1QKBA

Oligo-peptide binding protein (oppa) complexed with kvk
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
517
structure length
517
Chain Sequence
ADVPAGVQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVSRDLFEGLLISDVEGHPSPGVAEKWENKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGHIANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPKSAVEKFGDKWTQPANIVTNGAYKLKNWVVNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEIDMTYNNMPIELFQKLKKEIPNEVRVDPYLCTYYYEINNQKAPFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSYTPPYTDGAKLVEPEWFKWSQQKRNEEAKKLLAEAGFTADKPLTFDLLYNTSDLHKKLAIAVASIWKKNLGVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNIYVKNLYIIKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and Calorimetric Analysis of Peptide Binding to Oppa Protein
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Protein transport
molecule keywords PERIPLASMIC OLIGOPEPTIDE-BINDING PROTEIN
total genus 188
structure length 517
sequence length 517
ec nomenclature
pdb deposition date 1999-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00496 SBP_bac_5 Bacterial extracellular solute-binding proteins, family 5 Middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.105.10 Alpha Beta Roll Dipeptide-binding Protein; domain 3 Dipeptide-binding Protein; Domain 3 1qkbA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1qkbA01
3.90.76.10 Alpha Beta Alpha-Beta Complex Dipeptide-binding Protein; domain 1 Dipeptide-binding Protein; Domain 1 1qkbA02
5I58A 2B65A 3CI8A 4QSEA 4ELRA 3QK6A 4R9GA 2DYXA 2BJJX 1R1NA 2ALUA 1I6AA 4I9DA 1LAXA 1B4HA 3EPEA 3HCQA 1L5TA 4GRKA 3T66A 1S7YA 2REJA 4ZS9A 3G3JA 3LSXA 4OERA 4G8NA 3S9NC 1IEJA 3D4GA 2B4MA 3Q29A 5TPAB 4YKJA 4PQJA 3LBSA 2X7PA 3HN0A 4OVJA 4XIGQ 4H8IA 4LZ5A 1ATGA 4YAHX 4NF6B 4R6KA 3USDA 4GVOA 1WODA 2O69A 3FD3A 4TQUQ 4UA8A 2OZZA 3K6WA 1M5FA 1MPDA 4YZZA 4R73A 1D3KA 3JZJA 4IB2A 3TZAA 4EQ9A 5H8SA 3MVZA 4IO2A 5ICTA 3VLVA 3DRGA 3SEWA 2Y7RA 4KD5A 5AA2B 1ZJLA 4GL0A 1B51A 4WEDA 4RJZA 1J1NA 5KCJA 4AB5A 4EDPA 1DTZA 5AA4A 4YMAA 3IK6B 3FZVA 5ELVA 3A09A 1SW1A 3C4MA 3K1PA 3PPOA 4OENA 2ESNA 4KCCA 2NWJA 4XXUA 5FHNA 4ZZEA 2QJEA 2B3BA 3IOWA 4HTGA 2B3FA 2OJTA 4F39A 1UQWA 1BTJA 2X7QA 4ZEKA 4R2FA 3RTFB 2DE2A 3TTNA 4Q30B 5H8HB 1AH5A 1LLSA 3TTKA 1UTBB 2GH9A 3C36A 4JWOA 4XKPA 4WKMA 3ZKKA 4F2OA 3OOAA 3OSRA 2DP8A 1MH3A 3K02A 4M1VA 1ZMGA 3IB1A 3MAMA 2RINA 5K2XA 1GGGA 4F3PA 3O6HA 3C31A 4TOZA 4GQOA 5ITPA 4BDQA 3UIFA 2XXYA 2XXUA 3H3GA 3KBRA 2O1LA 4NMYA 2AIXA 3RNNA 1XVXA 2F34A 2RCBA 4FEBA 1ZBMA 4KPTA 4QSDA 2V84A 2Q8JA 1FW0A 2WOPA 1I69A 1JVXA 2Z23A 4G8HA 2A5TA 1MXUA 2H4IA 1SBPA 2DWIA 3B7DA 4O3CA 1NNPA 4RK2A 3CHGA 3CR9A 2IA4A 3KFMA 4N13A 4BDRA 5AA3A 1R9LA 1SI1A 1VFDA 1YCJA 3FGSA 2O68A 1M5CA 3D4CA 1A7LA 4H5FA 2XXQA 4KYDA 2XXWA 3FV2A 2UXAA 3DLNA 3IR1A 4ZE8A 1N7WA 2OCUA 1IUDA 3CFZA 3FASA 4BDOA 1IXIA 3FTOA 1SDXA 2O7IA 1PEBA 3CFXA 3O28A 2ZNUA 4H67A 3I5OA 3BBRA 3VE1B 4RPNA 5I59A 1B58A 1B7ZA 1PB7A 5H8FB 2HXWA 1NNKA 3Q27A 3RQTA 1D9VA 5I56A 4X1BA 1B6HA 1MXZA 3ILTB 2V3UA 3R7XA 3T93B 2G93A 4DE8A 4KCDA 2PMSA 3SERA 4QFKA 1MY3A 1N04A 2THIA 3QUFA 4KHZE 4EQ7A 3ONMA 5ICQA 1QJMA 3VDFA 2HQ0A 5JTYA 1XS5A 1EZ9A 4QFPA 3N6UA 4NF8B 5H8QB 3VFJA 2HCAA 3MW0A 2XXXA 3HHGA 4KYEA 3THIA 4ESWA 3G3IA 5HM4B 4RA1A 1PB8A 4OEVA 3W15C 4TLLB 4ELPA 3FJGA 2XXPA 1VFEA 2F35A 1US5A 3OXNA 1RKMA 1FTMA 3FXUA 2QS3A 3T9XB 3G3HA 2DOJA 3H03A 5CC2A 1NFTA 3B6WA 3PUVE 2AYSA 2D3IA 3CIJA 4M4GA 4F18A 3OSQA 2O1MA 2OK2A 4H6DA 4H65A 3N94A 2XX9A 2Y7PA 4OQOA 2H25A 1H44A 1GVCA 1GV8A 1FQBA 1OIBA 3U94A 4O3BA 4F1VA 3O6GA 1DSNA 1PDAA 4E0XA 3IB0A 1B3EA 3VV5A 1BP5A 4YKIA 3HPIA 3TTMA 2HAVA 1MH4A 2OBGA 1R9QA 3TCFA 5L9OA 1B1XA 5HBCA 3SESA 1NNTA 2PVUA 3KN8A 4NE4A 3K01A 4YB6A 1P99A 1P1NA 2ZNSA 1OQGA 3WAFA 1URGA 3MP1A 3QYTA 4ZZAA 4LQ5A 4KFQA 3OO6A 3U1OA 2F7BA 3KOTA 5KCJB 3GBAA 3DELB 2ZNTA 3T9HB 4IY6A 3MWBA 1B40A 1SI0A 4LUBA 1I6BA 4XTCQ 1B5HA 1OVBA 3RUMA 2I48A 2I58A 3TMGA 2DWHA 4KI0E 5A5XA 3S9EA 4ZEIA 2UVGA 1QVSA 2I3VA 3G7WA 4EQBA 4JSDA 1USYE 2CMOA 4GFRA 3A3UA 3C35A 1M5BA 3PD8A 3PPRA 4Q5TA 4TLMB 3VVFA 4FJPA 4OWDA 1O63A 3FVGA 4H0WA 4P0GA 3HHFA 1JVYA 2DSFA 5JK4A 1H43A 5DEXA 2XX8A 3SEUA 1B5JA 4ZECA 2FYIA 4ESXA 1XHYA 3O66A 3FATA 2KLFA 1BLFA 3MC2A 4P0IA 5H8FA 3UORA 2UYEA 4OMBA 1ELJA 2ONKE 5TP9B 3IX1A 2P0SA 3IO4A 3QUJA 1AIVA 3T9UA 3V89B 1Z7NE 2HEUA 5JEIA 1QUIA 4HCWA 3LUYA 3MBPA 4R75A 1ZLQA 4R74A 4NWDA 2GRVA 1DOTA 5F1QA 1H3DA 2DWAA 2UVIA 1LGBC 4ECFA 5I2NA 1D4NA 1OMPA 2Y7IA 3IAZA 1CB6A 2GHAA 2V25A 1ZIUA 3B6QA 4MFIA 2UVJA 3VVEA 4POXA 1IXGA 5FHMA 3KOSA 4GXAA 3DP4A 2OLBA 2ONSA 2LAOA 3KGCA 4IO7A 2F8DA 3DRKA 5IAIA 1MXVA 3PU5A 3FJMA 1BKAA 4YKKA 2Z22A 1N7XA 1EH3A 1PC3A 1LAGE 1QW0A 5CMKA 1AMFA 4G2ZA 5ITOA 2AL4A 2PT2A 3SKPA 1JEUA 2Z8FA 3TYHA 4EF2A 3IOVA 3IOUA 4OXVA 1UTHA 1A55A 3H6VA 1YAEA 3TTRA 3TFLA 4F2QA 1SW4A 2B4LA 5CMMA 4FEDA 3MZ9A 4MLVA 4XKNA 2YJPA 3SEXA 1MXYA 1WVJA 4EXKA 4EUOA 2XD2A 3O6IA 1Y4CA 2Y84A 3JV9A 1TXFA 3PUXE 4ISUA 5CBRA 2RC7A 3Q25A 3RY3A 1MG1A 4N07A 3TQWA 4ELQA 4HW8A 5I56B 1NNFA 1IQ7A 3PUYE 2PX1A 4EF1A 1LFIA 3OO7A 1EZOA 2G29A 4GIZA 1TFAA 1IXCA 4IY5A 3MZ1A 4KR5A 2FA7A 1SW2A 4UACA 1B52A 1MPBA 2Y7WA 5JTYB 2V3TA 1OLAA 1A99A 4QFOA 1WDNA 3O6PA 3BKIB 1KWHA 4U4XA 4BDMA 4Q8RA 4JXIA 5I84A 1S50A 1SYIA 1RYXA 1AOVA 3O9PA 2YLNA 1FQEA 5ISUA 3C34A 3CVGA 4NF6A 3TELA 1FTKA 2QRYA 3N6TA 3MVXA 1VE4A 3TAJA 3E4RA 4YICA 3IB2A 4BDLA 1QUJA 5B7DA 3V83A 1FTLA 1HSLA 2ANJA 5TU0A 1FQCA 4E0WA 1LSTA 3QIMA 2F7CA 2VGQA 3EHUA 3K1MA 3LSLA 5L8DA 3LC8A 4I62A 4N6PA 2P1SA 5FTIA 3T22A 1URSA 2I0BA 5I2NB 1Y3NA 4OYVA 2QS2A 4U22A 4RY1A 5EYFA 4NF8A 3RN8A 2H98A 3TKDA 1LFHA 2M8CA 1JNFA 1H76A 3S9LC 2F6GA 3KSXA 2REGA 2I3WA 1SVXB 2XX7A 1FTOA 2XHDA 1MQJA 1FTJA 5KZTA 1MQGA 1IXHA 3IOTA 2I49A 4G4PA 4Q0CA 1O64A 1NL5A 5J1DA 2PBWA 2Q89A 3G3FA 4PFWA 1N84A 2DXRA 1LBCA 3AXFA 2DS9A 3PMXA 4PE5B 3UN6A 1MPCA 5I59B 2W7YA 4YKPA 1TT1A 4QF9A 4OZ9A 4KQPA 1B5IA 1MY0A 1JQFA 1USYH 3F11A 5I57B 3K00A 2PT1A 3TODA 4F19A 2NOOA 2VD3A 4JWXA 3S2VA 5L9MA 1Q35A 1B32A 2GHBA 3E9XA 3IO6A 3LR1A 4JWYA 1A8EA 4ND9A 5BWJA 1B3LA 4KYSA 4NWCA 5LOMA 3KSJA 1FQDA 1SW5A 2F6PA 4G68C 4I8CA 2A5TB 1LFGA 4QHQA 3H7MA 2DE3A 4FAJA 1N3WA 4GD5A 1D9YA 3E13X 3OEMA 1JW1A 4G68A 1P1OA 4LZ7A 4LZ8A 5I2KA 3FVNA 3K2DA 3U8QA 2PYYA 4DDDA 3LSFB 1B9JA 1F9BA 1SYHA 4IGRA 2DXYA 4U4SA 2H99A 5DTBA 3FV1A 4G68B 5I2KB 5CBSA 3TQLA 3KG2A 4X9TA 2WOLA 3VXBA 1NMUA 1Y20A 3UK4A 4RPOA 3V8XB 4JB7A 4K3FA 2HAUA 2R71A 2ZYNA 4H1XA 3OELA 3Q26A 4POWA 4QSCA 5DVFA 1Y3PA 1P1UA 3T96B 4IO5A 1UIVA 4OETA 3DRHA 1IZ1A 5DVIA 4YMBA 1B3HA 4MF3A 3H06B 4NF5A 4R72A 4R6YA 4OESA 1LAFE 4LVQA 5I57A 1T0KA 2UYFA 3ECRA 3TCGA 2VOZA 3PMVA 1XT8A 2HZLA 3C33A 3DP6A 3PPPA 4RXLA 4PP0A 1NH8A 4F3BA 1POTA 4OTEA 2R9JA 4PETA 5AA2A 2QL3A 2XXIA 3G3KA 1XC1A 1LBBA 2VHAA 2F7AA 3EHTA 4G8MA 3EF7A 4U1ZA 2FNCA 3TEPA 3QXMA 1QUKA 3SETA 3FJ7A 3TUSA 3EHSA 3U72A 1MM6A 2NUVA 4FE8A 3RPWA 4P11A 2HFBA 4GLIA 3MPKA 4LA9A 2RF1A 3PGFA 4ONYA 3CRBA 4OFJA 2AL5A 4X1DA 3FXQA 1II5A 3OMBA 3UP9A 4MBPA 4IO3A 3TCHA 3A3CA 3B6TA 4IGTA 5CMCA 3K6VA 3ILUB 5TPAA 4U1OA 3FIRA 1B2HA 2RC8A 4O3AA 3ODBA 1LAHE 4PFYA 3TPAA 3DP8A 2H5YA 4GOTA 1B4ZA 4DCYA 3LVUA 1PBPA 1B7HA 1ZKBA 2DWJA 4U21A 2RKMA 3MZBA 3N26A 4OFLA 3CG1A 4I1DA 3KJTA 4RYAA 5L9SA 4ZEDA 4AQ4A 1S9TA 3O2AA 4NF4B 2F5XA 3C32A 3K6XA 2D5WA 5EHSA 2NVUB 3MP8A 5F7VA 5A5XB 3RTWB 1Y3QA 2YPNA 3EN3A 1M5DA 3QAXA 4DLDA 5BUUA 2DE4A 2XD3A 3RYAA 1LB8A 3DRJA 3FVKA 3GBBA 3PUWE 3S9MC 1DTGA 1P1QA 4XKQA 1IIWA 1B46A 1TWYA 2DQVA 3K6UA 2GFEA 3O29A 1XVYA 4OHNA 3WAEA 5CM6A 2F78A 1DPPA 1Y1MA 3VVDA 3ZKLA 2QSXA 1ZTYA 1B7UA 2Z8EA 2E1SA 3G3GA 4U23A 2XXHA 3DRFA 1H45A 3DM0A 1MRPA 4X48A 2I4BA 4WXJA 1YPNA 1B0HA 3ZS6A 1PB9A 1MXXA 2ZXTA 2O7UA 4LONB 5H8HA 4DZ1A 4GXSB 1N76A 3IL1B 5M2VA 1LCFA 1UTHB 3UGWA 1VSOA 3M3LA 1AL3A 2OWTA 2ZYKA 3MQ9A 4ZEBA 5EHMA 3RT8A 1P1WA 4BLAA 1O7TA 5CMBA 3M8UA 3CSGA 1EZPA 2O51A 4QFNA 3IJOB 3JYRA 5B70A 3GXAA 3PPNA 4R6HA 1UIUA 1YTVA 4BDNA 5AA1A 1MDQA 2QMWA 1QKBA 4PFUA 3OO9A 5AA4B 3UA8A 1B1HA 1OVTA 3K1NA 3DRIA 1TFDA 1Q1KA 1GTKA 1MQIA 2F36A 3BFUA 4C1UA 5H8NB 4LQ2A 3VLWA 1GR2A 4DCXA 4F3SA 3H6TA 3H4ZA 4OEUA 3E3KA 1MS7A 4IO4A 5KDTB 1MM7A 3OEKA 5CRYA 2D21A 5FHOA 5H8QA 3MP6A 4JBZA 1B0LA 2ZYOA 3U92A 3QSLA 2I4CA 4NTLA 4ELOA 3MJNA 4QFLA 3SDFA 4THIA 3KZGA 3LSWA 3RT6B 1Y9UA 1Z7ME 2I6EA 2CZLA 3OD7A 1B3GA 4GF8A 4HCYA 3S4UA 3VLUA 2DVCA 2QS4A 2O6AA 3SEYA 3MVYA 3PMWA 1B05A 1N3XA 4R9FA 4AB6A 1JW5A 3PPQA 2QPQA 3HSTA 4EXLA 1LCTA 4F29A 3Q28A 1M5EA 2ZMBA 4GWOA 4XKRA 1SQYA 4WEPA 2I0CA 4GL8A 1IITA 3GZGA 4YB7A 2UVHA 4HS7A 1PBQA 3VXCA 5I58B 4DIGA 4JSOA 1JW4A 2Z8DA 1MY4A 1XOCA 1Y1ZA 2WKYA 5TP9A 3K4UA 4QRZA 2VD2A 1ZU0A 1SD3A 1QULA 2QS1A 3KJ7A 3ZSFA 1QKAA 3RYBA 2RCAA 5HPQA 2V3QA 1BIYA 1EU8A 2Y7KA 4F3GA 1OLCA 1R6ZA 2ZYMA 5K2YA 3K0VA 4ZDMA 4YB5A 3W9VA 5DEXB 3TTLA 1B3FA 3C9HA 1MXWA 3IJXB 1A40A 2A5SA 4H5GA 4U2RA 4NF5B 1LB9A 1NH7A 2XXTA 4R2BA 4RNSA 2P2AA 3GLBA 3HO7A 3OENA 3RLFE 5KDTA 3I3VA 3L6HA 3I6VA 1UTBA 2XXRA 3FVOA 3HV1A 5IKBA 3CG3A 1OQHA 2H9BA 2WOKA 3KN3A 5H8NA 3BFTA 3H6WA 4G77A 1NKXA 2ONRA 4JDFA 3TDJA 1URDA 5AE4A 2O84X 4ZE9A 4PFTA 5DVJA 4ZEFA 3PUZE 3PV0E 3MUQA 4F1UA 2V93A 4F31B 4FATA 5AA2D 3SEVA 1MQHA 2R6GE 1RYOA 4YU0A 2RC9A 3U93A 2DVZA 1JETA 3MPLA 4H8JA 1I6QA 1HSJA 1MY1A 5FTHA 2Q9TA 3T9VA 4DXBA 4F22A 2F97A 4Z7EA 1FQAA 1MY2A 3M3KA 2VP1A 3O97A 3R6UA 4C0RA 3OO8A 4DXCA 1VR5A 2ABHA 1Y4TA 3KN7A 3M3FA 4DXUA 1DPEA 3P7IA 4OFOA 1N0TA 3V5AA 1JEVA 3FUZA 4NF4A 4FECA 3N5LA 5DYHA 2X26A 4LATA 3H6UA 3R26A 3MVWA 2IEEA 1CE2A 3IORA 4FORA 1POY1 4F1YA 3CSBA 1US4A 3FXRA 5CI5A 2Q88A 3KEIA 4MH5A 5DT6A 4RK9A 4IO6A 4LP2B 2Q2CA 1DMBA 1MDP1 2OWSA 3L6GA 4FIMA 3CFLA 1FCKA 2QMXA 3PD9A 1A8FA 4MLQA 4Z0IA 1A54A 3RGYA 3PAMA 1HSEA 4L17A 1FQFA 4C1TA 1MQDA 2E0SA 2Q2AA 3EQ1A 2XXVA 3W9WA 2HZKA 2NXOA 4NEDA 1ANFA
chains in the Genus database with same CATH superfamily
4FBPA 4R9GA 3EPEA 4GRKA 1YYZA 2REJA 3S9NC 3G3JA 3Q29A 5TPAB 4PQJA 4YAHX 4NF6B 4N8GA 1MPDA 3JZJA 4EQ9A 3MVZA 3DRGA 3SEWA 1ZJLA 5KCJA 4O8MA 2Q8MA 5ELVA 1SW1A 4H45A 4XXUA 5FHNA 4ZZEA 2B3BA 1UQWA 2X7QA 3TTNA 2ZZWA 3TTKA 1UTBB 4JWOA 4XKPA 3ZKKA 3IB1A 3O6HA 1FPFA 4TOZA 3KBRA 2O1LA 1XVXA 4QSDA 1I69A 1JVXA 2Z23A 2A5TA 2KQZA 2H4IA 2DDKA 3CR9A 5AA3A 1R9LA 4JB7A 4JVCA 4H5FA 1M5CA 3D4CA 1IMBA 2XXQA 2XXWA 2UXAA 3IR1A 3RYDA 2ZNUA 1B7ZA 1B6HA 2V3UA 3R7XA 4DE8A 2PMSA 1MY3A 1N04A 4KHZE 2WBBA 3VDFA 4QFPA 3MW0A 4KYEA 1LBZA 2XXPA 2F35A 4N15A 1FTMA 1CNQA 3PUVE 3OSQA 4H65A 1GV8A 2OBGA 1R9QA 1B1XA 5HBCA 3KN8A 4NE4A 3K01A 1P1NA 2ZNSA 4NAPA 3U1OA 2F7BA 3DELB 2ZNTA 3RUMA 1B40A 4XTCQ 3SERA 2I58A 3TMGA 4KI0E 3S9EA 4ZEIA 2I3VA 3KBZA 4P8BA 3PPRA 1M5BA 1LBVA 4FJPA 4H0WA 3FVGA 2DSFA 1H43A 3SEUA 1B5JA 2KLFA 4P0IA 3UORA 2ONKE 3IX1A 3QUJA 1AIVA 4R75A 4PGPA 2DWAA 1H3DA 4ECFA 1CB6A 2V25A 2UVJA 1IXGA 5FHMA 3DP4A 4IO7A 5T3JA 2F8DA 3PU5A 1PC3A 1LAGE 1NUWA 5ITOA 4OXVA 1UTHA 1A55A 5EQ8A 3FXBA 1MXYA 2XD2A 2Y84A 1FTAA 1TXFA 2RC7A 2WYKA 4N07A 3TQWA 1NNFA 1IQ7A 4EF1A 3OO7A 4N81A 5EQAA 1IXCA 3MZ1A 2MKZA 5JTYB 2V3TA 1A99A 3BKIB 4U4XA 4Q8RA 4BDMA 1S50A 1SYIA 1AOVA 3O9PA 5ISUA 3CVGA 4NF6A 3TAJA 1QUJA 2ANJA 1FQCA 2F7CA 2VGQA 4N6PA 3T22A 1URSA 4JVIA 1Y3NA 1LFHA 3KSXA 2I3WA 1SVXB 1MQJA 5KZTA 1MQGA 4OANA 2L5VA 1TT1A 1JQFA 3TODA 1IMFA 1LBWA 2NOOA 4MNIA 3IO6A 4ND9A 1A8EA 3B8BA 1B3LA 2A5TB 1LFGA 1D9YA 4LZ7A 3U8QA 1B9JA 1IMCA 4U4SA 5DTBA 4MEVA 3FV1A 4RPOA 4POWA 2XA5A 4OETA 2FIEA 5DVIA 4YMBA 1B3HA 4NF5A 4R6YA 4OESA 4KXPA 2WEFA 1LEVA 2VOZA 4RXLA 3PPPA 4OTEA 3G3KA 3EHTA 2F7AA 2FNCA 1QUKA 4NGUA 3EHSA 3U72A 1MM6A 4FE8A 3RPWA 4OVQA 4LA9A 2RF1A 4OFJA 1II5A 3OMBA 3UP9A 1NUXA 3K6VA 5TPAA 3T0JA 1LAHE 2H5YA 4DCYA 1SPIA 1S9TA 1FSAA 3O2AA 3C32A 3MP8A 3RTWB 5J16A 3EN3A 3QAXA 2DE4A 1FBFA 3KC0A 1P1QA 1TWYA 2GFEA 3WAEA 5CM6A 1BK4A 1Y1MA 1FPKA 3VVDA 2QSXA 1B7UA 2Z8EA 1YPNA 1B0HA 3ZS6A 1PB9A 4DZ1A 5H8HA 3IL1B 3UGWA 2ZYKA 4BLAA 2O51A 4QFNA 3JYRA 3E79A 1UIUA 2QMWA 1Q1KA 4C1UA 1GR2A 4DCXA 1QGXA 4IO4A 5H8QA 2D21A 2ZYOA 2I4CA 4ELOA 2CZLA 1B3GA 4HCYA 2QS4A 4O7IA 1B05A 4R9FA 2QPQA 4EXLA 1LCTA 4X04A 2I0CA 5I58B 4DIGA 3BIGA 4JSOA 1JW4A 4AS5A 4LN5A 1FBCA 2WKYA 3K4UA 4GWSA 3KJ7A 2Y7KA 2BJIA 2ZYMA 3W9VA 3IJXB 2A5SA 4H5GA 4U2RA 4R2BA 5KDTA 5H8NA 3H6WA 3TDJA 1URDA 2O84X 4PFTA 4F1UA 4FATA 3MUQA 3SEVA 2R6GE 1RYOA 5FTHA 2F97A 3R6UA 1VR5A 2ABHA 1DPEA 1JEVA 3N5LA 2X26A 3IORA 2IEEA 1FJ9A 4NHBA 3KEIA 4HE2A 4LP2B 1DMBA 1MDP1 2OWSA 1FCKA 3PD9A 1HSEA 1FPDA 3EQ1A 2XXVA 1FBDA 3G3FA 2HZKA 3UN6A 5I58A 1KA0A 3CI8A 3LV0A 2DYXA 4MX6A 1R1NA 2ALUA 1L5TA 1S7YA 3LSXA 1IEJA 3D4GA 2B4MA 4YKJA 4H8IA 4GVOA 1WODA 3FD3A 4TQUQ 4UA8A 3K6WA 1NUZA 4PCDA 5ICTA 3VLVA 1NV0A 2Y7RA 4KD5A 5AA2B 1B51A 1J1NA 4YMAA 3FZVA 3A09A 4OENA 4OVRA 4P1EA 5H8HB 1AH5A 2GH9A 3C36A 4WKMA 3OSRA 2DP8A 1MH3A 3MAMA 1GGGA 5ITPA 3RNNA 4NMYA 2V84A 2Q8JA 1FW0A 4XF5A 2WOPA 2QFLA 4G8HA 1MXUA 1SBPA 2DWIA 1NNPA 4N13A 4KYDA 3FGSA 3FV2A 3DLNA 1IXIA 2O7IA 5I59A 4RPNA 3HFUA 5H8FB 1NNKA 3Q27A 3RQTA 3KC1A 1MXZA 2G93A 3FBPA 4KCDA 4QFKA 4GX6A 3ONMA 1QJMA 2HQ0A 1XS5A 3N6UA 5H8QB 4ESWA 1PB8A 4OEVA 4ELPA 3FJGA 1VFEA 3OXNA 4M4GA 2OK2A 1FPEA 2Y7PA 1OIBA 3U94A 1PDAA 2WBDA 3VV5A 3TTMA 4YKIA 3HPIA 3TCFA 1NNTA 4MMPA 4QBAA 4KFQA 4NG7A 3OO6A 3KOTA 3GBAA 1K9YA 3MWBA 1B5HA 1USYE 3C35A 3PD8A 4GFRA 3A3UA 1JVYA 5JK4A 5EQ7A 2XX8A 5IZZA 3MC2A 2UYEA 4OMBA 4I3YA 3T9UA 3V89B 4HCWA 1DOTA 5I2NA 3IAZA 2GHAA 4MFIA 3VVEA 4GX3A 3KOSA 4GXAA 2WX9A 3KGCA 5IAIA 1NV2A 1BKAA 3FJMA 1N7XA 5CMKA 3SKPA 2Z8FA 3TYHA 3IOVA 3H6VA 3TTRA 2CEXA 4GWZA 4F2QA 5CMMA 4FEDA 3MZ9A 3SEXA 4N4UA 4EUOA 3O6IA 1DCUA 1MG1A 4ELQA 4HW8A 3PUYE 2FA7A 1SW2A 1MPBA 4JXIA 4MAGA 1RYXA 2YLNA 1FQEA 3TELA 1FTKA 2QRYA 3MVXA 3E4RA 3IB2A 2GQ1A 1FTLA 5TU0A 1LSTA 5FTIA 3LC8A 5EYFA 2QS2A 4RY1A 3RN8A 4NF8A 2H98A 1INPA 1RDYA 2F6GA 1JP4A 1FTJA 4I3EA 2I49A 4Q0CA 2DXRA 3AXFA 4PE5B 3T1BA 4YKPA 4OZ9A 4KQPA 2VD3A 2GHBA 3E9XA 4X8RA 2OX3A 4JWYA 3KSJA 5ET6A 1SW5A 2XWKA 4JVDA 2XWIA 2DE3A 1IMEA 4DDDA 4IGRA 4G68B 5I2KB 1NI9A 3MYUA 3VXBA 3UK4A 2R71A 3PTYA 1P1UA 4GBWA 4IO5A 4LVQA 3C33A 3RPLB 2R9JA 3QXMA 3FJ7A 2NUVA 4GLIA 3PGFA 3CRBA 5CMCA 3TCHA 2OWZA 1IMAA 3TPAA 4GOTA 1B4ZA 1PBPA 4PFBA 2DWJA 1NUYA 3MZBA 3N26A 4I1DA 5EYGA 4RYAA 4AQ4A 2P3VA 4G61A 4NF4B 3K6XA 2YPNA 4DLDA 1M5DA 2XD3A 3RYAA 3GBBA 3S9MC 2F3DA 1DTGA 4MNPA 1IIWA 3K6UA 3O29A 4OA4A 5IGAA 3ZKLA 3G3GA 2ZXTA 5M2VA 1LCFA 1P1WA 5CMBA 3M8UA 3CSGA 1EZPA 3IJOB 3GXAA 4PTKA 2HXRA 1MDQA 5I5PA 4PFUA 3OO9A 3UA8A 1B1HA 1MQIA 3BFUA 3VLWA 2CZKA 3H6TA 3H4ZA 2HPGA 3E3KA 5F24A 5CRYA 1B0LA 3QSLA 4NTLA 4N6KA 4THIA 3KZGA 1Y9UA 4N8YA 4GF8A 3VLUA 2O6AA 1JW5A 3PPQA 3HSTA 4NF0A 1M5EA 2ZMBA 2FBPA 1SQYA 2PFYA 3GZGA 1LBYA 5FBPA 2VPOA 2Z8DA 1Y1ZA 4QRZA 1ZU0A 1SD3A 1QKAA 3RYBA 2RCAA 3K0VA 3GYYA 4PAFA 3TTLA 1FBHA 4RNSA 4MIJA 3L6HA 5IKBA 3FVOA 2WOKA 3KN3A 3BFTA 3D1RA 4JDFA 4ZE9A 3PUZE 3PV0E 2FVZA 4YU0A 1JETA 3MPLA 1HSJA 1MY1A 4AS4A 3T9VA 3IFAA 1FQAA 1MY2A 3O97A 4DXCA 3P7IA 3FUZA 4FECA 5DYHA 4LATA 3H6UA 3R26A 3MVWA 4PDDA 4F1YA 3FXRA 4MH5A 4HE1A 4MLQA 1A54A 3RGYA 4NEDA 3E78A 2B65A 4QSEA 3QK6A 2BJJX 1I6AA 1LAXA 3HCQA 4ZS9A 4OERA 3LBSA 2X7PA 4XIGQ 4GBVA 4R6KA 3USDA 4UABA 4YZZA 3TZAA 4R73A 4IB2A 5H8SA 4IO2A 2ZZXA 4EDPA 4PF8A 3PPOA 3C4MA 2ESNA 4HTGA 4F39A 4ZEKA 3RTFB 2DE2A 4GWYA 4N6DA 3OOAA 4M1VA 2RINA 4BDQA 3UIFA 2XXYA 2XXUA 3H3GA 4FEBA 1ZBMA 4DI4B 4O3CA 3B7DA 4GWXA 4RK2A 3CHGA 3KFMA 2IA4A 1VFDA 4NN3A 2O68A 4OVSA 4ZE8A 1N7WA 2OCUA 1IUDA 3CFZA 3FASA 3O28A 1SDXA 1PEBA 4H67A 3VE1B 4X1BA 3ILTB 2QVVA 4GWWA 4EQ7A 2HCAA 3G3IA 1DBZA 5HM4B 4RA1A 3W15C 4TLLB 1RKMA 3LUZA 5CC2A 3B6WA 4H6DA 2H25A 1FQBA 4F1VA 1DSNA 3IB0A 2HAVA 5L9OA 1FBEA 2PVUA 1OQGA 3WAFA 1URGA 3MP1A 3QYTA 4MNCA 5KCJB 4NQ8A 1FBGA 4PE3A 4IY6A 4LUBA 1I6BA 1OVBA 1NV1A 2I48A 4IR8A 5A5XA 2UVGA 4JSDA 3QMFA 4OWDA 1O63A 1G0HA 5DEXA 4ESXA 3O66A 1BLFA 1D9QA 1ELJA 1Z7NE 5JEIA 1QUIA 3LUYA 3MBPA 4R74A 4NWDA 2GRVA 1D4NA 1OMPA 1ZIUA 3DRKA 1MXVA 4YKKA 2Z22A 1EH3A 1FPBA 2PFZA 1QW0A 1AMFA 2AL4A 2PT2A 3IOUA 1FPJA 1YAEA 1G0IA 2B4LA 2YJPA 1WVJA 4GX4A 1Y4CA 3PUXE 5CBRA 1NV5A 2G29A 4MCOA 1TFAA 4KR5A 4IY5A 2V4CA 4UACA 1B52A 2Y7WA 1OLAA 1WDNA 4QFOA 1EYIA 1VE4A 4BDLA 3V83A 4PGNA 3QIMA 3EHUA 3K1MA 3LSLA 4I62A 2P1SA 2I0BA 4U22A 2R8TA 3TKDA 2M8CA 2XHDA 1IXHA 3IOTA 4G4PA 1O64A 4PFRA 1NL5A 2Q89A 4I40A 1N84A 1LBCA 1MPCA 4PFIA 5I59B 1XI6A 5IZ1A 1B5IA 1USYH 4F19A 4JWXA 3S2VA 4XFEA 1FPLA 5BWJA 5LOMA 4G68C 4QHQA 3H7MA 4EXKA 3E13X 3OEMA 2Y5KA 4G68A 5I2KA 1P1OA 3FVNA 3K2DA 1SYHA 2DXYA 4OVTA 5CBSA 3KG2A 4X9TA 2WOLA 1NMUA 3V8XB 2ZZVA 4PDHA 4K3FA 4MHFA 4PAKA 3T96B 3ECRA 1XT8A 4PP0A 1POTA 1IMDA 5AA2A 2QL3A 1XC1A 1LBBA 3TEPA 3SETA 1DK4A 3EKIA 5ET5A 3B50A 2HFBA 4ONYA 2AL5A 3FXQA 2Q74A 4MBPA 4IGTA 4P9KA 1B2HA 5EQ9A 1B7HA 1ZKBA 3SZPA 4OFLA 3CG1A 5L9SA 2F5XA 4DI3D 2D5WA 5F7VA 1Y3QA 5BUUA 1FRPA 1FJ6A 1LB8A 3FVKA 3PUWE 4XKQA 2DQVA 1XVYA 4OHNA 1ZTYA 2E1SA 4U23A 5ET7A 3A29A 4WXJA 1MXXA 4LONB 2O7UA 4P56A 1VDWA 1N76A 5EHMA 3RT8A 4ZEBA 4P47A 3PPNA 4R6HA 1YTVA 5AA1A 5AA4B 1OVTA 3K1NA 1GTKA 2F36A 4OEUA 1MS7A 3OEKA 5FHOA 2CZIA 3MP6A 4QFLA 3SDFA 3LSWA 3RT6B 2I6EA 3S4UA 2DVCA 3SEYA 1N3XA 4AB6A 4F29A 4GWOA 4XKRA 4WEPA 4GL8A 1IITA 4YB7A 1EYJA 5TP9A 3ZSFA 1QULA 4N17A 5HPQA 1BIYA 4F3GA 1OLCA 4ZDMA 5DEXB 1MXWA 4NF5B 1NH7A 3GLBA 3HO7A 4GWUA 1NV3A 1UTBA 1YXIA 1OQHA 4G77A 1NKXA 2ONRA 5AA2D 2RC9A 2DVZA 1I6QA 4F22A 4Z7EA 4C0RA 3OO8A 4DXUA 4OFOA 4NF4A 1KA1A 4FORA 1US4A 5CI5A 5DT6A 2WYPA 4IO6A 4RK9A 2Q2CA 2Y5LA 3L6GA 2QMXA 2QVUA 4C1TA 4L17A 1FQFA 3BIHA 1MQDA 2E0SA 3W9WA 2NXOA 4ELRA 4I9DA 1B4HA 5I56B 3T66A 4G8NA 1RDZA 4OVJA 3HN0A 4LZ5A 1LBXA 1ATGA 2O69A 2OZZA 1M5FA 1D3KA 4GL0A 5DW8A 4WEDA 4RJZA 3RPLA 4AB5A 1DTZA 5AA4A 3IK6B 3K1PA 4KCCA 2XWVA 2NWJA 2QJEA 3IOWA 2B3FA 2OJTA 1BTJA 4R2FA 4Q30B 1LLSA 4F2OA 2VPNA 3K02A 5K2XA 1ZMGA 3NOHA 4F3PA 3C31A 1FPGA 2AIXA 2F34A 2RCBA 4KPTA 4BDRA 1YZ0A 1SI1A 1YCJA 1A7LA 2FHYA 2KR0A 4BDOA 3FTOA 3CFXA 2QVRA 3I5OA 3BBRA 4PF6A 1B58A 1PB7A 2HXWA 1D9VA 5I56A 3T93B 2THIA 3QUFA 5ICQA 1EZ9A 4NF8B 3VFJA 3HHGA 2XXXA 3THIA 1US5A 3FXUA 2QS3A 3T9XB 3G3HA 2DOJA 3H03A 1NFTA 2AYSA 2D3IA 3CIJA 4F18A 2O1MA 3N94A 2PCRA 2XX9A 4OQOA 1H44A 1GVCA 4O3BA 3O6GA 4E0XA 1Q9DA 5JTYA 1B3EA 1BP5A 1MH4A 3IFCA 3SESA 4H46A 4YB6A 1P99A 4ZZAA 4LQ5A 3T9HB 1SI0A 2DWHA 1QVSA 3G7WA 4EQBA 2CMOA 4Q5TA 3VVFA 4TLMB 3ROJA 4P0GA 3HHFA 4ZECA 2FYIA 1XHYA 3FATA 5H8FA 1NV6A 5TP9B 2P0SA 2CZHA 3IO4A 2JJKA 2HEUA 1ZLQA 1NV7A 2F3BA 2UVIA 5F1QA 1LGBC 2Y7IA 3B6QA 4POXA 2OLBA 2ONSA 2LAOA 5ESYA 4G2ZA 1JEUA 4EF2A 3TFLA 1SW4A 4MLVA 4XKNA 3JV9A 4ISUA 3Q25A 3RY3A 2P3NA 2PX1A 1LFIA 1EZOA 4GIZA 3O6PA 1KWHA 5I84A 3C34A 5LDZA 2VT5A 4OVPA 3N6TA 2XXKA 4YICA 5B7DA 1HSLA 4E0WA 5I3SA 2FIXA 5L8DA 5I2NB 4OYVA 1JNFA 1H76A 3S9LC 2REGA 2XX7A 1FTOA 5J1DA 2PBWA 4PFWA 5I7IA 3PMXA 2DS9A 2W7YA 4QF9A 1MY0A 3F11A 4PBQA 5I57B 3K00A 2PT1A 5LTCA 5L9MA 1Q35A 1B32A 2CEYA 3LR1A 4KYSA 4NWCA 4HE0A 1FQDA 2F6PA 4I8CA 4PAIA 1AWBA 5EYHA 4FAJA 1N3WA 4GD5A 1JW1A 4LZ8A 2PYYA 3LSFB 1F9BA 2H99A 3TQLA 1Y20A 2HAUA 2ZYNA 4H1XA 3OELA 3Q26A 4QSCA 5DVFA 1Y3PA 1UIVA 3DRHA 1IZ1A 2XWOA 4XEQA 4QXDA 4MF3A 3H06B 4R72A 5I57A 1LAFE 1T0KA 1K9ZA 2UYFA 3TCGA 3PMVA 2HZLA 3DP6A 4F3BA 1NH8A 4PETA 2XXIA 2VHAA 4G8MA 3EF7A 4U1ZA 2HHMA 3TUSA 5IZ3A 4P11A 3U65A 3MPKA 4X1DA 4NX1A 4IO3A 3B6TA 3A3CA 3ILUB 3MSTA 4U1OA 3FIRA 2RC8A 4O3AA 3ODBA 4PFYA 3DP8A 5IM2A 3LVUA 1NV4A 4U21A 2RKMA 3KJTA 4ZEDA 5IZ3B 1KZ8A 5EHSA 2NVUB 5A5XB 1RDXA 3DRJA 1B46A 2F78A 1DPPA 5ET8A 4X48A 2XXHA 3DRFA 1H45A 3DM0A 1MRPA 2I4BA 4GXSB 1UTHB 1VSOA 3M3LA 1AL3A 2OWTA 3MQ9A 1FPIA 1O7TA 4N91A 5B70A 4BDNA 1QKBA 3DRIA 1TFDA 5H8NB 4LQ2A 4F3SA 5KDTB 1MM7A 4JBZA 4PBHA 3U92A 3MJNA 1Z7ME 3OD7A 3MVYA 3PMWA 3Q28A 1EYKA 2UVHA 4HS7A 1PBQA 3VXCA 4HXVA 1MY4A 1XOCA 2VD2A 4MJOA 2QS1A 2V3QA 1EU8A 5K2YA 1R6ZA 4YB5A 1B3FA 3C9HA 1A40A 1LB9A 2XXTA 4O7MA 2P2AA 3OENA 3RLFE 1FBPA 3I3VA 3I6VA 2XXRA 3HV1A 3CG3A 2H9BA 5AE4A 5DVJA 4ZEFA 4F31B 2V93A 1MQHA 4P3LA 3U93A 4H8JA 3ISPA 2Q9TA 4P1LA 4DXBA 3M3KA 2VP1A 4O94A 3KN7A 1Y4TA 3M3FA 1N0TA 3V5AA 1CE2A 1POY1 3CSBA 2Q88A 4FIMA 3CFLA 4Z0IA 1A8FA 4PC9A 3PAMA 5A5LA 2Q2AA 4GQOA 1ANFA
chains in the Genus database with same CATH topology
5I58A 2B65A 3CI8A 4QSEA 4ELRA 3QK6A 4R9GA 2DYXA 2BJJX 1R1NA 2ALUA 1I6AA 4I9DA 1LAXA 1B4HA 3EPEA 3HCQA 1L5TA 4GRKA 3T66A 1S7YA 2REJA 4ZS9A 3G3JA 3LSXA 4OERA 4G8NA 3S9NC 1IEJA 3D4GA 2B4MA 3Q29A 5TPAB 4YKJA 4PQJA 3LBSA 2X7PA 3HN0A 4OVJA 4XIGQ 4H8IA 4LZ5A 1ATGA 4YAHX 4NF6B 4R6KA 3USDA 4GVOA 1WODA 2O69A 3FD3A 4TQUQ 4UA8A 2OZZA 3K6WA 1M5FA 1MPDA 4YZZA 4R73A 1D3KA 3JZJA 4IB2A 3TZAA 4EQ9A 5H8SA 3MVZA 4IO2A 5ICTA 3VLVA 3DRGA 3SEWA 2Y7RA 4KD5A 5AA2B 1ZJLA 4GL0A 1B51A 4WEDA 4RJZA 1J1NA 5KCJA 4AB5A 4EDPA 1DTZA 5AA4A 4YMAA 3IK6B 3FZVA 5ELVA 3A09A 1SW1A 3C4MA 3K1PA 3PPOA 4OENA 2ESNA 4KCCA 2NWJA 4XXUA 5FHNA 4ZZEA 2QJEA 2B3BA 3IOWA 4HTGA 2B3FA 2OJTA 4F39A 1UQWA 1BTJA 2X7QA 4ZEKA 4R2FA 3RTFB 2DE2A 3TTNA 4Q30B 5H8HB 1AH5A 1LLSA 3TTKA 1UTBB 2GH9A 3C36A 4JWOA 4XKPA 4WKMA 3ZKKA 4F2OA 3OOAA 3OSRA 2DP8A 1MH3A 3K02A 4M1VA 1ZMGA 3IB1A 3MAMA 2RINA 5K2XA 1GGGA 4F3PA 3O6HA 3C31A 4TOZA 4GQOA 5ITPA 4BDQA 3UIFA 2XXYA 2XXUA 3H3GA 3KBRA 2O1LA 4NMYA 2AIXA 3RNNA 1XVXA 2F34A 2RCBA 4FEBA 1ZBMA 4KPTA 4QSDA 2V84A 2Q8JA 1FW0A 2WOPA 1I69A 1JVXA 2Z23A 4G8HA 2A5TA 1MXUA 2H4IA 1SBPA 2DWIA 3B7DA 4O3CA 1NNPA 4RK2A 3CHGA 3CR9A 2IA4A 3KFMA 4N13A 4BDRA 5AA3A 1R9LA 1SI1A 1VFDA 1YCJA 3FGSA 2O68A 1M5CA 3D4CA 1A7LA 4H5FA 2XXQA 4KYDA 2XXWA 3FV2A 2UXAA 3DLNA 3IR1A 4ZE8A 1N7WA 2OCUA 1IUDA 3CFZA 3FASA 4BDOA 1IXIA 3FTOA 1SDXA 2O7IA 1PEBA 3CFXA 3O28A 2ZNUA 4H67A 3I5OA 3BBRA 3VE1B 4RPNA 5I59A 1B58A 1B7ZA 1PB7A 5H8FB 2HXWA 1NNKA 3Q27A 3RQTA 1D9VA 5I56A 4X1BA 1B6HA 1MXZA 3ILTB 2V3UA 3R7XA 3T93B 2G93A 4DE8A 4KCDA 2PMSA 3SERA 4QFKA 1MY3A 1N04A 2THIA 3QUFA 4KHZE 4EQ7A 3ONMA 5ICQA 1QJMA 3VDFA 2HQ0A 5JTYA 1XS5A 1EZ9A 4QFPA 3N6UA 4NF8B 5H8QB 3VFJA 2HCAA 3MW0A 2XXXA 3HHGA 4KYEA 3THIA 4ESWA 3G3IA 5HM4B 4RA1A 1PB8A 4OEVA 3W15C 4TLLB 4ELPA 3FJGA 2XXPA 1VFEA 2F35A 1US5A 3OXNA 1RKMA 1FTMA 3FXUA 2QS3A 3T9XB 3G3HA 2DOJA 3H03A 5CC2A 1NFTA 3B6WA 3PUVE 2AYSA 2D3IA 3CIJA 4M4GA 4F18A 3OSQA 2O1MA 2OK2A 4H6DA 4H65A 3N94A 2XX9A 2Y7PA 4OQOA 2H25A 1H44A 1GVCA 1GV8A 1FQBA 1OIBA 3U94A 4O3BA 4F1VA 3O6GA 1DSNA 1PDAA 4E0XA 3IB0A 1B3EA 3VV5A 1BP5A 4YKIA 3HPIA 3TTMA 2HAVA 1MH4A 2OBGA 1R9QA 3TCFA 5L9OA 1B1XA 5HBCA 3SESA 1NNTA 2PVUA 3KN8A 4NE4A 3K01A 4YB6A 1P99A 1P1NA 2ZNSA 1OQGA 3WAFA 1URGA 3MP1A 3QYTA 4ZZAA 4LQ5A 4KFQA 3OO6A 3U1OA 2F7BA 3KOTA 5KCJB 3GBAA 3DELB 2ZNTA 3T9HB 4IY6A 3MWBA 1B40A 1SI0A 4LUBA 1I6BA 4XTCQ 1B5HA 1OVBA 3RUMA 2I48A 2I58A 3TMGA 2DWHA 4KI0E 5A5XA 3S9EA 4ZEIA 2UVGA 1QVSA 2I3VA 3G7WA 4EQBA 4JSDA 1USYE 2CMOA 4GFRA 3A3UA 3C35A 1M5BA 3PD8A 3PPRA 4Q5TA 4TLMB 3VVFA 4FJPA 4OWDA 1O63A 3FVGA 4H0WA 4P0GA 3HHFA 1JVYA 2DSFA 5JK4A 1H43A 5DEXA 2XX8A 3SEUA 1B5JA 4ZECA 2FYIA 4ESXA 1XHYA 3O66A 3FATA 2KLFA 1BLFA 3MC2A 4P0IA 5H8FA 3UORA 2UYEA 4OMBA 1ELJA 2ONKE 5TP9B 3IX1A 2P0SA 3IO4A 3QUJA 1AIVA 3T9UA 3V89B 1Z7NE 2HEUA 5JEIA 1QUIA 4HCWA 3LUYA 3MBPA 4R75A 1ZLQA 4R74A 4NWDA 2GRVA 1DOTA 5F1QA 1H3DA 2DWAA 2UVIA 1LGBC 4ECFA 5I2NA 1D4NA 1OMPA 2Y7IA 3IAZA 1CB6A 2GHAA 2V25A 1ZIUA 3B6QA 4MFIA 2UVJA 3VVEA 4POXA 1IXGA 5FHMA 3KOSA 4GXAA 3DP4A 2OLBA 2ONSA 2LAOA 3KGCA 4IO7A 2F8DA 3DRKA 5IAIA 1MXVA 3PU5A 3FJMA 1BKAA 4YKKA 2Z22A 1N7XA 1EH3A 1PC3A 1LAGE 1QW0A 5CMKA 1AMFA 4G2ZA 5ITOA 2AL4A 2PT2A 3SKPA 1JEUA 2Z8FA 3TYHA 4EF2A 3IOVA 3IOUA 4OXVA 1UTHA 1A55A 3H6VA 1YAEA 3TTRA 3TFLA 4F2QA 1SW4A 2B4LA 5CMMA 4FEDA 3MZ9A 4MLVA 4XKNA 2YJPA 3SEXA 1MXYA 1WVJA 4EXKA 4EUOA 2XD2A 3O6IA 1Y4CA 2Y84A 3JV9A 1TXFA 3PUXE 4ISUA 5CBRA 2RC7A 3Q25A 3RY3A 1MG1A 4N07A 3TQWA 4ELQA 4HW8A 5I56B 1NNFA 1IQ7A 3PUYE 2PX1A 4EF1A 1LFIA 3OO7A 1EZOA 2G29A 4GIZA 1TFAA 1IXCA 4IY5A 3MZ1A 4KR5A 2FA7A 1SW2A 4UACA 1B52A 1MPBA 2Y7WA 5JTYB 2V3TA 1OLAA 1A99A 4QFOA 1WDNA 3O6PA 3BKIB 1KWHA 4U4XA 4BDMA 4Q8RA 4JXIA 5I84A 1S50A 1SYIA 1RYXA 1AOVA 3O9PA 2YLNA 1FQEA 5ISUA 3C34A 3CVGA 4NF6A 3TELA 1FTKA 2QRYA 3N6TA 3MVXA 1VE4A 3TAJA 3E4RA 4YICA 3IB2A 4BDLA 1QUJA 5B7DA 3V83A 1FTLA 1HSLA 2ANJA 5TU0A 1FQCA 4E0WA 1LSTA 3QIMA 2F7CA 2VGQA 3EHUA 3K1MA 3LSLA 5L8DA 3LC8A 4I62A 4N6PA 2P1SA 5FTIA 3T22A 1URSA 2I0BA 5I2NB 1Y3NA 4OYVA 2QS2A 4U22A 4RY1A 5EYFA 4NF8A 3RN8A 2H98A 3TKDA 1LFHA 2M8CA 1JNFA 1H76A 3S9LC 2F6GA 3KSXA 2REGA 2I3WA 1SVXB 2XX7A 1FTOA 2XHDA 1MQJA 1FTJA 5KZTA 1MQGA 1IXHA 3IOTA 2I49A 4G4PA 4Q0CA 1O64A 1NL5A 5J1DA 2PBWA 2Q89A 3G3FA 4PFWA 1N84A 2DXRA 1LBCA 3AXFA 2DS9A 3PMXA 4PE5B 3UN6A 1MPCA 5I59B 2W7YA 4YKPA 1TT1A 4QF9A 4OZ9A 4KQPA 1B5IA 1MY0A 1JQFA 1USYH 3F11A 5I57B 3K00A 2PT1A 3TODA 4F19A 2NOOA 2VD3A 4JWXA 3S2VA 5L9MA 1Q35A 1B32A 2GHBA 3E9XA 3IO6A 3LR1A 4JWYA 1A8EA 4ND9A 5BWJA 1B3LA 4KYSA 4NWCA 5LOMA 3KSJA 1FQDA 1SW5A 2F6PA 4G68C 4I8CA 2A5TB 1LFGA 4QHQA 3H7MA 2DE3A 4FAJA 1N3WA 4GD5A 1D9YA 3E13X 3OEMA 1JW1A 4G68A 1P1OA 4LZ7A 4LZ8A 5I2KA 3FVNA 3K2DA 3U8QA 2PYYA 4DDDA 3LSFB 1B9JA 1F9BA 1SYHA 4IGRA 2DXYA 4U4SA 2H99A 5DTBA 3FV1A 4G68B 5I2KB 5CBSA 3TQLA 3KG2A 4X9TA 2WOLA 3VXBA 1NMUA 1Y20A 3UK4A 4RPOA 3V8XB 4JB7A 4K3FA 2HAUA 2R71A 2ZYNA 4H1XA 3OELA 3Q26A 4POWA 4QSCA 5DVFA 1Y3PA 1P1UA 3T96B 4IO5A 1UIVA 4OETA 3DRHA 1IZ1A 5DVIA 4YMBA 1B3HA 4MF3A 3H06B 4NF5A 4R72A 4R6YA 4OESA 1LAFE 4LVQA 5I57A 1T0KA 2UYFA 3ECRA 3TCGA 2VOZA 3PMVA 1XT8A 2HZLA 3C33A 3DP6A 3PPPA 4RXLA 4PP0A 1NH8A 4F3BA 1POTA 4OTEA 2R9JA 4PETA 5AA2A 2QL3A 2XXIA 3G3KA 1XC1A 1LBBA 2VHAA 2F7AA 3EHTA 4G8MA 3EF7A 4U1ZA 2FNCA 3TEPA 3QXMA 1QUKA 3SETA 3FJ7A 3TUSA 3EHSA 3U72A 1MM6A 2NUVA 4FE8A 3RPWA 4P11A 2HFBA 4GLIA 3MPKA 4LA9A 2RF1A 3PGFA 4ONYA 3CRBA 4OFJA 2AL5A 4X1DA 3FXQA 1II5A 3OMBA 3UP9A 4MBPA 4IO3A 3TCHA 3A3CA 3B6TA 4IGTA 5CMCA 3K6VA 3ILUB 5TPAA 4U1OA 3FIRA 1B2HA 2RC8A 4O3AA 3ODBA 1LAHE 4PFYA 3TPAA 3DP8A 2H5YA 4GOTA 1B4ZA 4DCYA 3LVUA 1PBPA 1B7HA 1ZKBA 2DWJA 4U21A 2RKMA 3MZBA 3N26A 4OFLA 3CG1A 4I1DA 3KJTA 4RYAA 5L9SA 4ZEDA 4AQ4A 1S9TA 3O2AA 4NF4B 2F5XA 3C32A 3K6XA 2D5WA 5EHSA 2NVUB 3MP8A 5F7VA 5A5XB 3RTWB 1Y3QA 2YPNA 3EN3A 1M5DA 3QAXA 4DLDA 5BUUA 2DE4A 2XD3A 3RYAA 1LB8A 3DRJA 3FVKA 3GBBA 3PUWE 3S9MC 1DTGA 1P1QA 4XKQA 1IIWA 1B46A 1TWYA 2DQVA 3K6UA 2GFEA 3O29A 1XVYA 4OHNA 3WAEA 5CM6A 2F78A 1DPPA 1Y1MA 3VVDA 3ZKLA 2QSXA 1ZTYA 1B7UA 2Z8EA 2E1SA 3G3GA 4U23A 2XXHA 3DRFA 1H45A 3DM0A 1MRPA 4X48A 2I4BA 4WXJA 1YPNA 1B0HA 3ZS6A 1PB9A 1MXXA 2ZXTA 2O7UA 4LONB 5H8HA 4DZ1A 4GXSB 1N76A 3IL1B 5M2VA 1LCFA 1UTHB 3UGWA 1VSOA 3M3LA 1AL3A 2OWTA 2ZYKA 3MQ9A 4ZEBA 5EHMA 3RT8A 1P1WA 4BLAA 1O7TA 5CMBA 3M8UA 3CSGA 1EZPA 2O51A 4QFNA 3IJOB 3JYRA 5B70A 3GXAA 3PPNA 4R6HA 1UIUA 1YTVA 4BDNA 5AA1A 1MDQA 2QMWA 1QKBA 4PFUA 3OO9A 5AA4B 3UA8A 1B1HA 1OVTA 3K1NA 3DRIA 1TFDA 1Q1KA 1GTKA 1MQIA 2F36A 3BFUA 4C1UA 5H8NB 4LQ2A 3VLWA 1GR2A 4DCXA 4F3SA 3H6TA 3H4ZA 4OEUA 3E3KA 1MS7A 4IO4A 5KDTB 1MM7A 3OEKA 5CRYA 2D21A 5FHOA 5H8QA 3MP6A 4JBZA 1B0LA 2ZYOA 3U92A 3QSLA 2I4CA 4NTLA 4ELOA 3MJNA 4QFLA 3SDFA 4THIA 3KZGA 3LSWA 3RT6B 1Y9UA 1Z7ME 2I6EA 2CZLA 3OD7A 1B3GA 4GF8A 4HCYA 3S4UA 3VLUA 2DVCA 2QS4A 2O6AA 3SEYA 3MVYA 3PMWA 1B05A 1N3XA 4R9FA 4AB6A 1JW5A 3PPQA 2QPQA 3HSTA 4EXLA 1LCTA 4F29A 3Q28A 1M5EA 2ZMBA 4GWOA 4XKRA 1SQYA 4WEPA 2I0CA 4GL8A 1IITA 3GZGA 4YB7A 2UVHA 4HS7A 1PBQA 3VXCA 5I58B 4DIGA 4JSOA 1JW4A 2Z8DA 1MY4A 1XOCA 1Y1ZA 2WKYA 5TP9A 3K4UA 4QRZA 2VD2A 1ZU0A 1SD3A 1QULA 2QS1A 3KJ7A 3ZSFA 1QKAA 3RYBA 2RCAA 5HPQA 2V3QA 1BIYA 1EU8A 2Y7KA 4F3GA 1OLCA 1R6ZA 2ZYMA 5K2YA 3K0VA 4ZDMA 4YB5A 3W9VA 5DEXB 3TTLA 1B3FA 3C9HA 1MXWA 3IJXB 1A40A 2A5SA 4H5GA 4U2RA 4NF5B 1LB9A 1NH7A 2XXTA 4R2BA 4RNSA 2P2AA 3GLBA 3HO7A 3OENA 3RLFE 5KDTA 3I3VA 3L6HA 3I6VA 1UTBA 2XXRA 3FVOA 3HV1A 5IKBA 3CG3A 1OQHA 2H9BA 2WOKA 3KN3A 5H8NA 3BFTA 3H6WA 4G77A 1NKXA 2ONRA 4JDFA 3TDJA 1URDA 5AE4A 2O84X 4ZE9A 4PFTA 5DVJA 4ZEFA 3PUZE 3PV0E 3MUQA 4F1UA 2V93A 4F31B 4FATA 5AA2D 3SEVA 1MQHA 2R6GE 1RYOA 4YU0A 2RC9A 3U93A 2DVZA 1JETA 3MPLA 4H8JA 1I6QA 1HSJA 1MY1A 5FTHA 2Q9TA 3T9VA 4DXBA 4F22A 2F97A 4Z7EA 1FQAA 1MY2A 3M3KA 2VP1A 3O97A 3R6UA 4C0RA 3OO8A 4DXCA 1VR5A 2ABHA 1Y4TA 3KN7A 3M3FA 4DXUA 1DPEA 3P7IA 4OFOA 1N0TA 3V5AA 1JEVA 3FUZA 4NF4A 4FECA 3N5LA 5DYHA 2X26A 4LATA 3H6UA 3R26A 3MVWA 2IEEA 1CE2A 3IORA 4FORA 1POY1 4F1YA 3CSBA 1US4A 3FXRA 5CI5A 2Q88A 3KEIA 4MH5A 5DT6A 4RK9A 4IO6A 4LP2B 2Q2CA 1DMBA 1MDP1 2OWSA 3L6GA 4FIMA 3CFLA 1FCKA 2QMXA 3PD9A 1A8FA 4MLQA 4Z0IA 1A54A 3RGYA 3PAMA 1HSEA 4L17A 1FQFA 4C1TA 1MQDA 2E0SA 2Q2AA 3EQ1A 2XXVA 3W9WA 2HZKA 2NXOA 4NEDA 1ANFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I58 A;  2B65 A;  3CI8 A;  4QSE A;  4ELR A;  3QK6 A;  4R9G A;  2DYX A;  2BJJ X;  1R1N A;  2ALU A;  1I6A A;  4I9D A;  1LAX A;  1B4H A;  3EPE A;  3HCQ A;  1L5T A;  4GRK A;  3T66 A;  1S7Y A;  2REJ A;  4ZS9 A;  3G3J A;  3LSX A;  4OER A;  4G8N A;  3S9N C;  1IEJ A;  3D4G A;  2B4M A;  3Q29 A;  5TPA B;  4YKJ A;  4PQJ A;  3LBS A;  2X7P A;  3HN0 A;  4OVJ A;  4XIG Q;  4H8I A;  4LZ5 A;  1ATG A;  4YAH X;  4NF6 B;  4R6K A;  3USD A;  4GVO A;  1WOD A;  2O69 A;  3FD3 A;  4TQU Q;  4UA8 A;  2OZZ A;  3K6W A;  1M5F A;  1MPD A;  4YZZ A;  4R73 A;  1D3K A;  3JZJ A;  4IB2 A;  3TZA A;  4EQ9 A;  5H8S A;  3MVZ A;  4IO2 A;  5ICT A;  3VLV A;  3DRG A;  3SEW A;  2Y7R A;  4KD5 A;  5AA2 B;  1ZJL A;  4GL0 A;  1B51 A;  4WED A;  4RJZ A;  1J1N A;  5KCJ A;  4AB5 A;  4EDP A;  1DTZ A;  5AA4 A;  4YMA A;  3IK6 B;  3FZV A;  5ELV A;  3A09 A;  1SW1 A;  3C4M A;  3K1P A;  3PPO A;  4OEN A;  2ESN A;  4KCC A;  2NWJ A;  4XXU A;  5FHN A;  4ZZE A;  2QJE A;  2B3B A;  3IOW A;  4HTG A;  2B3F A;  2OJT A;  4F39 A;  1UQW A;  1BTJ A;  2X7Q A;  4ZEK A;  4R2F A;  3RTF B;  2DE2 A;  3TTN A;  4Q30 B;  5H8H B;  1AH5 A;  1LLS A;  3TTK A;  1UTB B;  2GH9 A;  3C36 A;  4JWO A;  4XKP A;  4WKM A;  3ZKK A;  4F2O A;  3OOA A;  3OSR A;  2DP8 A;  1MH3 A;  3K02 A;  4M1V A;  1ZMG A;  3IB1 A;  3MAM A;  2RIN A;  5K2X A;  1GGG A;  4F3P A;  3O6H A;  3C31 A;  4TOZ A;  4GQO A;  5ITP A;  4BDQ A;  3UIF A;  2XXY A;  2XXU A;  3H3G A;  3KBR A;  2O1L A;  4NMY A;  2AIX A;  3RNN A;  1XVX A;  2F34 A;  2RCB A;  4FEB A;  1ZBM A;  4KPT A;  4QSD A;  2V84 A;  2Q8J A;  1FW0 A;  2WOP A;  1I69 A;  1JVX A;  2Z23 A;  4G8H A;  2A5T A;  1MXU A;  2H4I A;  1SBP A;  2DWI A;  3B7D A;  4O3C A;  1NNP A;  4RK2 A;  3CHG A;  3CR9 A;  2IA4 A;  3KFM A;  4N13 A;  4BDR A;  5AA3 A;  1R9L A;  1SI1 A;  1VFD A;  1YCJ A;  3FGS A;  2O68 A;  1M5C A;  3D4C A;  1A7L A;  4H5F A;  2XXQ A;  4KYD A;  2XXW A;  3FV2 A;  2UXA A;  3DLN A;  3IR1 A;  4ZE8 A;  1N7W A;  2OCU A;  1IUD A;  3CFZ A;  3FAS A;  4BDO A;  1IXI A;  3FTO A;  1SDX A;  2O7I A;  1PEB A;  3CFX A;  3O28 A;  2ZNU A;  4H67 A;  3I5O A;  3BBR A;  3VE1 B;  4RPN A;  5I59 A;  1B58 A;  1B7Z A;  1PB7 A;  5H8F B;  2HXW A;  1NNK A;  3Q27 A;  3RQT A;  1D9V A;  5I56 A;  4X1B A;  1B6H A;  1MXZ A;  3ILT B;  2V3U A;  3R7X A;  3T93 B;  2G93 A;  4DE8 A;  4KCD A;  2PMS A;  3SER A;  4QFK A;  1MY3 A;  1N04 A;  2THI A;  3QUF A;  4KHZ E;  4EQ7 A;  3ONM A;  5ICQ A;  1QJM A;  3VDF A;  2HQ0 A;  5JTY A;  1XS5 A;  1EZ9 A;  4QFP A;  3N6U A;  4NF8 B;  5H8Q B;  3VFJ A;  2HCA A;  3MW0 A;  2XXX A;  3HHG A;  4KYE A;  3THI A;  4ESW A;  3G3I A;  5HM4 B;  4RA1 A;  1PB8 A;  4OEV A;  3W15 C;  4TLL B;  4ELP A;  3FJG A;  2XXP A;  1VFE A;  2F35 A;  1US5 A;  3OXN A;  1RKM A;  1FTM A;  3FXU A;  2QS3 A;  3T9X B;  3G3H A;  2DOJ A;  3H03 A;  5CC2 A;  1NFT A;  3B6W A;  3PUV E;  2AYS A;  2D3I A;  3CIJ A;  4M4G A;  4F18 A;  3OSQ A;  2O1M A;  2OK2 A;  4H6D A;  4H65 A;  3N94 A;  2XX9 A;  2Y7P A;  4OQO A;  2H25 A;  1H44 A;  1GVC A;  1GV8 A;  1FQB A;  1OIB A;  3U94 A;  4O3B A;  4F1V A;  3O6G A;  1DSN A;  1PDA A;  4E0X A;  3IB0 A;  1B3E A;  3VV5 A;  1BP5 A;  4YKI A;  3HPI A;  3TTM A;  2HAV A;  1MH4 A;  2OBG A;  1R9Q A;  3TCF A;  5L9O A;  1B1X A;  5HBC A;  3SES A;  1NNT A;  2PVU A;  3KN8 A;  4NE4 A;  3K01 A;  4YB6 A;  1P99 A;  1P1N A;  2ZNS A;  1OQG A;  3WAF A;  1URG A;  3MP1 A;  3QYT A;  4ZZA A;  4LQ5 A;  4KFQ A;  3OO6 A;  3U1O A;  2F7B A;  3KOT A;  5KCJ B;  3GBA A;  3DEL B;  2ZNT A;  3T9H B;  4IY6 A;  3MWB A;  1B40 A;  1SI0 A;  4LUB A;  1I6B A;  4XTC Q;  1B5H A;  1OVB A;  3RUM A;  2I48 A;  2I58 A;  3TMG A;  2DWH A;  4KI0 E;  5A5X A;  3S9E A;  4ZEI A;  2UVG A;  1QVS A;  2I3V A;  3G7W A;  4EQB A;  4JSD A;  1USY E;  2CMO A;  4GFR A;  3A3U A;  3C35 A;  1M5B A;  3PD8 A;  3PPR A;  4Q5T A;  4TLM B;  3VVF A;  4FJP A;  4OWD A;  1O63 A;  3FVG A;  4H0W A;  4P0G A;  3HHF A;  1JVY A;  2DSF A;  5JK4 A;  1H43 A;  5DEX A;  2XX8 A;  3SEU A;  1B5J A;  4ZEC A;  2FYI A;  4ESX A;  1XHY A;  3O66 A;  3FAT A;  2KLF A;  1BLF A;  3MC2 A;  4P0I A;  5H8F A;  3UOR A;  2UYE A;  4OMB A;  1ELJ A;  2ONK E;  5TP9 B;  3IX1 A;  2P0S A;  3IO4 A;  3QUJ A;  1AIV A;  3T9U A;  3V89 B;  1Z7N E;  2HEU A;  5JEI A;  1QUI A;  4HCW A;  3LUY A;  3MBP A;  4R75 A;  1ZLQ A;  4R74 A;  4NWD A;  2GRV A;  1DOT A;  5F1Q A;  1H3D A;  2DWA A;  2UVI A;  1LGB C;  4ECF A;  5I2N A;  1D4N A;  1OMP A;  2Y7I A;  3IAZ A;  1CB6 A;  2GHA A;  2V25 A;  1ZIU A;  3B6Q A;  4MFI A;  2UVJ A;  3VVE A;  4POX A;  1IXG A;  5FHM A;  3KOS A;  4GXA A;  3DP4 A;  2OLB A;  2ONS A;  2LAO A;  3KGC A;  4IO7 A;  2F8D A;  3DRK A;  5IAI A;  1MXV A;  3PU5 A;  3FJM A;  1BKA A;  4YKK A;  2Z22 A;  1N7X A;  1EH3 A;  1PC3 A;  1LAG E;  1QW0 A;  5CMK A;  1AMF A;  4G2Z A;  5ITO A;  2AL4 A;  2PT2 A;  3SKP A;  1JEU A;  2Z8F A;  3TYH A;  4EF2 A;  3IOV A;  3IOU A;  4OXV A;  1UTH A;  1A55 A;  3H6V A;  1YAE A;  3TTR A;  3TFL A;  4F2Q A;  1SW4 A;  2B4L A;  5CMM A;  4FED A;  3MZ9 A;  4MLV A;  4XKN A;  2YJP A;  3SEX A;  1MXY A;  1WVJ A;  4EXK A;  4EUO A;  2XD2 A;  3O6I A;  1Y4C A;  2Y84 A;  3JV9 A;  1TXF A;  3PUX E;  4ISU A;  5CBR A;  2RC7 A;  3Q25 A;  3RY3 A;  1MG1 A;  4N07 A;  3TQW A;  4ELQ A;  4HW8 A;  5I56 B;  1NNF A;  1IQ7 A;  3PUY E;  2PX1 A;  4EF1 A;  1LFI A;  3OO7 A;  1EZO A;  2G29 A;  4GIZ A;  1TFA A;  1IXC A;  4IY5 A;  3MZ1 A;  4KR5 A;  2FA7 A;  1SW2 A;  4UAC A;  1B52 A;  1MPB A;  2Y7W A;  5JTY B;  2V3T A;  1OLA A;  1A99 A;  4QFO A;  1WDN A;  3O6P A;  3BKI B;  1KWH A;  4U4X A;  4BDM A;  4Q8R A;  4JXI A;  5I84 A;  1S50 A;  1SYI A;  1RYX A;  1AOV A;  3O9P A;  2YLN A;  1FQE A;  5ISU A;  3C34 A;  3CVG A;  4NF6 A;  3TEL A;  1FTK A;  2QRY A;  3N6T A;  3MVX A;  1VE4 A;  3TAJ A;  3E4R A;  4YIC A;  3IB2 A;  4BDL A;  1QUJ A;  5B7D A;  3V83 A;  1FTL A;  1HSL A;  2ANJ A;  5TU0 A;  1FQC A;  4E0W A;  1LST A;  3QIM A;  2F7C A;  2VGQ A;  3EHU A;  3K1M A;  3LSL A;  5L8D A;  3LC8 A;  4I62 A;  4N6P A;  2P1S A;  5FTI A;  3T22 A;  1URS A;  2I0B A;  5I2N B;  1Y3N A;  4OYV A;  2QS2 A;  4U22 A;  4RY1 A;  5EYF A;  4NF8 A;  3RN8 A;  2H98 A;  3TKD A;  1LFH A;  2M8C A;  1JNF A;  1H76 A;  3S9L C;  2F6G A;  3KSX A;  2REG A;  2I3W A;  1SVX B;  2XX7 A;  1FTO A;  2XHD A;  1MQJ A;  1FTJ A;  5KZT A;  1MQG A;  1IXH A;  3IOT A;  2I49 A;  4G4P A;  4Q0C A;  1O64 A;  1NL5 A;  5J1D A;  2PBW A;  2Q89 A;  3G3F A;  4PFW A;  1N84 A;  2DXR A;  1LBC A;  3AXF A;  2DS9 A;  3PMX A;  4PE5 B;  3UN6 A;  1MPC A;  5I59 B;  2W7Y A;  4YKP A;  1TT1 A;  4QF9 A;  4OZ9 A;  4KQP A;  1B5I A;  1MY0 A;  1JQF A;  1USY H;  3F11 A;  5I57 B;  3K00 A;  2PT1 A;  3TOD A;  4F19 A;  2NOO A;  2VD3 A;  4JWX A;  3S2V A;  5L9M A;  1Q35 A;  1B32 A;  2GHB A;  3E9X A;  3IO6 A;  3LR1 A;  4JWY A;  1A8E A;  4ND9 A;  5BWJ A;  1B3L A;  4KYS A;  4NWC A;  5LOM A;  3KSJ A;  1FQD A;  1SW5 A;  2F6P A;  4G68 C;  4I8C A;  2A5T B;  1LFG A;  4QHQ A;  3H7M A;  2DE3 A;  4FAJ A;  1N3W A;  4GD5 A;  1D9Y A;  3E13 X;  3OEM A;  1JW1 A;  4G68 A;  1P1O A;  4LZ7 A;  4LZ8 A;  5I2K A;  3FVN A;  3K2D A;  3U8Q A;  2PYY A;  4DDD A;  3LSF B;  1B9J A;  1F9B A;  1SYH A;  4IGR A;  2DXY A;  4U4S A;  2H99 A;  5DTB A;  3FV1 A;  4G68 B;  5I2K B;  5CBS A;  3TQL A;  3KG2 A;  4X9T A;  2WOL A;  3VXB A;  1NMU A;  1Y20 A;  3UK4 A;  4RPO A;  3V8X B;  4JB7 A;  4K3F A;  2HAU A;  2R71 A;  2ZYN A;  4H1X A;  3OEL A;  3Q26 A;  4POW A;  4QSC A;  5DVF A;  1Y3P A;  1P1U A;  3T96 B;  4IO5 A;  1UIV A;  4OET A;  3DRH A;  1IZ1 A;  5DVI A;  4YMB A;  1B3H A;  4MF3 A;  3H06 B;  4NF5 A;  4R72 A;  4R6Y A;  4OES A;  1LAF E;  4LVQ A;  5I57 A;  1T0K A;  2UYF A;  3ECR A;  3TCG A;  2VOZ A;  3PMV A;  1XT8 A;  2HZL A;  3C33 A;  3DP6 A;  3PPP A;  4RXL A;  4PP0 A;  1NH8 A;  4F3B A;  1POT A;  4OTE A;  2R9J A;  4PET A;  5AA2 A;  2QL3 A;  2XXI A;  3G3K A;  1XC1 A;  1LBB A;  2VHA A;  2F7A A;  3EHT A;  4G8M A;  3EF7 A;  4U1Z A;  2FNC A;  3TEP A;  3QXM A;  1QUK A;  3SET A;  3FJ7 A;  3TUS A;  3EHS A;  3U72 A;  1MM6 A;  2NUV A;  4FE8 A;  3RPW A;  4P11 A;  2HFB A;  4GLI A;  3MPK A;  4LA9 A;  2RF1 A;  3PGF A;  4ONY A;  3CRB A;  4OFJ A;  2AL5 A;  4X1D A;  3FXQ A;  1II5 A;  3OMB A;  3UP9 A;  4MBP A;  4IO3 A;  3TCH A;  3A3C A;  3B6T A;  4IGT A;  5CMC A;  3K6V A;  3ILU B;  5TPA A;  4U1O A;  3FIR A;  1B2H A;  2RC8 A;  4O3A A;  3ODB A;  1LAH E;  4PFY A;  3TPA A;  3DP8 A;  2H5Y A;  4GOT A;  1B4Z A;  4DCY A;  3LVU A;  1PBP A;  1B7H A;  1ZKB A;  2DWJ A;  4U21 A;  2RKM A;  3MZB A;  3N26 A;  4OFL A;  3CG1 A;  4I1D A;  3KJT A;  4RYA A;  5L9S A;  4ZED A;  4AQ4 A;  1S9T A;  3O2A A;  4NF4 B;  2F5X A;  3C32 A;  3K6X A;  2D5W A;  5EHS A;  2NVU B;  3MP8 A;  5F7V A;  5A5X B;  3RTW B;  1Y3Q A;  2YPN A;  3EN3 A;  1M5D A;  3QAX A;  4DLD A;  5BUU A;  2DE4 A;  2XD3 A;  3RYA A;  1LB8 A;  3DRJ A;  3FVK A;  3GBB A;  3PUW E;  3S9M C;  1DTG A;  1P1Q A;  4XKQ A;  1IIW A;  1B46 A;  1TWY A;  2DQV A;  3K6U A;  2GFE A;  3O29 A;  1XVY A;  4OHN A;  3WAE A;  5CM6 A;  2F78 A;  1DPP A;  1Y1M A;  3VVD A;  3ZKL A;  2QSX A;  1ZTY A;  1B7U A;  2Z8E A;  2E1S A;  3G3G A;  4U23 A;  2XXH A;  3DRF A;  1H45 A;  3DM0 A;  1MRP A;  4X48 A;  2I4B A;  4WXJ A;  1YPN A;  1B0H A;  3ZS6 A;  1PB9 A;  1MXX A;  2ZXT A;  2O7U A;  4LON B;  5H8H A;  4DZ1 A;  4GXS B;  1N76 A;  3IL1 B;  5M2V A;  1LCF A;  1UTH B;  3UGW A;  1VSO A;  3M3L A;  1AL3 A;  2OWT A;  2ZYK A;  3MQ9 A;  4ZEB A;  5EHM A;  3RT8 A;  1P1W A;  4BLA A;  1O7T A;  5CMB A;  3M8U A;  3CSG A;  1EZP A;  2O51 A;  4QFN A;  3IJO B;  3JYR A;  5B70 A;  3GXA A;  3PPN A;  4R6H A;  1UIU A;  1YTV A;  4BDN A;  5AA1 A;  1MDQ A;  2QMW A;  1QKB A;  4PFU A;  3OO9 A;  5AA4 B;  3UA8 A;  1B1H A;  1OVT A;  3K1N A;  3DRI A;  1TFD A;  1Q1K A;  1GTK A;  1MQI A;  2F36 A;  3BFU A;  4C1U A;  5H8N B;  4LQ2 A;  3VLW A;  1GR2 A;  4DCX A;  4F3S A;  3H6T A;  3H4Z A;  4OEU A;  3E3K A;  1MS7 A;  4IO4 A;  5KDT B;  1MM7 A;  3OEK A;  5CRY A;  2D21 A;  5FHO A;  5H8Q A;  3MP6 A;  4JBZ A;  1B0L A;  2ZYO A;  3U92 A;  3QSL A;  2I4C A;  4NTL A;  4ELO A;  3MJN A;  4QFL A;  3SDF A;  4THI A;  3KZG A;  3LSW A;  3RT6 B;  1Y9U A;  1Z7M E;  2I6E A;  2CZL A;  3OD7 A;  1B3G A;  4GF8 A;  4HCY A;  3S4U A;  3VLU A;  2DVC A;  2QS4 A;  2O6A A;  3SEY A;  3MVY A;  3PMW A;  1B05 A;  1N3X A;  4R9F A;  4AB6 A;  1JW5 A;  3PPQ A;  2QPQ A;  3HST A;  4EXL A;  1LCT A;  4F29 A;  3Q28 A;  1M5E A;  2ZMB A;  4GWO A;  4XKR A;  1SQY A;  4WEP A;  2I0C A;  4GL8 A;  1IIT A;  3GZG A;  4YB7 A;  2UVH A;  4HS7 A;  1PBQ A;  3VXC A;  5I58 B;  4DIG A;  4JSO A;  1JW4 A;  2Z8D A;  1MY4 A;  1XOC A;  1Y1Z A;  2WKY A;  5TP9 A;  3K4U A;  4QRZ A;  2VD2 A;  1ZU0 A;  1SD3 A;  1QUL A;  2QS1 A;  3KJ7 A;  3ZSF A;  1QKA A;  3RYB A;  2RCA A;  5HPQ A;  2V3Q A;  1BIY A;  1EU8 A;  2Y7K A;  4F3G A;  1OLC A;  1R6Z A;  2ZYM A;  5K2Y A;  3K0V A;  4ZDM A;  4YB5 A;  3W9V A;  5DEX B;  3TTL A;  1B3F A;  3C9H A;  1MXW A;  3IJX B;  1A40 A;  2A5S A;  4H5G A;  4U2R A;  4NF5 B;  1LB9 A;  1NH7 A;  2XXT A;  4R2B A;  4RNS A;  2P2A A;  3GLB A;  3HO7 A;  3OEN A;  3RLF E;  5KDT A;  3I3V A;  3L6H A;  3I6V A;  1UTB A;  2XXR A;  3FVO A;  3HV1 A;  5IKB A;  3CG3 A;  1OQH A;  2H9B A;  2WOK A;  3KN3 A;  5H8N A;  3BFT A;  3H6W A;  4G77 A;  1NKX A;  2ONR A;  4JDF A;  3TDJ A;  1URD A;  5AE4 A;  2O84 X;  4ZE9 A;  4PFT A;  5DVJ A;  4ZEF A;  3PUZ E;  3PV0 E;  3MUQ A;  4F1U A;  2V93 A;  4F31 B;  4FAT A;  5AA2 D;  3SEV A;  1MQH A;  2R6G E;  1RYO A;  4YU0 A;  2RC9 A;  3U93 A;  2DVZ A;  1JET A;  3MPL A;  4H8J A;  1I6Q A;  1HSJ A;  1MY1 A;  5FTH A;  2Q9T A;  3T9V A;  4DXB A;  4F22 A;  2F97 A;  4Z7E A;  1FQA A;  1MY2 A;  3M3K A;  2VP1 A;  3O97 A;  3R6U A;  4C0R A;  3OO8 A;  4DXC A;  1VR5 A;  2ABH A;  1Y4T A;  3KN7 A;  3M3F A;  4DXU A;  1DPE A;  3P7I A;  4OFO A;  1N0T A;  3V5A A;  1JEV A;  3FUZ A;  4NF4 A;  4FEC A;  3N5L A;  5DYH A;  2X26 A;  4LAT A;  3H6U A;  3R26 A;  3MVW A;  2IEE A;  1CE2 A;  3IOR A;  4FOR A;  1POY 1;  4F1Y A;  3CSB A;  1US4 A;  3FXR A;  5CI5 A;  2Q88 A;  3KEI A;  4MH5 A;  5DT6 A;  4RK9 A;  4IO6 A;  4LP2 B;  2Q2C A;  1DMB A;  1MDP 1;  2OWS A;  3L6G A;  4FIM A;  3CFL A;  1FCK A;  2QMX A;  3PD9 A;  1A8F A;  4MLQ A;  4Z0I A;  1A54 A;  3RGY A;  3PAM A;  1HSE A;  4L17 A;  1FQF A;  4C1T A;  1MQD A;  2E0S A;  2Q2A A;  3EQ1 A;  2XXV A;  3W9W A;  2HZK A;  2NXO A;  4NED A;  1ANF A; 
#chains in the Genus database with same CATH topology
 4FBP A;  4R9G A;  3EPE A;  4GRK A;  1YYZ A;  2REJ A;  3S9N C;  3G3J A;  3Q29 A;  5TPA B;  4PQJ A;  4YAH X;  4NF6 B;  4N8G A;  1MPD A;  3JZJ A;  4EQ9 A;  3MVZ A;  3DRG A;  3SEW A;  1ZJL A;  5KCJ A;  4O8M A;  2Q8M A;  5ELV A;  1SW1 A;  4H45 A;  4XXU A;  5FHN A;  4ZZE A;  2B3B A;  1UQW A;  2X7Q A;  3TTN A;  2ZZW A;  3TTK A;  1UTB B;  4JWO A;  4XKP A;  3ZKK A;  3IB1 A;  3O6H A;  1FPF A;  4TOZ A;  3KBR A;  2O1L A;  1XVX A;  4QSD A;  1I69 A;  1JVX A;  2Z23 A;  2A5T A;  2KQZ A;  2H4I A;  2DDK A;  3CR9 A;  5AA3 A;  1R9L A;  4JB7 A;  4JVC A;  4H5F A;  1M5C A;  3D4C A;  1IMB A;  2XXQ A;  2XXW A;  2UXA A;  3IR1 A;  3RYD A;  2ZNU A;  1B7Z A;  1B6H A;  2V3U A;  3R7X A;  4DE8 A;  2PMS A;  1MY3 A;  1N04 A;  4KHZ E;  2WBB A;  3VDF A;  4QFP A;  3MW0 A;  4KYE A;  1LBZ A;  2XXP A;  2F35 A;  4N15 A;  1FTM A;  1CNQ A;  3PUV E;  3OSQ A;  4H65 A;  1GV8 A;  2OBG A;  1R9Q A;  1B1X A;  5HBC A;  3KN8 A;  4NE4 A;  3K01 A;  1P1N A;  2ZNS A;  4NAP A;  3U1O A;  2F7B A;  3DEL B;  2ZNT A;  3RUM A;  1B40 A;  4XTC Q;  3SER A;  2I58 A;  3TMG A;  4KI0 E;  3S9E A;  4ZEI A;  2I3V A;  3KBZ A;  4P8B A;  3PPR A;  1M5B A;  1LBV A;  4FJP A;  4H0W A;  3FVG A;  2DSF A;  1H43 A;  3SEU A;  1B5J A;  2KLF A;  4P0I A;  3UOR A;  2ONK E;  3IX1 A;  3QUJ A;  1AIV A;  4R75 A;  4PGP A;  2DWA A;  1H3D A;  4ECF A;  1CB6 A;  2V25 A;  2UVJ A;  1IXG A;  5FHM A;  3DP4 A;  4IO7 A;  5T3J A;  2F8D A;  3PU5 A;  1PC3 A;  1LAG E;  1NUW A;  5ITO A;  4OXV A;  1UTH A;  1A55 A;  5EQ8 A;  3FXB A;  1MXY A;  2XD2 A;  2Y84 A;  1FTA A;  1TXF A;  2RC7 A;  2WYK A;  4N07 A;  3TQW A;  1NNF A;  1IQ7 A;  4EF1 A;  3OO7 A;  4N81 A;  5EQA A;  1IXC A;  3MZ1 A;  2MKZ A;  5JTY B;  2V3T A;  1A99 A;  3BKI B;  4U4X A;  4Q8R A;  4BDM A;  1S50 A;  1SYI A;  1AOV A;  3O9P A;  5ISU A;  3CVG A;  4NF6 A;  3TAJ A;  1QUJ A;  2ANJ A;  1FQC A;  2F7C A;  2VGQ A;  4N6P A;  3T22 A;  1URS A;  4JVI A;  1Y3N A;  1LFH A;  3KSX A;  2I3W A;  1SVX B;  1MQJ A;  5KZT A;  1MQG A;  4OAN A;  2L5V A;  1TT1 A;  1JQF A;  3TOD A;  1IMF A;  1LBW A;  2NOO A;  4MNI A;  3IO6 A;  4ND9 A;  1A8E A;  3B8B A;  1B3L A;  2A5T B;  1LFG A;  1D9Y A;  4LZ7 A;  3U8Q A;  1B9J A;  1IMC A;  4U4S A;  5DTB A;  4MEV A;  3FV1 A;  4RPO A;  4POW A;  2XA5 A;  4OET A;  2FIE A;  5DVI A;  4YMB A;  1B3H A;  4NF5 A;  4R6Y A;  4OES A;  4KXP A;  2WEF A;  1LEV A;  2VOZ A;  4RXL A;  3PPP A;  4OTE A;  3G3K A;  3EHT A;  2F7A A;  2FNC A;  1QUK A;  4NGU A;  3EHS A;  3U72 A;  1MM6 A;  4FE8 A;  3RPW A;  4OVQ A;  4LA9 A;  2RF1 A;  4OFJ A;  1II5 A;  3OMB A;  3UP9 A;  1NUX A;  3K6V A;  5TPA A;  3T0J A;  1LAH E;  2H5Y A;  4DCY A;  1SPI A;  1S9T A;  1FSA A;  3O2A A;  3C32 A;  3MP8 A;  3RTW B;  5J16 A;  3EN3 A;  3QAX A;  2DE4 A;  1FBF A;  3KC0 A;  1P1Q A;  1TWY A;  2GFE A;  3WAE A;  5CM6 A;  1BK4 A;  1Y1M A;  1FPK A;  3VVD A;  2QSX A;  1B7U A;  2Z8E A;  1YPN A;  1B0H A;  3ZS6 A;  1PB9 A;  4DZ1 A;  5H8H A;  3IL1 B;  3UGW A;  2ZYK A;  4BLA A;  2O51 A;  4QFN A;  3JYR A;  3E79 A;  1UIU A;  2QMW A;  1Q1K A;  4C1U A;  1GR2 A;  4DCX A;  1QGX A;  4IO4 A;  5H8Q A;  2D21 A;  2ZYO A;  2I4C A;  4ELO A;  2CZL A;  1B3G A;  4HCY A;  2QS4 A;  4O7I A;  1B05 A;  4R9F A;  2QPQ A;  4EXL A;  1LCT A;  4X04 A;  2I0C A;  5I58 B;  4DIG A;  3BIG A;  4JSO A;  1JW4 A;  4AS5 A;  4LN5 A;  1FBC A;  2WKY A;  3K4U A;  4GWS A;  3KJ7 A;  2Y7K A;  2BJI A;  2ZYM A;  3W9V A;  3IJX B;  2A5S A;  4H5G A;  4U2R A;  4R2B A;  5KDT A;  5H8N A;  3H6W A;  3TDJ A;  1URD A;  2O84 X;  4PFT A;  4F1U A;  4FAT A;  3MUQ A;  3SEV A;  2R6G E;  1RYO A;  5FTH A;  2F97 A;  3R6U A;  1VR5 A;  2ABH A;  1DPE A;  1JEV A;  3N5L A;  2X26 A;  3IOR A;  2IEE A;  1FJ9 A;  4NHB A;  3KEI A;  4HE2 A;  4LP2 B;  1DMB A;  1MDP 1;  2OWS A;  1FCK A;  3PD9 A;  1HSE A;  1FPD A;  3EQ1 A;  2XXV A;  1FBD A;  3G3F A;  2HZK A;  3UN6 A;  5I58 A;  1KA0 A;  3CI8 A;  3LV0 A;  2DYX A;  4MX6 A;  1R1N A;  2ALU A;  1L5T A;  1S7Y A;  3LSX A;  1IEJ A;  3D4G A;  2B4M A;  4YKJ A;  4H8I A;  4GVO A;  1WOD A;  3FD3 A;  4TQU Q;  4UA8 A;  3K6W A;  1NUZ A;  4PCD A;  5ICT A;  3VLV A;  1NV0 A;  2Y7R A;  4KD5 A;  5AA2 B;  1B51 A;  1J1N A;  4YMA A;  3FZV A;  3A09 A;  4OEN A;  4OVR A;  4P1E A;  5H8H B;  1AH5 A;  2GH9 A;  3C36 A;  4WKM A;  3OSR A;  2DP8 A;  1MH3 A;  3MAM A;  1GGG A;  5ITP A;  3RNN A;  4NMY A;  2V84 A;  2Q8J A;  1FW0 A;  4XF5 A;  2WOP A;  2QFL A;  4G8H A;  1MXU A;  1SBP A;  2DWI A;  1NNP A;  4N13 A;  4KYD A;  3FGS A;  3FV2 A;  3DLN A;  1IXI A;  2O7I A;  5I59 A;  4RPN A;  3HFU A;  5H8F B;  1NNK A;  3Q27 A;  3RQT A;  3KC1 A;  1MXZ A;  2G93 A;  3FBP A;  4KCD A;  4QFK A;  4GX6 A;  3ONM A;  1QJM A;  2HQ0 A;  1XS5 A;  3N6U A;  5H8Q B;  4ESW A;  1PB8 A;  4OEV A;  4ELP A;  3FJG A;  1VFE A;  3OXN A;  4M4G A;  2OK2 A;  1FPE A;  2Y7P A;  1OIB A;  3U94 A;  1PDA A;  2WBD A;  3VV5 A;  3TTM A;  4YKI A;  3HPI A;  3TCF A;  1NNT A;  4MMP A;  4QBA A;  4KFQ A;  4NG7 A;  3OO6 A;  3KOT A;  3GBA A;  1K9Y A;  3MWB A;  1B5H A;  1USY E;  3C35 A;  3PD8 A;  4GFR A;  3A3U A;  1JVY A;  5JK4 A;  5EQ7 A;  2XX8 A;  5IZZ A;  3MC2 A;  2UYE A;  4OMB A;  4I3Y A;  3T9U A;  3V89 B;  4HCW A;  1DOT A;  5I2N A;  3IAZ A;  2GHA A;  4MFI A;  3VVE A;  4GX3 A;  3KOS A;  4GXA A;  2WX9 A;  3KGC A;  5IAI A;  1NV2 A;  1BKA A;  3FJM A;  1N7X A;  5CMK A;  3SKP A;  2Z8F A;  3TYH A;  3IOV A;  3H6V A;  3TTR A;  2CEX A;  4GWZ A;  4F2Q A;  5CMM A;  4FED A;  3MZ9 A;  3SEX A;  4N4U A;  4EUO A;  3O6I A;  1DCU A;  1MG1 A;  4ELQ A;  4HW8 A;  3PUY E;  2FA7 A;  1SW2 A;  1MPB A;  4JXI A;  4MAG A;  1RYX A;  2YLN A;  1FQE A;  3TEL A;  1FTK A;  2QRY A;  3MVX A;  3E4R A;  3IB2 A;  2GQ1 A;  1FTL A;  5TU0 A;  1LST A;  5FTI A;  3LC8 A;  5EYF A;  2QS2 A;  4RY1 A;  3RN8 A;  4NF8 A;  2H98 A;  1INP A;  1RDY A;  2F6G A;  1JP4 A;  1FTJ A;  4I3E A;  2I49 A;  4Q0C A;  2DXR A;  3AXF A;  4PE5 B;  3T1B A;  4YKP A;  4OZ9 A;  4KQP A;  2VD3 A;  2GHB A;  3E9X A;  4X8R A;  2OX3 A;  4JWY A;  3KSJ A;  5ET6 A;  1SW5 A;  2XWK A;  4JVD A;  2XWI A;  2DE3 A;  1IME A;  4DDD A;  4IGR A;  4G68 B;  5I2K B;  1NI9 A;  3MYU A;  3VXB A;  3UK4 A;  2R71 A;  3PTY A;  1P1U A;  4GBW A;  4IO5 A;  4LVQ A;  3C33 A;  3RPL B;  2R9J A;  3QXM A;  3FJ7 A;  2NUV A;  4GLI A;  3PGF A;  3CRB A;  5CMC A;  3TCH A;  2OWZ A;  1IMA A;  3TPA A;  4GOT A;  1B4Z A;  1PBP A;  4PFB A;  2DWJ A;  1NUY A;  3MZB A;  3N26 A;  4I1D A;  5EYG A;  4RYA A;  4AQ4 A;  2P3V A;  4G61 A;  4NF4 B;  3K6X A;  2YPN A;  4DLD A;  1M5D A;  2XD3 A;  3RYA A;  3GBB A;  3S9M C;  2F3D A;  1DTG A;  4MNP A;  1IIW A;  3K6U A;  3O29 A;  4OA4 A;  5IGA A;  3ZKL A;  3G3G A;  2ZXT A;  5M2V A;  1LCF A;  1P1W A;  5CMB A;  3M8U A;  3CSG A;  1EZP A;  3IJO B;  3GXA A;  4PTK A;  2HXR A;  1MDQ A;  5I5P A;  4PFU A;  3OO9 A;  3UA8 A;  1B1H A;  1MQI A;  3BFU A;  3VLW A;  2CZK A;  3H6T A;  3H4Z A;  2HPG A;  3E3K A;  5F24 A;  5CRY A;  1B0L A;  3QSL A;  4NTL A;  4N6K A;  4THI A;  3KZG A;  1Y9U A;  4N8Y A;  4GF8 A;  3VLU A;  2O6A A;  1JW5 A;  3PPQ A;  3HST A;  4NF0 A;  1M5E A;  2ZMB A;  2FBP A;  1SQY A;  2PFY A;  3GZG A;  1LBY A;  5FBP A;  2VPO A;  2Z8D A;  1Y1Z A;  4QRZ A;  1ZU0 A;  1SD3 A;  1QKA A;  3RYB A;  2RCA A;  3K0V A;  3GYY A;  4PAF A;  3TTL A;  1FBH A;  4RNS A;  4MIJ A;  3L6H A;  5IKB A;  3FVO A;  2WOK A;  3KN3 A;  3BFT A;  3D1R A;  4JDF A;  4ZE9 A;  3PUZ E;  3PV0 E;  2FVZ A;  4YU0 A;  1JET A;  3MPL A;  1HSJ A;  1MY1 A;  4AS4 A;  3T9V A;  3IFA A;  1FQA A;  1MY2 A;  3O97 A;  4DXC A;  3P7I A;  3FUZ A;  4FEC A;  5DYH A;  4LAT A;  3H6U A;  3R26 A;  3MVW A;  4PDD A;  4F1Y A;  3FXR A;  4MH5 A;  4HE1 A;  4MLQ A;  1A54 A;  3RGY A;  4NED A;  3E78 A;  2B65 A;  4QSE A;  3QK6 A;  2BJJ X;  1I6A A;  1LAX A;  3HCQ A;  4ZS9 A;  4OER A;  3LBS A;  2X7P A;  4XIG Q;  4GBV A;  4R6K A;  3USD A;  4UAB A;  4YZZ A;  3TZA A;  4R73 A;  4IB2 A;  5H8S A;  4IO2 A;  2ZZX A;  4EDP A;  4PF8 A;  3PPO A;  3C4M A;  2ESN A;  4HTG A;  4F39 A;  4ZEK A;  3RTF B;  2DE2 A;  4GWY A;  4N6D A;  3OOA A;  4M1V A;  2RIN A;  4BDQ A;  3UIF A;  2XXY A;  2XXU A;  3H3G A;  4FEB A;  1ZBM A;  4DI4 B;  4O3C A;  3B7D A;  4GWX A;  4RK2 A;  3CHG A;  3KFM A;  2IA4 A;  1VFD A;  4NN3 A;  2O68 A;  4OVS A;  4ZE8 A;  1N7W A;  2OCU A;  1IUD A;  3CFZ A;  3FAS A;  3O28 A;  1SDX A;  1PEB A;  4H67 A;  3VE1 B;  4X1B A;  3ILT B;  2QVV A;  4GWW A;  4EQ7 A;  2HCA A;  3G3I A;  1DBZ A;  5HM4 B;  4RA1 A;  3W15 C;  4TLL B;  1RKM A;  3LUZ A;  5CC2 A;  3B6W A;  4H6D A;  2H25 A;  1FQB A;  4F1V A;  1DSN A;  3IB0 A;  2HAV A;  5L9O A;  1FBE A;  2PVU A;  1OQG A;  3WAF A;  1URG A;  3MP1 A;  3QYT A;  4MNC A;  5KCJ B;  4NQ8 A;  1FBG A;  4PE3 A;  4IY6 A;  4LUB A;  1I6B A;  1OVB A;  1NV1 A;  2I48 A;  4IR8 A;  5A5X A;  2UVG A;  4JSD A;  3QMF A;  4OWD A;  1O63 A;  1G0H A;  5DEX A;  4ESX A;  3O66 A;  1BLF A;  1D9Q A;  1ELJ A;  1Z7N E;  5JEI A;  1QUI A;  3LUY A;  3MBP A;  4R74 A;  4NWD A;  2GRV A;  1D4N A;  1OMP A;  1ZIU A;  3DRK A;  1MXV A;  4YKK A;  2Z22 A;  1EH3 A;  1FPB A;  2PFZ A;  1QW0 A;  1AMF A;  2AL4 A;  2PT2 A;  3IOU A;  1FPJ A;  1YAE A;  1G0I A;  2B4L A;  2YJP A;  1WVJ A;  4GX4 A;  1Y4C A;  3PUX E;  5CBR A;  1NV5 A;  2G29 A;  4MCO A;  1TFA A;  4KR5 A;  4IY5 A;  2V4C A;  4UAC A;  1B52 A;  2Y7W A;  1OLA A;  1WDN A;  4QFO A;  1EYI A;  1VE4 A;  4BDL A;  3V83 A;  4PGN A;  3QIM A;  3EHU A;  3K1M A;  3LSL A;  4I62 A;  2P1S A;  2I0B A;  4U22 A;  2R8T A;  3TKD A;  2M8C A;  2XHD A;  1IXH A;  3IOT A;  4G4P A;  1O64 A;  4PFR A;  1NL5 A;  2Q89 A;  4I40 A;  1N84 A;  1LBC A;  1MPC A;  4PFI A;  5I59 B;  1XI6 A;  5IZ1 A;  1B5I A;  1USY H;  4F19 A;  4JWX A;  3S2V A;  4XFE A;  1FPL A;  5BWJ A;  5LOM A;  4G68 C;  4QHQ A;  3H7M A;  4EXK A;  3E13 X;  3OEM A;  2Y5K A;  4G68 A;  5I2K A;  1P1O A;  3FVN A;  3K2D A;  1SYH A;  2DXY A;  4OVT A;  5CBS A;  3KG2 A;  4X9T A;  2WOL A;  1NMU A;  3V8X B;  2ZZV A;  4PDH A;  4K3F A;  4MHF A;  4PAK A;  3T96 B;  3ECR A;  1XT8 A;  4PP0 A;  1POT A;  1IMD A;  5AA2 A;  2QL3 A;  1XC1 A;  1LBB A;  3TEP A;  3SET A;  1DK4 A;  3EKI A;  5ET5 A;  3B50 A;  2HFB A;  4ONY A;  2AL5 A;  3FXQ A;  2Q74 A;  4MBP A;  4IGT A;  4P9K A;  1B2H A;  5EQ9 A;  1B7H A;  1ZKB A;  3SZP A;  4OFL A;  3CG1 A;  5L9S A;  2F5X A;  4DI3 D;  2D5W A;  5F7V A;  1Y3Q A;  5BUU A;  1FRP A;  1FJ6 A;  1LB8 A;  3FVK A;  3PUW E;  4XKQ A;  2DQV A;  1XVY A;  4OHN A;  1ZTY A;  2E1S A;  4U23 A;  5ET7 A;  3A29 A;  4WXJ A;  1MXX A;  4LON B;  2O7U A;  4P56 A;  1VDW A;  1N76 A;  5EHM A;  3RT8 A;  4ZEB A;  4P47 A;  3PPN A;  4R6H A;  1YTV A;  5AA1 A;  5AA4 B;  1OVT A;  3K1N A;  1GTK A;  2F36 A;  4OEU A;  1MS7 A;  3OEK A;  5FHO A;  2CZI A;  3MP6 A;  4QFL A;  3SDF A;  3LSW A;  3RT6 B;  2I6E A;  3S4U A;  2DVC A;  3SEY A;  1N3X A;  4AB6 A;  4F29 A;  4GWO A;  4XKR A;  4WEP A;  4GL8 A;  1IIT A;  4YB7 A;  1EYJ A;  5TP9 A;  3ZSF A;  1QUL A;  4N17 A;  5HPQ A;  1BIY A;  4F3G A;  1OLC A;  4ZDM A;  5DEX B;  1MXW A;  4NF5 B;  1NH7 A;  3GLB A;  3HO7 A;  4GWU A;  1NV3 A;  1UTB A;  1YXI A;  1OQH A;  4G77 A;  1NKX A;  2ONR A;  5AA2 D;  2RC9 A;  2DVZ A;  1I6Q A;  4F22 A;  4Z7E A;  4C0R A;  3OO8 A;  4DXU A;  4OFO A;  4NF4 A;  1KA1 A;  4FOR A;  1US4 A;  5CI5 A;  5DT6 A;  2WYP A;  4IO6 A;  4RK9 A;  2Q2C A;  2Y5L A;  3L6G A;  2QMX A;  2QVU A;  4C1T A;  4L17 A;  1FQF A;  3BIH A;  1MQD A;  2E0S A;  3W9W A;  2NXO A;  4ELR A;  4I9D A;  1B4H A;  5I56 B;  3T66 A;  4G8N A;  1RDZ A;  4OVJ A;  3HN0 A;  4LZ5 A;  1LBX A;  1ATG A;  2O69 A;  2OZZ A;  1M5F A;  1D3K A;  4GL0 A;  5DW8 A;  4WED A;  4RJZ A;  3RPL A;  4AB5 A;  1DTZ A;  5AA4 A;  3IK6 B;  3K1P A;  4KCC A;  2XWV A;  2NWJ A;  2QJE A;  3IOW A;  2B3F A;  2OJT A;  1BTJ A;  4R2F A;  4Q30 B;  1LLS A;  4F2O A;  2VPN A;  3K02 A;  5K2X A;  1ZMG A;  3NOH A;  4F3P A;  3C31 A;  1FPG A;  2AIX A;  2F34 A;  2RCB A;  4KPT A;  4BDR A;  1YZ0 A;  1SI1 A;  1YCJ A;  1A7L A;  2FHY A;  2KR0 A;  4BDO A;  3FTO A;  3CFX A;  2QVR A;  3I5O A;  3BBR A;  4PF6 A;  1B58 A;  1PB7 A;  2HXW A;  1D9V A;  5I56 A;  3T93 B;  2THI A;  3QUF A;  5ICQ A;  1EZ9 A;  4NF8 B;  3VFJ A;  3HHG A;  2XXX A;  3THI A;  1US5 A;  3FXU A;  2QS3 A;  3T9X B;  3G3H A;  2DOJ A;  3H03 A;  1NFT A;  2AYS A;  2D3I A;  3CIJ A;  4F18 A;  2O1M A;  3N94 A;  2PCR A;  2XX9 A;  4OQO A;  1H44 A;  1GVC A;  4O3B A;  3O6G A;  4E0X A;  1Q9D A;  5JTY A;  1B3E A;  1BP5 A;  1MH4 A;  3IFC A;  3SES A;  4H46 A;  4YB6 A;  1P99 A;  4ZZA A;  4LQ5 A;  3T9H B;  1SI0 A;  2DWH A;  1QVS A;  3G7W A;  4EQB A;  2CMO A;  4Q5T A;  3VVF A;  4TLM B;  3ROJ A;  4P0G A;  3HHF A;  4ZEC A;  2FYI A;  1XHY A;  3FAT A;  5H8F A;  1NV6 A;  5TP9 B;  2P0S A;  2CZH A;  3IO4 A;  2JJK A;  2HEU A;  1ZLQ A;  1NV7 A;  2F3B A;  2UVI A;  5F1Q A;  1LGB C;  2Y7I A;  3B6Q A;  4POX A;  2OLB A;  2ONS A;  2LAO A;  5ESY A;  4G2Z A;  1JEU A;  4EF2 A;  3TFL A;  1SW4 A;  4MLV A;  4XKN A;  3JV9 A;  4ISU A;  3Q25 A;  3RY3 A;  2P3N A;  2PX1 A;  1LFI A;  1EZO A;  4GIZ A;  3O6P A;  1KWH A;  5I84 A;  3C34 A;  5LDZ A;  2VT5 A;  4OVP A;  3N6T A;  2XXK A;  4YIC A;  5B7D A;  1HSL A;  4E0W A;  5I3S A;  2FIX A;  5L8D A;  5I2N B;  4OYV A;  1JNF A;  1H76 A;  3S9L C;  2REG A;  2XX7 A;  1FTO A;  5J1D A;  2PBW A;  4PFW A;  5I7I A;  3PMX A;  2DS9 A;  2W7Y A;  4QF9 A;  1MY0 A;  3F11 A;  4PBQ A;  5I57 B;  3K00 A;  2PT1 A;  5LTC A;  5L9M A;  1Q35 A;  1B32 A;  2CEY A;  3LR1 A;  4KYS A;  4NWC A;  4HE0 A;  1FQD A;  2F6P A;  4I8C A;  4PAI A;  1AWB A;  5EYH A;  4FAJ A;  1N3W A;  4GD5 A;  1JW1 A;  4LZ8 A;  2PYY A;  3LSF B;  1F9B A;  2H99 A;  3TQL A;  1Y20 A;  2HAU A;  2ZYN A;  4H1X A;  3OEL A;  3Q26 A;  4QSC A;  5DVF A;  1Y3P A;  1UIV A;  3DRH A;  1IZ1 A;  2XWO A;  4XEQ A;  4QXD A;  4MF3 A;  3H06 B;  4R72 A;  5I57 A;  1LAF E;  1T0K A;  1K9Z A;  2UYF A;  3TCG A;  3PMV A;  2HZL A;  3DP6 A;  4F3B A;  1NH8 A;  4PET A;  2XXI A;  2VHA A;  4G8M A;  3EF7 A;  4U1Z A;  2HHM A;  3TUS A;  5IZ3 A;  4P11 A;  3U65 A;  3MPK A;  4X1D A;  4NX1 A;  4IO3 A;  3B6T A;  3A3C A;  3ILU B;  3MST A;  4U1O A;  3FIR A;  2RC8 A;  4O3A A;  3ODB A;  4PFY A;  3DP8 A;  5IM2 A;  3LVU A;  1NV4 A;  4U21 A;  2RKM A;  3KJT A;  4ZED A;  5IZ3 B;  1KZ8 A;  5EHS A;  2NVU B;  5A5X B;  1RDX A;  3DRJ A;  1B46 A;  2F78 A;  1DPP A;  5ET8 A;  4X48 A;  2XXH A;  3DRF A;  1H45 A;  3DM0 A;  1MRP A;  2I4B A;  4GXS B;  1UTH B;  1VSO A;  3M3L A;  1AL3 A;  2OWT A;  3MQ9 A;  1FPI A;  1O7T A;  4N91 A;  5B70 A;  4BDN A;  1QKB A;  3DRI A;  1TFD A;  5H8N B;  4LQ2 A;  4F3S A;  5KDT B;  1MM7 A;  4JBZ A;  4PBH A;  3U92 A;  3MJN A;  1Z7M E;  3OD7 A;  3MVY A;  3PMW A;  3Q28 A;  1EYK A;  2UVH A;  4HS7 A;  1PBQ A;  3VXC A;  4HXV A;  1MY4 A;  1XOC A;  2VD2 A;  4MJO A;  2QS1 A;  2V3Q A;  1EU8 A;  5K2Y A;  1R6Z A;  4YB5 A;  1B3F A;  3C9H A;  1A40 A;  1LB9 A;  2XXT A;  4O7M A;  2P2A A;  3OEN A;  3RLF E;  1FBP A;  3I3V A;  3I6V A;  2XXR A;  3HV1 A;  3CG3 A;  2H9B A;  5AE4 A;  5DVJ A;  4ZEF A;  4F31 B;  2V93 A;  1MQH A;  4P3L A;  3U93 A;  4H8J A;  3ISP A;  2Q9T A;  4P1L A;  4DXB A;  3M3K A;  2VP1 A;  4O94 A;  3KN7 A;  1Y4T A;  3M3F A;  1N0T A;  3V5A A;  1CE2 A;  1POY 1;  3CSB A;  2Q88 A;  4FIM A;  3CFL A;  4Z0I A;  1A8F A;  4PC9 A;  3PAM A;  5A5L A;  2Q2A A;  4GQO A;  1ANF A; 
#chains in the Genus database with same CATH homology
 5I58 A;  2B65 A;  3CI8 A;  4QSE A;  4ELR A;  3QK6 A;  4R9G A;  2DYX A;  2BJJ X;  1R1N A;  2ALU A;  1I6A A;  4I9D A;  1LAX A;  1B4H A;  3EPE A;  3HCQ A;  1L5T A;  4GRK A;  3T66 A;  1S7Y A;  2REJ A;  4ZS9 A;  3G3J A;  3LSX A;  4OER A;  4G8N A;  3S9N C;  1IEJ A;  3D4G A;  2B4M A;  3Q29 A;  5TPA B;  4YKJ A;  4PQJ A;  3LBS A;  2X7P A;  3HN0 A;  4OVJ A;  4XIG Q;  4H8I A;  4LZ5 A;  1ATG A;  4YAH X;  4NF6 B;  4R6K A;  3USD A;  4GVO A;  1WOD A;  2O69 A;  3FD3 A;  4TQU Q;  4UA8 A;  2OZZ A;  3K6W A;  1M5F A;  1MPD A;  4YZZ A;  4R73 A;  1D3K A;  3JZJ A;  4IB2 A;  3TZA A;  4EQ9 A;  5H8S A;  3MVZ A;  4IO2 A;  5ICT A;  3VLV A;  3DRG A;  3SEW A;  2Y7R A;  4KD5 A;  5AA2 B;  1ZJL A;  4GL0 A;  1B51 A;  4WED A;  4RJZ A;  1J1N A;  5KCJ A;  4AB5 A;  4EDP A;  1DTZ A;  5AA4 A;  4YMA A;  3IK6 B;  3FZV A;  5ELV A;  3A09 A;  1SW1 A;  3C4M A;  3K1P A;  3PPO A;  4OEN A;  2ESN A;  4KCC A;  2NWJ A;  4XXU A;  5FHN A;  4ZZE A;  2QJE A;  2B3B A;  3IOW A;  4HTG A;  2B3F A;  2OJT A;  4F39 A;  1UQW A;  1BTJ A;  2X7Q A;  4ZEK A;  4R2F A;  3RTF B;  2DE2 A;  3TTN A;  4Q30 B;  5H8H B;  1AH5 A;  1LLS A;  3TTK A;  1UTB B;  2GH9 A;  3C36 A;  4JWO A;  4XKP A;  4WKM A;  3ZKK A;  4F2O A;  3OOA A;  3OSR A;  2DP8 A;  1MH3 A;  3K02 A;  4M1V A;  1ZMG A;  3IB1 A;  3MAM A;  2RIN A;  5K2X A;  1GGG A;  4F3P A;  3O6H A;  3C31 A;  4TOZ A;  4GQO A;  5ITP A;  4BDQ A;  3UIF A;  2XXY A;  2XXU A;  3H3G A;  3KBR A;  2O1L A;  4NMY A;  2AIX A;  3RNN A;  1XVX A;  2F34 A;  2RCB A;  4FEB A;  1ZBM A;  4KPT A;  4QSD A;  2V84 A;  2Q8J A;  1FW0 A;  2WOP A;  1I69 A;  1JVX A;  2Z23 A;  4G8H A;  2A5T A;  1MXU A;  2H4I A;  1SBP A;  2DWI A;  3B7D A;  4O3C A;  1NNP A;  4RK2 A;  3CHG A;  3CR9 A;  2IA4 A;  3KFM A;  4N13 A;  4BDR A;  5AA3 A;  1R9L A;  1SI1 A;  1VFD A;  1YCJ A;  3FGS A;  2O68 A;  1M5C A;  3D4C A;  1A7L A;  4H5F A;  2XXQ A;  4KYD A;  2XXW A;  3FV2 A;  2UXA A;  3DLN A;  3IR1 A;  4ZE8 A;  1N7W A;  2OCU A;  1IUD A;  3CFZ A;  3FAS A;  4BDO A;  1IXI A;  3FTO A;  1SDX A;  2O7I A;  1PEB A;  3CFX A;  3O28 A;  2ZNU A;  4H67 A;  3I5O A;  3BBR A;  3VE1 B;  4RPN A;  5I59 A;  1B58 A;  1B7Z A;  1PB7 A;  5H8F B;  2HXW A;  1NNK A;  3Q27 A;  3RQT A;  1D9V A;  5I56 A;  4X1B A;  1B6H A;  1MXZ A;  3ILT B;  2V3U A;  3R7X A;  3T93 B;  2G93 A;  4DE8 A;  4KCD A;  2PMS A;  3SER A;  4QFK A;  1MY3 A;  1N04 A;  2THI A;  3QUF A;  4KHZ E;  4EQ7 A;  3ONM A;  5ICQ A;  1QJM A;  3VDF A;  2HQ0 A;  5JTY A;  1XS5 A;  1EZ9 A;  4QFP A;  3N6U A;  4NF8 B;  5H8Q B;  3VFJ A;  2HCA A;  3MW0 A;  2XXX A;  3HHG A;  4KYE A;  3THI A;  4ESW A;  3G3I A;  5HM4 B;  4RA1 A;  1PB8 A;  4OEV A;  3W15 C;  4TLL B;  4ELP A;  3FJG A;  2XXP A;  1VFE A;  2F35 A;  1US5 A;  3OXN A;  1RKM A;  1FTM A;  3FXU A;  2QS3 A;  3T9X B;  3G3H A;  2DOJ A;  3H03 A;  5CC2 A;  1NFT A;  3B6W A;  3PUV E;  2AYS A;  2D3I A;  3CIJ A;  4M4G A;  4F18 A;  3OSQ A;  2O1M A;  2OK2 A;  4H6D A;  4H65 A;  3N94 A;  2XX9 A;  2Y7P A;  4OQO A;  2H25 A;  1H44 A;  1GVC A;  1GV8 A;  1FQB A;  1OIB A;  3U94 A;  4O3B A;  4F1V A;  3O6G A;  1DSN A;  1PDA A;  4E0X A;  3IB0 A;  1B3E A;  3VV5 A;  1BP5 A;  4YKI A;  3HPI A;  3TTM A;  2HAV A;  1MH4 A;  2OBG A;  1R9Q A;  3TCF A;  5L9O A;  1B1X A;  5HBC A;  3SES A;  1NNT A;  2PVU A;  3KN8 A;  4NE4 A;  3K01 A;  4YB6 A;  1P99 A;  1P1N A;  2ZNS A;  1OQG A;  3WAF A;  1URG A;  3MP1 A;  3QYT A;  4ZZA A;  4LQ5 A;  4KFQ A;  3OO6 A;  3U1O A;  2F7B A;  3KOT A;  5KCJ B;  3GBA A;  3DEL B;  2ZNT A;  3T9H B;  4IY6 A;  3MWB A;  1B40 A;  1SI0 A;  4LUB A;  1I6B A;  4XTC Q;  1B5H A;  1OVB A;  3RUM A;  2I48 A;  2I58 A;  3TMG A;  2DWH A;  4KI0 E;  5A5X A;  3S9E A;  4ZEI A;  2UVG A;  1QVS A;  2I3V A;  3G7W A;  4EQB A;  4JSD A;  1USY E;  2CMO A;  4GFR A;  3A3U A;  3C35 A;  1M5B A;  3PD8 A;  3PPR A;  4Q5T A;  4TLM B;  3VVF A;  4FJP A;  4OWD A;  1O63 A;  3FVG A;  4H0W A;  4P0G A;  3HHF A;  1JVY A;  2DSF A;  5JK4 A;  1H43 A;  5DEX A;  2XX8 A;  3SEU A;  1B5J A;  4ZEC A;  2FYI A;  4ESX A;  1XHY A;  3O66 A;  3FAT A;  2KLF A;  1BLF A;  3MC2 A;  4P0I A;  5H8F A;  3UOR A;  2UYE A;  4OMB A;  1ELJ A;  2ONK E;  5TP9 B;  3IX1 A;  2P0S A;  3IO4 A;  3QUJ A;  1AIV A;  3T9U A;  3V89 B;  1Z7N E;  2HEU A;  5JEI A;  1QUI A;  4HCW A;  3LUY A;  3MBP A;  4R75 A;  1ZLQ A;  4R74 A;  4NWD A;  2GRV A;  1DOT A;  5F1Q A;  1H3D A;  2DWA A;  2UVI A;  1LGB C;  4ECF A;  5I2N A;  1D4N A;  1OMP A;  2Y7I A;  3IAZ A;  1CB6 A;  2GHA A;  2V25 A;  1ZIU A;  3B6Q A;  4MFI A;  2UVJ A;  3VVE A;  4POX A;  1IXG A;  5FHM A;  3KOS A;  4GXA A;  3DP4 A;  2OLB A;  2ONS A;  2LAO A;  3KGC A;  4IO7 A;  2F8D A;  3DRK A;  5IAI A;  1MXV A;  3PU5 A;  3FJM A;  1BKA A;  4YKK A;  2Z22 A;  1N7X A;  1EH3 A;  1PC3 A;  1LAG E;  1QW0 A;  5CMK A;  1AMF A;  4G2Z A;  5ITO A;  2AL4 A;  2PT2 A;  3SKP A;  1JEU A;  2Z8F A;  3TYH A;  4EF2 A;  3IOV A;  3IOU A;  4OXV A;  1UTH A;  1A55 A;  3H6V A;  1YAE A;  3TTR A;  3TFL A;  4F2Q A;  1SW4 A;  2B4L A;  5CMM A;  4FED A;  3MZ9 A;  4MLV A;  4XKN A;  2YJP A;  3SEX A;  1MXY A;  1WVJ A;  4EXK A;  4EUO A;  2XD2 A;  3O6I A;  1Y4C A;  2Y84 A;  3JV9 A;  1TXF A;  3PUX E;  4ISU A;  5CBR A;  2RC7 A;  3Q25 A;  3RY3 A;  1MG1 A;  4N07 A;  3TQW A;  4ELQ A;  4HW8 A;  5I56 B;  1NNF A;  1IQ7 A;  3PUY E;  2PX1 A;  4EF1 A;  1LFI A;  3OO7 A;  1EZO A;  2G29 A;  4GIZ A;  1TFA A;  1IXC A;  4IY5 A;  3MZ1 A;  4KR5 A;  2FA7 A;  1SW2 A;  4UAC A;  1B52 A;  1MPB A;  2Y7W A;  5JTY B;  2V3T A;  1OLA A;  1A99 A;  4QFO A;  1WDN A;  3O6P A;  3BKI B;  1KWH A;  4U4X A;  4BDM A;  4Q8R A;  4JXI A;  5I84 A;  1S50 A;  1SYI A;  1RYX A;  1AOV A;  3O9P A;  2YLN A;  1FQE A;  5ISU A;  3C34 A;  3CVG A;  4NF6 A;  3TEL A;  1FTK A;  2QRY A;  3N6T A;  3MVX A;  1VE4 A;  3TAJ A;  3E4R A;  4YIC A;  3IB2 A;  4BDL A;  1QUJ A;  5B7D A;  3V83 A;  1FTL A;  1HSL A;  2ANJ A;  5TU0 A;  1FQC A;  4E0W A;  1LST A;  3QIM A;  2F7C A;  2VGQ A;  3EHU A;  3K1M A;  3LSL A;  5L8D A;  3LC8 A;  4I62 A;  4N6P A;  2P1S A;  5FTI A;  3T22 A;  1URS A;  2I0B A;  5I2N B;  1Y3N A;  4OYV A;  2QS2 A;  4U22 A;  4RY1 A;  5EYF A;  4NF8 A;  3RN8 A;  2H98 A;  3TKD A;  1LFH A;  2M8C A;  1JNF A;  1H76 A;  3S9L C;  2F6G A;  3KSX A;  2REG A;  2I3W A;  1SVX B;  2XX7 A;  1FTO A;  2XHD A;  1MQJ A;  1FTJ A;  5KZT A;  1MQG A;  1IXH A;  3IOT A;  2I49 A;  4G4P A;  4Q0C A;  1O64 A;  1NL5 A;  5J1D A;  2PBW A;  2Q89 A;  3G3F A;  4PFW A;  1N84 A;  2DXR A;  1LBC A;  3AXF A;  2DS9 A;  3PMX A;  4PE5 B;  3UN6 A;  1MPC A;  5I59 B;  2W7Y A;  4YKP A;  1TT1 A;  4QF9 A;  4OZ9 A;  4KQP A;  1B5I A;  1MY0 A;  1JQF A;  1USY H;  3F11 A;  5I57 B;  3K00 A;  2PT1 A;  3TOD A;  4F19 A;  2NOO A;  2VD3 A;  4JWX A;  3S2V A;  5L9M A;  1Q35 A;  1B32 A;  2GHB A;  3E9X A;  3IO6 A;  3LR1 A;  4JWY A;  1A8E A;  4ND9 A;  5BWJ A;  1B3L A;  4KYS A;  4NWC A;  5LOM A;  3KSJ A;  1FQD A;  1SW5 A;  2F6P A;  4G68 C;  4I8C A;  2A5T B;  1LFG A;  4QHQ A;  3H7M A;  2DE3 A;  4FAJ A;  1N3W A;  4GD5 A;  1D9Y A;  3E13 X;  3OEM A;  1JW1 A;  4G68 A;  1P1O A;  4LZ7 A;  4LZ8 A;  5I2K A;  3FVN A;  3K2D A;  3U8Q A;  2PYY A;  4DDD A;  3LSF B;  1B9J A;  1F9B A;  1SYH A;  4IGR A;  2DXY A;  4U4S A;  2H99 A;  5DTB A;  3FV1 A;  4G68 B;  5I2K B;  5CBS A;  3TQL A;  3KG2 A;  4X9T A;  2WOL A;  3VXB A;  1NMU A;  1Y20 A;  3UK4 A;  4RPO A;  3V8X B;  4JB7 A;  4K3F A;  2HAU A;  2R71 A;  2ZYN A;  4H1X A;  3OEL A;  3Q26 A;  4POW A;  4QSC A;  5DVF A;  1Y3P A;  1P1U A;  3T96 B;  4IO5 A;  1UIV A;  4OET A;  3DRH A;  1IZ1 A;  5DVI A;  4YMB A;  1B3H A;  4MF3 A;  3H06 B;  4NF5 A;  4R72 A;  4R6Y A;  4OES A;  1LAF E;  4LVQ A;  5I57 A;  1T0K A;  2UYF A;  3ECR A;  3TCG A;  2VOZ A;  3PMV A;  1XT8 A;  2HZL A;  3C33 A;  3DP6 A;  3PPP A;  4RXL A;  4PP0 A;  1NH8 A;  4F3B A;  1POT A;  4OTE A;  2R9J A;  4PET A;  5AA2 A;  2QL3 A;  2XXI A;  3G3K A;  1XC1 A;  1LBB A;  2VHA A;  2F7A A;  3EHT A;  4G8M A;  3EF7 A;  4U1Z A;  2FNC A;  3TEP A;  3QXM A;  1QUK A;  3SET A;  3FJ7 A;  3TUS A;  3EHS A;  3U72 A;  1MM6 A;  2NUV A;  4FE8 A;  3RPW A;  4P11 A;  2HFB A;  4GLI A;  3MPK A;  4LA9 A;  2RF1 A;  3PGF A;  4ONY A;  3CRB A;  4OFJ A;  2AL5 A;  4X1D A;  3FXQ A;  1II5 A;  3OMB A;  3UP9 A;  4MBP A;  4IO3 A;  3TCH A;  3A3C A;  3B6T A;  4IGT A;  5CMC A;  3K6V A;  3ILU B;  5TPA A;  4U1O A;  3FIR A;  1B2H A;  2RC8 A;  4O3A A;  3ODB A;  1LAH E;  4PFY A;  3TPA A;  3DP8 A;  2H5Y A;  4GOT A;  1B4Z A;  4DCY A;  3LVU A;  1PBP A;  1B7H A;  1ZKB A;  2DWJ A;  4U21 A;  2RKM A;  3MZB A;  3N26 A;  4OFL A;  3CG1 A;  4I1D A;  3KJT A;  4RYA A;  5L9S A;  4ZED A;  4AQ4 A;  1S9T A;  3O2A A;  4NF4 B;  2F5X A;  3C32 A;  3K6X A;  2D5W A;  5EHS A;  2NVU B;  3MP8 A;  5F7V A;  5A5X B;  3RTW B;  1Y3Q A;  2YPN A;  3EN3 A;  1M5D A;  3QAX A;  4DLD A;  5BUU A;  2DE4 A;  2XD3 A;  3RYA A;  1LB8 A;  3DRJ A;  3FVK A;  3GBB A;  3PUW E;  3S9M C;  1DTG A;  1P1Q A;  4XKQ A;  1IIW A;  1B46 A;  1TWY A;  2DQV A;  3K6U A;  2GFE A;  3O29 A;  1XVY A;  4OHN A;  3WAE A;  5CM6 A;  2F78 A;  1DPP A;  1Y1M A;  3VVD A;  3ZKL A;  2QSX A;  1ZTY A;  1B7U A;  2Z8E A;  2E1S A;  3G3G A;  4U23 A;  2XXH A;  3DRF A;  1H45 A;  3DM0 A;  1MRP A;  4X48 A;  2I4B A;  4WXJ A;  1YPN A;  1B0H A;  3ZS6 A;  1PB9 A;  1MXX A;  2ZXT A;  2O7U A;  4LON B;  5H8H A;  4DZ1 A;  4GXS B;  1N76 A;  3IL1 B;  5M2V A;  1LCF A;  1UTH B;  3UGW A;  1VSO A;  3M3L A;  1AL3 A;  2OWT A;  2ZYK A;  3MQ9 A;  4ZEB A;  5EHM A;  3RT8 A;  1P1W A;  4BLA A;  1O7T A;  5CMB A;  3M8U A;  3CSG A;  1EZP A;  2O51 A;  4QFN A;  3IJO B;  3JYR A;  5B70 A;  3GXA A;  3PPN A;  4R6H A;  1UIU A;  1YTV A;  4BDN A;  5AA1 A;  1MDQ A;  2QMW A;  1QKB A;  4PFU A;  3OO9 A;  5AA4 B;  3UA8 A;  1B1H A;  1OVT A;  3K1N A;  3DRI A;  1TFD A;  1Q1K A;  1GTK A;  1MQI A;  2F36 A;  3BFU A;  4C1U A;  5H8N B;  4LQ2 A;  3VLW A;  1GR2 A;  4DCX A;  4F3S A;  3H6T A;  3H4Z A;  4OEU A;  3E3K A;  1MS7 A;  4IO4 A;  5KDT B;  1MM7 A;  3OEK A;  5CRY A;  2D21 A;  5FHO A;  5H8Q A;  3MP6 A;  4JBZ A;  1B0L A;  2ZYO A;  3U92 A;  3QSL A;  2I4C A;  4NTL A;  4ELO A;  3MJN A;  4QFL A;  3SDF A;  4THI A;  3KZG A;  3LSW A;  3RT6 B;  1Y9U A;  1Z7M E;  2I6E A;  2CZL A;  3OD7 A;  1B3G A;  4GF8 A;  4HCY A;  3S4U A;  3VLU A;  2DVC A;  2QS4 A;  2O6A A;  3SEY A;  3MVY A;  3PMW A;  1B05 A;  1N3X A;  4R9F A;  4AB6 A;  1JW5 A;  3PPQ A;  2QPQ A;  3HST A;  4EXL A;  1LCT A;  4F29 A;  3Q28 A;  1M5E A;  2ZMB A;  4GWO A;  4XKR A;  1SQY A;  4WEP A;  2I0C A;  4GL8 A;  1IIT A;  3GZG A;  4YB7 A;  2UVH A;  4HS7 A;  1PBQ A;  3VXC A;  5I58 B;  4DIG A;  4JSO A;  1JW4 A;  2Z8D A;  1MY4 A;  1XOC A;  1Y1Z A;  2WKY A;  5TP9 A;  3K4U A;  4QRZ A;  2VD2 A;  1ZU0 A;  1SD3 A;  1QUL A;  2QS1 A;  3KJ7 A;  3ZSF A;  1QKA A;  3RYB A;  2RCA A;  5HPQ A;  2V3Q A;  1BIY A;  1EU8 A;  2Y7K A;  4F3G A;  1OLC A;  1R6Z A;  2ZYM A;  5K2Y A;  3K0V A;  4ZDM A;  4YB5 A;  3W9V A;  5DEX B;  3TTL A;  1B3F A;  3C9H A;  1MXW A;  3IJX B;  1A40 A;  2A5S A;  4H5G A;  4U2R A;  4NF5 B;  1LB9 A;  1NH7 A;  2XXT A;  4R2B A;  4RNS A;  2P2A A;  3GLB A;  3HO7 A;  3OEN A;  3RLF E;  5KDT A;  3I3V A;  3L6H A;  3I6V A;  1UTB A;  2XXR A;  3FVO A;  3HV1 A;  5IKB A;  3CG3 A;  1OQH A;  2H9B A;  2WOK A;  3KN3 A;  5H8N A;  3BFT A;  3H6W A;  4G77 A;  1NKX A;  2ONR A;  4JDF A;  3TDJ A;  1URD A;  5AE4 A;  2O84 X;  4ZE9 A;  4PFT A;  5DVJ A;  4ZEF A;  3PUZ E;  3PV0 E;  3MUQ A;  4F1U A;  2V93 A;  4F31 B;  4FAT A;  5AA2 D;  3SEV A;  1MQH A;  2R6G E;  1RYO A;  4YU0 A;  2RC9 A;  3U93 A;  2DVZ A;  1JET A;  3MPL A;  4H8J A;  1I6Q A;  1HSJ A;  1MY1 A;  5FTH A;  2Q9T A;  3T9V A;  4DXB A;  4F22 A;  2F97 A;  4Z7E A;  1FQA A;  1MY2 A;  3M3K A;  2VP1 A;  3O97 A;  3R6U A;  4C0R A;  3OO8 A;  4DXC A;  1VR5 A;  2ABH A;  1Y4T A;  3KN7 A;  3M3F A;  4DXU A;  1DPE A;  3P7I A;  4OFO A;  1N0T A;  3V5A A;  1JEV A;  3FUZ A;  4NF4 A;  4FEC A;  3N5L A;  5DYH A;  2X26 A;  4LAT A;  3H6U A;  3R26 A;  3MVW A;  2IEE A;  1CE2 A;  3IOR A;  4FOR A;  1POY 1;  4F1Y A;  3CSB A;  1US4 A;  3FXR A;  5CI5 A;  2Q88 A;  3KEI A;  4MH5 A;  5DT6 A;  4RK9 A;  4IO6 A;  4LP2 B;  2Q2C A;  1DMB A;  1MDP 1;  2OWS A;  3L6G A;  4FIM A;  3CFL A;  1FCK A;  2QMX A;  3PD9 A;  1A8F A;  4MLQ A;  4Z0I A;  1A54 A;  3RGY A;  3PAM A;  1HSE A;  4L17 A;  1FQF A;  4C1T A;  1MQD A;  2E0S A;  2Q2A A;  3EQ1 A;  2XXV A;  3W9W A;  2HZK A;  2NXO A;  4NED A;  1ANF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...