2LAO A;  4OET A;  3T9V A;  4LQ2 A;  1Y1Z A;  5BUU A;  4PQJ A;  1JET A;  4WEP A;  1LB9 A;  4H67 A;  1S9T A;  2I49 A;  1Y3P A;  2FA7 A;  4FED A;  1DSN A;  2M8C A;  4R6K A;  2XXX A;  3B6T A;  2W7Y A;  1TXF A;  3WAE A;  3UOR A;  3TCF A;  1MY3 A;  2DXR A;  2O84 X;  2IA4 A;  4DDD A;  1B4H A;  5L8D A;  1VFD A;  1ZIU A;  1A8E A;  4RK2 A;  3Q27 A;  1RKM A;  3PMW A;  2I4B A;  5DEX B;  3DRG A;  2GRV A;  2ONS A;  3PUZ E;  2UYE A;  2O69 A;  3DP8 A;  4G68 B;  1MG1 A;  3IB2 A;  4IO7 A;  1IZ1 A;  2YJP A;  2QL3 A;  4QFP A;  1B7H A;  3RT8 A;  3OMB A;  4EXK A;  4M1V A;  1MY0 A;  3DLN A;  3OEN A;  4KCC A;  1EH3 A;  1VSO A;  4OYV A;  2A5T A;  1URG A;  5I56 A;  2I58 A;  4AQ4 A;  3T9U A;  3IOU A;  5DVJ A;  4YB7 A;  5CMK A;  1IEJ A;  4U4S A;  4LZ7 A;  1DPE A;  3Q28 A;  4BDN A;  4MF3 A;  1MQJ A;  2Y84 A;  3CFX A;  1IQ7 A;  1Y20 A;  2ZXT A;  2GFE A;  2BJJ X;  1J1N A;  1EU8 A;  2THI A;  5AA3 A;  2E1S A;  1PBP A;  4GOT A;  3TQW A;  4F2Q A;  4R9F A;  5TP9 B;  4N13 A;  1MPB A;  3E9X A;  3O2A A;  3RN8 A;  2XX9 A;  3VVE A;  2VOZ A;  5H8H B;  2V25 A;  4KCD A;  4QSC A;  4YB6 A;  3M3F A;  4OEN A;  1XVX A;  1TFA A;  5F1Q A;  2FYI A;  2D5W A;  3B7D A;  3HV1 A;  1JQF A;  5CMC A;  4XXU A;  5B7D A;  3DRF A;  3DP4 A;  1PBQ A;  2VD3 A;  3IX1 A;  3M3L A;  4EUO A;  4UAC A;  1UIV A;  3R6U A;  4U21 A;  1QW0 A;  4XKQ A;  3VLW A;  2QS3 A;  4GRK A;  3FD3 A;  4YIC A;  3IK6 B;  4G8H A;  5DVF A;  4DXB A;  1YCJ A;  3DM0 A;  3S9M C;  3OOA A;  4LP2 B;  3O6H A;  1II5 A;  2O51 A;  4XKP A;  3RTW B;  3PUW E;  3H03 A;  2ANJ A;  4LA9 A;  4RYA A;  1QKB A;  5CMM A;  1I6B A;  2HFB A;  3LC8 A;  3A3C A;  1N7W A;  4ELP A;  3CFL A;  4X9T A;  4EF2 A;  3FVK A;  1PDA A;  3SEW A;  4PP0 A;  3MZB A;  4KYD A;  2I48 A;  3KZG A;  2KLF A;  3JZJ A;  1DPP A;  1FQC A;  5EHM A;  3H7M A;  5M2V A;  2XXI A;  3TOD A;  4BDR A;  4F1Y A;  2I4C A;  2DE4 A;  4YKJ A;  1QUI A;  3SEU A;  1HSJ A;  3K1M A;  2DS9 A;  2B65 A;  2XXW A;  3RGY A;  4YMA A;  3LVU A;  5ITP A;  1FQF A;  4GF8 A;  3DRJ A;  3HN0 A;  4O3B A;  1UTB B;  1D3K A;  3D4G A;  2DSF A;  1A40 A;  3CI8 A;  2F35 A;  4RJZ A;  3O6I A;  3K02 A;  4IGR A;  3CG1 A;  2Y7I A;  3OSQ A;  3MC2 A;  2NWJ A;  4FIM A;  3IB0 A;  3U1O A;  3C35 A;  4DZ1 A;  3FGS A;  3PPR A;  1B1X A;  2UVH A;  3K4U A;  2OCU A;  5FHM A;  3IJO B;  4FAT A;  3HCQ A;  4EQ9 A;  3LSX A;  1N3W A;  1I69 A;  5A5X B;  1LBB A;  2H98 A;  2DOJ A;  4FOR A;  5KZT A;  3U94 A;  1SYH A;  1ZLQ A;  4U2R A;  4POX A;  3TYH A;  4H8I A;  3S4U A;  1NNP A;  1IXI A;  5TPA A;  3TPA A;  4JWX A;  2V84 A;  5CBS A;  3IO6 A;  3ECR A;  4EQB A;  5AA4 B;  4R6Y A;  1Y3Q A;  5H8Q A;  3FZV A;  3C4M A;  4KFQ A;  1FCK A;  1XHY A;  3ONM A;  2ESN A;  4U23 A;  4F1V A;  1US5 A;  2V93 A;  4C0R A;  1SD3 A;  5I58 B;  3FAT A;  2Y7R A;  2DWH A;  4N07 A;  3MP8 A;  3C31 A;  4OER A;  1SDX A;  1O64 A;  3R7X A;  1UTH B;  2HZL A;  2P2A A;  3CIJ A;  3TTN A;  2RF1 A;  3MQ9 A;  4Q8R A;  1B1H A;  1B3E A;  1GGG A;  5I2K B;  2F7B A;  1F9B A;  3KN3 A;  2OWT A;  3UGW A;  1FQD A;  3PUV E;  2H4I A;  5L9S A;  2O7I A;  3S9N C;  5FTH A;  1MQG A;  1LCF A;  2DQV A;  2XXR A;  4U1Z A;  3FJG A;  4DIG A;  1LAX A;  2IEE A;  4EXL A;  2F5X A;  3VV5 A;  1M5D A;  2NXO A;  2Z8D A;  5I2N B;  3O28 A;  1B51 A;  2ZYK A;  1LFI A;  4F29 A;  2DYX A;  1ANF A;  5I57 B;  4JDF A;  1SW5 A;  4PE5 B;  3KOT A;  3OEK A;  4LON B;  4GXA A;  1USY E;  2GHA A;  3KG2 A;  1SI1 A;  3FVO A;  5H8F B;  3K6V A;  3DRI A;  4HCY A;  1OVB A;  1JVY A;  1FQB A;  3KBR A;  1OVT A;  1AIV A;  2REG A;  5LOM A;  1ZTY A;  2H99 A;  1US4 A;  3KSJ A;  3I6V A;  1M5F A;  3U8Q A;  3RQT A;  1MXZ A;  1B46 A;  1BTJ A;  3D4C A;  5DEX A;  2F7C A;  1QUK A;  4WXJ A;  1XS5 A;  4RY1 A;  4JSO A;  1N04 A;  2I3W A;  3PPQ A;  3V89 B;  3EQ1 A;  4R2F A;  1USY H;  4QHQ A;  3FVG A;  5EYF A;  2DVZ A;  2UYF A;  3JV9 A;  4G68 A;  3PD8 A;  1L5T A;  3TAJ A;  3THI A;  2CMO A;  3TCG A;  2RIN A;  1TFD A;  3K1P A;  1R9Q A;  3VLV A;  5DVI A;  3FV2 A;  3PV0 E;  1ATG A;  3W9V A;  4JWY A;  2NUV A;  4KI0 E;  3PMX A;  4H1X A;  2I6E A;  3Q26 A;  1VFE A;  5HBC A;  1Y4C A;  1MRP A;  3EHU A;  2RKM A;  2Z23 A;  3KFM A;  4G2Z A;  1Z7M E;  3CFZ A;  4UA8 A;  3ZSF A;  1GR2 A;  3W9W A;  2PYY A;  4GL0 A;  2F97 A;  4OTE A;  1JEV A;  4IO6 A;  4F31 B;  1FTM A;  2YLN A;  4ZE8 A;  3U92 A;  1FTJ A;  2F78 A;  1PB8 A;  3H3G A;  3VLU A;  2GHB A;  3K0V A;  3OXN A;  3QAX A;  1LLS A;  4E0X A;  4MH5 A;  5TP9 A;  3DRK A;  1OLC A;  3LR1 A;  2O6A A;  3O9P A;  5I59 B;  5H8H A;  3GLB A;  1LBC A;  3MPK A;  1O63 A;  3SKP A;  1H76 A;  1ZKB A;  4KR5 A;  3H6U A;  2RCB A;  2QMX A;  1AL3 A;  1TWY A;  4ECF A;  5K2Y A;  4OQO A;  4NED A;  4F1U A;  3I5O A;  1SQY A;  1S7Y A;  4OFJ A;  1MH3 A;  2B4M A;  5KCJ B;  3UK4 A;  4IO5 A;  1B5H A;  2PVU A;  3SER A;  3OO8 A;  3TZA A;  3IO4 A;  1M5B A;  4IY6 A;  4IY5 A;  3G3F A;  3VXB A;  4JBZ A;  4OEU A;  1LGB C;  2UVG A;  4DCX A;  3PUY E;  2RC8 A;  1GV8 A;  3QUF A;  2QMW A;  1ZJL A;  1NMU A;  3QYT A;  3FJM A;  3KGC A;  3KJT A;  4FEB A;  1B0L A;  5CC2 A;  3GBA A;  3V8X B;  2QS1 A;  2F6P A;  3O29 A;  3JYR A;  3LSW A;  2WOP A;  5FTI A;  4I8C A;  4IGT A;  3DRH A;  2D21 A;  3USD A;  4F2O A;  4YZZ A;  4NF8 B;  3T22 A;  1SI0 A;  4ZEC A;  3RYB A;  5ELV A;  1H3D A;  1NL5 A;  3SDF A;  3FUZ A;  3QXM A;  1KWH A;  3L6H A;  4POW A;  1UTB A;  4GQO A;  1PEB A;  3VFJ A;  4GWO A;  4YMB A;  3TFL A;  4IO2 A;  2R71 A;  5JTY B;  3T66 A;  3B6Q A;  3KSX A;  2DVC A;  3V83 A;  3SEX A;  4MBP A;  5CI5 A;  1R9L A;  1B7U A;  3FAS A;  4KD5 A;  1P99 A;  4OMB A;  4ESX A;  4K3F A;  5ITO A;  4QRZ A;  4ZEI A;  4F3S A;  3FXQ A;  5A5X A;  3IOV A;  2ZYM A;  2XX7 A;  3QIM A;  4P0G A;  2XXV A;  3S9L C;  3RY3 A;  2QSX A;  1OIB A;  3ILU B;  1FQE A;  5H8N B;  4RPN A;  4ELO A;  3E13 X;  2P0S A;  3TEP A;  5DYH A;  2Y7K A;  2UVI A;  4IB2 A;  1OMP A;  3OSR A;  4F19 A;  1O7T A;  4BDQ A;  5AA4 A;  2RC9 A;  4U1O A;  3W15 C;  1NH7 A;  3MVY A;  4F3B A;  1MDP 1;  2R9J A;  1AMF A;  2O7U A;  4XKR A;  4ONY A;  3F11 A;  5I58 A;  2PX1 A;  1B9J A;  5EHS A;  4X48 A;  3MPL A;  1N0T A;  1P1O A;  4OZ9 A;  3MVW A;  3TUS A;  1UQW A;  4FE8 A;  1N84 A;  1R6Z A;  3FV1 A;  5KDT B;  1H43 A;  2B4L A;  3IB1 A;  3ZKL A;  3TTM A;  2XX8 A;  4F22 A;  3DEL B;  3RYA A;  4TQU Q;  5I2K A;  3GZG A;  4GL8 A;  1A8F A;  4NMY A;  1DOT A;  4ELQ A;  1XOC A;  3RNN A;  4WKM A;  1P1N A;  2FNC A;  1B2H A;  4QSE A;  5ISU A;  3SEY A;  4LQ5 A;  4FEC A;  3LBS A;  2X26 A;  1WVJ A;  3LSF B;  2AYS A;  1MXV A;  4HCW A;  3MAM A;  3HHF A;  3RTF B;  3HST A;  4R73 A;  3C34 A;  4LUB A;  4OES A;  1JW5 A;  2DP8 A;  2Q8J A;  5I2N A;  2OK2 A;  4ZEF A;  4F18 A;  3OO7 A;  3V5A A;  4R9G A;  1D4N A;  4Q30 B;  5I57 A;  2ALU A;  4ISU A;  4HW8 A;  1FW0 A;  3CSG A;  4NTL A;  1I6Q A;  1JVX A;  4GXS B;  3A3U A;  1N7X A;  2HAV A;  4R75 A;  1Y9U A;  5H8F A;  3KN8 A;  2PMS A;  4XTC Q;  5HPQ A;  2R6G E;  3ODB A;  1LB8 A;  2ZYO A;  2V3U A;  3FTO A;  1IXG A;  3U72 A;  3TTK A;  1LCT A;  2DXY A;  3ZS6 A;  4O3C A;  3MBP A;  3OEL A;  1P1Q A;  4G8N A;  2B3B A;  3M3K A;  1M5C A;  4RPO A;  4ZED A;  5K2X A;  1MM7 A;  1FTL A;  2I0B A;  4KYS A;  4EQ7 A;  1VR5 A;  2XHD A;  1IIT A;  3IOT A;  5JEI A;  4GFR A;  4EDP A;  3N6U A;  1Q35 A;  1CE2 A;  2QS2 A;  4N6P A;  4OFO A;  3QK6 A;  2XXY A;  3FXU A;  1ZBM A;  2G29 A;  2WOK A;  2HQ0 A;  4RA1 A;  4X1B A;  5AA2 B;  3PU5 A;  4LVQ A;  4G68 C;  3GBB A;  4DLD A;  3K6W A;  4R74 A;  3MVZ A;  1YPN A;  4IO4 A;  5AE4 A;  4M4G A;  3TKD A;  1MQH A;  2H5Y A;  1MQI A;  4KPT A;  3K2D A;  3FXR A;  3IL1 B;  5FHO A;  3MVX A;  3O97 A;  5BWJ A;  3TTL A;  4MLQ A;  2DWA A;  4KQP A;  2OLB A;  1IIW A;  4YB5 A;  4YKI A;  4OEV A;  4MFI A;  5CMB A;  4Q5T A;  1HSE A;  4NF6 B;  3MWB A;  5I84 A;  3KOS A;  4JSD A;  1A54 A;  1IXH A;  3PPN A;  2UXA A;  1FQA A;  4R72 A;  4O3A A;  2AL4 A;  1MXX A;  4PFU A;  5I59 A;  4H0W A;  1LFH A;  5IKB A;  4H5F A;  3HO7 A;  1XC1 A;  2OZZ A;  4C1U A;  5TU0 A;  3N26 A;  1SBP A;  2V3Q A;  1WOD A;  4NF4 B;  5B70 A;  1TT1 A;  3KEI A;  1DTZ A;  4YKP A;  3IJX B;  3LSL A;  5CRY A;  4GLI A;  5ICQ A;  3IR1 A;  3MUQ A;  3T9H B;  4NE4 A;  3K00 A;  2HZK A;  4XKN A;  5HM4 B;  2WKY A;  5KCJ A;  1B05 A;  1YTV A;  2G93 A;  1SYI A;  1BKA A;  4NF5 B;  5IAI A;  4H8J A;  1B52 A;  4MLV A;  4H65 A;  1QUJ A;  1LAF E;  1Y3N A;  1D9V A;  2XD3 A;  3FVN A;  4QSD A;  5H8S A;  1DMB A;  3OO6 A;  2QS4 A;  3G3G A;  2Y7W A;  4DXC A;  1B58 A;  3G3K A;  3T9X B;  3WAF A;  4X1D A;  2E0S A;  2Q88 A;  4YAH X;  2ZNS A;  1QUL A;  2RC7 A;  3UP9 A;  3N94 A;  4AB6 A;  3MJN A;  1LST A;  3GXA A;  5DTB A;  3QUJ A;  1UIU A;  4FJP A;  4GD5 A;  1B3H A;  3K1N A;  4G8M A;  5J1D A;  1NH8 A;  3EF7 A;  3G3I A;  3BKI B;  4NF8 A;  3CR9 A;  1B32 A;  4EF1 A;  1IXC A;  2F7A A;  4XIG Q;  2DE2 A;  3VXC A;  1DTG A;  2WOL A;  1JW1 A;  1AH5 A;  2ZYN A;  3ILT B;  3OEM A;  5JTY A;  1GVC A;  1WDN A;  2GH9 A;  3SET A;  2Q2C A;  5L9M A;  2P1S A;  1B0H A;  3C32 A;  2XXU A;  2NOO A;  2AIX A;  3C9H A;  5DT6 A;  5FHN A;  2DWI A;  1OQH A;  4C1T A;  2I3V A;  4PFY A;  3UA8 A;  1FTK A;  3VVD A;  3C33 A;  1POT A;  2ZNU A;  2PT2 A;  1MXY A;  4ZS9 A;  2ONR A;  1B6H A;  1POY 1;  4I62 A;  4LZ5 A;  5H8N A;  1AOV A;  2H25 A;  4Z7E A;  1A55 A;  3S2V A;  2XXT A;  4BLA A;  1PC3 A;  4OWD A;  1T0K A;  3BFT A;  4Q0C A;  2UVJ A;  1P1W A;  4QFN A;  4GVO A;  2XXH A;  3BFU A;  3KJ7 A;  3DP6 A;  1EZO A;  3SEV A;  3PMV A;  1EZP A;  3PGF A;  1PB7 A;  4JB7 A;  2Q89 A;  3H4Z A;  1Z7N E;  2VHA A;  3S9E A;  3VE1 B;  3ZKK A;  4QFO A;  2VGQ A;  3P7I A;  4YKK A;  2Y7P A;  1ZU0 A;  2Z22 A;  3O6G A;  4TLM B;  4PET A;  1MM6 A;  1Y4T A;  1NNT A;  3OD7 A;  5KDT A;  4L17 A;  2REJ A;  2A5T B;  2PT1 A;  1A7L A;  3C36 A;  5I56 B;  1SW4 A;  1HSL A;  1URD A;  3Q29 A;  5F7V A;  1BP5 A;  3MZ1 A;  3IOR A;  3TEL A;  3MW0 A;  4F3P A;  3R26 A;  1S50 A;  4U22 A;  3H06 B;  4NWD A;  1PB9 A;  5ICT A;  4OXV A;  3MP6 A;  3PAM A;  1P1U A;  2XD2 A;  4LZ8 A;  1B3G A;  1ZMG A;  1ELJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...