1QKBA

Oligo-peptide binding protein (oppa) complexed with kvk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and Calorimetric Analysis of Peptide Binding to Oppa Protein
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Protein transport
molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1qkbA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qkbA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1qkbA02
4WXJA 3QUJA 2ZYOA 3U93A 5I58A 2O6AA 1EZPA 3TFLA 1DMBA 4LZ8A 5CMMA 5ITPA 1AIVA 1ATGA 4I1DA 3D4CA 3FXRA 4PFTA 1TFDA 1ZBMA 2GHAA 4NF5A 4R6HA 1FQBA 4PFYA 1A99A 1XC1A 1LB8A 1DTGA 1Y20A 3HCQA 3I6VA 2O69A 4QHQA 1NMUA 3G3JA 5FTIA 3SEUA 4F22A 4RPOA 5TPAB 1J1NA 4ZZAA 3IK6B 1AOVA 3JYRA 1B3EA 2PMSA 3HO7A 4KPTA 1USYH 5I57A 3FATA 2F97A 2XD3A 3FV1A 1GV8A 4FE8A 5ICQA 4K3FA 3SKPA 1Y3PA 3FVGA 5B7DA 1H45A 1B32A 1B40A 3PAMA 2O1MA 4F1UA 4OFOA 3KN8A 1L5TA 2Z23A 2NVUB 4ELPA 4XKNA 1LSTA 1MXVA 1NFTA 3CG1A 3DM0A 3H4ZA 1JVYA 3MPKA 4YKJA 3USDA 1EZ9A 3KOSA 1LAHE 3RTWB 2HQ0A 3TKDA 3QAXA 2Z8DA 1T0KA 1BTJA 3TCHA 1PBQA 2F78A 4QRZA 2OWSA 2HAUA 4PFWA 4F1VA 3LC8A 1SBPA 3VFJA 1RYOA 4BDQA 1S9TA 1FTJA 2AYSA 3FUZA 3OENA 4R6KA 3SESA 1MM7A 4PFUA 1B5IA 1HSJA 1LCTA 3VV5A 2ONRA 4MFIA 3S9EA 3PMVA 5H8HA 3FXUA 4BDMA 3ZKLA 4KYDA 3O6PA 3RY3A 4Q0CA 1YAEA 3VLVA 1FTKA 4DXCA 1UQWA 3KJTA 3KN7A 3QIMA 3OO9A 5ELVA 5K2XA 3S4UA 2F5XA 4P0GA 4F3PA 1JEVA 1ANFA 1VR5A 1QVSA 3H7MA 3KBRA 4R72A 3T9HB 2KLFA 2QS2A 4OENA 4YU0A 4AB6A 4EXKA 3LBSA 3PV0E 4BDLA 3KFMA 3MUQA 1IUDA 2XXWA 1PB9A 1USYE 3RYBA 4IB2A 1LLSA 2ZYNA 1QUKA 2V93A 1NNPA 1MM6A 3LSXA 4U4XA 3PPQA 2E0SA 4ZEFA 1FQDA 3FTOA 5ISUA 1JQFA 1MY3A 2DWJA 4U22A 1Y4CA 3PPPA 4ZS9A 5M2VA 4H8IA 1OVBA 4MH5A 4F18A 2VGQA 4YB5A 4TLLB 5AA4B 4QSCA 1IQ7A 2P2AA 2UYFA 4Q5TA 1N3XA 3S9NC 1SQYA 5JTYA 2BJJX 3L6GA 4ZDMA 1P1OA 3IOWA 5L9MA 5TP9B 3V8XB 2VOZA 4C1TA 4JSDA 2D5WA 2H98A 3EHSA 5I59A 3EPEA 4NEDA 3TTMA 5ITOA 4IO7A 1LFGA 4JBZA 5L9OA 1H44A 3IB2A 1MXWA 5DT6A 1KWHA 4E0WA 5I57B 1FQAA 3G3KA 3LSWA 4EDPA 3EHUA 5JTYB 3WAEA 4JWOA 1H76A 1M5DA 1N3WA 2V3QA 5AA2B 1AMFA 4KYSA 2DVCA 3K0VA 4GL0A 1XVYA 5KZTA 2O7UA 4TOZA 3MBPA 1SD3A 1MQGA 3IJOB 4G8HA 4IO3A 5FHMA 2B3BA 2V84A 4H1XA 4BDOA 1B46A 5AE4A 2I58A 2OK2A 2I3WA 4H5GA 4N6PA 2I4CA 3R7XA 3EHTA 3W9WA 3I3VA 5CMKA 4QFOA 4I62A 4F2QA 4LATA 4EUOA 3PUYE 2ABHA 3MW0A 2LAOA 4GD5A 4NTLA 2DWHA 4LZ5A 3T9VA 2F35A 1POTA 2ZNUA 2V3UA 1VE4A 3IORA 4ZEIA 1QJMA 1TWYA 2RKMA 3H6WA 3K1PA 1JEUA 2ZMBA 4PQJA 3C4MA 3K4UA 3THIA 1IZ1A 3TCFA 3O9PA 3B6WA 3G7WA 1ZLQA 1ZTYA 1MH3A 2GHBA 4MF3A 3UK4A 2F7AA 4KI0E 1OLCA 1RYXA 2Y84A 3C36A 3C32A 2REJA 4WEDA 4WEPA 1B3GA 2IEEA 1AH5A 1MY1A 2Z8FA 2THIA 5L8DA 5BUUA 5CBSA 3U92A 3V83A 4M1VA 3FJMA 3IAZA 4NMYA 5CMBA 3MVWA 3OO7A 3W9VA 3MPLA 2ALUA 3IO4A 4IO5A 2HZKA 4ZEDA 1OIBA 2DSFA 2R71A 3C31A 3H03A 3Q26A 4GOTA 4YB7A 4DXUA 4QFPA 1B3HA 3DELB 1MQJA 2O1LA 3C35A 3IB1A 3B7DA 3FD3A 4DDDA 2H99A 5BWJA 2UXAA 1NH7A 4R73A 4FAJA 2CZLA 3LUYA 3E13X 3PPRA 2XXUA 3DRKA 1B1HA 5I59B 3PD9A 4KCCA 3VE1B 1B0LA 1SI0A 4H5FA 4KCDA 3VXCA 3T9XB 4F19A 5I2KA 3OSQA 3R6UA 3RLFE 1N7XA 2GRVA 2HXWA 2I6EA 2ZNSA 4U1OA 2F34A 4FEDA 1Y1MA 2F7BA 3IOTA 3M3LA 3T96B 3VLWA 4F2OA 3F11A 1S7YA 3K6XA 5H8FA 5KCJB 5KDTB 1Q1KA 2UVGA 4F3GA 3GBAA 1MQIA 2RC7A 2XXVA 3DP4A 3K01A 3BBRA 5F1QA 2Y7KA 2YJPA 4LQ5A 3PUVE 4DCXA 1PC3A 4ELOA 5I2NA 3DRIA 2DOJA 1B3FA 2UVHA 4JDFA 2ONKE 4Q30B 3S9MC 1Z7NE 4LVQA 3KN3A 4YICA 1QUIA 2A5TA 2A5TB 4XTCQ 4FORA 2PVUA 1XOCA 4P11A 4U21A 1OMPA 3O97A 3TZAA 1B9JA 3GBBA 1UIVA 1FQCA 1Y3QA 2QS4A 3Q27A 5CRYA 3RTFB 2I48A 3TQWA 3N6TA 4ZE9A 1LFHA 3UIFA 1FQFA 3CFZA 3KEIA 3V89B 3VVDA 4EQ9A 1MXZA 1R1NA 4FEBA 3SEYA 4RK9A 1D4NA 1SDXA 4RA1A 3HSTA 4HS7A 2O51A 4POWA 1B0HA 3FJGA 4RYAA 5F7VA 1FTLA 5HPQA 1UTBA 3T22A 3O66A 3HN0A 3KOTA 3K6UA 3BKIB 3K2DA 2CMOA 4OETA 3KGCA 4R9GA 3OXNA 5CMCA 3PUWE 3UORA 1P1QA 5CI5A 3QUFA 2DYXA 2GH9A 2PT2A 4N07A 4NF4A 4OMBA 1B4HA 1MPBA 1SW4A 4KYEA 1I6AA 3N6UA 3IB0A 3OO6A 2F7CA 3Q25A 4HCYA 3M3KA 4XIGQ 1MY0A 3Q28A 1OVTA 4NF6B 2G29A 5J1DA 2ZNTA 1ZMGA 4R6YA 3SEWA 4ELQA 3EQ1A 2FYIA 3DRHA 3ECRA 4LP2B 3H6UA 3FZVA 2Z22A 3TQLA 4DE8A 2B65A 2Q89A 3H06B 2W7YA 3M3FA 3O28A 4YKKA 5FHNA 4F3BA 3BFUA 1B6HA 2F8DA 3OD7A 3MZ9A 1SW5A 2DQVA 3ONMA 4OHNA 2RF1A 2DWIA 2F6PA 4H6DA 3GLBA 4R2BA 4DIGA 2DS9A 5CC2A 1M5FA 3FVOA 4NF8B 4R74A 1Z7ME 4ELRA 4G77A 4FIMA 1Y9UA 2Y7WA 4ECFA 3VLUA 4ZEBA 1A54A 4NF5B 3AXFA 3K6VA 3ILUB 2QSXA 3G3GA 1A8FA 4GRKA 4OFJA 4MLQA 1LCFA 3TCGA 3MJNA 4LA9A 1JW4A 1JW1A 4RY1A 3SEVA 1B5JA 3MZBA 3OSRA 3PUZE 4NF4B 4EF1A 1MG1A 1NH8A 5JEIA 3DRJA 3RQTA 4X48A 1LAXA 1GGGA 1PB7A 2H25A 1YPNA 4ND9A 3B6QA 5DEXB 1S50A 2UVIA 5FTHA 3RPWA 4P0IA 1R9QA 3N26A 5IKBA 1VFEA 3IOVA 3M8UA 4GFRA 4JWXA 4X1DA 3UP9A 1N76A 1BP5A 2I0CA 2NUVA 1JVXA 2YLNA 3MVYA 1F9BA 5DTBA 3GXAA 1B05A 2DP8A 5DVIA 2QPQA 4AB5A 1D3KA 1QKBA 2HFBA 3CHGA 2V25A 2XHDA 2NWJA 3QXMA 3FVKA 1VFDA 4G2ZA 3DRFA 3MVZA 5DVFA 4X9TA 2XX7A 1DSNA 3K6WA 5AA4A 1B5HA 4YMBA 2OCUA 1NNTA 4LUBA 3UN6A 3VVFA 2I4BA 3CFXA 1M5CA 5EYFA 1Y4TA 4TQUQ 2G93A 4IY6A 1B51A 2NOOA 1URDA 4I9DA 2HEUA 4ONYA 1WDNA 4BDNA 4O3AA 4U1ZA 5JK4A 3T66A 2O84X 2E1SA 2X26A 5H8QA 3CSBA 4OVJA 3VDFA 3VVEA 2ZYMA 3CSGA 1B3LA 5IAIA 1O7TA 2PT1A 2XX9A 3U94A 4EQ7A 1DPPA 3OEKA 4XKRA 4QFNA 1M5BA 4GQOA 2QMXA 3R26A 4HW8A 5A5XA 4C1UA 1LBBA 1P99A 1URGA 2Y7RA 3PUXE 3RN8A 5A5XB 4GLIA 4RNSA 1I69A 2OZZA 3FVNA 1BKAA 3HHFA 5I56B 3RGYA 1N7WA 3LSFB 4YKPA 2Q8JA 4EXLA 4KR5A 2I49A 4FATA 3O6HA 1MPCA 3MAMA 4ZE8A 2I0BA 4IGTA 4NWDA 3RT6B 1BLFA 1MH4A 2IA4A 1Q35A 2DXRA 2PYYA 4ISUA 4PE5B 3CR9A 4IO6A 4TLMB 3ZSFA 5ICTA 3G3FA 4OQOA 4IGRA 4THIA 4JSOA 1CE2A 1ZIUA 1MXUA 3K1NA 2A5SA 2B3FA 2Q9TA 4Z0IA 3B6TA 2VD3A 3PU5A 3ILTB 5H8HB 3MC2A 4GIZA 2Q88A 2XXIA 2D3IA 1BIYA 4RPNA 2Z8EA 1VSOA 3P7IA 2ANJA 2RCAA 4GXSB 4EQBA 2ONSA 3CG3A 3SETA 2GFEA 3K1MA 3E3KA 1TXFA 1MY4A 3H3GA 3KJ7A 1A55A 5I56A 4F29A 3E4RA 1EH3A 2X7PA 2XD2A 4OTEA 4IO2A 4OESA 1P1NA 1ZKBA 3O6GA 1LAGE 1MRPA 4F31B 2DE3A 2DE4A 2OLBA 1TFAA 4XKQA 1HSLA 1RKMA 2M8CA 5K2YA 2DVZA 3IO6A 4I8CA 3KSXA 1UTHB 3HPIA 1YTVA 3Q29A 3SERA 4C0RA 5B70A 4YKIA 1LB9A 4OZ9A 1GR2A 1P1UA 2YPNA 3VXBA 1FCKA 2FNCA 2HZLA 2VHAA 3JZJA 3RNNA 1P1WA 3K00A 2ZYKA 5EHMA 1JETA 2ZXTA 3CFLA 4BLAA 4F3SA 3TUSA 2AIXA 3U1OA 2WOPA 3GZGA 3TAJA 3A09A 4QSDA 2QS1A 1QW0A 4NF8A 2QRYA 1N0TA 3RUMA 1ZJLA 2FA7A 3PD8A 4JXIA 4XXUA 4LQ2A 1PDAA 1OQHA 1OQGA 2QL3A 1PEBA 1OLAA 1LFIA 3O6IA 5HM4B 1SW2A 3MP1A 3FASA 3CVGA 5AA3A 1UTHA 3W15C 1SW1A 3OEMA 1I6QA 3FIRA 3JV9A 3TDJA 4OWDA 2V3TA 4X1BA 3S2VA 3RYAA 4L17A 4QFKA 4MBPA 3CI8A 1DPEA 1MS7A 2R9JA 2DE2A 4IY5A 4DLDA 3A3CA 4FJPA 4DCYA 4KD5A 2ESNA 3PPNA 4HTGA 5H8NB 1EZOA 4OXVA 4QFLA 3FV2A 3LR1A 3N94A 1O64A 3H6TA 5H8NA 4AQ4A 5I84A 4ZECA 2AL4A 1B1XA 1H3DA 1Y1ZA 2XXXA 3EF7A 3MP6A 4YZZA 4DXBA 3C33A 4PETA 1FQEA 1IIWA 1N84A 4G4PA 5DVJA 3DLNA 4DZ1A 3TODA 2OJTA 2RCBA 2UVJA 2F36A 1I6BA 3IOUA 1NL5A 1DOTA 4E0XA 2B4LA 4ZEKA 5CBRA 1ELJA 1GVCA 1XS5A 5I2NB 1O63A 1MY2A 1YCJA 1PB8A 1POY1 3MVXA 1MXYA 3TTRA 2XXPA 1A8EA 4KQPA 4GL8A 2Q2AA 3U8QA 4QF9A 1SYIA 3KG2A 3OMBA 3CIJA 1DTZA 3O2AA 4ZZEA 1WODA 2VP1A 3DRGA 1TT1A 2B4MA 3OO8A 2PX1A 3MWBA 3ODBA 2P1SA 3ZKKA 3IX1A 3WAFA 4OERA 1B7ZA 1JW5A 1MDP1 3IJXB 5AA2D 3TTKA 5KDTA 1R9LA 3G3HA 1URSA 2OWTA 2Y7IA 1NKXA 2D21A 2F6GA 3MQ9A 4U2RA 5H8QB 4BDRA 1B58A 3C34A 1R6ZA 3UA8A 1MDQA 4EF2A 1PBPA 5LOMA 3MZ1A 2AL5A 4Z7EA 4H65A 1WVJA 4NF6A 4O3BA 4RK2A 4M4GA 2X7QA 1LAFE 3IL1B 5DYHA 3MP8A 1IXGA 2PBWA 3RT8A 2H5YA 3TPAA 2O68A 4ESWA 2DXYA 4R2FA 4OFLA 1M5EA 4JB7A 3I5OA 4HCWA 4Q8RA 3T93B 3EN3A 3K02A 2WOKA 3KSJA 1AL3A 4O3CA 2XXRA 4OYVA 5TU0A 1MQDA 5I2KB 1SVXB 1FW0A 1FTMA 1XHYA 2P0SA 3C9HA 1IITA 3HHGA 4UA8A 4LZ7A 3A3UA 2QMWA 3E9XA 1A7LA 1UTBB 3DP6A 3D4GA 3HV1A 4JWYA 5H8FB 2QJEA 3PPOA 3G3IA 3L6HA 4G68C 4GWOA 2VD2A 2O7IA 4YB6A 5L9SA 1EU8A 1NNFA 3BFTA 3PGFA 4H8JA 2QS3A 1MQHA 2HAVA 2RC8A 3T9UA 3SEXA 2DWAA 5TPAA 4H0WA 1CB6A 4F1YA 1NNKA 1MXXA 4G68A 4KFQA 3TYHA 1US5A 4YAHX 3PMWA 4MLVA 2HCAA 3PMXA 4GVOA 1GTKA 1US4A 2XXQA 4IO4A 4LONB 4RJZA 4U4SA 1D9VA 3FGSA 3N5LA 3H6VA 2XXYA 4F39A 1B4ZA 2WKYA 4GF8A 4R9FA 5H8SA 5I58B 4PP0A 3V5AA 2R6GE 1XT8A 3OOAA 1II5A 4NE4A 1QKAA 3LVUA 3TELA 3TEPA 2REGA 4XKPA 1IEJA 1N04A 2XX8A 2H9BA 3FXQA 1SYHA 4U23A 3KZGA 5CM6A 3TTLA 5KCJA 2XXTA 1B52A 3IR1A 1B7UA 3O29A 4FECA 4QSEA 4WKMA 4N13A 1SI1A 5EHSA 1FTOA 2Y7PA 4H67A 3QYTA 1B7HA 4G8MA 1JNFA 4UACA 5AA1A 4OEUA 1IXHA 1B2HA 1H43A 4NWCA 4POXA 3CRBA 3TMGA 5DEXA 1UIUA 2H4IA 2XXHA 1HSEA 5HBCA 3SDFA 4OEVA 1MPDA 1QUJA 2Q2CA 3FJ7A 2NXOA 1QULA 1XVXA 4R75A 3QK6A 2UYEA 2RC9A 4RXLA 4ESXA 3ZS6A 1ZU0A 2RINA 1Y3NA 3UGWA 1D9YA 1A40A 2OBGA 3QSLA 5FHOA 2WOLA 5AA2A 1LGBC 4GXAA 1LBCA 3S9LC 3DP8A 3LSLA 4G68B 4G8NA 1IXCA 4KHZE 3OELA 3TTNA 3U72A 5TP9A 4YMAA 1IXIA 2I3VA
chains in the Genus database with same CATH superfamily
4NG7A 3QUJA 2O6AA 3TFLA 4N8YA 4PFTA 2GHAA 3EKIA 1FQBA 4NX1A 1LB8A 1DTGA 3HCQA 3I6VA 3G3JA 4O7MA 2PMSA 2F97A 3FV1A 4K3FA 5B7DA 4F1UA 4ELPA 1NV3A 1IMFA 3DM0A 4OVRA 1JVYA 4QBAA 3TKDA 3QAXA 1BTJA 2XWOA 2F78A 4PFWA 4R6KA 1B5IA 1LCTA 2ONRA 3S9EA 3O6PA 1FTKA 4DXCA 3QIMA 4P0GA 1JEVA 4PGNA 3KBRA 4R72A 1NV7A 4EXKA 4BDLA 2XXWA 1NV6A 2E0SA 1FQDA 1JQFA 2DWJA 4H45A 5JTYA 1P1OA 4HE2A 1FJ6A 3EPEA 3TTMA 5L9OA 3EHUA 3WAEA 1H76A 1N3WA 1AMFA 4XF5A 2O7UA 4TOZA 1SD3A 3IJOB 5FHMA 4BDOA 4GX6A 4PCDA 3EHTA 3W9WA 2BJIA 3U65A 1NV2A 1POTA 4NAPA 3G7WA 1ZLQA 5EQ8A 1ZTYA 2GHBA 2F7AA 1OLCA 2Y84A 3C36A 4PFIA 3RPLB 2REJA 2IEEA 5CBSA 2Z8FA 2THIA 3FJMA 3OO7A 2DSFA 4DXUA 4YB7A 2WX9A 4QFPA 1MQJA 3C35A 3IB1A 5BWJA 4DDDA 2H99A 1NH7A 4FAJA 2XXUA 1B1HA 1LBZA 4KCDA 4F19A 4GWWA 3T9XB 1N7XA 2HXWA 2I6EA 2ZNSA 2V4CA 5H8FA 5KCJB 2QFLA 3GBAA 1MQIA 2RC7A 4LQ5A 4OVSA 5I2NA 3DRIA 2ONKE 3KN3A 4XTCQ 1LFHA 2I48A 4ZE9A 1FQFA 3KEIA 3V89B 4NF0A 1MXZA 4RK9A 1SDXA 4RA1A 1B0HA 3O66A 3HN0A 3KOTA 3K6UA 5DW8A 3KGCA 3UORA 2PT2A 4OMBA 1LEVA 4PAFA 4XIGQ 1FPFA 3Q28A 2ZNTA 1ZMGA 4R6YA 3SEWA 3EQ1A 4LP2B 3H6UA 3TQLA 2Q89A 5FHNA 3M3FA 2W7YA 4YKKA 4OHNA 2F8DA 4R2BA 2CZKA 3FVOA 4R74A 4ELRA 4FIMA 1A54A 3AXFA 3K6VA 2QSXA 4OFJA 1LCFA 3TCGA 3OSRA 1NH8A 5I3SA 1EYKA 1YPNA 3B6QA 1R9QA 3IOVA 4JWXA 2FBPA 4X1DA 1B05A 1D3KA 1EYJA 1VFDA 3MVZA 1DSNA 2OCUA 1M5CA 4TQUQ 2G93A 4IY6A 2FIXA 4ONYA 1VDWA 3T66A 2O84X 5IAIA 1B3LA 3R26A 4HW8A 5A5XB 2Y7RA 4GLIA 4RNSA 5I56B 4PF6A 4KR5A 1MPCA 3MAMA 4ZE8A 4IGTA 1MH4A 2PYYA 3CR9A 2B3FA 3PU5A 3ILTB 2Z8EA 4EQBA 2ONSA 3SETA 3K1MA 2F3DA 1IMCA 1P1NA 1MRPA 2DE3A 2OLBA 1TFAA 4C0RA 1YTVA 4YKIA 4OZ9A 1GR2A 1P1UA 1FCKA 3JZJA 1P1WA 5EHMA 1JETA 2ZXTA 3CFLA 3TUSA 2WOPA 3A09A 2QS1A 1QW0A 4NF8A 1PEBA 2R8TA 4PF8A 4L17A 2Q74A 5ESYA 1CNQA 1DPEA 1MS7A 2DE2A 4OVPA 4DLDA 4DCYA 2ESNA 4HTGA 1EZOA 4OXVA 4AQ4A 5I84A 4ZECA 4MIJA 1B1XA 3EF7A 3DLNA 4DZ1A 3TODA 2OJTA 4MEVA 1I6BA 4E0XA 1NL5A 1DOTA 2B4LA 5CBRA 5I2NB 1YCJA 3D1RA 1POY1 2XWIA 4QF9A 3KG2A 3CIJA 3ODBA 2P1SA 3ZKKA 3WAFA 4NQ8A 1IMDA 1URSA 4BDRA 1B58A 4EF2A 4NF6A 3IL1B 5DYHA 3MYUA 2PBWA 2DXYA 4OFLA 3I5OA 4DI4B 4GBWA 3T93B 5TU0A 3TTRA 3RYDA 5I2KB 1FW0A 1XHYA 3HHGA 3C9HA 3A3UA 1UTBB 3D4GA 3PPOA 3L6HA 4GWOA 2VD2A 2O7IA 5L9SA 2QS3A 3T9UA 5ET6A 1CB6A 1NNKA 1MXXA 4G68A 3TYHA 4RJZA 4LONB 2XXYA 2R6GE 1XT8A 1II5A 4NE4A 1QKAA 3TEPA 1RDYA 1N04A 1AIVA 2XX8A 3KZGA 2WBDA 1YXIA 1B52A 3IR1A 4N13A 1SI1A 1FTOA 3B8BA 5DEXA 1HSEA 3FJ7A 4OVQA 3PTYA 2UYEA 5A5LA 2RC9A 3ZS6A 3UGWA 4PGPA 2WOLA 3E79A 2PCRA 1IXCA 4KHZE 3OELA 4PTKA 5TP9A 4WXJA 3U93A 5CMMA 3D4CA 3FXRA 1XC1A 2O69A 2PFZA 4RPOA 1J1NA 1AOVA 1B3EA 4XEQA 3FATA 4FE8A 3SKPA 5LTCA 1H45A 1B40A 3MSTA 1L5TA 3USDA 1EZ9A 1LAHE 3RTWB 1T0KA 2Z8DA 4QRZA 2OWSA 4BDQA 1RYOA 1FTJA 4MNPA 4PAIA 3VV5A 5H8HA 3FXUA 3ZKLA 4KYDA 3RY3A 4Q0CA 1YAEA 3VLVA 1UQWA 3KJTA 5ELVA 5K2XA 4F3PA 5I7IA 1QVSA 4OENA 4AB6A 1FPIA 3A29A 1USYE 3RYBA 1QUKA 1MM6A 5ISUA 1Y4CA 5M2VA 4H8IA 1OVBA 2VGQA 4PBHA 4QSCA 3S9NC 2BJJX 4ZDMA 3IOWA 5TP9B 4C1TA 2VOZA 4JSDA 2D5WA 2H98A 3EHSA 4NEDA 5ITOA 1LFGA 1MXWA 5DT6A 3LSWA 5JTYB 1JP4A 4JWOA 2V3QA 5AA2B 2CZHA 4KYSA 2DVCA 3K0VA 4P1EA 5KZTA 1MQGA 4IO3A 2B3BA 5IZ1A 2I3WA 4H5GA 4N6PA 3I3VA 4I62A 2ABHA 3MW0A 3H6WA 4N4UA 3THIA 4PQJA 3C4MA 3K4UA 1IZ1A 3B50A 3UK4A 4KI0E 4P47A 1AH5A 1MY1A 5L8DA 4M1VA 3IAZA 5CMBA 3MVWA 2ALUA 3IO4A 4GX3A 2HZKA 4ZEDA 3H03A 4GWSA 1B3HA 4P9KA 4P8BA 2O1LA 3B7DA 1BK4A 3FD3A 2UXAA 3KC0A 3PD9A 4PFRA 4H5FA 3OSQA 4FEDA 1Y1MA 3IOTA 5KDTB 5AA4A 2UVGA 3K01A 3BBRA 5F1QA 2Y7KA 4DCXA 1PC3A 4ELOA 2DOJA 4JDFA 2KR0A 4Q30B 3S9MC 1QUIA 1FPBA 4FORA 3GBBA 1UIVA 3Q27A 2QS4A 3N6TA 3UIFA 3CFZA 4GWXA 3SZPA 3SEYA 2O51A 3T22A 4R9GA 5CMCA 3PUWE 1P1QA 3BIGA 2GH9A 4N07A 4NF4A 1B4HA 1MPBA 1SW4A 1I6AA 3OO6A 3M3KA 4ELQA 3DRHA 1NV0A 2Z22A 4P3LA 4DE8A 2F3BA 3H06B 3O28A 3TZAA 3MZ9A 3ONMA 1NV5A 4PDDA 4DIGA 4I3EA 2DS9A 1M5FA 5F24A 3VLUA 4ZEBA 4NF5B 1A8FA 5IZ3B 2HXRA 1JW1A 1B5JA 5JEIA 4N6DA 3RQTA 4P1LA 1LAXA 4X48A 1GGGA 3RPWA 5DEXB 1S50A 2UVIA 3N26A 1VFEA 3M8UA 2WYPA 1BP5A 2DP8A 5DVIA 4AB5A 2QPQA 1QKBA 2HFBA 2NWJA 4G2ZA 4X9TA 3K6WA 1Y4TA 4I9DA 4U1ZA 5EQ7A 3VVEA 3CSBA 2ZYMA 3CSGA 4JVIA 3U94A 5A5XA 1LBBA 1P99A 1URGA 3RN8A 2OZZA 3HHFA 3RGYA 1N7WA 3LSFB 4YKPA 1FPJA 3RT6B 2XWVA 3G3FA 2OWZA 1CE2A 2A5SA 1FBPA 2VD3A 5H8HB 1IMBA 2Q88A 2D3IA 1VSOA 2RCAA 4GXSB 1A55A 3E4RA 2X7PA 4IO2A 1LAGE 1KA1A 1RKMA 3IO6A 5B70A 3HPIA 3Q29A 1DBZA 3VXBA 3RNNA 4F3SA 3U1OA 3GZGA 4I40A 4MNCA 4QSDA 3RUMA 1ZJLA 4XXUA 5HM4B 1UTHA 3W15C 3FIRA 2Y5KA 4MJOA 4X1BA 3RYAA 4QFKA 4MBPA 4FJPA 4QFLA 1KZ8A 3N94A 5H8NA 4YZZA 4DXBA 1N84A 5DVJA 2RCBA 3IOUA 4N81A 1PB8A 4KQPA 4GL8A 4JVDA 1DTZA 2VP1A 3DRGA 2ZZWA 4MNIA 3IJXB 1JW5A 1MDP1 3TTKA 5KDTA 1R9LA 2OWTA 1INPA 4U2RA 2D21A 2F6GA 4F29A 5LOMA 4H65A 1WVJA 4RK2A 3MP8A 1IXGA 3TPAA 4ESWA 4HCWA 4PC9A 4Q8RA 3EN3A 3KSJA 4O3CA 4UA8A 4JWYA 4G68C 1EU8A 4H8JA 2RC8A 1RDZA 2HAVA 5EYGA 3SEXA 2XWKA 1NV4A 4F1YA 4N8GA 1US5A 4YAHX 4GVOA 4IO4A 4U4SA 1D9VA 4OANA 1B4ZA 2WKYA 5H8SA 5I58B 3OOAA 3LVUA 1FPDA 2REGA 4IR8A 3FXQA 4U23A 3TTLA 2XXTA 2Y7PA 1LBYA 3QYTA 4G8MA 1JNFA 4AS5A 5IZ3A 1UIUA 4GWZA 1FRPA 2Q2CA 1XVXA 3QK6A 4NHBA 2RINA 1A40A 2OBGA 3QSLA 5AA2A 4GXAA 1KA0A 1LBCA 3LSLA 1NUZA 3U72A 1IMAA 1EZPA 5I58A 4LZ8A 5ITPA 1ATGA 4I1DA 1ZBMA 4PFBA 4R6HA 1Y20A 3SEUA 4QHQA 1NMUA 5FTIA 4ZZAA 3IK6B 3JYRA 3HO7A 4MCOA 1USYH 2XD3A 1FJ9A 1B32A 2O1MA 4MAGA 5ET8A 4OFOA 3KN8A 2Z23A 4XKNA 3CG1A 1MXVA 4YKJA 3H4ZA 3MPKA 3QMFA 3FBPA 1NUWA 3IFCA 2OX3A 3TCHA 3LC8A 1SBPA 3VFJA 1MM7A 1HSJA 1G0HA 3KN7A 3OO9A 2F5XA 3T9HB 2KLFA 3LBSA 3KFMA 1PB9A 2QVUA 1LLSA 2ZYNA 2V93A 4ZEFA 3PPQA 3FTOA 1MY3A 4U22A 3PPPA 4ZS9A 4F18A 3NOHA 4TLLB 1IQ7A 2P2AA 2UYFA 4Q5TA 1SQYA 3L6GA 5I59A 4JBZA 1H44A 1FPKA 1KWHA 4EDPA 4N6KA 1M5DA 3E78A 4GL0A 1XVYA 4G8HA 2V84A 2OK2A 4UABA 2GQ1A 3R7XA 5CMKA 4KXPA 4F2QA 4EUOA 3PUYE 2LAOA 4NTLA 2DWHA 2F35A 4PBQA 2FHYA 2V3UA 1VE4A 3K1PA 1QJMA 2RKMA 3TCFA 3O9PA 3B6WA 1MH3A 1K9ZA 4WEPA 1B3GA 5BUUA 3GYYA 3W9VA 3MPLA 2R71A 4G61A 3Q26A 1FPGA 3LUYA 5I59B 3E13X 3PPRA 3VE1B 1B0LA 1SI0A 5I2KA 3R6UA 2GRVA 4U1OA 2F34A 3T96B 2F7BA 3VLWA 4F2OA 3M3LA 1S7YA 3K6XA 3PUXE 2YJPA 3PUVE 2UVHA 1Z7NE 2A5TA 4P11A 4U21A 1OMPA 3O97A 1B9JA 1FQCA 1Y3QA 3RTFB 2L5VA 4FEBA 4RYAA 1UTBA 3LUZA 4GX4A 4PDHA 3BKIB 4OETA 1NI9A 5CI5A 2DYXA 1EYIA 4HCYA 1MY0A 1OVTA 4NF6B 5J1DA 2FYIA 1YYZA 3FZVA 2B65A 1B6HA 3OD7A 1SW5A 3IFAA 2RF1A 5CC2A 4G77A 1Y9UA 4MX6A 3G3GA 4MLQA 3ROJA 3MJNA 2CEYA 1JW4A 4RY1A 4EF1A 3DRJA 4ND9A 4P0IA 4NGUA 4GFRA 1RDXA 1N76A 4H46A 5DTBA 4LN5A 2XHDA 3CHGA 3QXMA 2JJKA 3FVKA 3DRFA 5DVFA 2XX7A 4MHFA 4LUBA 3UN6A 3CFXA 2HPGA 1LBWA 2NOOA 1NUYA 2HEUA 1WDNA 4GWYA 5JK4A 5H8QA 2X26A 2E1SA 4OVJA 3T0JA 4EQ7A 3OEKA 1D9QA 1M5BA 4GQOA 2QMXA 2XXKA 3S9LC 1I69A 5EQ9A 2Q8JA 4EXLA 2I49A 4FATA 3O6HA 4NWDA 2I0BA 1BLFA 1Q35A 5J16A 4PE5B 4OQOA 4IGRA 1ZIUA 3K1NA 1MXUA 2Q9TA 4Z0IA 4N91A 1FBCA 2XXIA 1BIYA 4RPNA 4I3YA 2QVRA 4HE0A 5I56A 4HE1A 4F31B 2DE4A 3ISPA 1HSLA 2DVZA 3KSXA 3RPLA 2YPNA 2FNCA 2HZLA 2VHAA 2ZYKA 2AIXA 2CEXA 3TAJA 2QRYA 4JXIA 1OQHA 1OQGA 1OLAA 3O6IA 1SW2A 3MP1A 3FASA 3CVGA 1SW1A 3OEMA 1I6QA 3JV9A 3TDJA 2R9JA 4IY5A 3PPNA 3FV2A 3LR1A 2XXXA 3MP6A 4PETA 5ET7A 2UVJA 2F36A 4ZEKA 1GVCA 1XS5A 1MY2A 3MVXA 2XXPA 3OMBA 3O2AA 1WODA 2PX1A 3MWBA 4QXDA 2DDKA 5AA2D 4GWUA 2Y7IA 1NKXA 4F39A 5H8QB 1MDQA 2AL5A 4Z7EA 4M4GA 1LAFE 3RT8A 4JB7A 1NV1A 4OYVA 1AL3A 1MQDA 2P0SA 1IITA 4GBVA 4LZ7A 5H8FB 3E9XA 3DP6A 4O7IA 3G3IA 4YB6A 1MQHA 2DWAA 4H0WA 2Q8MA 2HCAA 3PMXA 2XXQA 3N5LA 3H6VA 4GF8A 3V5AA 4XKPA 5CM6A 5KCJA 1LBXA 4FECA 4WKMA 5EHSA 4H67A 5AA1A 4OEUA 1IXHA 1B2HA 5AA3A 4POXA 3CRBA 4X8RA 3TMGA 2XXHA 3SDFA 2XA5A 1FBHA 1QUJA 1YZ0A 4RXLA 4ESXA 1D9YA 2WBBA 3DP8A 4G68B 3TTNA 4YMAA 1IXIA 2I3VA 2ZYOA 1DMBA 1TFDA 4NF5A 4PFYA 1A99A 3BIHA 4F22A 5TPAB 4KPTA 1AWBA 5I57A 1QGXA 1GV8A 5ICQA 1Y3PA 3FVGA 3PAMA 4OA4A 2NVUB 2VPNA 1LSTA 1NFTA 3KOSA 2HQ0A 1PBQA 2HAUA 4X04A 4F1VA 1S9TA 2AYSA 3FUZA 3OENA 3SESA 4PFUA 4MFIA 3PMVA 5EYHA 3KC1A 3S4UA 1ANFA 1VR5A 3H7MA 2QS2A 4YU0A 3PV0E 3MUQA 1IUDA 4IB2A 1NNPA 3LSXA 4U4XA 4MH5A 5AA4B 4YB5A 2Y5LA 1N3XA 1XI6A 5L9MA 3V8XB 4IO7A 3IB2A 4E0WA 5I57B 1FQAA 3G3KA 2HHMA 4O94A 3MBPA 4H1XA 1B46A 5AE4A 2I58A 2I4CA 4QFOA 4LATA 4GD5A 4LZ5A 2ZNUA 3IORA 4ZEIA 1TWYA 1NUXA 1JEUA 2ZMBA 1IMEA 4MF3A 1RYXA 3C32A 4WEDA 3V83A 4O8MA 3U92A 4NMYA 4IO5A 1OIBA 3C31A 4GOTA 3DELB 4N17A 1FPLA 4R73A 2CZLA 3DRKA 5IM2A 1SPIA 4KCCA 3VXCA 3RLFE 1FSAA 3F11A 1Q1KA 4F3GA 2XXVA 3DP4A 2MKZA 1B3FA 4FBPA 2ZZXA 4LVQA 4YICA 2A5TB 2PVUA 1XOCA 1LBVA 5EQAA 2PFYA 2KQZA 1FBFA 5CRYA 3TQWA 3VVDA 4EQ9A 1R1NA 1D4NA 4HS7A 3HSTA 4POWA 5F7VA 3FJGA 1FTLA 5HPQA 2QVVA 3K2DA 2CMOA 3OXNA 3QUFA 3LV0A 4KYEA 3N6UA 3IB0A 3Q25A 2F7CA 5I5PA 2G29A 2VPOA 3ECRA 4F3BA 3BFUA 2DQVA 2DWIA 2F6PA 4H6DA 3GLBA 4NF8B 1Z7ME 2Y7WA 4ECFA 2P3VA 3ILUB 4GRKA 4LA9A 3SEVA 3MZBA 3PUZE 4NF4B 1MG1A 1PB7A 3T9VA 2H25A 5FTHA 5IKBA 1DK4A 3UP9A 2NUVA 2I0CA 2YLNA 1JVXA 3MVYA 1F9BA 3GXAA 2V25A 4DI3D 1B5HA 4YMBA 1NNTA 5FBPA 4XFEA 3VVFA 5IZZA 2I4BA 5EYFA 1B51A 4P56A 1URDA 4BDNA 4O3AA 3VDFA 1O7TA 2PT1A 2XX9A 4N15A 4PAKA 1DPPA 4XKRA 4QFNA 4C1UA 3FVNA 1BKAA 2IA4A 2DXRA 4ISUA 4IO6A 4TLMB 3ZSFA 5ICTA 5IGAA 4THIA 2FIEA 4PE3A 4JSOA 3B6TA 3MC2A 4GIZA 2ZZVA 2CZIA 3P7IA 2ANJA 3CG3A 2GFEA 4MMPA 3E3KA 1TXFA 1MY4A 3H3GA 3KJ7A 1FPEA 1K9YA 1EH3A 3KBZA 2XD2A 4OTEA 4OESA 1ZKBA 3O6GA 5ET5A 1DCUA 4XKQA 2M8CA 5K2YA 4I8CA 3SERA 1UTHB 1LB9A 4BLAA 3K00A 1N0TA 2FA7A 3PD8A 4LQ2A 1PDAA 2QL3A 1LFIA 5LDZA 4OWDA 4AS4A 2V3TA 3HFUA 3S2VA 3CI8A 3FXBA 3A3CA 4KD5A 5H8NB 1O64A 3H6TA 2AL4A 1H3DA 1Y1ZA 3C33A 1FQEA 1IIWA 4G4PA 2P3NA 5T3JA 1ELJA 1O63A 2VT5A 1MXYA 1A8EA 2WEFA 2Q2AA 3U8QA 1SYIA 4ZZEA 1TT1A 2B4MA 3OO8A 3IX1A 4OERA 1B7ZA 3G3HA 3MQ9A 3C34A 1R6ZA 3UA8A 1PBPA 3MZ1A 4O3BA 1FBDA 2X7QA 2H5YA 2O68A 4R2FA 1M5EA 3K02A 2WOKA 4BDMA 2XXRA 1SVXB 1FTMA 1FTAA 1Q9DA 2QMWA 3HV1A 1A7LA 2QJEA 4NN3A 1NNFA 3BFTA 3PGFA 5TPAA 4KFQA 2WYKA 3PMWA 4MLVA 1FBGA 1GTKA 1US4A 3FGSA 4R9FA 4PP0A 3TELA 3T1BA 4OVTA 1IEJA 2H9BA 1SYHA 3O29A 1B7UA 4QSEA 4JVCA 1FBEA 1B7HA 4UACA 4NWCA 1H43A 2H4IA 5HBCA 4OEVA 1MPDA 2NXOA 1QULA 4R75A 1ZU0A 1Y3NA 5FHOA 1LGBC 2FVZA 1G0IA 4G8NA 4HXVA
chains in the Genus database with same CATH topology
4WXJA 3QUJA 2ZYOA 3U93A 5I58A 2O6AA 1EZPA 3TFLA 1DMBA 4LZ8A 5CMMA 5ITPA 1AIVA 1ATGA 4I1DA 3D4CA 3FXRA 4PFTA 1TFDA 1ZBMA 2GHAA 4NF5A 4R6HA 1FQBA 4PFYA 1A99A 1XC1A 1LB8A 1DTGA 1Y20A 3HCQA 3I6VA 2O69A 4QHQA 1NMUA 3G3JA 5FTIA 3SEUA 4F22A 4RPOA 5TPAB 1J1NA 4ZZAA 3IK6B 1AOVA 3JYRA 1B3EA 2PMSA 3HO7A 4KPTA 1USYH 5I57A 3FATA 2F97A 2XD3A 3FV1A 1GV8A 4FE8A 5ICQA 4K3FA 3SKPA 1Y3PA 3FVGA 5B7DA 1H45A 1B32A 1B40A 3PAMA 2O1MA 4F1UA 4OFOA 3KN8A 1L5TA 2Z23A 2NVUB 4ELPA 4XKNA 1LSTA 1MXVA 1NFTA 3CG1A 3DM0A 3H4ZA 1JVYA 3MPKA 4YKJA 3USDA 1EZ9A 3KOSA 1LAHE 3RTWB 2HQ0A 3TKDA 3QAXA 2Z8DA 1T0KA 1BTJA 3TCHA 1PBQA 2F78A 4QRZA 2OWSA 2HAUA 4PFWA 4F1VA 3LC8A 1SBPA 3VFJA 1RYOA 4BDQA 1S9TA 1FTJA 2AYSA 3FUZA 3OENA 4R6KA 3SESA 1MM7A 4PFUA 1B5IA 1HSJA 1LCTA 3VV5A 2ONRA 4MFIA 3S9EA 3PMVA 5H8HA 3FXUA 4BDMA 3ZKLA 4KYDA 3O6PA 3RY3A 4Q0CA 1YAEA 3VLVA 1FTKA 4DXCA 1UQWA 3KJTA 3KN7A 3QIMA 3OO9A 5ELVA 5K2XA 3S4UA 2F5XA 4P0GA 4F3PA 1JEVA 1ANFA 1VR5A 1QVSA 3H7MA 3KBRA 4R72A 3T9HB 2KLFA 2QS2A 4OENA 4YU0A 4AB6A 4EXKA 3LBSA 3PV0E 4BDLA 3KFMA 3MUQA 1IUDA 2XXWA 1PB9A 1USYE 3RYBA 4IB2A 1LLSA 2ZYNA 1QUKA 2V93A 1NNPA 1MM6A 3LSXA 4U4XA 3PPQA 2E0SA 4ZEFA 1FQDA 3FTOA 5ISUA 1JQFA 1MY3A 2DWJA 4U22A 1Y4CA 3PPPA 4ZS9A 5M2VA 4H8IA 1OVBA 4MH5A 4F18A 2VGQA 4YB5A 4TLLB 5AA4B 4QSCA 1IQ7A 2P2AA 2UYFA 4Q5TA 1N3XA 3S9NC 1SQYA 5JTYA 2BJJX 3L6GA 4ZDMA 1P1OA 3IOWA 5L9MA 5TP9B 3V8XB 2VOZA 4C1TA 4JSDA 2D5WA 2H98A 3EHSA 5I59A 3EPEA 4NEDA 3TTMA 5ITOA 4IO7A 1LFGA 4JBZA 5L9OA 1H44A 3IB2A 1MXWA 5DT6A 1KWHA 4E0WA 5I57B 1FQAA 3G3KA 3LSWA 4EDPA 3EHUA 5JTYB 3WAEA 4JWOA 1H76A 1M5DA 1N3WA 2V3QA 5AA2B 1AMFA 4KYSA 2DVCA 3K0VA 4GL0A 1XVYA 5KZTA 2O7UA 4TOZA 3MBPA 1SD3A 1MQGA 3IJOB 4G8HA 4IO3A 5FHMA 2B3BA 2V84A 4H1XA 4BDOA 1B46A 5AE4A 2I58A 2OK2A 2I3WA 4H5GA 4N6PA 2I4CA 3R7XA 3EHTA 3W9WA 3I3VA 5CMKA 4QFOA 4I62A 4F2QA 4LATA 4EUOA 3PUYE 2ABHA 3MW0A 2LAOA 4GD5A 4NTLA 2DWHA 4LZ5A 3T9VA 2F35A 1POTA 2ZNUA 2V3UA 1VE4A 3IORA 4ZEIA 1QJMA 1TWYA 2RKMA 3H6WA 3K1PA 1JEUA 2ZMBA 4PQJA 3C4MA 3K4UA 3THIA 1IZ1A 3TCFA 3O9PA 3B6WA 3G7WA 1ZLQA 1ZTYA 1MH3A 2GHBA 4MF3A 3UK4A 2F7AA 4KI0E 1OLCA 1RYXA 2Y84A 3C36A 3C32A 2REJA 4WEDA 4WEPA 1B3GA 2IEEA 1AH5A 1MY1A 2Z8FA 2THIA 5L8DA 5BUUA 5CBSA 3U92A 3V83A 4M1VA 3FJMA 3IAZA 4NMYA 5CMBA 3MVWA 3OO7A 3W9VA 3MPLA 2ALUA 3IO4A 4IO5A 2HZKA 4ZEDA 1OIBA 2DSFA 2R71A 3C31A 3H03A 3Q26A 4GOTA 4YB7A 4DXUA 4QFPA 1B3HA 3DELB 1MQJA 2O1LA 3C35A 3IB1A 3B7DA 3FD3A 4DDDA 2H99A 5BWJA 2UXAA 1NH7A 4R73A 4FAJA 2CZLA 3LUYA 3E13X 3PPRA 2XXUA 3DRKA 1B1HA 5I59B 3PD9A 4KCCA 3VE1B 1B0LA 1SI0A 4H5FA 4KCDA 3VXCA 3T9XB 4F19A 5I2KA 3OSQA 3R6UA 3RLFE 1N7XA 2GRVA 2HXWA 2I6EA 2ZNSA 4U1OA 2F34A 4FEDA 1Y1MA 2F7BA 3IOTA 3M3LA 3T96B 3VLWA 4F2OA 3F11A 1S7YA 3K6XA 5H8FA 5KCJB 5KDTB 1Q1KA 2UVGA 4F3GA 3GBAA 1MQIA 2RC7A 2XXVA 3DP4A 3K01A 3BBRA 5F1QA 2Y7KA 2YJPA 4LQ5A 3PUVE 4DCXA 1PC3A 4ELOA 5I2NA 3DRIA 2DOJA 1B3FA 2UVHA 4JDFA 2ONKE 4Q30B 3S9MC 1Z7NE 4LVQA 3KN3A 4YICA 1QUIA 2A5TA 2A5TB 4XTCQ 4FORA 2PVUA 1XOCA 4P11A 4U21A 1OMPA 3O97A 3TZAA 1B9JA 3GBBA 1UIVA 1FQCA 1Y3QA 2QS4A 3Q27A 5CRYA 3RTFB 2I48A 3TQWA 3N6TA 4ZE9A 1LFHA 3UIFA 1FQFA 3CFZA 3KEIA 3V89B 3VVDA 4EQ9A 1MXZA 1R1NA 4FEBA 3SEYA 4RK9A 1D4NA 1SDXA 4RA1A 3HSTA 4HS7A 2O51A 4POWA 1B0HA 3FJGA 4RYAA 5F7VA 1FTLA 5HPQA 1UTBA 3T22A 3O66A 3HN0A 3KOTA 3K6UA 3BKIB 3K2DA 2CMOA 4OETA 3KGCA 4R9GA 3OXNA 5CMCA 3PUWE 3UORA 1P1QA 5CI5A 3QUFA 2DYXA 2GH9A 2PT2A 4N07A 4NF4A 4OMBA 1B4HA 1MPBA 1SW4A 4KYEA 1I6AA 3N6UA 3IB0A 3OO6A 2F7CA 3Q25A 4HCYA 3M3KA 4XIGQ 1MY0A 3Q28A 1OVTA 4NF6B 2G29A 5J1DA 2ZNTA 1ZMGA 4R6YA 3SEWA 4ELQA 3EQ1A 2FYIA 3DRHA 3ECRA 4LP2B 3H6UA 3FZVA 2Z22A 3TQLA 4DE8A 2B65A 2Q89A 3H06B 2W7YA 3M3FA 3O28A 4YKKA 5FHNA 4F3BA 3BFUA 1B6HA 2F8DA 3OD7A 3MZ9A 1SW5A 2DQVA 3ONMA 4OHNA 2RF1A 2DWIA 2F6PA 4H6DA 3GLBA 4R2BA 4DIGA 2DS9A 5CC2A 1M5FA 3FVOA 4NF8B 4R74A 1Z7ME 4ELRA 4G77A 4FIMA 1Y9UA 2Y7WA 4ECFA 3VLUA 4ZEBA 1A54A 4NF5B 3AXFA 3K6VA 3ILUB 2QSXA 3G3GA 1A8FA 4GRKA 4OFJA 4MLQA 1LCFA 3TCGA 3MJNA 4LA9A 1JW4A 1JW1A 4RY1A 3SEVA 1B5JA 3MZBA 3OSRA 3PUZE 4NF4B 4EF1A 1MG1A 1NH8A 5JEIA 3DRJA 3RQTA 4X48A 1LAXA 1GGGA 1PB7A 2H25A 1YPNA 4ND9A 3B6QA 5DEXB 1S50A 2UVIA 5FTHA 3RPWA 4P0IA 1R9QA 3N26A 5IKBA 1VFEA 3IOVA 3M8UA 4GFRA 4JWXA 4X1DA 3UP9A 1N76A 1BP5A 2I0CA 2NUVA 1JVXA 2YLNA 3MVYA 1F9BA 5DTBA 3GXAA 1B05A 2DP8A 5DVIA 2QPQA 4AB5A 1D3KA 1QKBA 2HFBA 3CHGA 2V25A 2XHDA 2NWJA 3QXMA 3FVKA 1VFDA 4G2ZA 3DRFA 3MVZA 5DVFA 4X9TA 2XX7A 1DSNA 3K6WA 5AA4A 1B5HA 4YMBA 2OCUA 1NNTA 4LUBA 3UN6A 3VVFA 2I4BA 3CFXA 1M5CA 5EYFA 1Y4TA 4TQUQ 2G93A 4IY6A 1B51A 2NOOA 1URDA 4I9DA 2HEUA 4ONYA 1WDNA 4BDNA 4O3AA 4U1ZA 5JK4A 3T66A 2O84X 2E1SA 2X26A 5H8QA 3CSBA 4OVJA 3VDFA 3VVEA 2ZYMA 3CSGA 1B3LA 5IAIA 1O7TA 2PT1A 2XX9A 3U94A 4EQ7A 1DPPA 3OEKA 4XKRA 4QFNA 1M5BA 4GQOA 2QMXA 3R26A 4HW8A 5A5XA 4C1UA 1LBBA 1P99A 1URGA 2Y7RA 3PUXE 3RN8A 5A5XB 4GLIA 4RNSA 1I69A 2OZZA 3FVNA 1BKAA 3HHFA 5I56B 3RGYA 1N7WA 3LSFB 4YKPA 2Q8JA 4EXLA 4KR5A 2I49A 4FATA 3O6HA 1MPCA 3MAMA 4ZE8A 2I0BA 4IGTA 4NWDA 3RT6B 1BLFA 1MH4A 2IA4A 1Q35A 2DXRA 2PYYA 4ISUA 4PE5B 3CR9A 4IO6A 4TLMB 3ZSFA 5ICTA 3G3FA 4OQOA 4IGRA 4THIA 4JSOA 1CE2A 1ZIUA 1MXUA 3K1NA 2A5SA 2B3FA 2Q9TA 4Z0IA 3B6TA 2VD3A 3PU5A 3ILTB 5H8HB 3MC2A 4GIZA 2Q88A 2XXIA 2D3IA 1BIYA 4RPNA 2Z8EA 1VSOA 3P7IA 2ANJA 2RCAA 4GXSB 4EQBA 2ONSA 3CG3A 3SETA 2GFEA 3K1MA 3E3KA 1TXFA 1MY4A 3H3GA 3KJ7A 1A55A 5I56A 4F29A 3E4RA 1EH3A 2X7PA 2XD2A 4OTEA 4IO2A 4OESA 1P1NA 1ZKBA 3O6GA 1LAGE 1MRPA 4F31B 2DE3A 2DE4A 2OLBA 1TFAA 4XKQA 1HSLA 1RKMA 2M8CA 5K2YA 2DVZA 3IO6A 4I8CA 3KSXA 1UTHB 3HPIA 1YTVA 3Q29A 3SERA 4C0RA 5B70A 4YKIA 1LB9A 4OZ9A 1GR2A 1P1UA 2YPNA 3VXBA 1FCKA 2FNCA 2HZLA 2VHAA 3JZJA 3RNNA 1P1WA 3K00A 2ZYKA 5EHMA 1JETA 2ZXTA 3CFLA 4BLAA 4F3SA 3TUSA 2AIXA 3U1OA 2WOPA 3GZGA 3TAJA 3A09A 4QSDA 2QS1A 1QW0A 4NF8A 2QRYA 1N0TA 3RUMA 1ZJLA 2FA7A 3PD8A 4JXIA 4XXUA 4LQ2A 1PDAA 1OQHA 1OQGA 2QL3A 1PEBA 1OLAA 1LFIA 3O6IA 5HM4B 1SW2A 3MP1A 3FASA 3CVGA 5AA3A 1UTHA 3W15C 1SW1A 3OEMA 1I6QA 3FIRA 3JV9A 3TDJA 4OWDA 2V3TA 4X1BA 3S2VA 3RYAA 4L17A 4QFKA 4MBPA 3CI8A 1DPEA 1MS7A 2R9JA 2DE2A 4IY5A 4DLDA 3A3CA 4FJPA 4DCYA 4KD5A 2ESNA 3PPNA 4HTGA 5H8NB 1EZOA 4OXVA 4QFLA 3FV2A 3LR1A 3N94A 1O64A 3H6TA 5H8NA 4AQ4A 5I84A 4ZECA 2AL4A 1B1XA 1H3DA 1Y1ZA 2XXXA 3EF7A 3MP6A 4YZZA 4DXBA 3C33A 4PETA 1FQEA 1IIWA 1N84A 4G4PA 5DVJA 3DLNA 4DZ1A 3TODA 2OJTA 2RCBA 2UVJA 2F36A 1I6BA 3IOUA 1NL5A 1DOTA 4E0XA 2B4LA 4ZEKA 5CBRA 1ELJA 1GVCA 1XS5A 5I2NB 1O63A 1MY2A 1YCJA 1PB8A 1POY1 3MVXA 1MXYA 3TTRA 2XXPA 1A8EA 4KQPA 4GL8A 2Q2AA 3U8QA 4QF9A 1SYIA 3KG2A 3OMBA 3CIJA 1DTZA 3O2AA 4ZZEA 1WODA 2VP1A 3DRGA 1TT1A 2B4MA 3OO8A 2PX1A 3MWBA 3ODBA 2P1SA 3ZKKA 3IX1A 3WAFA 4OERA 1B7ZA 1JW5A 1MDP1 3IJXB 5AA2D 3TTKA 5KDTA 1R9LA 3G3HA 1URSA 2OWTA 2Y7IA 1NKXA 2D21A 2F6GA 3MQ9A 4U2RA 5H8QB 4BDRA 1B58A 3C34A 1R6ZA 3UA8A 1MDQA 4EF2A 1PBPA 5LOMA 3MZ1A 2AL5A 4Z7EA 4H65A 1WVJA 4NF6A 4O3BA 4RK2A 4M4GA 2X7QA 1LAFE 3IL1B 5DYHA 3MP8A 1IXGA 2PBWA 3RT8A 2H5YA 3TPAA 2O68A 4ESWA 2DXYA 4R2FA 4OFLA 1M5EA 4JB7A 3I5OA 4HCWA 4Q8RA 3T93B 3EN3A 3K02A 2WOKA 3KSJA 1AL3A 4O3CA 2XXRA 4OYVA 5TU0A 1MQDA 5I2KB 1SVXB 1FW0A 1FTMA 1XHYA 2P0SA 3C9HA 1IITA 3HHGA 4UA8A 4LZ7A 3A3UA 2QMWA 3E9XA 1A7LA 1UTBB 3DP6A 3D4GA 3HV1A 4JWYA 5H8FB 2QJEA 3PPOA 3G3IA 3L6HA 4G68C 4GWOA 2VD2A 2O7IA 4YB6A 5L9SA 1EU8A 1NNFA 3BFTA 3PGFA 4H8JA 2QS3A 1MQHA 2HAVA 2RC8A 3T9UA 3SEXA 2DWAA 5TPAA 4H0WA 1CB6A 4F1YA 1NNKA 1MXXA 4G68A 4KFQA 3TYHA 1US5A 4YAHX 3PMWA 4MLVA 2HCAA 3PMXA 4GVOA 1GTKA 1US4A 2XXQA 4IO4A 4LONB 4RJZA 4U4SA 1D9VA 3FGSA 3N5LA 3H6VA 2XXYA 4F39A 1B4ZA 2WKYA 4GF8A 4R9FA 5H8SA 5I58B 4PP0A 3V5AA 2R6GE 1XT8A 3OOAA 1II5A 4NE4A 1QKAA 3LVUA 3TELA 3TEPA 2REGA 4XKPA 1IEJA 1N04A 2XX8A 2H9BA 3FXQA 1SYHA 4U23A 3KZGA 5CM6A 3TTLA 5KCJA 2XXTA 1B52A 3IR1A 1B7UA 3O29A 4FECA 4QSEA 4WKMA 4N13A 1SI1A 5EHSA 1FTOA 2Y7PA 4H67A 3QYTA 1B7HA 4G8MA 1JNFA 4UACA 5AA1A 4OEUA 1IXHA 1B2HA 1H43A 4NWCA 4POXA 3CRBA 3TMGA 5DEXA 1UIUA 2H4IA 2XXHA 1HSEA 5HBCA 3SDFA 4OEVA 1MPDA 1QUJA 2Q2CA 3FJ7A 2NXOA 1QULA 1XVXA 4R75A 3QK6A 2UYEA 2RC9A 4RXLA 4ESXA 3ZS6A 1ZU0A 2RINA 1Y3NA 3UGWA 1D9YA 1A40A 2OBGA 3QSLA 5FHOA 2WOLA 5AA2A 1LGBC 4GXAA 1LBCA 3S9LC 3DP8A 3LSLA 4G68B 4G8NA 1IXCA 4KHZE 3OELA 3TTNA 3U72A 5TP9A 4YMAA 1IXIA 2I3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WXJ A;  3QUJ A;  2ZYO A;  3U93 A;  5I58 A;  2O6A A;  1EZP A;  3TFL A;  1DMB A;  4LZ8 A;  5CMM A;  5ITP A;  1AIV A;  1ATG A;  4I1D A;  3D4C A;  3FXR A;  4PFT A;  1TFD A;  1ZBM A;  2GHA A;  4NF5 A;  4R6H A;  1FQB A;  4PFY A;  1A99 A;  1XC1 A;  1LB8 A;  1DTG A;  1Y20 A;  3HCQ A;  3I6V A;  2O69 A;  4QHQ A;  1NMU A;  3G3J A;  5FTI A;  3SEU A;  4F22 A;  4RPO A;  5TPA B;  1J1N A;  4ZZA A;  3IK6 B;  1AOV A;  3JYR A;  1B3E A;  2PMS A;  3HO7 A;  4KPT A;  1USY H;  5I57 A;  3FAT A;  2F97 A;  2XD3 A;  3FV1 A;  1GV8 A;  4FE8 A;  5ICQ A;  4K3F A;  3SKP A;  1Y3P A;  3FVG A;  5B7D A;  1H45 A;  1B32 A;  1B40 A;  3PAM A;  2O1M A;  4F1U A;  4OFO A;  3KN8 A;  1L5T A;  2Z23 A;  2NVU B;  4ELP A;  4XKN A;  1LST A;  1MXV A;  1NFT A;  3CG1 A;  3DM0 A;  3H4Z A;  1JVY A;  3MPK A;  4YKJ A;  3USD A;  1EZ9 A;  3KOS A;  1LAH E;  3RTW B;  2HQ0 A;  3TKD A;  3QAX A;  2Z8D A;  1T0K A;  1BTJ A;  3TCH A;  1PBQ A;  2F78 A;  4QRZ A;  2OWS A;  2HAU A;  4PFW A;  4F1V A;  3LC8 A;  1SBP A;  3VFJ A;  1RYO A;  4BDQ A;  1S9T A;  1FTJ A;  2AYS A;  3FUZ A;  3OEN A;  4R6K A;  3SES A;  1MM7 A;  4PFU A;  1B5I A;  1HSJ A;  1LCT A;  3VV5 A;  2ONR A;  4MFI A;  3S9E A;  3PMV A;  5H8H A;  3FXU A;  4BDM A;  3ZKL A;  4KYD A;  3O6P A;  3RY3 A;  4Q0C A;  1YAE A;  3VLV A;  1FTK A;  4DXC A;  1UQW A;  3KJT A;  3KN7 A;  3QIM A;  3OO9 A;  5ELV A;  5K2X A;  3S4U A;  2F5X A;  4P0G A;  4F3P A;  1JEV A;  1ANF A;  1VR5 A;  1QVS A;  3H7M A;  3KBR A;  4R72 A;  3T9H B;  2KLF A;  2QS2 A;  4OEN A;  4YU0 A;  4AB6 A;  4EXK A;  3LBS A;  3PV0 E;  4BDL A;  3KFM A;  3MUQ A;  1IUD A;  2XXW A;  1PB9 A;  1USY E;  3RYB A;  4IB2 A;  1LLS A;  2ZYN A;  1QUK A;  2V93 A;  1NNP A;  1MM6 A;  3LSX A;  4U4X A;  3PPQ A;  2E0S A;  4ZEF A;  1FQD A;  3FTO A;  5ISU A;  1JQF A;  1MY3 A;  2DWJ A;  4U22 A;  1Y4C A;  3PPP A;  4ZS9 A;  5M2V A;  4H8I A;  1OVB A;  4MH5 A;  4F18 A;  2VGQ A;  4YB5 A;  4TLL B;  5AA4 B;  4QSC A;  1IQ7 A;  2P2A A;  2UYF A;  4Q5T A;  1N3X A;  3S9N C;  1SQY A;  5JTY A;  2BJJ X;  3L6G A;  4ZDM A;  1P1O A;  3IOW A;  5L9M A;  5TP9 B;  3V8X B;  2VOZ A;  4C1T A;  4JSD A;  2D5W A;  2H98 A;  3EHS A;  5I59 A;  3EPE A;  4NED A;  3TTM A;  5ITO A;  4IO7 A;  1LFG A;  4JBZ A;  5L9O A;  1H44 A;  3IB2 A;  1MXW A;  5DT6 A;  1KWH A;  4E0W A;  5I57 B;  1FQA A;  3G3K A;  3LSW A;  4EDP A;  3EHU A;  5JTY B;  3WAE A;  4JWO A;  1H76 A;  1M5D A;  1N3W A;  2V3Q A;  5AA2 B;  1AMF A;  4KYS A;  2DVC A;  3K0V A;  4GL0 A;  1XVY A;  5KZT A;  2O7U A;  4TOZ A;  3MBP A;  1SD3 A;  1MQG A;  3IJO B;  4G8H A;  4IO3 A;  5FHM A;  2B3B A;  2V84 A;  4H1X A;  4BDO A;  1B46 A;  5AE4 A;  2I58 A;  2OK2 A;  2I3W A;  4H5G A;  4N6P A;  2I4C A;  3R7X A;  3EHT A;  3W9W A;  3I3V A;  5CMK A;  4QFO A;  4I62 A;  4F2Q A;  4LAT A;  4EUO A;  3PUY E;  2ABH A;  3MW0 A;  2LAO A;  4GD5 A;  4NTL A;  2DWH A;  4LZ5 A;  3T9V A;  2F35 A;  1POT A;  2ZNU A;  2V3U A;  1VE4 A;  3IOR A;  4ZEI A;  1QJM A;  1TWY A;  2RKM A;  3H6W A;  3K1P A;  1JEU A;  2ZMB A;  4PQJ A;  3C4M A;  3K4U A;  3THI A;  1IZ1 A;  3TCF A;  3O9P A;  3B6W A;  3G7W A;  1ZLQ A;  1ZTY A;  1MH3 A;  2GHB A;  4MF3 A;  3UK4 A;  2F7A A;  4KI0 E;  1OLC A;  1RYX A;  2Y84 A;  3C36 A;  3C32 A;  2REJ A;  4WED A;  4WEP A;  1B3G A;  2IEE A;  1AH5 A;  1MY1 A;  2Z8F A;  2THI A;  5L8D A;  5BUU A;  5CBS A;  3U92 A;  3V83 A;  4M1V A;  3FJM A;  3IAZ A;  4NMY A;  5CMB A;  3MVW A;  3OO7 A;  3W9V A;  3MPL A;  2ALU A;  3IO4 A;  4IO5 A;  2HZK A;  4ZED A;  1OIB A;  2DSF A;  2R71 A;  3C31 A;  3H03 A;  3Q26 A;  4GOT A;  4YB7 A;  4DXU A;  4QFP A;  1B3H A;  3DEL B;  1MQJ A;  2O1L A;  3C35 A;  3IB1 A;  3B7D A;  3FD3 A;  4DDD A;  2H99 A;  5BWJ A;  2UXA A;  1NH7 A;  4R73 A;  4FAJ A;  2CZL A;  3LUY A;  3E13 X;  3PPR A;  2XXU A;  3DRK A;  1B1H A;  5I59 B;  3PD9 A;  4KCC A;  3VE1 B;  1B0L A;  1SI0 A;  4H5F A;  4KCD A;  3VXC A;  3T9X B;  4F19 A;  5I2K A;  3OSQ A;  3R6U A;  3RLF E;  1N7X A;  2GRV A;  2HXW A;  2I6E A;  2ZNS A;  4U1O A;  2F34 A;  4FED A;  1Y1M A;  2F7B A;  3IOT A;  3M3L A;  3T96 B;  3VLW A;  4F2O A;  3F11 A;  1S7Y A;  3K6X A;  5H8F A;  5KCJ B;  5KDT B;  1Q1K A;  2UVG A;  4F3G A;  3GBA A;  1MQI A;  2RC7 A;  2XXV A;  3DP4 A;  3K01 A;  3BBR A;  5F1Q A;  2Y7K A;  2YJP A;  4LQ5 A;  3PUV E;  4DCX A;  1PC3 A;  4ELO A;  5I2N A;  3DRI A;  2DOJ A;  1B3F A;  2UVH A;  4JDF A;  2ONK E;  4Q30 B;  3S9M C;  1Z7N E;  4LVQ A;  3KN3 A;  4YIC A;  1QUI A;  2A5T A;  2A5T B;  4XTC Q;  4FOR A;  2PVU A;  1XOC A;  4P11 A;  4U21 A;  1OMP A;  3O97 A;  3TZA A;  1B9J A;  3GBB A;  1UIV A;  1FQC A;  1Y3Q A;  2QS4 A;  3Q27 A;  5CRY A;  3RTF B;  2I48 A;  3TQW A;  3N6T A;  4ZE9 A;  1LFH A;  3UIF A;  1FQF A;  3CFZ A;  3KEI A;  3V89 B;  3VVD A;  4EQ9 A;  1MXZ A;  1R1N A;  4FEB A;  3SEY A;  4RK9 A;  1D4N A;  1SDX A;  4RA1 A;  3HST A;  4HS7 A;  2O51 A;  4POW A;  1B0H A;  3FJG A;  4RYA A;  5F7V A;  1FTL A;  5HPQ A;  1UTB A;  3T22 A;  3O66 A;  3HN0 A;  3KOT A;  3K6U A;  3BKI B;  3K2D A;  2CMO A;  4OET A;  3KGC A;  4R9G A;  3OXN A;  5CMC A;  3PUW E;  3UOR A;  1P1Q A;  5CI5 A;  3QUF A;  2DYX A;  2GH9 A;  2PT2 A;  4N07 A;  4NF4 A;  4OMB A;  1B4H A;  1MPB A;  1SW4 A;  4KYE A;  1I6A A;  3N6U A;  3IB0 A;  3OO6 A;  2F7C A;  3Q25 A;  4HCY A;  3M3K A;  4XIG Q;  1MY0 A;  3Q28 A;  1OVT A;  4NF6 B;  2G29 A;  5J1D A;  2ZNT A;  1ZMG A;  4R6Y A;  3SEW A;  4ELQ A;  3EQ1 A;  2FYI A;  3DRH A;  3ECR A;  4LP2 B;  3H6U A;  3FZV A;  2Z22 A;  3TQL A;  4DE8 A;  2B65 A;  2Q89 A;  3H06 B;  2W7Y A;  3M3F A;  3O28 A;  4YKK A;  5FHN A;  4F3B A;  3BFU A;  1B6H A;  2F8D A;  3OD7 A;  3MZ9 A;  1SW5 A;  2DQV A;  3ONM A;  4OHN A;  2RF1 A;  2DWI A;  2F6P A;  4H6D A;  3GLB A;  4R2B A;  4DIG A;  2DS9 A;  5CC2 A;  1M5F A;  3FVO A;  4NF8 B;  4R74 A;  1Z7M E;  4ELR A;  4G77 A;  4FIM A;  1Y9U A;  2Y7W A;  4ECF A;  3VLU A;  4ZEB A;  1A54 A;  4NF5 B;  3AXF A;  3K6V A;  3ILU B;  2QSX A;  3G3G A;  1A8F A;  4GRK A;  4OFJ A;  4MLQ A;  1LCF A;  3TCG A;  3MJN A;  4LA9 A;  1JW4 A;  1JW1 A;  4RY1 A;  3SEV A;  1B5J A;  3MZB A;  3OSR A;  3PUZ E;  4NF4 B;  4EF1 A;  1MG1 A;  1NH8 A;  5JEI A;  3DRJ A;  3RQT A;  4X48 A;  1LAX A;  1GGG A;  1PB7 A;  2H25 A;  1YPN A;  4ND9 A;  3B6Q A;  5DEX B;  1S50 A;  2UVI A;  5FTH A;  3RPW A;  4P0I A;  1R9Q A;  3N26 A;  5IKB A;  1VFE A;  3IOV A;  3M8U A;  4GFR A;  4JWX A;  4X1D A;  3UP9 A;  1N76 A;  1BP5 A;  2I0C A;  2NUV A;  1JVX A;  2YLN A;  3MVY A;  1F9B A;  5DTB A;  3GXA A;  1B05 A;  2DP8 A;  5DVI A;  2QPQ A;  4AB5 A;  1D3K A;  1QKB A;  2HFB A;  3CHG A;  2V25 A;  2XHD A;  2NWJ A;  3QXM A;  3FVK A;  1VFD A;  4G2Z A;  3DRF A;  3MVZ A;  5DVF A;  4X9T A;  2XX7 A;  1DSN A;  3K6W A;  5AA4 A;  1B5H A;  4YMB A;  2OCU A;  1NNT A;  4LUB A;  3UN6 A;  3VVF A;  2I4B A;  3CFX A;  1M5C A;  5EYF A;  1Y4T A;  4TQU Q;  2G93 A;  4IY6 A;  1B51 A;  2NOO A;  1URD A;  4I9D A;  2HEU A;  4ONY A;  1WDN A;  4BDN A;  4O3A A;  4U1Z A;  5JK4 A;  3T66 A;  2O84 X;  2E1S A;  2X26 A;  5H8Q A;  3CSB A;  4OVJ A;  3VDF A;  3VVE A;  2ZYM A;  3CSG A;  1B3L A;  5IAI A;  1O7T A;  2PT1 A;  2XX9 A;  3U94 A;  4EQ7 A;  1DPP A;  3OEK A;  4XKR A;  4QFN A;  1M5B A;  4GQO A;  2QMX A;  3R26 A;  4HW8 A;  5A5X A;  4C1U A;  1LBB A;  1P99 A;  1URG A;  2Y7R A;  3PUX E;  3RN8 A;  5A5X B;  4GLI A;  4RNS A;  1I69 A;  2OZZ A;  3FVN A;  1BKA A;  3HHF A;  5I56 B;  3RGY A;  1N7W A;  3LSF B;  4YKP A;  2Q8J A;  4EXL A;  4KR5 A;  2I49 A;  4FAT A;  3O6H A;  1MPC A;  3MAM A;  4ZE8 A;  2I0B A;  4IGT A;  4NWD A;  3RT6 B;  1BLF A;  1MH4 A;  2IA4 A;  1Q35 A;  2DXR A;  2PYY A;  4ISU A;  4PE5 B;  3CR9 A;  4IO6 A;  4TLM B;  3ZSF A;  5ICT A;  3G3F A;  4OQO A;  4IGR A;  4THI A;  4JSO A;  1CE2 A;  1ZIU A;  1MXU A;  3K1N A;  2A5S A;  2B3F A;  2Q9T A;  4Z0I A;  3B6T A;  2VD3 A;  3PU5 A;  3ILT B;  5H8H B;  3MC2 A;  4GIZ A;  2Q88 A;  2XXI A;  2D3I A;  1BIY A;  4RPN A;  2Z8E A;  1VSO A;  3P7I A;  2ANJ A;  2RCA A;  4GXS B;  4EQB A;  2ONS A;  3CG3 A;  3SET A;  2GFE A;  3K1M A;  3E3K A;  1TXF A;  1MY4 A;  3H3G A;  3KJ7 A;  1A55 A;  5I56 A;  4F29 A;  3E4R A;  1EH3 A;  2X7P A;  2XD2 A;  4OTE A;  4IO2 A;  4OES A;  1P1N A;  1ZKB A;  3O6G A;  1LAG E;  1MRP A;  4F31 B;  2DE3 A;  2DE4 A;  2OLB A;  1TFA A;  4XKQ A;  1HSL A;  1RKM A;  2M8C A;  5K2Y A;  2DVZ A;  3IO6 A;  4I8C A;  3KSX A;  1UTH B;  3HPI A;  1YTV A;  3Q29 A;  3SER A;  4C0R A;  5B70 A;  4YKI A;  1LB9 A;  4OZ9 A;  1GR2 A;  1P1U A;  2YPN A;  3VXB A;  1FCK A;  2FNC A;  2HZL A;  2VHA A;  3JZJ A;  3RNN A;  1P1W A;  3K00 A;  2ZYK A;  5EHM A;  1JET A;  2ZXT A;  3CFL A;  4BLA A;  4F3S A;  3TUS A;  2AIX A;  3U1O A;  2WOP A;  3GZG A;  3TAJ A;  3A09 A;  4QSD A;  2QS1 A;  1QW0 A;  4NF8 A;  2QRY A;  1N0T A;  3RUM A;  1ZJL A;  2FA7 A;  3PD8 A;  4JXI A;  4XXU A;  4LQ2 A;  1PDA A;  1OQH A;  1OQG A;  2QL3 A;  1PEB A;  1OLA A;  1LFI A;  3O6I A;  5HM4 B;  1SW2 A;  3MP1 A;  3FAS A;  3CVG A;  5AA3 A;  1UTH A;  3W15 C;  1SW1 A;  3OEM A;  1I6Q A;  3FIR A;  3JV9 A;  3TDJ A;  4OWD A;  2V3T A;  4X1B A;  3S2V A;  3RYA A;  4L17 A;  4QFK A;  4MBP A;  3CI8 A;  1DPE A;  1MS7 A;  2R9J A;  2DE2 A;  4IY5 A;  4DLD A;  3A3C A;  4FJP A;  4DCY A;  4KD5 A;  2ESN A;  3PPN A;  4HTG A;  5H8N B;  1EZO A;  4OXV A;  4QFL A;  3FV2 A;  3LR1 A;  3N94 A;  1O64 A;  3H6T A;  5H8N A;  4AQ4 A;  5I84 A;  4ZEC A;  2AL4 A;  1B1X A;  1H3D A;  1Y1Z A;  2XXX A;  3EF7 A;  3MP6 A;  4YZZ A;  4DXB A;  3C33 A;  4PET A;  1FQE A;  1IIW A;  1N84 A;  4G4P A;  5DVJ A;  3DLN A;  4DZ1 A;  3TOD A;  2OJT A;  2RCB A;  2UVJ A;  2F36 A;  1I6B A;  3IOU A;  1NL5 A;  1DOT A;  4E0X A;  2B4L A;  4ZEK A;  5CBR A;  1ELJ A;  1GVC A;  1XS5 A;  5I2N B;  1O63 A;  1MY2 A;  1YCJ A;  1PB8 A;  1POY 1;  3MVX A;  1MXY A;  3TTR A;  2XXP A;  1A8E A;  4KQP A;  4GL8 A;  2Q2A A;  3U8Q A;  4QF9 A;  1SYI A;  3KG2 A;  3OMB A;  3CIJ A;  1DTZ A;  3O2A A;  4ZZE A;  1WOD A;  2VP1 A;  3DRG A;  1TT1 A;  2B4M A;  3OO8 A;  2PX1 A;  3MWB A;  3ODB A;  2P1S A;  3ZKK A;  3IX1 A;  3WAF A;  4OER A;  1B7Z A;  1JW5 A;  1MDP 1;  3IJX B;  5AA2 D;  3TTK A;  5KDT A;  1R9L A;  3G3H A;  1URS A;  2OWT A;  2Y7I A;  1NKX A;  2D21 A;  2F6G A;  3MQ9 A;  4U2R A;  5H8Q B;  4BDR A;  1B58 A;  3C34 A;  1R6Z A;  3UA8 A;  1MDQ A;  4EF2 A;  1PBP A;  5LOM A;  3MZ1 A;  2AL5 A;  4Z7E A;  4H65 A;  1WVJ A;  4NF6 A;  4O3B A;  4RK2 A;  4M4G A;  2X7Q A;  1LAF E;  3IL1 B;  5DYH A;  3MP8 A;  1IXG A;  2PBW A;  3RT8 A;  2H5Y A;  3TPA A;  2O68 A;  4ESW A;  2DXY A;  4R2F A;  4OFL A;  1M5E A;  4JB7 A;  3I5O A;  4HCW A;  4Q8R A;  3T93 B;  3EN3 A;  3K02 A;  2WOK A;  3KSJ A;  1AL3 A;  4O3C A;  2XXR A;  4OYV A;  5TU0 A;  1MQD A;  5I2K B;  1SVX B;  1FW0 A;  1FTM A;  1XHY A;  2P0S A;  3C9H A;  1IIT A;  3HHG A;  4UA8 A;  4LZ7 A;  3A3U A;  2QMW A;  3E9X A;  1A7L A;  1UTB B;  3DP6 A;  3D4G A;  3HV1 A;  4JWY A;  5H8F B;  2QJE A;  3PPO A;  3G3I A;  3L6H A;  4G68 C;  4GWO A;  2VD2 A;  2O7I A;  4YB6 A;  5L9S A;  1EU8 A;  1NNF A;  3BFT A;  3PGF A;  4H8J A;  2QS3 A;  1MQH A;  2HAV A;  2RC8 A;  3T9U A;  3SEX A;  2DWA A;  5TPA A;  4H0W A;  1CB6 A;  4F1Y A;  1NNK A;  1MXX A;  4G68 A;  4KFQ A;  3TYH A;  1US5 A;  4YAH X;  3PMW A;  4MLV A;  2HCA A;  3PMX A;  4GVO A;  1GTK A;  1US4 A;  2XXQ A;  4IO4 A;  4LON B;  4RJZ A;  4U4S A;  1D9V A;  3FGS A;  3N5L A;  3H6V A;  2XXY A;  4F39 A;  1B4Z A;  2WKY A;  4GF8 A;  4R9F A;  5H8S A;  5I58 B;  4PP0 A;  3V5A A;  2R6G E;  1XT8 A;  3OOA A;  1II5 A;  4NE4 A;  1QKA A;  3LVU A;  3TEL A;  3TEP A;  2REG A;  4XKP A;  1IEJ A;  1N04 A;  2XX8 A;  2H9B A;  3FXQ A;  1SYH A;  4U23 A;  3KZG A;  5CM6 A;  3TTL A;  5KCJ A;  2XXT A;  1B52 A;  3IR1 A;  1B7U A;  3O29 A;  4FEC A;  4QSE A;  4WKM A;  4N13 A;  1SI1 A;  5EHS A;  1FTO A;  2Y7P A;  4H67 A;  3QYT A;  1B7H A;  4G8M A;  1JNF A;  4UAC A;  5AA1 A;  4OEU A;  1IXH A;  1B2H A;  1H43 A;  4NWC A;  4POX A;  3CRB A;  3TMG A;  5DEX A;  1UIU A;  2H4I A;  2XXH A;  1HSE A;  5HBC A;  3SDF A;  4OEV A;  1MPD A;  1QUJ A;  2Q2C A;  3FJ7 A;  2NXO A;  1QUL A;  1XVX A;  4R75 A;  3QK6 A;  2UYE A;  2RC9 A;  4RXL A;  4ESX A;  3ZS6 A;  1ZU0 A;  2RIN A;  1Y3N A;  3UGW A;  1D9Y A;  1A40 A;  2OBG A;  3QSL A;  5FHO A;  2WOL A;  5AA2 A;  1LGB C;  4GXA A;  1LBC A;  3S9L C;  3DP8 A;  3LSL A;  4G68 B;  4G8N A;  1IXC A;  4KHZ E;  3OEL A;  3TTN A;  3U72 A;  5TP9 A;  4YMA A;  1IXI A;  2I3V A; 
#chains in the Genus database with same CATH topology
 4NG7 A;  3QUJ A;  2O6A A;  3TFL A;  4N8Y A;  4PFT A;  2GHA A;  3EKI A;  1FQB A;  4NX1 A;  1LB8 A;  1DTG A;  3HCQ A;  3I6V A;  3G3J A;  4O7M A;  2PMS A;  2F97 A;  3FV1 A;  4K3F A;  5B7D A;  4F1U A;  4ELP A;  1NV3 A;  1IMF A;  3DM0 A;  4OVR A;  1JVY A;  4QBA A;  3TKD A;  3QAX A;  1BTJ A;  2XWO A;  2F78 A;  4PFW A;  4R6K A;  1B5I A;  1LCT A;  2ONR A;  3S9E A;  3O6P A;  1FTK A;  4DXC A;  3QIM A;  4P0G A;  1JEV A;  4PGN A;  3KBR A;  4R72 A;  1NV7 A;  4EXK A;  4BDL A;  2XXW A;  1NV6 A;  2E0S A;  1FQD A;  1JQF A;  2DWJ A;  4H45 A;  5JTY A;  1P1O A;  4HE2 A;  1FJ6 A;  3EPE A;  3TTM A;  5L9O A;  3EHU A;  3WAE A;  1H76 A;  1N3W A;  1AMF A;  4XF5 A;  2O7U A;  4TOZ A;  1SD3 A;  3IJO B;  5FHM A;  4BDO A;  4GX6 A;  4PCD A;  3EHT A;  3W9W A;  2BJI A;  3U65 A;  1NV2 A;  1POT A;  4NAP A;  3G7W A;  1ZLQ A;  5EQ8 A;  1ZTY A;  2GHB A;  2F7A A;  1OLC A;  2Y84 A;  3C36 A;  4PFI A;  3RPL B;  2REJ A;  2IEE A;  5CBS A;  2Z8F A;  2THI A;  3FJM A;  3OO7 A;  2DSF A;  4DXU A;  4YB7 A;  2WX9 A;  4QFP A;  1MQJ A;  3C35 A;  3IB1 A;  5BWJ A;  4DDD A;  2H99 A;  1NH7 A;  4FAJ A;  2XXU A;  1B1H A;  1LBZ A;  4KCD A;  4F19 A;  4GWW A;  3T9X B;  1N7X A;  2HXW A;  2I6E A;  2ZNS A;  2V4C A;  5H8F A;  5KCJ B;  2QFL A;  3GBA A;  1MQI A;  2RC7 A;  4LQ5 A;  4OVS A;  5I2N A;  3DRI A;  2ONK E;  3KN3 A;  4XTC Q;  1LFH A;  2I48 A;  4ZE9 A;  1FQF A;  3KEI A;  3V89 B;  4NF0 A;  1MXZ A;  4RK9 A;  1SDX A;  4RA1 A;  1B0H A;  3O66 A;  3HN0 A;  3KOT A;  3K6U A;  5DW8 A;  3KGC A;  3UOR A;  2PT2 A;  4OMB A;  1LEV A;  4PAF A;  4XIG Q;  1FPF A;  3Q28 A;  2ZNT A;  1ZMG A;  4R6Y A;  3SEW A;  3EQ1 A;  4LP2 B;  3H6U A;  3TQL A;  2Q89 A;  5FHN A;  3M3F A;  2W7Y A;  4YKK A;  4OHN A;  2F8D A;  4R2B A;  2CZK A;  3FVO A;  4R74 A;  4ELR A;  4FIM A;  1A54 A;  3AXF A;  3K6V A;  2QSX A;  4OFJ A;  1LCF A;  3TCG A;  3OSR A;  1NH8 A;  5I3S A;  1EYK A;  1YPN A;  3B6Q A;  1R9Q A;  3IOV A;  4JWX A;  2FBP A;  4X1D A;  1B05 A;  1D3K A;  1EYJ A;  1VFD A;  3MVZ A;  1DSN A;  2OCU A;  1M5C A;  4TQU Q;  2G93 A;  4IY6 A;  2FIX A;  4ONY A;  1VDW A;  3T66 A;  2O84 X;  5IAI A;  1B3L A;  3R26 A;  4HW8 A;  5A5X B;  2Y7R A;  4GLI A;  4RNS A;  5I56 B;  4PF6 A;  4KR5 A;  1MPC A;  3MAM A;  4ZE8 A;  4IGT A;  1MH4 A;  2PYY A;  3CR9 A;  2B3F A;  3PU5 A;  3ILT B;  2Z8E A;  4EQB A;  2ONS A;  3SET A;  3K1M A;  2F3D A;  1IMC A;  1P1N A;  1MRP A;  2DE3 A;  2OLB A;  1TFA A;  4C0R A;  1YTV A;  4YKI A;  4OZ9 A;  1GR2 A;  1P1U A;  1FCK A;  3JZJ A;  1P1W A;  5EHM A;  1JET A;  2ZXT A;  3CFL A;  3TUS A;  2WOP A;  3A09 A;  2QS1 A;  1QW0 A;  4NF8 A;  1PEB A;  2R8T A;  4PF8 A;  4L17 A;  2Q74 A;  5ESY A;  1CNQ A;  1DPE A;  1MS7 A;  2DE2 A;  4OVP A;  4DLD A;  4DCY A;  2ESN A;  4HTG A;  1EZO A;  4OXV A;  4AQ4 A;  5I84 A;  4ZEC A;  4MIJ A;  1B1X A;  3EF7 A;  3DLN A;  4DZ1 A;  3TOD A;  2OJT A;  4MEV A;  1I6B A;  4E0X A;  1NL5 A;  1DOT A;  2B4L A;  5CBR A;  5I2N B;  1YCJ A;  3D1R A;  1POY 1;  2XWI A;  4QF9 A;  3KG2 A;  3CIJ A;  3ODB A;  2P1S A;  3ZKK A;  3WAF A;  4NQ8 A;  1IMD A;  1URS A;  4BDR A;  1B58 A;  4EF2 A;  4NF6 A;  3IL1 B;  5DYH A;  3MYU A;  2PBW A;  2DXY A;  4OFL A;  3I5O A;  4DI4 B;  4GBW A;  3T93 B;  5TU0 A;  3TTR A;  3RYD A;  5I2K B;  1FW0 A;  1XHY A;  3HHG A;  3C9H A;  3A3U A;  1UTB B;  3D4G A;  3PPO A;  3L6H A;  4GWO A;  2VD2 A;  2O7I A;  5L9S A;  2QS3 A;  3T9U A;  5ET6 A;  1CB6 A;  1NNK A;  1MXX A;  4G68 A;  3TYH A;  4RJZ A;  4LON B;  2XXY A;  2R6G E;  1XT8 A;  1II5 A;  4NE4 A;  1QKA A;  3TEP A;  1RDY A;  1N04 A;  1AIV A;  2XX8 A;  3KZG A;  2WBD A;  1YXI A;  1B52 A;  3IR1 A;  4N13 A;  1SI1 A;  1FTO A;  3B8B A;  5DEX A;  1HSE A;  3FJ7 A;  4OVQ A;  3PTY A;  2UYE A;  5A5L A;  2RC9 A;  3ZS6 A;  3UGW A;  4PGP A;  2WOL A;  3E79 A;  2PCR A;  1IXC A;  4KHZ E;  3OEL A;  4PTK A;  5TP9 A;  4WXJ A;  3U93 A;  5CMM A;  3D4C A;  3FXR A;  1XC1 A;  2O69 A;  2PFZ A;  4RPO A;  1J1N A;  1AOV A;  1B3E A;  4XEQ A;  3FAT A;  4FE8 A;  3SKP A;  5LTC A;  1H45 A;  1B40 A;  3MST A;  1L5T A;  3USD A;  1EZ9 A;  1LAH E;  3RTW B;  1T0K A;  2Z8D A;  4QRZ A;  2OWS A;  4BDQ A;  1RYO A;  1FTJ A;  4MNP A;  4PAI A;  3VV5 A;  5H8H A;  3FXU A;  3ZKL A;  4KYD A;  3RY3 A;  4Q0C A;  1YAE A;  3VLV A;  1UQW A;  3KJT A;  5ELV A;  5K2X A;  4F3P A;  5I7I A;  1QVS A;  4OEN A;  4AB6 A;  1FPI A;  3A29 A;  1USY E;  3RYB A;  1QUK A;  1MM6 A;  5ISU A;  1Y4C A;  5M2V A;  4H8I A;  1OVB A;  2VGQ A;  4PBH A;  4QSC A;  3S9N C;  2BJJ X;  4ZDM A;  3IOW A;  5TP9 B;  4C1T A;  2VOZ A;  4JSD A;  2D5W A;  2H98 A;  3EHS A;  4NED A;  5ITO A;  1LFG A;  1MXW A;  5DT6 A;  3LSW A;  5JTY B;  1JP4 A;  4JWO A;  2V3Q A;  5AA2 B;  2CZH A;  4KYS A;  2DVC A;  3K0V A;  4P1E A;  5KZT A;  1MQG A;  4IO3 A;  2B3B A;  5IZ1 A;  2I3W A;  4H5G A;  4N6P A;  3I3V A;  4I62 A;  2ABH A;  3MW0 A;  3H6W A;  4N4U A;  3THI A;  4PQJ A;  3C4M A;  3K4U A;  1IZ1 A;  3B50 A;  3UK4 A;  4KI0 E;  4P47 A;  1AH5 A;  1MY1 A;  5L8D A;  4M1V A;  3IAZ A;  5CMB A;  3MVW A;  2ALU A;  3IO4 A;  4GX3 A;  2HZK A;  4ZED A;  3H03 A;  4GWS A;  1B3H A;  4P9K A;  4P8B A;  2O1L A;  3B7D A;  1BK4 A;  3FD3 A;  2UXA A;  3KC0 A;  3PD9 A;  4PFR A;  4H5F A;  3OSQ A;  4FED A;  1Y1M A;  3IOT A;  5KDT B;  5AA4 A;  2UVG A;  3K01 A;  3BBR A;  5F1Q A;  2Y7K A;  4DCX A;  1PC3 A;  4ELO A;  2DOJ A;  4JDF A;  2KR0 A;  4Q30 B;  3S9M C;  1QUI A;  1FPB A;  4FOR A;  3GBB A;  1UIV A;  3Q27 A;  2QS4 A;  3N6T A;  3UIF A;  3CFZ A;  4GWX A;  3SZP A;  3SEY A;  2O51 A;  3T22 A;  4R9G A;  5CMC A;  3PUW E;  1P1Q A;  3BIG A;  2GH9 A;  4N07 A;  4NF4 A;  1B4H A;  1MPB A;  1SW4 A;  1I6A A;  3OO6 A;  3M3K A;  4ELQ A;  3DRH A;  1NV0 A;  2Z22 A;  4P3L A;  4DE8 A;  2F3B A;  3H06 B;  3O28 A;  3TZA A;  3MZ9 A;  3ONM A;  1NV5 A;  4PDD A;  4DIG A;  4I3E A;  2DS9 A;  1M5F A;  5F24 A;  3VLU A;  4ZEB A;  4NF5 B;  1A8F A;  5IZ3 B;  2HXR A;  1JW1 A;  1B5J A;  5JEI A;  4N6D A;  3RQT A;  4P1L A;  1LAX A;  4X48 A;  1GGG A;  3RPW A;  5DEX B;  1S50 A;  2UVI A;  3N26 A;  1VFE A;  3M8U A;  2WYP A;  1BP5 A;  2DP8 A;  5DVI A;  4AB5 A;  2QPQ A;  1QKB A;  2HFB A;  2NWJ A;  4G2Z A;  4X9T A;  3K6W A;  1Y4T A;  4I9D A;  4U1Z A;  5EQ7 A;  3VVE A;  3CSB A;  2ZYM A;  3CSG A;  4JVI A;  3U94 A;  5A5X A;  1LBB A;  1P99 A;  1URG A;  3RN8 A;  2OZZ A;  3HHF A;  3RGY A;  1N7W A;  3LSF B;  4YKP A;  1FPJ A;  3RT6 B;  2XWV A;  3G3F A;  2OWZ A;  1CE2 A;  2A5S A;  1FBP A;  2VD3 A;  5H8H B;  1IMB A;  2Q88 A;  2D3I A;  1VSO A;  2RCA A;  4GXS B;  1A55 A;  3E4R A;  2X7P A;  4IO2 A;  1LAG E;  1KA1 A;  1RKM A;  3IO6 A;  5B70 A;  3HPI A;  3Q29 A;  1DBZ A;  3VXB A;  3RNN A;  4F3S A;  3U1O A;  3GZG A;  4I40 A;  4MNC A;  4QSD A;  3RUM A;  1ZJL A;  4XXU A;  5HM4 B;  1UTH A;  3W15 C;  3FIR A;  2Y5K A;  4MJO A;  4X1B A;  3RYA A;  4QFK A;  4MBP A;  4FJP A;  4QFL A;  1KZ8 A;  3N94 A;  5H8N A;  4YZZ A;  4DXB A;  1N84 A;  5DVJ A;  2RCB A;  3IOU A;  4N81 A;  1PB8 A;  4KQP A;  4GL8 A;  4JVD A;  1DTZ A;  2VP1 A;  3DRG A;  2ZZW A;  4MNI A;  3IJX B;  1JW5 A;  1MDP 1;  3TTK A;  5KDT A;  1R9L A;  2OWT A;  1INP A;  4U2R A;  2D21 A;  2F6G A;  4F29 A;  5LOM A;  4H65 A;  1WVJ A;  4RK2 A;  3MP8 A;  1IXG A;  3TPA A;  4ESW A;  4HCW A;  4PC9 A;  4Q8R A;  3EN3 A;  3KSJ A;  4O3C A;  4UA8 A;  4JWY A;  4G68 C;  1EU8 A;  4H8J A;  2RC8 A;  1RDZ A;  2HAV A;  5EYG A;  3SEX A;  2XWK A;  1NV4 A;  4F1Y A;  4N8G A;  1US5 A;  4YAH X;  4GVO A;  4IO4 A;  4U4S A;  1D9V A;  4OAN A;  1B4Z A;  2WKY A;  5H8S A;  5I58 B;  3OOA A;  3LVU A;  1FPD A;  2REG A;  4IR8 A;  3FXQ A;  4U23 A;  3TTL A;  2XXT A;  2Y7P A;  1LBY A;  3QYT A;  4G8M A;  1JNF A;  4AS5 A;  5IZ3 A;  1UIU A;  4GWZ A;  1FRP A;  2Q2C A;  1XVX A;  3QK6 A;  4NHB A;  2RIN A;  1A40 A;  2OBG A;  3QSL A;  5AA2 A;  4GXA A;  1KA0 A;  1LBC A;  3LSL A;  1NUZ A;  3U72 A;  1IMA A;  1EZP A;  5I58 A;  4LZ8 A;  5ITP A;  1ATG A;  4I1D A;  1ZBM A;  4PFB A;  4R6H A;  1Y20 A;  3SEU A;  4QHQ A;  1NMU A;  5FTI A;  4ZZA A;  3IK6 B;  3JYR A;  3HO7 A;  4MCO A;  1USY H;  2XD3 A;  1FJ9 A;  1B32 A;  2O1M A;  4MAG A;  5ET8 A;  4OFO A;  3KN8 A;  2Z23 A;  4XKN A;  3CG1 A;  1MXV A;  4YKJ A;  3H4Z A;  3MPK A;  3QMF A;  3FBP A;  1NUW A;  3IFC A;  2OX3 A;  3TCH A;  3LC8 A;  1SBP A;  3VFJ A;  1MM7 A;  1HSJ A;  1G0H A;  3KN7 A;  3OO9 A;  2F5X A;  3T9H B;  2KLF A;  3LBS A;  3KFM A;  1PB9 A;  2QVU A;  1LLS A;  2ZYN A;  2V93 A;  4ZEF A;  3PPQ A;  3FTO A;  1MY3 A;  4U22 A;  3PPP A;  4ZS9 A;  4F18 A;  3NOH A;  4TLL B;  1IQ7 A;  2P2A A;  2UYF A;  4Q5T A;  1SQY A;  3L6G A;  5I59 A;  4JBZ A;  1H44 A;  1FPK A;  1KWH A;  4EDP A;  4N6K A;  1M5D A;  3E78 A;  4GL0 A;  1XVY A;  4G8H A;  2V84 A;  2OK2 A;  4UAB A;  2GQ1 A;  3R7X A;  5CMK A;  4KXP A;  4F2Q A;  4EUO A;  3PUY E;  2LAO A;  4NTL A;  2DWH A;  2F35 A;  4PBQ A;  2FHY A;  2V3U A;  1VE4 A;  3K1P A;  1QJM A;  2RKM A;  3TCF A;  3O9P A;  3B6W A;  1MH3 A;  1K9Z A;  4WEP A;  1B3G A;  5BUU A;  3GYY A;  3W9V A;  3MPL A;  2R71 A;  4G61 A;  3Q26 A;  1FPG A;  3LUY A;  5I59 B;  3E13 X;  3PPR A;  3VE1 B;  1B0L A;  1SI0 A;  5I2K A;  3R6U A;  2GRV A;  4U1O A;  2F34 A;  3T96 B;  2F7B A;  3VLW A;  4F2O A;  3M3L A;  1S7Y A;  3K6X A;  3PUX E;  2YJP A;  3PUV E;  2UVH A;  1Z7N E;  2A5T A;  4P11 A;  4U21 A;  1OMP A;  3O97 A;  1B9J A;  1FQC A;  1Y3Q A;  3RTF B;  2L5V A;  4FEB A;  4RYA A;  1UTB A;  3LUZ A;  4GX4 A;  4PDH A;  3BKI B;  4OET A;  1NI9 A;  5CI5 A;  2DYX A;  1EYI A;  4HCY A;  1MY0 A;  1OVT A;  4NF6 B;  5J1D A;  2FYI A;  1YYZ A;  3FZV A;  2B65 A;  1B6H A;  3OD7 A;  1SW5 A;  3IFA A;  2RF1 A;  5CC2 A;  4G77 A;  1Y9U A;  4MX6 A;  3G3G A;  4MLQ A;  3ROJ A;  3MJN A;  2CEY A;  1JW4 A;  4RY1 A;  4EF1 A;  3DRJ A;  4ND9 A;  4P0I A;  4NGU A;  4GFR A;  1RDX A;  1N76 A;  4H46 A;  5DTB A;  4LN5 A;  2XHD A;  3CHG A;  3QXM A;  2JJK A;  3FVK A;  3DRF A;  5DVF A;  2XX7 A;  4MHF A;  4LUB A;  3UN6 A;  3CFX A;  2HPG A;  1LBW A;  2NOO A;  1NUY A;  2HEU A;  1WDN A;  4GWY A;  5JK4 A;  5H8Q A;  2X26 A;  2E1S A;  4OVJ A;  3T0J A;  4EQ7 A;  3OEK A;  1D9Q A;  1M5B A;  4GQO A;  2QMX A;  2XXK A;  3S9L C;  1I69 A;  5EQ9 A;  2Q8J A;  4EXL A;  2I49 A;  4FAT A;  3O6H A;  4NWD A;  2I0B A;  1BLF A;  1Q35 A;  5J16 A;  4PE5 B;  4OQO A;  4IGR A;  1ZIU A;  3K1N A;  1MXU A;  2Q9T A;  4Z0I A;  4N91 A;  1FBC A;  2XXI A;  1BIY A;  4RPN A;  4I3Y A;  2QVR A;  4HE0 A;  5I56 A;  4HE1 A;  4F31 B;  2DE4 A;  3ISP A;  1HSL A;  2DVZ A;  3KSX A;  3RPL A;  2YPN A;  2FNC A;  2HZL A;  2VHA A;  2ZYK A;  2AIX A;  2CEX A;  3TAJ A;  2QRY A;  4JXI A;  1OQH A;  1OQG A;  1OLA A;  3O6I A;  1SW2 A;  3MP1 A;  3FAS A;  3CVG A;  1SW1 A;  3OEM A;  1I6Q A;  3JV9 A;  3TDJ A;  2R9J A;  4IY5 A;  3PPN A;  3FV2 A;  3LR1 A;  2XXX A;  3MP6 A;  4PET A;  5ET7 A;  2UVJ A;  2F36 A;  4ZEK A;  1GVC A;  1XS5 A;  1MY2 A;  3MVX A;  2XXP A;  3OMB A;  3O2A A;  1WOD A;  2PX1 A;  3MWB A;  4QXD A;  2DDK A;  5AA2 D;  4GWU A;  2Y7I A;  1NKX A;  4F39 A;  5H8Q B;  1MDQ A;  2AL5 A;  4Z7E A;  4M4G A;  1LAF E;  3RT8 A;  4JB7 A;  1NV1 A;  4OYV A;  1AL3 A;  1MQD A;  2P0S A;  1IIT A;  4GBV A;  4LZ7 A;  5H8F B;  3E9X A;  3DP6 A;  4O7I A;  3G3I A;  4YB6 A;  1MQH A;  2DWA A;  4H0W A;  2Q8M A;  2HCA A;  3PMX A;  2XXQ A;  3N5L A;  3H6V A;  4GF8 A;  3V5A A;  4XKP A;  5CM6 A;  5KCJ A;  1LBX A;  4FEC A;  4WKM A;  5EHS A;  4H67 A;  5AA1 A;  4OEU A;  1IXH A;  1B2H A;  5AA3 A;  4POX A;  3CRB A;  4X8R A;  3TMG A;  2XXH A;  3SDF A;  2XA5 A;  1FBH A;  1QUJ A;  1YZ0 A;  4RXL A;  4ESX A;  1D9Y A;  2WBB A;  3DP8 A;  4G68 B;  3TTN A;  4YMA A;  1IXI A;  2I3V A;  2ZYO A;  1DMB A;  1TFD A;  4NF5 A;  4PFY A;  1A99 A;  3BIH A;  4F22 A;  5TPA B;  4KPT A;  1AWB A;  5I57 A;  1QGX A;  1GV8 A;  5ICQ A;  1Y3P A;  3FVG A;  3PAM A;  4OA4 A;  2NVU B;  2VPN A;  1LST A;  1NFT A;  3KOS A;  2HQ0 A;  1PBQ A;  2HAU A;  4X04 A;  4F1V A;  1S9T A;  2AYS A;  3FUZ A;  3OEN A;  3SES A;  4PFU A;  4MFI A;  3PMV A;  5EYH A;  3KC1 A;  3S4U A;  1ANF A;  1VR5 A;  3H7M A;  2QS2 A;  4YU0 A;  3PV0 E;  3MUQ A;  1IUD A;  4IB2 A;  1NNP A;  3LSX A;  4U4X A;  4MH5 A;  5AA4 B;  4YB5 A;  2Y5L A;  1N3X A;  1XI6 A;  5L9M A;  3V8X B;  4IO7 A;  3IB2 A;  4E0W A;  5I57 B;  1FQA A;  3G3K A;  2HHM A;  4O94 A;  3MBP A;  4H1X A;  1B46 A;  5AE4 A;  2I58 A;  2I4C A;  4QFO A;  4LAT A;  4GD5 A;  4LZ5 A;  2ZNU A;  3IOR A;  4ZEI A;  1TWY A;  1NUX A;  1JEU A;  2ZMB A;  1IME A;  4MF3 A;  1RYX A;  3C32 A;  4WED A;  3V83 A;  4O8M A;  3U92 A;  4NMY A;  4IO5 A;  1OIB A;  3C31 A;  4GOT A;  3DEL B;  4N17 A;  1FPL A;  4R73 A;  2CZL A;  3DRK A;  5IM2 A;  1SPI A;  4KCC A;  3VXC A;  3RLF E;  1FSA A;  3F11 A;  1Q1K A;  4F3G A;  2XXV A;  3DP4 A;  2MKZ A;  1B3F A;  4FBP A;  2ZZX A;  4LVQ A;  4YIC A;  2A5T B;  2PVU A;  1XOC A;  1LBV A;  5EQA A;  2PFY A;  2KQZ A;  1FBF A;  5CRY A;  3TQW A;  3VVD A;  4EQ9 A;  1R1N A;  1D4N A;  4HS7 A;  3HST A;  4POW A;  5F7V A;  3FJG A;  1FTL A;  5HPQ A;  2QVV A;  3K2D A;  2CMO A;  3OXN A;  3QUF A;  3LV0 A;  4KYE A;  3N6U A;  3IB0 A;  3Q25 A;  2F7C A;  5I5P A;  2G29 A;  2VPO A;  3ECR A;  4F3B A;  3BFU A;  2DQV A;  2DWI A;  2F6P A;  4H6D A;  3GLB A;  4NF8 B;  1Z7M E;  2Y7W A;  4ECF A;  2P3V A;  3ILU B;  4GRK A;  4LA9 A;  3SEV A;  3MZB A;  3PUZ E;  4NF4 B;  1MG1 A;  1PB7 A;  3T9V A;  2H25 A;  5FTH A;  5IKB A;  1DK4 A;  3UP9 A;  2NUV A;  2I0C A;  2YLN A;  1JVX A;  3MVY A;  1F9B A;  3GXA A;  2V25 A;  4DI3 D;  1B5H A;  4YMB A;  1NNT A;  5FBP A;  4XFE A;  3VVF A;  5IZZ A;  2I4B A;  5EYF A;  1B51 A;  4P56 A;  1URD A;  4BDN A;  4O3A A;  3VDF A;  1O7T A;  2PT1 A;  2XX9 A;  4N15 A;  4PAK A;  1DPP A;  4XKR A;  4QFN A;  4C1U A;  3FVN A;  1BKA A;  2IA4 A;  2DXR A;  4ISU A;  4IO6 A;  4TLM B;  3ZSF A;  5ICT A;  5IGA A;  4THI A;  2FIE A;  4PE3 A;  4JSO A;  3B6T A;  3MC2 A;  4GIZ A;  2ZZV A;  2CZI A;  3P7I A;  2ANJ A;  3CG3 A;  2GFE A;  4MMP A;  3E3K A;  1TXF A;  1MY4 A;  3H3G A;  3KJ7 A;  1FPE A;  1K9Y A;  1EH3 A;  3KBZ A;  2XD2 A;  4OTE A;  4OES A;  1ZKB A;  3O6G A;  5ET5 A;  1DCU A;  4XKQ A;  2M8C A;  5K2Y A;  4I8C A;  3SER A;  1UTH B;  1LB9 A;  4BLA A;  3K00 A;  1N0T A;  2FA7 A;  3PD8 A;  4LQ2 A;  1PDA A;  2QL3 A;  1LFI A;  5LDZ A;  4OWD A;  4AS4 A;  2V3T A;  3HFU A;  3S2V A;  3CI8 A;  3FXB A;  3A3C A;  4KD5 A;  5H8N B;  1O64 A;  3H6T A;  2AL4 A;  1H3D A;  1Y1Z A;  3C33 A;  1FQE A;  1IIW A;  4G4P A;  2P3N A;  5T3J A;  1ELJ A;  1O63 A;  2VT5 A;  1MXY A;  1A8E A;  2WEF A;  2Q2A A;  3U8Q A;  1SYI A;  4ZZE A;  1TT1 A;  2B4M A;  3OO8 A;  3IX1 A;  4OER A;  1B7Z A;  3G3H A;  3MQ9 A;  3C34 A;  1R6Z A;  3UA8 A;  1PBP A;  3MZ1 A;  4O3B A;  1FBD A;  2X7Q A;  2H5Y A;  2O68 A;  4R2F A;  1M5E A;  3K02 A;  2WOK A;  4BDM A;  2XXR A;  1SVX B;  1FTM A;  1FTA A;  1Q9D A;  2QMW A;  3HV1 A;  1A7L A;  2QJE A;  4NN3 A;  1NNF A;  3BFT A;  3PGF A;  5TPA A;  4KFQ A;  2WYK A;  3PMW A;  4MLV A;  1FBG A;  1GTK A;  1US4 A;  3FGS A;  4R9F A;  4PP0 A;  3TEL A;  3T1B A;  4OVT A;  1IEJ A;  2H9B A;  1SYH A;  3O29 A;  1B7U A;  4QSE A;  4JVC A;  1FBE A;  1B7H A;  4UAC A;  4NWC A;  1H43 A;  2H4I A;  5HBC A;  4OEV A;  1MPD A;  2NXO A;  1QUL A;  4R75 A;  1ZU0 A;  1Y3N A;  5FHO A;  1LGB C;  2FVZ A;  1G0I A;  4G8N A;  4HXV A; 
#chains in the Genus database with same CATH homology
 4WXJ A;  3QUJ A;  2ZYO A;  3U93 A;  5I58 A;  2O6A A;  1EZP A;  3TFL A;  1DMB A;  4LZ8 A;  5CMM A;  5ITP A;  1AIV A;  1ATG A;  4I1D A;  3D4C A;  3FXR A;  4PFT A;  1TFD A;  1ZBM A;  2GHA A;  4NF5 A;  4R6H A;  1FQB A;  4PFY A;  1A99 A;  1XC1 A;  1LB8 A;  1DTG A;  1Y20 A;  3HCQ A;  3I6V A;  2O69 A;  4QHQ A;  1NMU A;  3G3J A;  5FTI A;  3SEU A;  4F22 A;  4RPO A;  5TPA B;  1J1N A;  4ZZA A;  3IK6 B;  1AOV A;  3JYR A;  1B3E A;  2PMS A;  3HO7 A;  4KPT A;  1USY H;  5I57 A;  3FAT A;  2F97 A;  2XD3 A;  3FV1 A;  1GV8 A;  4FE8 A;  5ICQ A;  4K3F A;  3SKP A;  1Y3P A;  3FVG A;  5B7D A;  1H45 A;  1B32 A;  1B40 A;  3PAM A;  2O1M A;  4F1U A;  4OFO A;  3KN8 A;  1L5T A;  2Z23 A;  2NVU B;  4ELP A;  4XKN A;  1LST A;  1MXV A;  1NFT A;  3CG1 A;  3DM0 A;  3H4Z A;  1JVY A;  3MPK A;  4YKJ A;  3USD A;  1EZ9 A;  3KOS A;  1LAH E;  3RTW B;  2HQ0 A;  3TKD A;  3QAX A;  2Z8D A;  1T0K A;  1BTJ A;  3TCH A;  1PBQ A;  2F78 A;  4QRZ A;  2OWS A;  2HAU A;  4PFW A;  4F1V A;  3LC8 A;  1SBP A;  3VFJ A;  1RYO A;  4BDQ A;  1S9T A;  1FTJ A;  2AYS A;  3FUZ A;  3OEN A;  4R6K A;  3SES A;  1MM7 A;  4PFU A;  1B5I A;  1HSJ A;  1LCT A;  3VV5 A;  2ONR A;  4MFI A;  3S9E A;  3PMV A;  5H8H A;  3FXU A;  4BDM A;  3ZKL A;  4KYD A;  3O6P A;  3RY3 A;  4Q0C A;  1YAE A;  3VLV A;  1FTK A;  4DXC A;  1UQW A;  3KJT A;  3KN7 A;  3QIM A;  3OO9 A;  5ELV A;  5K2X A;  3S4U A;  2F5X A;  4P0G A;  4F3P A;  1JEV A;  1ANF A;  1VR5 A;  1QVS A;  3H7M A;  3KBR A;  4R72 A;  3T9H B;  2KLF A;  2QS2 A;  4OEN A;  4YU0 A;  4AB6 A;  4EXK A;  3LBS A;  3PV0 E;  4BDL A;  3KFM A;  3MUQ A;  1IUD A;  2XXW A;  1PB9 A;  1USY E;  3RYB A;  4IB2 A;  1LLS A;  2ZYN A;  1QUK A;  2V93 A;  1NNP A;  1MM6 A;  3LSX A;  4U4X A;  3PPQ A;  2E0S A;  4ZEF A;  1FQD A;  3FTO A;  5ISU A;  1JQF A;  1MY3 A;  2DWJ A;  4U22 A;  1Y4C A;  3PPP A;  4ZS9 A;  5M2V A;  4H8I A;  1OVB A;  4MH5 A;  4F18 A;  2VGQ A;  4YB5 A;  4TLL B;  5AA4 B;  4QSC A;  1IQ7 A;  2P2A A;  2UYF A;  4Q5T A;  1N3X A;  3S9N C;  1SQY A;  5JTY A;  2BJJ X;  3L6G A;  4ZDM A;  1P1O A;  3IOW A;  5L9M A;  5TP9 B;  3V8X B;  2VOZ A;  4C1T A;  4JSD A;  2D5W A;  2H98 A;  3EHS A;  5I59 A;  3EPE A;  4NED A;  3TTM A;  5ITO A;  4IO7 A;  1LFG A;  4JBZ A;  5L9O A;  1H44 A;  3IB2 A;  1MXW A;  5DT6 A;  1KWH A;  4E0W A;  5I57 B;  1FQA A;  3G3K A;  3LSW A;  4EDP A;  3EHU A;  5JTY B;  3WAE A;  4JWO A;  1H76 A;  1M5D A;  1N3W A;  2V3Q A;  5AA2 B;  1AMF A;  4KYS A;  2DVC A;  3K0V A;  4GL0 A;  1XVY A;  5KZT A;  2O7U A;  4TOZ A;  3MBP A;  1SD3 A;  1MQG A;  3IJO B;  4G8H A;  4IO3 A;  5FHM A;  2B3B A;  2V84 A;  4H1X A;  4BDO A;  1B46 A;  5AE4 A;  2I58 A;  2OK2 A;  2I3W A;  4H5G A;  4N6P A;  2I4C A;  3R7X A;  3EHT A;  3W9W A;  3I3V A;  5CMK A;  4QFO A;  4I62 A;  4F2Q A;  4LAT A;  4EUO A;  3PUY E;  2ABH A;  3MW0 A;  2LAO A;  4GD5 A;  4NTL A;  2DWH A;  4LZ5 A;  3T9V A;  2F35 A;  1POT A;  2ZNU A;  2V3U A;  1VE4 A;  3IOR A;  4ZEI A;  1QJM A;  1TWY A;  2RKM A;  3H6W A;  3K1P A;  1JEU A;  2ZMB A;  4PQJ A;  3C4M A;  3K4U A;  3THI A;  1IZ1 A;  3TCF A;  3O9P A;  3B6W A;  3G7W A;  1ZLQ A;  1ZTY A;  1MH3 A;  2GHB A;  4MF3 A;  3UK4 A;  2F7A A;  4KI0 E;  1OLC A;  1RYX A;  2Y84 A;  3C36 A;  3C32 A;  2REJ A;  4WED A;  4WEP A;  1B3G A;  2IEE A;  1AH5 A;  1MY1 A;  2Z8F A;  2THI A;  5L8D A;  5BUU A;  5CBS A;  3U92 A;  3V83 A;  4M1V A;  3FJM A;  3IAZ A;  4NMY A;  5CMB A;  3MVW A;  3OO7 A;  3W9V A;  3MPL A;  2ALU A;  3IO4 A;  4IO5 A;  2HZK A;  4ZED A;  1OIB A;  2DSF A;  2R71 A;  3C31 A;  3H03 A;  3Q26 A;  4GOT A;  4YB7 A;  4DXU A;  4QFP A;  1B3H A;  3DEL B;  1MQJ A;  2O1L A;  3C35 A;  3IB1 A;  3B7D A;  3FD3 A;  4DDD A;  2H99 A;  5BWJ A;  2UXA A;  1NH7 A;  4R73 A;  4FAJ A;  2CZL A;  3LUY A;  3E13 X;  3PPR A;  2XXU A;  3DRK A;  1B1H A;  5I59 B;  3PD9 A;  4KCC A;  3VE1 B;  1B0L A;  1SI0 A;  4H5F A;  4KCD A;  3VXC A;  3T9X B;  4F19 A;  5I2K A;  3OSQ A;  3R6U A;  3RLF E;  1N7X A;  2GRV A;  2HXW A;  2I6E A;  2ZNS A;  4U1O A;  2F34 A;  4FED A;  1Y1M A;  2F7B A;  3IOT A;  3M3L A;  3T96 B;  3VLW A;  4F2O A;  3F11 A;  1S7Y A;  3K6X A;  5H8F A;  5KCJ B;  5KDT B;  1Q1K A;  2UVG A;  4F3G A;  3GBA A;  1MQI A;  2RC7 A;  2XXV A;  3DP4 A;  3K01 A;  3BBR A;  5F1Q A;  2Y7K A;  2YJP A;  4LQ5 A;  3PUV E;  4DCX A;  1PC3 A;  4ELO A;  5I2N A;  3DRI A;  2DOJ A;  1B3F A;  2UVH A;  4JDF A;  2ONK E;  4Q30 B;  3S9M C;  1Z7N E;  4LVQ A;  3KN3 A;  4YIC A;  1QUI A;  2A5T A;  2A5T B;  4XTC Q;  4FOR A;  2PVU A;  1XOC A;  4P11 A;  4U21 A;  1OMP A;  3O97 A;  3TZA A;  1B9J A;  3GBB A;  1UIV A;  1FQC A;  1Y3Q A;  2QS4 A;  3Q27 A;  5CRY A;  3RTF B;  2I48 A;  3TQW A;  3N6T A;  4ZE9 A;  1LFH A;  3UIF A;  1FQF A;  3CFZ A;  3KEI A;  3V89 B;  3VVD A;  4EQ9 A;  1MXZ A;  1R1N A;  4FEB A;  3SEY A;  4RK9 A;  1D4N A;  1SDX A;  4RA1 A;  3HST A;  4HS7 A;  2O51 A;  4POW A;  1B0H A;  3FJG A;  4RYA A;  5F7V A;  1FTL A;  5HPQ A;  1UTB A;  3T22 A;  3O66 A;  3HN0 A;  3KOT A;  3K6U A;  3BKI B;  3K2D A;  2CMO A;  4OET A;  3KGC A;  4R9G A;  3OXN A;  5CMC A;  3PUW E;  3UOR A;  1P1Q A;  5CI5 A;  3QUF A;  2DYX A;  2GH9 A;  2PT2 A;  4N07 A;  4NF4 A;  4OMB A;  1B4H A;  1MPB A;  1SW4 A;  4KYE A;  1I6A A;  3N6U A;  3IB0 A;  3OO6 A;  2F7C A;  3Q25 A;  4HCY A;  3M3K A;  4XIG Q;  1MY0 A;  3Q28 A;  1OVT A;  4NF6 B;  2G29 A;  5J1D A;  2ZNT A;  1ZMG A;  4R6Y A;  3SEW A;  4ELQ A;  3EQ1 A;  2FYI A;  3DRH A;  3ECR A;  4LP2 B;  3H6U A;  3FZV A;  2Z22 A;  3TQL A;  4DE8 A;  2B65 A;  2Q89 A;  3H06 B;  2W7Y A;  3M3F A;  3O28 A;  4YKK A;  5FHN A;  4F3B A;  3BFU A;  1B6H A;  2F8D A;  3OD7 A;  3MZ9 A;  1SW5 A;  2DQV A;  3ONM A;  4OHN A;  2RF1 A;  2DWI A;  2F6P A;  4H6D A;  3GLB A;  4R2B A;  4DIG A;  2DS9 A;  5CC2 A;  1M5F A;  3FVO A;  4NF8 B;  4R74 A;  1Z7M E;  4ELR A;  4G77 A;  4FIM A;  1Y9U A;  2Y7W A;  4ECF A;  3VLU A;  4ZEB A;  1A54 A;  4NF5 B;  3AXF A;  3K6V A;  3ILU B;  2QSX A;  3G3G A;  1A8F A;  4GRK A;  4OFJ A;  4MLQ A;  1LCF A;  3TCG A;  3MJN A;  4LA9 A;  1JW4 A;  1JW1 A;  4RY1 A;  3SEV A;  1B5J A;  3MZB A;  3OSR A;  3PUZ E;  4NF4 B;  4EF1 A;  1MG1 A;  1NH8 A;  5JEI A;  3DRJ A;  3RQT A;  4X48 A;  1LAX A;  1GGG A;  1PB7 A;  2H25 A;  1YPN A;  4ND9 A;  3B6Q A;  5DEX B;  1S50 A;  2UVI A;  5FTH A;  3RPW A;  4P0I A;  1R9Q A;  3N26 A;  5IKB A;  1VFE A;  3IOV A;  3M8U A;  4GFR A;  4JWX A;  4X1D A;  3UP9 A;  1N76 A;  1BP5 A;  2I0C A;  2NUV A;  1JVX A;  2YLN A;  3MVY A;  1F9B A;  5DTB A;  3GXA A;  1B05 A;  2DP8 A;  5DVI A;  2QPQ A;  4AB5 A;  1D3K A;  1QKB A;  2HFB A;  3CHG A;  2V25 A;  2XHD A;  2NWJ A;  3QXM A;  3FVK A;  1VFD A;  4G2Z A;  3DRF A;  3MVZ A;  5DVF A;  4X9T A;  2XX7 A;  1DSN A;  3K6W A;  5AA4 A;  1B5H A;  4YMB A;  2OCU A;  1NNT A;  4LUB A;  3UN6 A;  3VVF A;  2I4B A;  3CFX A;  1M5C A;  5EYF A;  1Y4T A;  4TQU Q;  2G93 A;  4IY6 A;  1B51 A;  2NOO A;  1URD A;  4I9D A;  2HEU A;  4ONY A;  1WDN A;  4BDN A;  4O3A A;  4U1Z A;  5JK4 A;  3T66 A;  2O84 X;  2E1S A;  2X26 A;  5H8Q A;  3CSB A;  4OVJ A;  3VDF A;  3VVE A;  2ZYM A;  3CSG A;  1B3L A;  5IAI A;  1O7T A;  2PT1 A;  2XX9 A;  3U94 A;  4EQ7 A;  1DPP A;  3OEK A;  4XKR A;  4QFN A;  1M5B A;  4GQO A;  2QMX A;  3R26 A;  4HW8 A;  5A5X A;  4C1U A;  1LBB A;  1P99 A;  1URG A;  2Y7R A;  3PUX E;  3RN8 A;  5A5X B;  4GLI A;  4RNS A;  1I69 A;  2OZZ A;  3FVN A;  1BKA A;  3HHF A;  5I56 B;  3RGY A;  1N7W A;  3LSF B;  4YKP A;  2Q8J A;  4EXL A;  4KR5 A;  2I49 A;  4FAT A;  3O6H A;  1MPC A;  3MAM A;  4ZE8 A;  2I0B A;  4IGT A;  4NWD A;  3RT6 B;  1BLF A;  1MH4 A;  2IA4 A;  1Q35 A;  2DXR A;  2PYY A;  4ISU A;  4PE5 B;  3CR9 A;  4IO6 A;  4TLM B;  3ZSF A;  5ICT A;  3G3F A;  4OQO A;  4IGR A;  4THI A;  4JSO A;  1CE2 A;  1ZIU A;  1MXU A;  3K1N A;  2A5S A;  2B3F A;  2Q9T A;  4Z0I A;  3B6T A;  2VD3 A;  3PU5 A;  3ILT B;  5H8H B;  3MC2 A;  4GIZ A;  2Q88 A;  2XXI A;  2D3I A;  1BIY A;  4RPN A;  2Z8E A;  1VSO A;  3P7I A;  2ANJ A;  2RCA A;  4GXS B;  4EQB A;  2ONS A;  3CG3 A;  3SET A;  2GFE A;  3K1M A;  3E3K A;  1TXF A;  1MY4 A;  3H3G A;  3KJ7 A;  1A55 A;  5I56 A;  4F29 A;  3E4R A;  1EH3 A;  2X7P A;  2XD2 A;  4OTE A;  4IO2 A;  4OES A;  1P1N A;  1ZKB A;  3O6G A;  1LAG E;  1MRP A;  4F31 B;  2DE3 A;  2DE4 A;  2OLB A;  1TFA A;  4XKQ A;  1HSL A;  1RKM A;  2M8C A;  5K2Y A;  2DVZ A;  3IO6 A;  4I8C A;  3KSX A;  1UTH B;  3HPI A;  1YTV A;  3Q29 A;  3SER A;  4C0R A;  5B70 A;  4YKI A;  1LB9 A;  4OZ9 A;  1GR2 A;  1P1U A;  2YPN A;  3VXB A;  1FCK A;  2FNC A;  2HZL A;  2VHA A;  3JZJ A;  3RNN A;  1P1W A;  3K00 A;  2ZYK A;  5EHM A;  1JET A;  2ZXT A;  3CFL A;  4BLA A;  4F3S A;  3TUS A;  2AIX A;  3U1O A;  2WOP A;  3GZG A;  3TAJ A;  3A09 A;  4QSD A;  2QS1 A;  1QW0 A;  4NF8 A;  2QRY A;  1N0T A;  3RUM A;  1ZJL A;  2FA7 A;  3PD8 A;  4JXI A;  4XXU A;  4LQ2 A;  1PDA A;  1OQH A;  1OQG A;  2QL3 A;  1PEB A;  1OLA A;  1LFI A;  3O6I A;  5HM4 B;  1SW2 A;  3MP1 A;  3FAS A;  3CVG A;  5AA3 A;  1UTH A;  3W15 C;  1SW1 A;  3OEM A;  1I6Q A;  3FIR A;  3JV9 A;  3TDJ A;  4OWD A;  2V3T A;  4X1B A;  3S2V A;  3RYA A;  4L17 A;  4QFK A;  4MBP A;  3CI8 A;  1DPE A;  1MS7 A;  2R9J A;  2DE2 A;  4IY5 A;  4DLD A;  3A3C A;  4FJP A;  4DCY A;  4KD5 A;  2ESN A;  3PPN A;  4HTG A;  5H8N B;  1EZO A;  4OXV A;  4QFL A;  3FV2 A;  3LR1 A;  3N94 A;  1O64 A;  3H6T A;  5H8N A;  4AQ4 A;  5I84 A;  4ZEC A;  2AL4 A;  1B1X A;  1H3D A;  1Y1Z A;  2XXX A;  3EF7 A;  3MP6 A;  4YZZ A;  4DXB A;  3C33 A;  4PET A;  1FQE A;  1IIW A;  1N84 A;  4G4P A;  5DVJ A;  3DLN A;  4DZ1 A;  3TOD A;  2OJT A;  2RCB A;  2UVJ A;  2F36 A;  1I6B A;  3IOU A;  1NL5 A;  1DOT A;  4E0X A;  2B4L A;  4ZEK A;  5CBR A;  1ELJ A;  1GVC A;  1XS5 A;  5I2N B;  1O63 A;  1MY2 A;  1YCJ A;  1PB8 A;  1POY 1;  3MVX A;  1MXY A;  3TTR A;  2XXP A;  1A8E A;  4KQP A;  4GL8 A;  2Q2A A;  3U8Q A;  4QF9 A;  1SYI A;  3KG2 A;  3OMB A;  3CIJ A;  1DTZ A;  3O2A A;  4ZZE A;  1WOD A;  2VP1 A;  3DRG A;  1TT1 A;  2B4M A;  3OO8 A;  2PX1 A;  3MWB A;  3ODB A;  2P1S A;  3ZKK A;  3IX1 A;  3WAF A;  4OER A;  1B7Z A;  1JW5 A;  1MDP 1;  3IJX B;  5AA2 D;  3TTK A;  5KDT A;  1R9L A;  3G3H A;  1URS A;  2OWT A;  2Y7I A;  1NKX A;  2D21 A;  2F6G A;  3MQ9 A;  4U2R A;  5H8Q B;  4BDR A;  1B58 A;  3C34 A;  1R6Z A;  3UA8 A;  1MDQ A;  4EF2 A;  1PBP A;  5LOM A;  3MZ1 A;  2AL5 A;  4Z7E A;  4H65 A;  1WVJ A;  4NF6 A;  4O3B A;  4RK2 A;  4M4G A;  2X7Q A;  1LAF E;  3IL1 B;  5DYH A;  3MP8 A;  1IXG A;  2PBW A;  3RT8 A;  2H5Y A;  3TPA A;  2O68 A;  4ESW A;  2DXY A;  4R2F A;  4OFL A;  1M5E A;  4JB7 A;  3I5O A;  4HCW A;  4Q8R A;  3T93 B;  3EN3 A;  3K02 A;  2WOK A;  3KSJ A;  1AL3 A;  4O3C A;  2XXR A;  4OYV A;  5TU0 A;  1MQD A;  5I2K B;  1SVX B;  1FW0 A;  1FTM A;  1XHY A;  2P0S A;  3C9H A;  1IIT A;  3HHG A;  4UA8 A;  4LZ7 A;  3A3U A;  2QMW A;  3E9X A;  1A7L A;  1UTB B;  3DP6 A;  3D4G A;  3HV1 A;  4JWY A;  5H8F B;  2QJE A;  3PPO A;  3G3I A;  3L6H A;  4G68 C;  4GWO A;  2VD2 A;  2O7I A;  4YB6 A;  5L9S A;  1EU8 A;  1NNF A;  3BFT A;  3PGF A;  4H8J A;  2QS3 A;  1MQH A;  2HAV A;  2RC8 A;  3T9U A;  3SEX A;  2DWA A;  5TPA A;  4H0W A;  1CB6 A;  4F1Y A;  1NNK A;  1MXX A;  4G68 A;  4KFQ A;  3TYH A;  1US5 A;  4YAH X;  3PMW A;  4MLV A;  2HCA A;  3PMX A;  4GVO A;  1GTK A;  1US4 A;  2XXQ A;  4IO4 A;  4LON B;  4RJZ A;  4U4S A;  1D9V A;  3FGS A;  3N5L A;  3H6V A;  2XXY A;  4F39 A;  1B4Z A;  2WKY A;  4GF8 A;  4R9F A;  5H8S A;  5I58 B;  4PP0 A;  3V5A A;  2R6G E;  1XT8 A;  3OOA A;  1II5 A;  4NE4 A;  1QKA A;  3LVU A;  3TEL A;  3TEP A;  2REG A;  4XKP A;  1IEJ A;  1N04 A;  2XX8 A;  2H9B A;  3FXQ A;  1SYH A;  4U23 A;  3KZG A;  5CM6 A;  3TTL A;  5KCJ A;  2XXT A;  1B52 A;  3IR1 A;  1B7U A;  3O29 A;  4FEC A;  4QSE A;  4WKM A;  4N13 A;  1SI1 A;  5EHS A;  1FTO A;  2Y7P A;  4H67 A;  3QYT A;  1B7H A;  4G8M A;  1JNF A;  4UAC A;  5AA1 A;  4OEU A;  1IXH A;  1B2H A;  1H43 A;  4NWC A;  4POX A;  3CRB A;  3TMG A;  5DEX A;  1UIU A;  2H4I A;  2XXH A;  1HSE A;  5HBC A;  3SDF A;  4OEV A;  1MPD A;  1QUJ A;  2Q2C A;  3FJ7 A;  2NXO A;  1QUL A;  1XVX A;  4R75 A;  3QK6 A;  2UYE A;  2RC9 A;  4RXL A;  4ESX A;  3ZS6 A;  1ZU0 A;  2RIN A;  1Y3N A;  3UGW A;  1D9Y A;  1A40 A;  2OBG A;  3QSL A;  5FHO A;  2WOL A;  5AA2 A;  1LGB C;  4GXA A;  1LBC A;  3S9L C;  3DP8 A;  3LSL A;  4G68 B;  4G8N A;  1IXC A;  4KHZ E;  3OEL A;  3TTN A;  3U72 A;  5TP9 A;  4YMA A;  1IXI A;  2I3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...