1QKQA

Charcot-leyden crystal protein - mannose complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
SLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EOSINOPHIL LYSOPHOSPHOLIPASE
publication title Selective Recognition of Mannose by the Human Eosinophil Charcot-Leyden Crystal Protein (Galectin-10): A Crystallographic Study at 1.8 A Resolution
pubmed rcsb
molecule tags Hydrolase
total genus 34
structure length 141
sequence length 141
ec nomenclature ec 3.1.1.5: Lysophospholipase.
pdb deposition date 1999-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qkqA00
1LU1A 1PZ8A 1JN2P 1GZ9A 2W08A 4XIKA 5DUUA 4XE9A 3UJQA 2V73A 2ZABA 4YGEA 2ES3A 3IKWA 3VKOA 2EXKA 1AXKA 4PBOA 1G7YA 3OBRA 5DUVA 3A4UA 2D7FA 4FPKA 2UWCA 4XJ8A 1DQ1A 3INAA 1N47A 5SV8A 3RRDA 5GALA 2ZMLA 5IK8A 4HL0A 1DQ0A 2EIGA 2JE9A 2NN8A 2P34A 3HN1A 3OGGA 3SH4A 4YM3A 1SLIA 4KBBA 1IS3A 2A6WA 3ILFA 4Q8LA 3TB0A 1G9AA 1V6LA 4Y1YA 4YZ5A 5F9TA 2GDFA 2DUPA 1N3OA 1QGLA 2W39A 1IS6A 2CWSA 3M3OA 4IQPA 4XDQA 2DVFA 2NMOA 3ZYPA 1GKBA 3USUA 1DYKA 2D3RA 1AXYA 3ATGA 1ENSA 4GKXA 2VY0A 4YGBA 1MS1A 1NLSA 4SLIA 4ATFA 2BQPA 5HCFA 1S0FA 3SH3A 4P14A 3PVEA 4GWMA 4WVVA 3WVJA 1QOOA 1UKGA 2P2KA 3O12A 5CA6A 2D43A 3PMEA 4YW3A 3MW3A 2DYCA 5JOYA 1B09A 3NV2A 1C1LA 4YW4A 1KDKA 1KITA 2A7AA 4BM8A 2ARXA 1MS8A 4Q1PA 1G9DA 4CZSA 3HMYA 1S0GA 4WV8A 1GICA 5GLWA 2NM1A 3WUCA 1IKPA 3ZVXA 3SISA 1SLTA 1LU2A 5DZEA 4R9DA 1MS3A 4FPEA 1Z0HA 3AYEA 4AGGA 5T5LA 4Q27A 2NYYA 1LHVA 1YIFA 3WUDA 2E7TA 3I8TA 5GM0A 4FPCA 3MEPA 1CPNA 2I2SA 2XG3A 3UL2A 1JW6A 3FFZA 2ZHMA 1VALA 3AP7A 1V00A 1GNZA 2TEPA 3QLQA 3SLIA 3RG0A 1IKQA 3AZZA 3IPVA 3ZSJA 1ENRA 2A71A 4K1ZA 1MS4A 4FPHA 2EF6A 4ASMB 1ZM1A 3SITA 3OY8B 3WDVA 2DWRA 2Q5TA 2OW4A 1LHUA 3V0AB 4NO4A 3V0BB 3ZXLA 4Q1RA 1W6OB 3OPZA 3D5OA 1G9CA 1KDMA 1SBDA 3LCPA 1LHWA 1W0PA 3M3EA 3ZXKA 4UW4A 5T54A 1Q8PA 4XZPA 3W58A 1LOGA 2A75A 2NMNA 4XJWA 1GSLA 1W6PB 1BKZA 2D3SA 2JD4A 3OJBA 4U2AA 5IK4A 1HQLA 3ILRA 2YV8A 4M3CF 4FPGA 1DHKB 2SBAA 4XJZA 1SLLA 3GNEA 2CTVA 1SCSA 1JOJA 1WBLA 3UJOA 3AXEA 4YM1A 2ZGLA 2UU8A 4UW5A 1WLWA 3FLPA 1WLCA 2D6PA 3AZYA 4Q2FA 1V6KA 2AH2A 2DU0A 1SCRA 1IOAA 2WSVA 3B69A 3BTAA 3KM5A 4XJUA 5DZFA 4DRRA 4Y22A 3WDTA 1QMJA 2OUHA 1LCLA 4FPFA 2ZHKA 1V6MA 2W52A 4YW2A 1G8WA 1LTEA 4JRAA 1DGLA 1SBEA 3V64A 4ATEA 2GMEA 2GMPA 1DBNA 1QDOA 2PHXA 5GLUA 1JYIA 2GN7A 4BMBA 1HLCA 5GLZA 2CNAA 2WKKA 2LALA 5JOWA 1SLAA 1SBFA 2FMDA 4ITCA 4DQAA 2NZ9A 4Y20B 3SH5A 3WDUA 2D6NA 3O0XA 2VUAA 2SLIA 3AXDA 3HR9A 3BODA 4LBQB 1URXA 4R9BA 1CR7A 2ZKNA 3WDYA 5JVVA 1Q56A 4AGVA 1HQWA 3WCRA 4U36A 3WG1A 1WW5A 4RL7A 3WDWA 1NXD1 3R05A 1VIWB 1UZZA 3N7KA 5EWSA 1DQ5A 2DVBA 1LOFA 4LBQD 5H9QA 4YFZA 2D6LX 1C57A 1GZWB 2E51A 2R0HA 3ZXFA 1LENA 3TAYA 2WT1A 1JUIA 4DFSA 1G9FA 1Q8VA 1KRIA 3WG3A 1SLBA 1ULEA 3O5SA 3QCWA 5CBLA 2ZMNA 2UURA 5E8AA 1N3QA 4LBOA 1CESA 1FYUA 3WZ1A 2R0FA 4Y26A 5DUXA 2UWBA 1R1ZA 4FPOB 1WW7A 2D6MA 4XHXA 5T55A 1JXNA 1C4RA 1LESA 2JE7A 2YROA 1S0CA 4M00A 3OYWB 4CTEA 1MVQA 3ENRA 3WCSA 4XTPA 4M3CB 4XXPA 4BMEA 3U4XA 2WT2A 1S0IA 3PVNA 1DFQA 3WV6A 4XIOA 2A3XA 1FATA 5GLTA 1A3KA 1MR5A 5KXCA 3B01A 3MW2A 3V0BA 3UK9A 4LBNA 2ZAAA 1VAVA 2R1BA 1S0BA 3DUIA 1AVBA 3KQRA 4GWNA 3ZPYA 1JBCA 4I30A 1W6MB 1LHNA 1LULA 4YFWA 1F9KA 4UW6A 5GZEA 4BQ1A 2JKBA 4L8QA 4BLJA 1UL9A 1D0HA 2DV9A 1DLLA 4Q26A 2CYFA 4C1XA 4R9AA 4PCRA 4Y1UA 3AP4A 1BYHA 3VKMA 4BOWA 4JCKA 3N7MA 3FLTA 3POYA 2VH9A 1AX1A 1LODA 3AZXA 4LBMA 3AK0A 1MZ6A 3D6EA 2ZACA 3VKFC 1DIWA 3FLRA 4FPYA 4HANA 4ZKTB 1ULDA 2WT0A 5EXOA 1LHOA 1U0AA 2DTWA 1S0JA 4FVVA 2YZ4A 1OKQA 4FQ4A 2OUJA 1I1EA 2PHWA 4D69A 4LBKA 1OQ1A 1LOCA 2R1DA 1W6QA 1UAIA 5EYXA 1YO8A 2ZGKA 3M3QA 3PVOA 1Z78A 2A6ZA 2UWAA 4FOWA 3LSDA 1AJKA 1BZWA 3FBYA 3R4UA 4FOVA 5FREA 5BYNA 1N1VA 1UX6A 3SNMA 4XBLA 1EPWA 1VLNA 1WD4A 2GALA 2ZGQA 3D4KA 3OBTA 4GALA 4K20A 4XILA 5DG2A 2EALA 2A3WA 4YG0A 4FPJA 1MVEA 1H9WA 1QOTA 4WVWA 5FRAA 1QOSA 1N1SA 5IUQA 2P3IA 2VW2A 4P9YA 3AZWA 3VKNA 5KXBA 1C1FA 1D2SA 4XMAA 1LECA 1N3PA 2P3JA 4K21A 3ZXEA 2VW0A 2W68A 5AVAA 4FOQA 3USUB 2DVAA 1AJOA 1SACA 1WCSA 3DGTA 2WSUA 1WUVA 3O0VA 1LJ7A 3L2YA 5JMCA 5GZCA 4P9WA 1V6JA 1Q8OA 5DG1A 4ZXKA 1GANA 4YLZA 1GYKA 3APBA 1Q8SA 2B7YA 4Y1ZA 5GZFA 5GZGA 1V6OA 4BLIA 1W6NB 3OYWA 1CPMA 5IK5A 3AJYA 1ULFA 3POSA 4M3CA 4FPLA 2DU1A 2JECA 4YG6A 4P9XA 4YZ4A 5DZGA 1AF9A 2GMMA 3GALA 2GNMA 1WW6A 4XMIA 1YYNA 2NP0A 2ZBJA 1LEMA 2PHRA 1ULGA 3IMNA 4YG3A 3NWKA 4NOTA 4XBNA 1W0OA 1GV9A 2EXHA 3A0KA 4Y1XA 3RMXA 1CIWA 3N3HA 1H9PA 2E7QA 1G86A 2G4IA 4YW5A 1F31A 4YGCA 4M3CE 1AZDA 1FNZA 2CWMA 4AVVA 1UN1A 4FQZA 1LEDA 1RIRA 1O4YA 3I4IA 5GZDA 1KQRA 2KM2A 4R9CA 1UPSA 1QDCA 2DTYA 1CN1A 5T50A 3WDXA 2ZGOA 4AVTA 2XB6C 2VU9A 3T1LA 1BJQA 1QF3A 1O4ZA 2VXRA 3IPVB 1J1TA 4PBPA 1V6IA 2JJ6A 5EYYA 2GNTA 2RHPA 1CJPA 2ZGRA 4Z8BA 1WW4A 3AFKA 3AYDA 3N7JA 4XTMA 3POWA 3ZSLA 1GZCA 1PZ9A 2ZMKA 4YM2A 1SLCA 2ZHNA 3W59A 2DVDA 5DXDA 1UZYA 2ZGNA 5E88A 1CONA 3WHTA 2GN3A 1H30A 4YZ1A 2R49A 2D6OX 1FX5A 4XJ9A 3T2TA 1DQ4A 3H0OA 4F83A 4W65A 1QKQA 3M3CA 2E6VA 3OY8A 2D3PA 2H0BA 1APNA 2YMZA 3WG4A 5H9RA 2Z42A 4LBLA 3V0AA 4PF5A 1RINA 1LOAA 3AYCA 2ZGTA 3FUOA 1W6OA 2P37A 4GA9A 2A6YA 2VW1A 4XXAA 5JOXA 1QNYA 3VUOA 1LOBA 3WOGA 3NV4A 4M01A 5L73A 4CRQA 2ARBA 1IS5A 5T5PA 3ZSMA 4BPZA 2AGSA 1KJRA 4WZFA 4XOGA 3IN9A 3JU9A 1W6PA 5HCAA 3AX4A 3RQ0A 3AP9A 4Y22B 3NV3A 3AYAA 1A8DA 4GXLA 1S0DA 4Y1VA 2WQZC 2PELA 5IK7A 1MS5A 1TEIA 2D44A 4YZ2A 2P3KA 1BXHA 2WLQA 1CVNA 1ULCA 1W6NA 1Y7BA 3MPPG 1BQPA 4ISQA 2ZGPA 2ZZJA 2AR6A 5DUWA 1MS0A 3IM0A 3WLUA 2AENA 3O0WA 4FP3A 4RA0A 5IT6A 2DURA 5JOZA 1GBGA 4K1YA 1MS9A 2OVUA 1DQ2A 2GNBA 5KXDA 3B00A 2ERFA 4YGDA 3NV1A 1JHNA 1N1TA 4AWDA 2YY1A 1HDKA 3BIWE 1SFYA 1FAYA 2CY6A 2EXJA 1HKDA 1YXWA 4Y20A 1WLDA 5E89A 2ENRA 4OZXA 3WG2A 1CQ9A 1YI7A 2CL2A 4XJAA 3A0NA 4LBQA 4LBJA 5LK5A 2A6XA 2A70A 2ZGMA 2ZHLA 2A6VA 3ASIA 3M2MA 1XQNA 4H55A 4JC1A 3N7LA 2DVGA 2EXIA 1MZ5A 3ILNA 3PJQA 2ZGSA 3AP6A 2A5ZA 1AXZA 1KJLA 2C9AA 2WJSA 1FV3A 2V5YA 1N1YA 5GLVA 4UW3A 3T1MA 3WHUA 1GNHA 1GZWA 1LGNA 3VV1A 4TZDA 1RITA 2PHFA 3MW4A 5H9PA 4AYUA 1OFSA 2AYHA 2FHRA 4GKYA 1AX2A 4ISRA 3ZSKA 2PHTA 5JLVA 2HYKA 5GJ6A 5HCBA 2AREA 1YRZA 1WD3A 4XHBA 3AP5A 4XYXA 3RS6A 3RSJA 1DZQA 4AGRA 2ZGUA 1JYCA 2PHUA 2AUYA 1ONAA 3B3QE 3RMYA 1LGCA 1FNYA 3FUQA 2GNDA 1GLHA 4C1WA 1G9BA 2LTNA 4FOYA 2DUQA 3Q9OA 4YW1A 3JUUA 4FP2A 4Y24A 2YXSA 5CNAA 2C5DA 4DS0A 3VKLA 1LOEA 2JDZA 3N36A 4AVSA 5CAZA 4Q8KA 3LSEA 4PQ9A 3BOPA 2DUOA 4MYEA 3R4SA 1AX0A 1W6MA 5JDBA 1DQ6A 3M1HA 1PZ7A 4DPNA 4XBQA 4DRVA 1S1AA 3B9CA 5F5QA 3WNXA 5H9SA 5T5OA 1LGBA 1FV2A 2D6KA 5CB7A 1ENQA 3ZYRA 3CNAA 5T5JA 1QU0A 1ZA4A 2A3YA 1I3HA 1W6QB 3N35A 1MACA 1IS4A 2R16A 4YZ3A 3C2UA 1DYPA 4TYSA 1S0EA 1Q8QA 1QNWA 2WNEA 5KXEA 2ZA9A 1UMZA 2EAKA 3ZXJA 1LOFC 1X50A 3V65A 1VAMA 1F5FA 2E53A 1V6NA 3AZVA 5T52A 1WBFA 4YM0A 1A78A 3AJZA
chains in the Genus database with same CATH superfamily
1LU1A 4OHXA 4M4RA 3VBHA 3ETPA 1GZ9A 5BNOC 2W08A 2D5FA 1T2XA 4Q4X1 3UJQA 4JGYB 4A2UA 4BIFA 2CSGA 3KT7A 3WNMA 3ZR6A 1IQAA 1Y9GA 3Q8BA 2QZ2A 3OBRA 2MEV1 4PDWB 5J37A 2D7FA 1HX6A 1T6GC 2OA2A 5J36A 3DL3A 1RVF3 4QXCA 2IXKA 1I5ZA 1VBE2 3I7DA 4OI0A 4XFCA 2DBIA 1GOGA 3HN1A 4JTOA 4JRLA 5BNOA 3VD9A 4YM3A 1E5HA 1SLIA 1YFUA 1IS3A 2D98A 2WDBA 3ILFA 3MLJA 4KBBA 3GZUC 3VDDA 4Y1YA 4YZ5A 1QJU1 2VM9A 2ORXA 4XDQA 1IS6A 2CWSA 2Q8EA 1QQP3 1HB2A 1XRUA 4HSLA 3I97A 2YHJA 4Y4YA 1COV1 4XFIA 5FCCA 4CEYC 2EICA 4PIXA 4COZA 4FI9A 5F5IA 3L2HA 4W8JA 2W2IA 5J7MA 5KHJA 4SLIA 5BNPA 2BFUS 5LWBA 1UYZA 1NX9A 1OT5A 4P14A 4GWMA 1SDDB 4XC9A 5I0RA 1QOOA 1V9U3 1QEXA 3S7IA 3KT1A 4Q0SA 2UYAA 3O12A 3ZFGA 3KF3A 5CA6A 3VZJA 4Q4W3 4YW3A 3PMSA 3M7AA 4LTAA 4CU8A 5K4LA 1D0GA 3NV2A 2WWSA 5FYIA 1Y9QA 2IXLA 3WD5A 2RV9A 4XUTA 4CZSA 1GICA 1NCRB 1VMJA 5LA9A 4AW7A 1YQ8A 3SISA 1LU2A 5FYZA 1MS3A 4UFHA 2ZTNA 4KGGA 1W06A 4Y4RA 1PMJX 4HPKB 1C3HA 4EQVA 5EV7A 1VBA3 2WZ8A 2MPFA 2RM21 5GM0A 3AM2A 4FPCA 3S0MA 3GBWA 2FDHA 3UL2A 1H8TA 1UYXA 2K46A 3GGLA 2ZHMA 3OPTA 1VALA 3OBAA 3VZKA 4GB33 3ZYFA 5A32A 3VD3A 1XOYA 5A6XA 2GP3A 1GNZA 1MZEA 2TEPA 2QQKA 3QLQA 1ZREA 5FZLA 1A34A 1HV1A 1IKQA 4AEKA 1GMMA 3POBA 3ZSJA 3EJKA 2EF6A 4P5HA 2FDGA 1ZM1A 3K51A 4RD7A 1YQCA 3KV6A 1YUDA 2ARCA 1UU5A 3H1MA 3I2GA 1RUE3 2X5IC 3ES4A 4FT8A 1IG3A 3JD71 5FIXA 3JZVA 3H50A 1LHUA 3RYPA 3SEEA 4NO4A 4XFBA 1W6OB 3LFIA 3GF6A 3KB5A 3NSTA 5FO9B 1KDMA 1LHWA 1W0PA 5D8AC 1VP6A 4D6RA 1O3RA 1F4AA 1WCUA 4JQTA 2VQUA 1DP0A 3VN4A 4WVMB 1PGL2 3VBOC 5T54A 5FZAA 4LHSA 4P02B 1LOGA 5EJ1B 2VR4A 3B7MA 2GC0A 4JZRA 5FMOL 2GU9A 1AYN2 1GSLA 4RHV1 1RHI1 4Q4V3 2JD4A 2D3SA 4U2AA 4RS5C 2BOIA 2W1UA 1HQLA 1J83A 1MQTB 2SBAA 3I3DA 4FPGA 4B4PA 5ABJB 5FXVA 3C7EA 1EV11 2PMWB 2YC2A 2EVXA 5FZ0A 1RC6A 4KBZA 3UJOA 5A70A 1H2KA 1ND2B 3BKZA 3QH6A 1PK6A 1V6KA 2AH2A 2ZCWA 3VBUA 5AC92 1SCRA 1F8VA 3KM5A 2YFZA 3H1YA 3OB8A 5IAXA 4Y22A 2XLAA 3WDTA 2VOKA 2HYXA 5AFBA 3GJBA 4CUGA 1DGLA 1H0BA 1K5JA 2GMEA 2D93A 3TN91 3WT3A 5EIYB 4I3GA 1OVPA 4BMBA 1HLCA 4OHZA 5GLZA 4ZHNA 4LEJA 3N9MA 2OKXA 3RZMA 2CNAA 2J42A 5JOWA 2VBPA 2VAUA 4HKWA 3LOIA 3NO8A 3DEMA 3K4AA 4Y20B 1J1LA 2D6NA 3O0XA 3WDUA 5ACA1 2JG8B 1CJDA 4GMP1 5DAPA 5B4NA 2RS33 1CR7A 2ZKNA 3VBFA 1TNFA 4N9HA 5JVVA 1Q56A 1UY2A 5FLJA 4CXXA 4JAAA 1HQWA 2VPVA 3I2HA 4DXZA 3WNKA 3WG1A 2IXJA 4MOAA 4OLLA 2OS2A 2WRAA 3WR0A 3R05A 1UZZA 4YFZA 5H9QA 1J59A 1U5ZA 5KBFA 1C57A 1LRHA 2R0HA 5K7PA 1Y3TA 4NRMA 4IDZA 2IXHA 3TAYA 4DFSA 3AFGA 1G9FA 3EXUA 2PHDA 5FZFA 1ZZ7A 2WA3A 1DLCA 2UURA 2WNUC 3HIFA 3MIHA 4MV2A 5E8AA 4BIOA 1FYUA 1QJU2 2BERA 4BXSV 4RR3C 4XHXA 2HWE1 1KFUL 1LESA 3FBMA 3SCGA 3OYWB 4QPWA 1REEA 3ENRA 2BBAA 2OX0A 1COV2 3LA3A 4X6RB 5FZOA 2V4AA 1AUYA 3OUJA 4MXWA 1L3JA 5JSOA 3J9SA 2MHFA 3U4XA 3O1RA 1X33A 2P5BA 3RDIA 1FATA 2IVJA 3RZGA 1FOD1 3B01A 4XFAA 4LBNA 1ZZBA 2QQUA 4E4DX 2KA3A 1VAVA 3CJIA 4BQ5A 1POV3 2CAVA 3ZYJB 2RDNA 3HJRA 2XJUA 1LULA 1F9KA 1G9DA 4R4ZA 2JKBA 2PQSA 4CXYA 1UL9A 1D0HA 2JIGA 1OUSA 4RN5A 2HWB1 4MGZE 4EYUA 4R9AA 4PCRA 3P6BA 4URAA 4JGZB 2B46X 3FLTA 2AACA 2VH9A 3WW3A 2Z4FA 1PVXA 4LBMA 4GH4C 3AK0A 3MGUA 4XUNA 1XNDA 2ZACA 2DBNA 2X8KA 1NQDA 2RM22 4MADA 3ZMOA 2CDPA 4CPBD 1NAEA 2VVEA 4DXRA 3WNNA 2QCSB 3NKGA 2VQTA 3K77A 5EJ3A 5FBZA 2VUCA 4N43A 4QQHA 2R072 2VD7A 2W95A 1S0JA 1TE1B 3H42B 2FD8A 4D94A 1GOHA 1MEC3 1XYOA 2O8OA 1LOCA 2R1DA 1W2OA 1UAIA 2GC3A 4D6QA 1G6NA 4QPGB 1YO8A 3JD72 4A45A 4CP2A 1WMXA 2VMDA 1W2TA 4FOWA 1R082 2C1FA 2BYVE 2YG0A 4Z1VA 1RUH3 3VZLA 2WYSA 1N1VA 1UX6A 2WABA 1C8NA 4Q4Y3 3D4KA 2ZGQA 2GALA 3R0RA 4HT1T 3ZIXA 1AL21 2JDKA 4KQ7A 3WQ0A 2EALA 5FZ8A 1W8ZA 4OUMA 3S5QA 4FPJA 4DMIA 1MVEA 3GCXA 1H4GA 4WM8A 5A3PA 1QIQA 4WVWA 1N1SA 2P3IA 4IEUA 3DYOA 4CP9B 3AZWA 2XBO1 2AC1A 1LECA 1N3PA 4ES9A 3ZXEA 3VB9A 1EV12 4FOQA 2DVAA 4AHZA 1AR61 1WCSA 2WSUA 5CFDA 3L2YA 4IEWA 5EZWA 1Q8OA 4MVTA 1IHMA 5IK5A 3K2OA 2HWD1 1GYKA 1CAXB 1VRH3 4FO9A 4GULA 5CU1A 5GZFA 3USSA 1V6OA 1XNTA 3NAPC 2JICA 1S2BA 1UYPA 3OGRA 5EP9A 3GXUA 3AJYA 3E6BA 3LE0A 3POSA 4META 2JECA 4YG6A 4EZ4A 2OIIA 1VBC2 4P9XA 2JDMA 4IEVA 3CIHA 3CMGA 2GMMA 2WNVB 2VMCA 3CQOA 2TBVA 5LY2A 5FYHA 1YYNA 1JZ8A 5I0SA 3T0DA 2ZBJA 1LEMA 2PHRA 4UF0A 4YG3A 2NP0A 1XYPA 5JSPA 3VBRC 4Y1XA 5KHHA 3CDZB 5KHIA 5ACA2 1CAVB 4YW5A 4LHLA 3Q8AA 4V1PA 3ZXDA 1O7FA 4AVVA 1RVF1 4BCUA 1UN1A 4CPBA 3I4IA 1X7NA 2H6BA 4P9IA 4DIQA 2KM2A 3W21A 2C24A 5T50A 1CN1A 2XJVA 3NJXA 4I0AA 3AB0A 4S2DA 2WZPP 5FYSA 1BJQA 4L9BA 1YEWA 2VXRA 1K5MB 4B7EA 1F4HA 2JJ6A 4C90A 2ORZA 2RHPA 5D2AA 4JVAA 1CWPA 4P5YA 1WW4A 1W2UA 1WCQA 3UYJA 1QQP1 3MIEA 3P3PA 3CEWA 4MHUA 1YQ2A 1HJGA 4AEDB 1PZ9A 2HWE2 1PNFA 4IEYA 2ZHNA 4XVHA 3W59A 2DVDA 5C8CA 2Z2SB 1CONA 3H8OA 3KV5A 2DCYA 3UNPA 1DQ4A 1V9U1 1W8WA 2BNNA 3H7JA 4F83A 5KWRA 2G9FA 1FOD2 5EPAA 3VBSC 3M8LA 3OY8A 2WO2A 4Q4W1 5C9AA 2Q1MA 3I3QA 5H9RA 3ZLIA 5JXGA 1J84A 4PF5A 1RINA 2BRTA 5CADA 3FUOA 2W1SA 3PUAA 4INDA 1HRI3 3VHNA 4AQ6A 5M0TA 2HWB2 4PF1A 4I2OA 2HEWF 2DFCA 1O8SA 4M01A 3VHOA 3WP5A 3N9OA 4AK3A 5C4WB 3WNPA 4CRQA 2VL4A 2BGCA 4LLFA 3T30A 1V70A 4I0BA 4IGOA 2VBBA 4CP1A 1VBA1 3AMQA 2HKXA 1XPWA 3VBSA 3C7HA 5HCAA 3RQ0A 1RUC3 3AP9A 1X8EA 5IVCA 4GB31 4ZS2A 3AYAA 1A8DA 4QX1A 3E97A 4UOJA 1MS5A 1QJZA 4URTA 4DEVA 1KFXL 3LGRA 1CZTA 4CDQB 1RJ7A 1TMF2 2C0ZA 2P3KA 1BXHA 2P6CA 3LWCA 5A7WA 4AVBA 2QBXA 5F7UA 5IHRA 3TEZA 3MPPG 4ISQA 1RUE1 5DUWA 2QE3A 5E1RA 5IT6A 4RA0A 5JOZA 5E16A 2DURA 1NZCA 1OOPA 3IBMA 4OFGA 2RDRA 2OVUA 5A7PA 3U10A 1DQ2A 4CDUA 4YW7A 5BNQA 2GNBA 2CGNA 5DMYA 5JZGA 1BHGA 3QACA 1HN0A 4PLMA 1E5SA 5DAQA 4CCMA 1JHNA 4OVEA 1JOPA 4EN9B 2VQ0A 1AL22 4E27A 4A42A 1FMD2 4NHKA 2CY6A 2EXJA 1ASJ3 3LEKA 4OZXA 3LEGA 2XQXA 1UXZA 2ZZQA 1NQJA 3A0NA 1OFNA 4LBQA 4Q4V1 4OULA 5FY1A 5LK5A 4ZONA 4MG2A 1JZ4A 2ZHLA 1DF0A 1H1MA 3MYXA 4NR1A 1RUG2 1RXGA 4QPIC 4UI9L 2JDHA 4ONUA 2EXIA 3JQWA 2Q1ZB 3HN3A 2B45X 2VZRA 3AP6A 2A5ZA 2C9AA 2WJSA 2XLGA 3IB3A 1FV3A 3OF1A 3OPWA 3TEXA 3ZR5A 1N1YA 2YPDA 3ORJA 2HWC2 1AR62 4UW3A 3WHUA 3JCIA 1GNHA 5L9VA 5A1LA 1LGNA 1GNYA 2G9GA 3PHMA 1RITA 3CBNA 4LE3A 4N90A 4XQWA 4UBHA 3ZSEA 2HWD2 4AFDA 1OFSA 3J8F3 4GKYA 4QXKA 4XQDA 5BNNC 3S5AA 3FZ3A 1POV0 2HYKA 3THDA 5LW9A 1YRZA 4WM7C 3MLLA 4IERA 4QDQA 1OLMA 3FJSA 1ZZ9A 1DZQA 3ZFFA 2VNRA 2RR12 4GD4A 4RQPC 1FNYA 3BU7A 4LO6B 5FQ0B 2J1SA 4FFGA 3ZKUA 2PFWA 1BK0A 3NQHA 4FOYA 2DUQA 1UY4A 2RS31 3JUUA 5C3RA 2HBUA 1OA2A 5CNAA 3WY6A 4Z2WA 1SZBA 5FZDA 4AVSA 4HN0A 3LSEA 1KGYA 4QM9A 4CDWC 1AX0A 1IG0A 1LKNA 4EROA 2G9ZA 4GZ9A 1HXS3 3KHCA 1PZ7A 4CEWC 1S1AA 3WNXA 3KHBA 5H9SA 1FV2A 3E5UA 1ENQA 4XETA 2XXZA 2Y6FA 5FK7A 4I0WB 4LA3A 1I3HA 4E8CA 4Z82A 1SFPA 3POJA 3RZJA 2R16A 1QQP2 1GP6A 5KXEA 3J7HA 4HETA 4E2QA 2ZA9A 3RZHA 3LDKA 3FX3A 4BJ0A 3ZYIB 1VAMA 1F5FA 3AZVA 4RSUA 3LFMA 4YM0A 5FXWA 3AJZA 1HB4A 5KHKA 3OGSA 3GDBA 1V9U2 1F35A 1CZSA 1JN2P 2WN2A 3IZOA 4QPIB 4A6OA 2W9XA 4XUQA 5DUUA 4RGKA 1YJKA 5F3EA 1ZX5A 2EIBA 2ES3A 2HJIA 2QVSB 3IKWA 3VL8A 4PBOA 1G7YA 3U07A 4UFMA 1R093 3A4UA 4FPKA 2UWCA 4XJ8A 5I8SA 3DXTA 2BVBA 1N47A 4LA2A 3ZXGA 3ITQA 1F15A 4IEXA 4XPVA 3B93A 4NRQA 3UESA 5AFEA 1DQ0A 1JI6A 4QX3A 2EIGA 2I45A 2JE9A 2R062 1C8M3 2NN8A 4AHYA 1FT9A 1RUOA 3OGGA 2WAOA 3DXUA 4E4ZA 2XQRA 1GR3A 3LPFA 5LEKA 2A6WA 5A3OA 1GWKA 4JV4A 5CFCC 1DGRN 4BB3A 2WNOA 2GDFA 2DUPA 2VCBA 5FMCA 2B39A 1PVC1 1NCQA 2ZX1A 2DVFA 2NMOA 3ZYPA 3USUA 3B5LB 4DEQA 4ARYA 1AXYA 1MEC1 5CEHA 2QDNA 3GBFA 4GKXA 1YJLA 1RUE2 4YGBA 2VMGA 3SMHA 3BB6A 3UT0A 1MS1A 4JKMA 4QMAA 4A7YA 2BQPA 2B4KA 4JDOA 4QXHA 4CDWB 1S0FA 2W94A 4N53C 1O3TA 3CF6E 2WZR3 2CAUA 4NIHA 3O7OA 1S4CA 4MGTA 4Q4Y1 1Q3EA 2TNFA 4OI2A 1XXNA 2FCUA 1JU3A 2J1AA 2QQWA 2VOTA 4YW4A 2YB7A 2YDEA 4CU7A 1XJAA 2A7AA 1HV0A 2QQJA 1MS8A 4MGYE 4AVCA 4IE0A 5LA1A 2VUDA 3JBG3 5FYBA 5F3GA 2BDRA 2J1RA 3I2JA 1YIPA 2YFUA 3RFRA 1NA1B 2P6HA 3RWNA 1AYM2 3WF2A 3PNAA 5CKNA 1Z0HA 4YVSC 2ETEA 4AGGA 2DCKA 3LAGA 4Q27A 2NYYA 3MHZA 2P17A 1PO13 1YIFA 4RYDA 1QJX2 3I8TA 4NAOA 1A8MA 2J1TA 2RJLA 4UYBA 1NLQA 2RS52 2FZ1A 2XG3A 3GCWA 2JDNA 3KWVA 3KV4A 1BMV1 4JGYC 3TEWA 1SPPA 1CAWB 1VMHA 4LO7A 1W90A 2ET7A 3RG0A 2FDIA 1ENRA 4K1ZA 4PDWC 1MS4A 2ZEZA 4ASMB 3SITA 2Y0OA 2VZTA 1EUTA 4PJYA 3MBWA 2DWRA 4QQOA 2PQQA 5HXVA 5CG8A 1UOJA 4Q1RA 1SG3A 4LKDA 1SBDA 3A21A 4DB5A 1U5YA 3NL1A 2PAKA 3K4DA 1H4HA 4HZFA 1WA4A 5FO7B 3ZXKA 2RS32 2GC1A 4ASLA 5LBFA 3F95A 5JUVA 1Q8PA 2D97A 3EHKA 5ANQA 2VOWA 3ZFEA 2A75A 1ZYBA 1ULPA 2F4LA 1W6PB 3IMMA 3U75A 1R1A3 5IK4A 3BTZA 4O61A 2YV8A 3WNOA 1SLLA 1OQDA 1SCSA 1WBLA 5A7OA 4MLOA 2ZGLA 2UU8A 4XABA 4AFCA 3T09A 4UW5A 4N53B 5K0UC 4YARA 1O5UA 3UV9A 2G1MA 4EZHA 1RUI3 4I09A 5JXJA 2D6PA 3T4HB 2IFRA 2VTXA 4Q2FA 4A44A 5FJKA 1WZXA 5LB6A 4EJRA 2DU0A 5FZIA 2WSVA 1CIYA 1LCLA 3OUIA 1ZA7A 3Q8FA 1M06G 5FUPA 1G8WA 1LTEA 4JRAA 3N9NA 1SBEA 2K0GA 1RUJ3 4HXCA 2BW8A 2IUWA 2UY9A 1GUIA 2PHXA 4IEPA 4KH9A 4UBGA 2GN7A 3I3EA 5G04L 5DN2A 2WS92 3J26N 2YC0A 3JB8A 3OCPA 3OSDA 4DQAA 5FPXA 5FLIA 3CZUA 1K3IA 2SLIA 3AXDA 3VL9A 4A7KA 2JDPA 3WDYA 1HRI1 2ILMA 1ZBE3 2IZWA 2WL1A 4NWWA 4AGVA 1NCRA 3AKSA 2GH8A 3JXSA 3WCRA 3D0SA 2QQMA 4U36A 2VECA 1EUUA 3WDWA 4L97A 2DVBA 1LOFA 2PLV3 2Y26A 2D6LX 4X8NA 1EAH3 4YVWA 1LAJA 4IV1B 1LENA 3RYKA 4AHWA 1JUIA 1RUC1 1Q8VA 3CJXA 1SLBA 1ENXA 1ULEA 2Y60A 5JMOA 3E6CC 1AHSA 4QPYA 2Y34A 2Q0AA 3MUY1 3THCA 3C3VA 1CESA 2UWBA 1WW7A 4JTNA 4QHBA 4IEQA 1JXNA 1W2AX 5FMDA 4N7IA 2YROA 1S0CA 3OGJA 4QT6A 4YSFA 1MEC2 3NNFA 4NIAA 4ZU5A 1UNBA 1H2MA 1DFQA 3HT2A 4HVRA 3ZDSA 4KG0A 3LA7A 3UKVA 5FTTC 1MQTC 2J7MA 2X53S 4R4XA 5A3NA 5ABJC 1RUH2 4CU6A 2XVGA 2R1BA 5FYYA 1AVBA 1QJY2 1WWYA 3E1F1 3KQRA 4COWA 1ND2C 1TME2 5K0UB 1W6MB 4YFWA 4AFBA 1B35C 1ASJ1 4CCDA 4BLJA 1DLLA 2DDUA 2WUHA 5JSRA 4IV3B 4B1LA 4C1XA 4RFRB 1BYHA 3U37A 1ND3B 4JCKA 1AX1A 3PVBB 1I6XA 4NVPA 1LODA 3AZXA 4CEYA 4BDVB 2BWAA 1MQTA 3D6EA 4ZPIA 2RMU1 5FZ6A 2Y6HA 5DDJ3 5LY1A 2VMEA 2JG9B 3N9PA 5JXHA 1ST8A 2WT0A 5EXOA 1LHOA 2QQVA 1BMV2 4IEOA 1NG0A 2JG8C 1VRH2 2XHKA 2YZ4A 3J8F1 4PIZA 1PMIA 2LRPA 2OUJA 1H1IA 3WX5A 4LBKA 4UFIA 1ZRFA 2Y6JA 3HBKA 1W6QA 3KSCA 3VBHB 4M0HA 4KG8A 4TSVA 1IPSA 3D82A 2VO5A 3PVOA 4I01A 5F8PA 1HIXA 1O59A 3LSDA 1AJKA 1BZWA 4GMP0 5BYNA 5FREA 3POFA 1JYWA 3SNMA 3TWIA 1VLNA 1WD4A 3OBTA 4XF9A 3M70A 5DG2A 2W3JA 2A73B 1ODNA 3KS7A 4Q0VA 2CV6A 2VGDA 1UMHA 2H0VA 1H9WA 4AEJA 5FRAA 4LNVA 5IUQA 1HXS1 3LA2A 4P9YA 3VDDB 2V72A 4BK5A 3WW2A 3WF0A 3VKNA 1Y43B 1OA4A 3T2QA 1QHDA 5KXBA 4AI3A 2X5IA 2CU5A 4XMAA 5HV0A 1O6UA 1RUD3 1V0AA 2HWF3 2W68A 3MLKA 2VQAA 4HOOA 1AJOA 1SACA 5AVAA 4O9EA 4FAGA 4IESA 4D7SA 5JMCA 1OUXA 1V6JA 1XNAA 3Q8CA 3VZOA 3EYPA 4AG4A 4LPLA 4YLZA 5BNPB 2Y33A 5D8AA 4E2GA 1HB1A 1OF3A 4PIYA 3FHAA 2WAAA 3OYWA 1B35B 4QQLA 2FDJA 3VBOA 4LITA 3ZFGB 4FPLA 2ADDA 4JGZC 1FPN3 4CUBA 1AF9A 1D4M2 1UY3A 2OQ6A 2OT7A 3OBZA 2P3YA 4QGMA 4QDSA 4XMIA 1WCKA 4MXVA 1O8PA 3IMNA 5AVPA 2J1VA 1W8HA 3J7LA 4RS5A 3HVDA 1W0OA 2JX9A 4BH9A 3RJRA 4MGIE 3TRSB 3N3HA 4K8RB 2ZXQA 2E7QA 3KCYA 2G4IA 5KHGA 3VD7A 1R091 1GQGA 1JH5A 4HK8A 4Q4X2 2CWMA 5FZKA 1DYOA 1QY4A 4D6SA 4J1WA 5A3LA 2MEV2 1UPSA 4MHRA 1QDCA 2DTYA 4OI1A 3WDXA 1C8M1 2F17A 4QPGC 1US3A 5A32B 4LLOA 4ES8A 4AQTA 1E5IA 1YHFA 3FMGA 5F32A 1M4WA 5F6LB 2QQNA 4QKFA 3KMHA 1RUC2 4DUWA 5EYYA 4PQQA 5CZKA 2GNTA 4PBPA 3AFKA 4LULA 3POWA 2GSYA 5IFTA 2ZMKA 1W03A 1SLCA 4RFT0 2WC2A 1TG7A 2WFF3 4BQYA 2CDOA 5JIUA 4HK9A 2LROA 2ZEXA 1H30A 4YZ1A 2R49A 3B9IA 4HVOA 4ZZ8A 3HNMA 2X10A 2WBKA 4YPJA 2XL7A 2FDKA 2WZR1 2FBEA 1O91A 2W46A 2D3PA 4GJYA 3D8CA 2VZ3A 2B9UA 3VHPA 3V0AA 5FWJA 3LPGA 2HBTA 2P37A 3JBG1 4Y5TA 2WNUA 2VMIA 5JOXA 3CLPA 3WOGA 4KWJA 1DG6A 2GZWA 4RR3A 4O7XA 4OCTA 4AF9A 4MUVA 1NLRA 1UWWA 3PTYA 1IS5A 1PO11 5T5PA 3POIA 1PK6B 3NRUA 4WZFA 2WNVC 1U12A 4XOGA 1W9TA 4F3JA 3AX4A 3BU0A 5EHDA 4Y22B 4NIIA 3ZPOA 4KWLA 1HW5A 2W1WA 2R043 1VE0A 2RJKA 3I59A 5IK7A 1Q5OA 1TEIA 3DPRC 2J22A 3I54A 5FZ4A 2D44A 3NNJA 3SXWA 4OHYA 3J8F2 4HSJA 2CGOA 5A1FA 5IYYA 4J25A 5IJRA 4AFMA 2QZ3A 3PUQA 4IUGA 1JYNA 2ZGPA 1PVC3 3LZZA 4QDRA 3ZN6A 3SC7X 4NE9A 4XQ4A 2QQPA 4COUA 5J98B 4FFHA 3AKTA 3VBFB 2ERFA 3VD5A 4GH4A 1K5MC 1UKRA 1N1TA 2RJ2A 3LD8A 3BIWE 1GQPA 1CAVA 1FAYA 4AEDC 2CL2A 4MX3A 5FP3A 1HXS2 1R1A1 2A6XA 1VBD3 2AZ5A 1UXXX 1VB4A 2ZGMA 3B02A 4CDXB 4W50A 2BFUL 4H55A 5F6KA 1H1AA 3N7LA 2DVGA 5C71A 2XVKA 5CYYA 4RHV2 1L7QA 1KJLA 2R7EB 1RHI2 2WR9A 3LEMA 3VLBB 1RUI1 2XH6A 3QBQA 2Y64A 3T1MA 3GHMA 1W9FA 1GZWA 3MFAA 4XEZA 3VV1A 4QB1A 3BCWA 2PHFA 1LNSA 5LK7B 3KT4A 2AYHA 2FHRA 2YU1A 4ISRA 4K7JA 3ZSKA 4A6SA 3OG2A 1K42A 4TXWA 5HCBA 3J4UH 1RUJ1 4LOTA 2E32A 3RS6A 3AP5A 3CJIB 3DV8A 1GP5A 5C4WC 1JYTA 3RSJA 2XUEA 1JYCA 2PHUA 1W0NA 2VMFA 5B2GB 3BIEA 3TN92 2GH2A 2B5HA 4B4QA 3W5MA 3H8XA 5KC5A 2LTNA 4YW1A 3Q9OA 4LK6A 1RJ8A 1R092 2VZVA 1ZBE1 2ZEWA 3I2OA 3DPRB 4CDQC 4Q8KA 1UX7A 2PAEA 1W04A 4FTSA 3WW1A 2PLV1 4LIVA 3NAPA 4XBQA 1EAH1 3ETQA 1QJFA 5F5QA 3ZDVA 1EYBA 4B3NA 4C8DA 2D6KA 3EB7A 3ACHA 3ZYRA 3A23A 5E6HA 5CKQA 5T5JA 1QU0A 1ZA4A 4MO3M 4UFLA 1OPMA 1WMEA 3AMHA 5FWEA 1MACA 2YPJA 4S2HA 3VBRA 4TYSA 1S0EA 4CVUA 4JKKA 3NJYA 2RS13 4QQPA 4DXSA 5FAXA 3MV01 1X50A 1DGRA 3UGFA 2E53A 1V6NA 5FPLA 3AKRA 1WBFA 1RMU3 1A78A 1JYXA 3D3AA 3MF9A 5EJZB 2OZ6A 4DNYA 1UOGA 4XIKA 4L2NA 4Z92B 4XE9A 1I5PA 3IAQA 2BGPA 3PDQA 3ABZA 3CO2A 4WM8B 4YGEA 3ZYGA 4C0BA 4RGAA 4OQ9A 3HPNA 3M3IA 5DUVA 4Z2AA 1SFNA 3JBG2 1IPJA 1DQ1A 2ZX0A 2WWJA 1HJFA 1LR5A 3AMNA 3RRDA 2RDSA 5IK8A 1K45A 2FQPA 1ULOA 1UOFA 5JPMB 3MI8A 1WA6X 3BTXA 2AEZA 3HT1A 4QKBA 1WMFA 1NOVA 2JXAA 4IXLA 3LOBA 4M4PA 5IVBA 1UIJA 1BK1A 5DDJ1 2X09A 2P34A 3FWEA 4HFSA 5AC93 4BHPA 1W8OA 4PT6A 3DF0A 4DZGA 2QNKA 4Q8LA 5LA0A 4Y5SA 5C3PA 1V6LA 1ZRCA 5F9TA 1N3OA 1QGLA 2W39A 3OGVA 1BCXA 1GKBA 3SQOA 2HLEA 1DYKA 4CCEA 4FXKB 2D3RA 1DCSA 3K75B 5I0TA 1STMA 5J1XA 3ATGA 1DU3D 5IVJA 5FY0A 1ENSA 4UF0B 3TNQA 2QJVA 2XONA 2OZJA 3K3NA 1NLSA 1C28A 3POGA 3KCCA 4WVZA 3SH3A 4WVVA 3WVJA 1BBT1 1J3PA 4XFFA 1UKGA 1W9SA 3I2IA 5J09A 4FSJA 1VAKA 2P2KA 2NPIA 2D43A 4V2WA 4ASKA 5FOBB 5K8SA 3KV9A 2ET1A 4AAXA 1J3QA 2XJQA 3KGLA 5F2WA 1B09A 1RUF3 1C1LA 5I91A 1KITA 4QX2A 2XJPA 3PL0A 4BM8A 4EN6B 4WV8A 1S0GA 2WINB 4LE4A 4BK4A 5FUNA 2NM1A 1YFYA 4AZZA 3G6JB 2E63A 1SLTA 4NN0A 5DZEA 4R9DA 1UZVA 1GU3A 1AR73 3AYEA 3VD4A 3VDBA 2BPA2 4KWUA 1R1A2 3HNYM 5T5LA 4QX8A 4BISA 1I9RA 1LHVA 2JKXA 4TLFA 1RUD1 2E7TA 5IVVA 2HWF1 3H8RA 1ZNPA 1WGPA 5FFOC 2JDUA 1W8TA 2I2SA 1ZBA1 3FFZA 2XBO2 1RUI2 3AP7A 5C8CB 2XOMA 4EN8B 2RMU3 2BZDA 2DFBA 3HBZA 5C6CA 2FCTA 3UKNA 5I8TA 2E7AA 4NIDA 3AZZA 3IPVA 3VDAA 2A71A 4G9SB 4FPHA 4X6QB 1YCIA 1RUJ2 1OI6A 3S7EA 2VCMA 3OY8B 4LOSA 5C9AB 1FPN1 3ZO0B 3WDVA 2GP5A 1X8MA 2Q5TA 2XJTA 4BQ4A 2VULA 3V0BB 2NLRA 3ZXLA 4EWDA 2O8QA 4QPIA 1H2NA 1XE0A 3OPZA 4QXBA 3T4VA 2B9VA 1UD1A 1DDLA 3A22A 1X9PA 5L36A 2Z79A 4G4FA 1SEFA 5FYCA 5A7NA 5FZHA 3W58A 1X82A 4BWOA 2YGMA 2NMNA 4QU2A 4B4RA 4BE3A 2E9QA 2XMLA 1ZRDA 2XPJA 5BNNA 5C5UA 5DAWA 2PLV2 3GZEA 4M3CF 3ILRA 1NE4A 4XJZA 1EAH2 1RVF2 2VVFA 1OH3A 2VG9A 3AL6A 4WM7A 3AXEA 1EPZA 2R073 2X29A 4CU9A 4E2SA 4IL7A 3UGGA 3RZKA 2TUNA 4DY3A 1QH6A 3AZYA 1OBNA 4RQPA 3J7MA 4ZXEA 1JS9A 5IAVA 3BTAA 3B69A 4IETA 5DZFA 4XJUA 4DRRA 1OOPB 1QMJA 4PHZA 2E31A 4FPFA 1W39A 2WFF1 2ZHKA 1DGWA 4CDUB 1V6MA 2W52A 4YW2A 5JZGB 1NA1C 4ATEA 1R083 1DBNA 1QDOA 5GLUA 3MV11 1YQ5A 4MGSA 1ZVFA 4F8AA 3KCXA 1AR93 4CDWA 1GZTA 5DPNA 3TYJA 5A6YA 3WP6A 1VJ2A 2LALA 1SLAA 4NHLA 1SBFA 2OXBA 5IVEA 3RI9A 1OLQA 4S2FA 4NUBA 3SH5A 3THPA 4OZOA 4CEWA 2VUAA 3G7DA 3MFCA 2CGPA 3UGHA 2O14A 3WW4A 3BODA 2W87A 1XNBA 3H3ZA 4LBQB 1URXA 2BEOA 2VOVA 2ZX2A 2YBPA 2YC4A 5JPNB 2XUMA 4Q4W2 1OXCA 2J1EA 5A6ZA 3I3BA 1WW5A 4RL7A 3LB9A 1NXD1 1NZIA 1JODA 1DQ5A 2XWBB 3K4ZA 1PO23 1W8UA 4MGQA 5DDJ2 5LCWL 1OHFA 4KU8A 3NNMA 3QCWA 3TBDA 1XBFA 3O5SA 5BY5A 5CBLA 5FPUA 2ZMNA 4CUAA 2R041 1VBA2 1CAUA 4HONA 2R0FA 5T55A 2XWJB 4DO0A 3PIGA 1C4RA 2JE7A 4CTEA 1VBC3 4M00A 5A33A 3F2ZA 1HQNA 1YQ6A 1MVQA 4GB32 5HXMA 3WCSA 2XL9A 4XTPA 2KXLA 4KGQA 4QU1A 4M3CB 5FZ9A 3WNLA 2XVLA 3ON7A 3U78A 3WV6A 1WMDA 3KQ4B 1W9WA 4QX5A 1MR5A 2F6BA 2ADEA 3MW2A 3NMBA 3UK9A 1K12A 4LHNA 5C3QA 1CZVA 1S0BA 2JWPA 4GWNA 3ZPYA 2ZPXA 2FDFA 1JBCA 4FTBA 4I30A 1H2LA 3LEIA 5GZEA 4BQ1A 5C5TA 5FY8A 4A41A 5CFCA 4S2GA 2DV9A 4Q26A 4XAEA 2ZOEB 2CYFA 4ARXA 4NPMA 2ZKLA 1JU4A 3DYPA 4QGLA 4Y1UA 4AI8A 3U0ZA 4JDNA 4BOWA 3BPSA 1VBD1 4CDXC 3CHXA 4NMIA 3FHIB 3DN7A 2JEMA 1NT0A 3I2FA 2IWGB 4QHZA 1MZ6A 4LT5A 3ACGA 2G19A 2ZEYA 3FLRA 1RUD2 4IE4A 2C6SA 4HANA 4Q4V2 1D7PM 5FZBA 5F37A 3BTYA 4N53A 1U0AA 3SKVA 4D0QA 5L7OC 2DTWA 1X9TA 1W3VA 1TQ5A 1OKQA 1QH7A 1I1EA 4D69A 1EY2A 4XUOA 1OQ1A 5GKAC 5FMOS 4AQSA 4Q0UA 3C7OA 1IZ3A 5EYXA 4A4AA 5FY9A 4DUVA 3IWZA 1FPN2 2HEYF 2O0OA 3M3QA 1IGOA 1O3QA 2A6ZA 2UWAA 4YVSA 5B4XA 3R4UA 2Q30A 4FOVA 3SEPA 4IV1C 5J3UA 2LUWA 4W4ZA 4XBLA 1EPWA 5FPAA 4ET7A 3EMRA 2DCJA 3KF5A 1ZZ8A 2R32A 2A3WA 1PX3A 5JWPA 4JGYA 3WQ1A 4XW3A 2WZEA 5ERLA 2IXIA 2VJXA 1JTZX 2QFEA 1QOSA 5LA2A 4K9SA 4QKNA 2VW2A 2JDYA 4PDWA 4LKSA 4KI5M 4UWDA 4C0HA 2J1UA 1DGWX 1C1FA 3HNBM 4Q0QA 1Z7S3 2P3JA 4TTGA 5HV4A 3R6SA 5FPBA 3USUB 1IQDC 3B94A 1WUVA 1C5HA 1LJ7A 1TMF3 1TVGA 4MZUA 4NPRA 4AHXA 4CCJA 4P9WA 4RGGA 4E9KA 3GZTB 4L11A 1QXPA 1W8FA 4L99A 1GANA 4WZCA 2RVAA 2Q8DA 3ROUA 4AI2A 3APBA 1Q8SA 2B7YA 2RS11 4UT5A 4Y1ZA 5FY5A 4BLIA 1W6NB 1OKOA 5DAVA 1BLZA 4V2VA 2WFF2 1VR3A 2HEVF 4IV3C 5FYUA 2DU1A 1ND3C 4BA6A 4YZ4A 1RMU1 2WLPA 5C3SA 4K3UA 1UPIA 2QQLA 1PGL1 1ULGA 2C9KA 3V56A 1LB2A 3ST7A 1FMD3 2XHNA 2EXHA 2JG9C 2D40A 3T2PA 5HBAA 4LO5B 1CIWA 4OHVA 2JB8A 3IIAA 1H9PA 1XSQA 3S6PA 5K0UA 5T3NA 4YGCA 4M3CE 2H6CA 2PTMA 1FNZA 4COYA 5C7GA 4HN1A 4H7MA 5L7OB 1RUG3 3LF7A 4K40A 4FQZA 1LEDA 1ND3A 2WO1A 4R9CA 2Y6KA 3HEIA 5BXXA 3VBHC 4CCNA 4QHOA 2WYFA 4AVTA 2HWC3 4KL1A 4YYOA 2XB6C 1PIV3 5AC91 3TNPB 5A3TA 4OHWA 1O4ZA 1POQA 5FYMA 4UXAA 1J1TA 4HPKA 1CJPA 1Y4WA 3K3OA 3IDCB 4AI1A 4XTMA 3W20A 1NXMA 3ZSLA 3GZAA 3H3UA 1OMIA 3W9AA 2K2SA 1BVVA 4ORFA 3ZOIA 5FDBA 2VCCA 4HVQA 2XDVA 1UZYA 5F39A 3NNLA 2RR13 5L19A 2EAAA 1PVC2 2ZGNA 3WHTA 4N7UA 4IGPA 3NNGA 3OOXA 2W0XA 4C91A 3VDDC 3NJZA 4P9JA 3MZHA 2FZ2A 1QKQA 1SMVA 3HAGA 3M3CA 2UYBA 3QD6A 4Y3OA 4M0NA 2W47A 1XB9A 2H0BA 1APNA 3ZFEB 2YMZA 1RUF1 5FP8A 3PTRB 1VB2A 4CP0A 2BUKA 2PN5A 3AYCA 2ZGTA 1YLLA 1HRV3 1W6OA 5LBEA 4GA9A 5FXZA 4IE5A 4XXAA 5BNPC 1QNYA 4Q4Y2 4D7TA 3H9AA 3NV4A 5FMBA 1AR71 1JZ6A 5FP9A 4XDOA 1D4VB 1PHMA 4WVMA 1VBD2 2Y6LA 3PURA 4EWAA 2ARBA 3ZFGC 4LMFA 4YWAA 3ZSMA 2AGSA 1KJRA 4GIQA 5CVRA 3IN9A 1AL0G 2WN3A 3JU9A 4R52A 2WQ4A 2D5HA 5J48A 4GWIA 5ABJA 2PA7A 4GXLA 1S0DA 1R64A 2CHHA 2PELA 2WQZC 1RTVA 3O1TA 1UCXA 4YZ2A 1MZFA 1ND2A 4UAPA 1CVNA 2Q4SA 3U4SA 1B35A 1Y7BA 1BQPA 2ZZJA 5FYTA 3VHRA 3IM0A 1RUNA 2C26A 3MPBA 2LM3A 1GBGA 1H8TC 4K1YA 2E33A 3KGZA 5KXDA 2R6QA 1BEV3 4XCBA 5F5AA 1WKYA 3LIGA 4H14A 4YGDA 1W3XA 3DECA 4UFKA 5EQUA 2YY1A 3O1UA 3S57A 2QTWB 2PYTA 1BBT3 5FR3A 1SFYA 1MPXA 4Y33A 3WG2A 4QB6A 2L9LA 4Y20A 3X29B 1CQ9A 1YI7A 4XF3A 2R063 4XJAA 2JG8A 3BGAA 2W1QA 4YVWB 5IWFA 2A6VA 3ASIA 3FFQA 3U14A 2XKPA 3PUSA 2Y38A 4GJZA 1S2EA 3L9JT 3N9LA 1MZ5A 2R071 1PM4A 2ZGSA 3ILNA 3PJQA 3TOJA 5BNOB 2BV4A 4Z07A 1WLTA 2V5YA 5GLVA 1PGW1 3T0AA 1NUKA 3MW4A 5H9PA 4AYUA 4AL9A 1ZBA3 2RS12 4GWJA 2YBKA 5FOJB 1R081 4P00B 4P9GA 1WD3A 4XYXA 1AR91 5FO8B 2BJSA 1RMU2 2XJSA 3H7YA 4AGRA 1YFWA 2AUYA 3KD4A 1LGCA 1PK6C 4GQ7A 3VBUC 2GNDA 1X36A 1GLHA 3QOPA 4AI0A 4C1WA 4EN0A 1G9BA 3VZMA 4LXLA 1AYM3 4YRDA 4EN7B 4FP2A 4Y24A 3A7QA 5FKCA 3KVAA 2QUOA 2Y8KA 2YXSA 3HQXA 4W6XA 4CEYB 3VKLA 5HCHA 3IT8A 2JDZA 3N36A 2VCAA 4JQRA 4PQ9A 1OQEA 3BOPA 4MYEA 2VNOA 1QJX3 2WWUA 3R4SA 1DQ6A 1HRI2 2RS53 5DQ0A 4O9GA 5EFUA 4MSVA 4DRVA 3O1SA 4DINB 3E5QA 1PO21 4B1MA 3O1PA 1UQXA 5T5OA 1VBB3 4JGZA 5L9BA 5CB7A 3T2OA 3MIBA 1H8TB 1OD3A 3CNAA 1H6YA 3VBFC 5F2SA 3VDCA 1FI2A 5FZGA 1W6QB 5D1IA 2W91A 1IS4A 4MH0E 1KD7A 5FV3A 2I07B 1QXRA 1VBC1 3ZX7A 1Q8QA 5FP4A 4P9LA 3H8UA 1UY0A 3NJVA 2P1BA 3ACLA 3WINE 4KMQA 3K46A 4XAAA 1Y9MA 3V65A 1RGSA 5I8YA 4KU7A 5T52A 1CX4A 2OYZA 1PM7A 4CCKA 4F7ZA 2QQOA 2P4EA 1PZ8A 5JR7B 3HOBA 5FZEA 5I93A 2BGOA 2VTXJ 4QPGA 2WIIB 2B42B 2RG4A 2V73A 2ZABA 2NQYA 2BBVA 1RUF2 3VKOA 2EXKA 1AXKA 2Y6GA 3IDAA 5LBCA 4XACA 2B8MA 3BI3A 5DABA 1W05A 1CD3G 3INAA 1NE6A 3AC0A 5DAXA 2W92A 2X5IB 4XFHA 5SV8A 1QJEA 5GALA 4CE8A 3O14A 2ZMLA 1W28A 1RXFA 1AR72 4HL0A 5FZCA 1ASJ2 3S30A 4MGKE 5C70A 4LIUA 3ACIA 3CJIC 4XF0A 1NY71 3HQRA 3SH4A 5D8AB 4CP9A 5CIRA 4I3PA 1T6BX 3TB0A 1G9AA 1CGPA 2WA4A 3E5XA 3EBRA 3MDPA 3EQEA 2OPKA 2RMU2 3VBOB 2ID4A 3VBUB 3M3OA 4IQPA 5GZCA 1AR83 4NAMA 3PUHA 2VZ1A 4G3YC 1XE8A 2IFWA 2WS93 5FY7A 2ZX4A 1GFF2 2VY0A 3AMMA 4RS5B 4ATFA 1CAXA 5HCFA 1JMUB 3ZN4A 4HBNA 4BYYA 3PVEA 4B8EA 3RVHA 5JAXA 4CCCA 2EIDA 4N43C 2VE1A 4AXOA 4WBBA 3PMEA 3MW3A 4L92A 2DYCA 3IDBB 2WNVA 2BU9A 3MIGA 1H8VA 4IE7A 4XCAA 2BNMA 1KDKA 5JOYA 4JHTA 3AKPA 3PIJA 4IEZA 5ANNA 2Q8CA 3I49A 2ARXA 4Q1PA 3HMYA 5GLWA 3WUCA 1IKPA 3ZVXA 1SQ4A 1W99A 3DPRA 4HKLA 4FAHA 4QB2A 1GOFA 4FPEA 2BNOA 3WQBA 2R30A 2ZJCA 3WP4A 1VBE3 5BPXA 2VVDA 4K6BA 1HN1A 3PJYA 4XDPA 1RB8G 1Z7S1 3WUDA 4D7YA 4ZU4A 4QQ2A 2PHLA 3KVBA 2BP6A 3MEPA 1CPNA 2JE8A 3W5NA 1JW6A 1TMF1 4HLTA 1UO9A 3SHRA 1PGW2 1ZZ6A 4BQ3A 5A3UA 4WM8C 1V00A 3SLIA 1OLRA 4LJHA 1K5MA 5LRRA 5A3WA 2I74A 5FZOB 4DUXA 1A6CA 2OPWA 4HMZA 4XF1A 4NIGA 1L7RA 2PAMA 4TN7A 4MXWB 3OTFA 5C3OA 4AEDA 5I0DA 1ZRRA 1AR92 5CFDC 1QJY3 2OW4A 3V0AB 5JR2A 3GYDA 1SDWA 1TME3 4LQRA 3ZKYA 3N4MA 3NW4A 1FMD1 2WNUB 2XJRA 3D5OA 4LKFA 3T0BA 1G9CA 3LCPA 1UU4A 4BU2A 3P5BA 1D2QA 1JZ2A 3M3EA 2XGXA 4RR3B 3RPQA 4FFIA 2DCZA 4UW4A 3NVCA 4XZPA 1RUG1 4O65A 3OUHA 2X05A 4XJWA 4EE2A 3AL5A 4CXWA 4H2AA 2JIJA 4KWKA 1BKZA 1J58A 3OJBA 4BQXA 2HWC1 4PLNA 1DHKB 1PIV1 3I59B 3GNEA 1PO22 2CTVA 1JOJA 3JB4C 3Q8EA 4YM1A 3I3MA 2WO7A 4BQWA 1WLWA 5C4WA 3FLPA 2Q8OA 1WLCA 4E4SA 1C8M2 2YU2A 4N43B 3OEAA 4AVAA 5FY4A 2VZUA 4CA9A 1IOAA 1GWMA 3P1IA 3ZN6B 5C8WA 2OUHA 1J3RA 4JHZA 4NROA 2RR11 2VNVA 4UFJA 3ELNA 3V64A 3MICA 1JUHA 2GMPA 4X8PA 1JYIA 1GP4A 3ALQA 4GH4B 4CDQA 1PGSA 3QH7A 2RDQA 4CYDA 3GM8A 5HPOA 1W9YA 2WKKA 4NHMA 2HH9A 1UYYA 2FMDA 4ITCA 2NZ9A 4ZU7A 2KR2A 3C7GA 3PU8A 5F3IA 1GWLA 1HB3A 3HR9A 3FE5A 3BOWA 2VUJA 1HRV1 4R9BA 2WZR2 2IVIB 5FPVA 5FKBA 3IAPA 2XKOA 5C8CC 1JYVA 3E6DA 4J6GA 4LUMA 3RWKX 3WF3A 4KNCA 1AYN3 3ZYBA 2ZS6B 1VIWB 3N7KA 5IATA 5EWSA 5C9AC 4LBQD 4NJ4A 5A80A 1GZWB 1U5XA 2E51A 3ZXFA 1NY72 4XF4A 1E5RA 2WT1A 3ZXAC 1KRIA 1L7LA 5CFDB 3WG3A 1YFXA 4OYUA 2JDAA 2QQIA 1PO12 2MNGA 1XU2A 1JHJA 1N3QA 4LBOA 3FHQA 3LKJA 4R8HA 3WZ1A 4Y26A 5DUXA 1R1ZA 4FPOB 5LASA 2D6MA 3BALA 4OUEA 4HG6B 3WP3A 4OQ8A 1DZTA 2VZSA 5CG9A 2VOXA 1D4M3 3BPZA 1DZRA 4QM8A 4QD2A 4XXPA 4BMEA 2Q1FA 1S0IA 2WT2A 3EO6A 1PNGA 3PVNA 5JXIA 3AVRA 3DKWA 3OD4A 4QAWA 3GHNA 4JKLA 4XIOA 2A3XA 4COVA 5GLTA 1A3KA 4AOCA 5G05L 5KXCA 3IDEA 1BEV1 3V0BA 4XURA 1O3SA 2ZAAA 4A3ZA 1O4TA 3ZN5A 3DUIA 4Q4X3 4IW3A 3UETA 1FXZA 4CCLA 1LHNA 3AVSA 2VZQA 4UW6A 3THTA 4L8QA 2MEV3 1ALYA 1ZZCA 1JZ5A 3NAPB 3ZIWA 3ZM8A 5FQ0A 3OD0A 2R061 1OOPC 3AP4A 3VKMA 5LEJA 3D0JA 3N7MA 4NHXA 1XNKA 3POYA 4CDUC 5JZGC 3CL1A 4P08A 4AR2A 4LO4B 1PX4A 3WEZA 1Z7S2 3VKFC 1DIWA 4FPYA 1VRBA 4QWNA 4ZKTB 3VBRB 4QX7A 1ULDA 2ARAA 3WXPA 1REDA 2UY8A 5F3CA 1UU6A 1QJU3 2FMYA 2WFPA 4CSWA 3PUIA 3AMPA 4FVVA 5APAA 1S55A 3I2DA 5FXXA 3UKTA 1KS5A 4FQ4A 2VMHA 3NKTA 5LRSA 2PHWA 3J7NA 5K9YA 1COV3 4CUCA 3URFA 4TLGA 4L0PA 2ZGKA 2E26A 1Z78A 2YBSA 2VXJA 3KZ4C 5A7SA 3LIHA 4LR4A 3FBYA 2VTFA 3IIIA 4FFFA 4H3WA 4GALA 1AYM1 4XILA 4K20A 2FCVA 1H6XA 4GAZA 5F5CA 2JENA 5CKMA 3MF6A 4PI2A 4CCOA 1OH4A 4NRPA 4YG0A 1REFA 3T3YA 4EV0A 1QOTA 1QJX1 1UZ0A 2LS6A 3BN6A 4Y5Z0 3ZFFC 2RS51 3WSOA 1ZBE2 5JCTA 2IXCA 4AFAA 5A3MA 1KS4A 1D2SA 1PIV2 1VBB1 3AKQA 4K21A 3VBSB 2VW0A 2RM23 3SCFA 4AI9A 3DYMA 1SHWB 3RYRA 3DGTA 5ISLA 1IPKA 2XLFA 2VZOA 3O0VA 4QGNA 3C8XA 3BUCA 5DG1A 4AAPA 4QKDA 4ZXKA 5GZGA 4OMDA 5A7WB 1VPHA 1OA3A 3VZNA 1CPMA 4TWTA 4K8FA 4QX0A 3O1OA 3MIDA 4EWEA 1ULFA 1VMFA 1KXGA 4M3CA 5FK8A 5L9RA 4HKOA 4ZY9A 4BQ2A 5DZGA 1JOBA 4FCAA 2ATFA 2Y0IA 3GALA 3JD73 1YI9A 1WW6A 2GNMA 2VZPA 5FZ1A 4Q29A 1XE7A 4PLOA 5FZ7A 3NWKA 4NOTA 4XBNA 3A0KA 1GV9A 2V09A 3ES1A 5FJHA 5FZ3A 3RMXA 5A1AA 1OC1A 3K48A 5LBBA 1OPOA 5IFPA 5BV6A 1G86A 4Q5OA 3SCHA 1HRV2 1F31A 3LQCA 4OI4A 4AEMA 4OUSA 1AZDA 5A6QA 5JIAA 1OURA 3R4DB 5A7QA 3DCQA 3LDRA 3DKQA 1RIRA 1O4YA 2YYOA 3MUZ1 5GZDA 3HD8B 1KQRA 1YC61 4H7LA 4RHV3 1RHI3 2OQ7A 2ZGOA 3ME2A 1NA1A 2VU9A 4JDMA 3T1LA 3RJ2X 3FN9A 1EV13 1QF3A 4AQ2A 3GJAA 1C5IA 3P3NA 1OD5A 1TZOA 3IPVB 1V6IA 3POEA 1YNAA 1GQHA 2V4VA 1E57A 2ZGRA 1UIKA 4Z8BA 4IE6A 3AYDA 1XSRA 3N7JA 3H3LA 2EIEA 5J96B 1AR81 1GZCA 4NHYA 3JQXA 4YM2A 2WQ8A 2WS91 2VBDA 3MO4A 5DXDA 2W5FA 5E88A 1CAWA 3VGIA 3TN93 4XFGA 2GN3A 3WF1A 4E4HA 1POV1 2D6OX 1FX5A 2GC2A 2JD9A 2YUEA 4XJ9A 3RGBA 3T2TA 2DCTA 3ZFFB 3H0OA 3N9QA 4W65A 5SV5A 1BEV2 2E6VA 1NCQC 1XU1A 1UF2C 2PXJA 3WG4A 2Z42A 4YW6A 3RZZA 1UMIA 4LBLA 5ACA3 1BBT2 1LOAA 5TSWA 1UOBA 4GMP3 4LHKA 5BNNB 4BXFA 3MIFA 3I2KA 2A6YA 2VW1A 4PI0A 3VUOA 1LOBA 2AEYA 2V5DA 4WM7B 4W6WA 1JZ3A 5IW0A 1VBE1 5L73A 4LKEA 3U1XA 3HWJA 2JB4A 4BPZA 4RQPB 2ZX3A 3ZYHA 4ZZ5A 1W6PA 4B29A 4ZS3A 4D3WA 1CX1A 2GAUA 3NV3A 5FZMA 3O1MA 4Y1VA 3WQ7A 4FXGB 5FPZA 2HWF2 3RNSA 5KC6A 1RL3A 2HWE3 4J1XA 1ZBA2 2WLQA 2BTVC 3C7FA 1ULCA 1W6NA 3WF4A 4BZ4A 4DY5A 4DXTA 4A3XA 2AR6A 1O5LA 1RUH1 1MS0A 4NWVA 3WLUA 2AENA 3O0WA 4FP3A 4CEWB 2LW8A 1QJY1 3PLQA 1MS9A 1TME1 1NYWA 4CDXA 3SKJE 3B00A 1FOD3 2C4XA 4I02A 5D21A 2N7GA 3BYWA 3ZMNA 3NV1A 1UZWA 2Z69A 3BVCA 1ZRIA 3CKHA 1JZ7A 2ZAHA 4AWDA 1HDKA 1NKGA 5HI0A 5E89A 1HKDA 1YXWA 2RE9A 1WLDA 5FLHA 1XC6A 2ENRA 2HWB3 5L7OA 2BWCA 5FP7A 4LBJA 5LZ6A 2A70A 1U5IA 5F1RA 4LK7A 4LORA 4N9IA 2XR4A 1QXJA 1XQNA 3CZJA 3M2MA 4JC1A 4JX0A 4Q0PA 5FUIA 1CAUB 5KR7A 1OVSA 1VBB2 3O1VA 5IVYA 2Z5WA 1VRH1 1AXZA 1KEXA 2VNGA 2EA7A 5A33B 5BUVA 3TEYA 2BOJA 1EP0A 4OMCA 2KD7A 4D8MA 5LATA 1XNCA 3ZFEC 3FC0A 1NCQB 4IV1A 1BVP1 4TZDA 3HQUA 4LUKA 4YNIA 5JLVA 1AX2A 2QDRA 2PHTA 5GJ6A 5JI7A 1UY1A 4N8MA 4XZUG 2AREA 5C33A 4XHBA 1PMHX 1RYYA 2O1QA 2ZGUA 5IVFA 1ONAA 3B3QE 3RMYA 4A7ZA 4E8DA 5CFCB 3FUQA 3U11A 3PU3A 5I0UA 4XUPA 3RZLA 5FYVA 1ACCA 1AL23 1XYNA 3FL7A 4AE2A 2C5DA 4DS0A 5JI9A 3ECQA 4SBVA 1LOEA 5FBJA 1OLME 2IC1A 1Q43A 1S2KA 2WO3A 5CAZA 3KLSA 2DUOA 2K9ZA 1AYN1 1W6MA 3H1WA 1F2NA 4NPLA 1W2NA 1UW8A 1WCDJ 4FBFA 3M1HA 5CISA 2YGLA 5JDBA 4DPNA 3GBGA 2XBO3 2A1XA 3M4FA 3B9CA 3CU7A 4IV3A 4W6YA 1YWKA 4DOUA 2QKDA 1LGBA 3ACFA 2DF7A 1AR63 2VC9A 1OSGA 2A3YA 4IGQA 1TNRA 1NCRC 3N35A 1SPPB 4YZ3A 2BVVA 2JG9A 3C2UA 1DYPA 1US2A 1AR82 2WNEA 1QNWA 2HWD3 1F5JA 4B7KA 4FTEA 1UMZA 1D4M1 1OF4A 1W8NA 2EAKA 3LDBA 3ZXJA 1LOFC 2R042 4YVSB 1QWRA 2F4PA 4LO8A 3T08A 4YVWC 1ODMA 1P8JA 3RI8A 3OEBA
chains in the Genus database with same CATH topology
1LU1A 4OHXA 3VBHA 1GZ9A 5BNOC 2W08A 2D5FA 4Q4X1 4A2UA 3UJQA 4JGYB 4BIFA 3KT7A 1IQAA 2QZ2A 3OBRA 2MEV1 4PDWB 5J37A 2D7FA 1HX6A 1T6GC 2OA2A 5J36A 3DL3A 1RVF3 2IXKA 1I5ZA 1VBE2 3I7DA 4OI0A 4XFCA 3HN1A 4JTOA 4JRLA 5BNOA 4YM3A 1SLIA 1YFUA 1IS3A 2D98A 3MLJA 3ILFA 4KBBA 3VDDA 3GZUC 4Y1YA 4YZ5A 1QJU1 4XDQA 1IS6A 2CWSA 1QQP3 1XRUA 4HSLA 2YHJA 4Y4YA 1COV1 4XFIA 5FCCA 4CEYC 4PIXA 4COZA 3L2HA 5J7MA 5KHJA 4SLIA 5BNPA 2BFUS 4P14A 4GWMA 5I0RA 1QOOA 1V9U3 3S7IA 3KT1A 4Q0SA 2UYAA 3O12A 3ZFGA 5CA6A 3VZJA 4Q4W3 4YW3A 3PMSA 3M7AA 4LTAA 1D0GA 3NV2A 2WWSA 1Y9QA 2IXLA 3WD5A 4CZSA 1GICA 1NCRB 4AW7A 3SISA 1LU2A 1MS3A 2ZTNA 4KGGA 4HPKB 1C3HA 5EV7A 1VBA3 2MPFA 2RM21 5GM0A 3AM2A 4FPCA 3S0MA 3GBWA 3UL2A 1H8TA 2ZHMA 1VALA 3VZKA 4GB33 5A32A 1GNZA 1MZEA 2TEPA 3QLQA 1ZREA 1HV1A 1IKQA 4AEKA 3ZSJA 3EJKA 2EF6A 4P5HA 1ZM1A 3K51A 4RD7A 1YUDA 1UU5A 3H1MA 1RUE3 2X5IC 3ES4A 4FT8A 3JD71 3JZVA 3H50A 1LHUA 3RYPA 4NO4A 4XFBA 1W6OB 3GF6A 3KB5A 3NSTA 5FO9B 1KDMA 1LHWA 1W0PA 5D8AC 1VP6A 1O3RA 3VN4A 4WVMB 1PGL2 3VBOC 5T54A 1LOGA 3B7MA 2GC0A 5FMOL 2GU9A 1AYN2 1GSLA 4RHV1 1RHI1 4Q4V3 2JD4A 2D3SA 4U2AA 4RS5C 1HQLA 1MQTB 4FPGA 2SBAA 5ABJB 4B4PA 3UJOA 1EV11 2EVXA 1RC6A 1H2KA 1ND2B 3QH6A 1PK6A 1V6KA 2AH2A 2ZCWA 3VBUA 5AC92 1SCRA 1F8VA 3KM5A 3H1YA 4Y22A 2XLAA 3WDTA 2VOKA 5AFBA 1DGLA 1H0BA 3TN91 2GMEA 2D93A 3WT3A 4I3GA 4BMBA 1HLCA 4OHZA 5GLZA 4LEJA 2CNAA 5JOWA 4HKWA 3LOIA 3NO8A 4Y20B 1J1LA 2D6NA 3O0XA 3WDUA 5ACA1 2JG8B 1CJDA 4GMP1 2RS33 1CR7A 2ZKNA 3VBFA 1TNFA 4N9HA 5JVVA 1Q56A 5FLJA 4JAAA 1HQWA 2VPVA 4DXZA 3WG1A 2IXJA 4OLLA 3WR0A 3R05A 1UZZA 4YFZA 5H9QA 1J59A 1U5ZA 5KBFA 1C57A 1LRHA 2R0HA 5K7PA 1Y3TA 3TAYA 2IXHA 4DFSA 3AFGA 1G9FA 3EXUA 2PHDA 1ZZ7A 2WNUC 2UURA 2WA3A 3HIFA 3MIHA 4MV2A 5E8AA 4BIOA 1FYUA 1QJU2 4RR3C 4XHXA 2HWE1 1KFUL 1LESA 3FBMA 3SCGA 3OYWB 1REEA 3ENRA 3LA3A 1COV2 4X6RB 1AUYA 4MXWA 1L3JA 5JSOA 3J9SA 2MHFA 3U4XA 1X33A 3RDIA 1FATA 1FOD1 3B01A 4XFAA 4LBNA 1ZZBA 4E4DX 2KA3A 1VAVA 3CJIA 1POV3 2CAVA 3ZYJB 2XJUA 1LULA 1F9KA 1G9DA 4R4ZA 2JKBA 1UL9A 1D0HA 2HWB1 4MGZE 4R9AA 4PCRA 4JGZB 2B46X 3FLTA 2VH9A 3WW3A 1PVXA 4LBMA 4GH4C 3AK0A 3MGUA 1XNDA 2ZACA 2X8KA 1NQDA 2RM22 3ZMOA 2VVEA 2QCSB 3NKGA 5EJ3A 5FBZA 4N43A 4QQHA 2R072 1S0JA 1TE1B 4D94A 1MEC3 1XYOA 2O8OA 1LOCA 2R1DA 1UAIA 2GC3A 1G6NA 4QPGB 1YO8A 3JD72 4CP2A 4FOWA 1R082 2C1FA 2BYVE 4Z1VA 1RUH3 3VZLA 1N1VA 1UX6A 1C8NA 4Q4Y3 3D4KA 2ZGQA 2GALA 3R0RA 4HT1T 3ZIXA 1AL21 3WQ0A 4KQ7A 2EALA 4OUMA 4FPJA 4DMIA 1MVEA 1H4GA 4WM8A 4WVWA 1N1SA 2P3IA 4IEUA 3AZWA 2XBO1 1LECA 1N3PA 4ES9A 3ZXEA 1EV12 4FOQA 2DVAA 4AHZA 1AR61 1WCSA 2WSUA 5CFDA 3L2YA 4IEWA 5EZWA 1Q8OA 4MVTA 1IHMA 2HWD1 1GYKA 1CAXB 1VRH3 4FO9A 4GULA 5CU1A 5GZFA 3USSA 1V6OA 3NAPC 2JICA 1S2BA 5IK5A 3AJYA 3E6BA 3POSA 4META 2JECA 4YG6A 2OIIA 1VBC2 4P9XA 4IEVA 2GMMA 2WNVB 2TBVA 1YYNA 2NP0A 5I0SA 2ZBJA 1LEMA 2PHRA 4YG3A 1XYPA 5JSPA 3VBRC 4Y1XA 5KHHA 5KHIA 5ACA2 1CAVB 4YW5A 4LHLA 4V1PA 3ZXDA 1O7FA 4AVVA 1RVF1 4BCUA 1UN1A 3I4IA 1X7NA 2H6BA 4P9IA 2KM2A 5T50A 1CN1A 2XJVA 4I0AA 3AB0A 4S2DA 2WZPP 1BJQA 4L9BA 2VXRA 1K5MB 4B7EA 2JJ6A 4C90A 2RHPA 4JVAA 1WW4A 1W2UA 1QQP1 3MIEA 3P3PA 3CEWA 4AEDB 1PZ9A 2HWE2 1PNFA 4IEYA 2ZHNA 3W59A 2DVDA 5C8CA 2Z2SB 1CONA 2DCYA 1DQ4A 1V9U1 2BNNA 3H7JA 4F83A 5KWRA 2G9FA 1FOD2 3VBSC 3M8LA 3OY8A 5C9AA 4Q4W1 2Q1MA 5H9RA 4PF5A 1RINA 5CADA 3FUOA 4INDA 1HRI3 3VHNA 4AQ6A 2HWB2 4I2OA 2HEWF 2DFCA 4M01A 3VHOA 3WP5A 4AK3A 5C4WB 4CRQA 4LLFA 2BGCA 4CP1A 1V70A 4I0BA 1VBA1 3AMQA 2HKXA 3VBSA 5HCAA 3RQ0A 1RUC3 3AP9A 1X8EA 4GB31 3AYAA 1A8DA 3E97A 1MS5A 1QJZA 4URTA 1KFXL 3LGRA 4CDQB 1RJ7A 1TMF2 2C0ZA 2P3KA 1BXHA 3LWCA 4AVBA 3MPPG 4ISQA 1RUE1 5DUWA 2QE3A 5E1RA 5IT6A 4RA0A 5JOZA 5E16A 2DURA 1NZCA 1OOPA 3IBMA 2OVUA 3U10A 5BNQA 1DQ2A 4CDUA 5JZGA 2GNBA 2CGNA 3QACA 4PLMA 1JHNA 4OVEA 4EN9B 2VQ0A 1AL22 4E27A 1FMD2 4NHKA 2CY6A 2EXJA 1ASJ3 4OZXA 2ZZQA 1NQJA 3A0NA 1OFNA 4LBQA 4Q4V1 4OULA 5LK5A 2ZHLA 1DF0A 1H1MA 3MYXA 4NR1A 1RUG2 4QPIC 4ONUA 2EXIA 3JQWA 2Q1ZB 2B45X 3AP6A 3OF1A 2XLGA 2A5ZA 2WJSA 2C9AA 1FV3A 1AR62 1N1YA 2HWC2 4UW3A 3WHUA 3JCIA 1GNHA 1LGNA 2G9GA 3PHMA 1RITA 4N90A 4LE3A 4XQWA 4AFDA 4UBHA 3ZSEA 2HWD2 1OFSA 3J8F3 4GKYA 4QXKA 4XQDA 5BNNC 3FZ3A 1POV0 2HYKA 1YRZA 4WM7C 3MLLA 4IERA 3FJSA 1ZZ9A 1DZQA 3ZFFA 2VNRA 2RR12 4RQPC 1FNYA 3BU7A 4LO6B 5FQ0B 2PFWA 4FOYA 2DUQA 2RS31 3JUUA 1OA2A 5CNAA 3WY6A 4Z2WA 4AVSA 4HN0A 3LSEA 4QM9A 4CDWC 1AX0A 1LKNA 4EROA 1HXS3 1PZ7A 4CEWC 1S1AA 3WNXA 5H9SA 1FV2A 3E5UA 1ENQA 4XETA 4I0WB 4LA3A 1I3HA 4Z82A 2R16A 1QQP2 5KXEA 4E2QA 4HETA 2ZA9A 3FX3A 3ZYIB 1VAMA 1F5FA 3AZVA 4RSUA 4YM0A 3AJZA 5KHKA 1V9U2 1JN2P 4QPIB 5DUUA 1YJKA 1ZX5A 2HJIA 2ES3A 3VL8A 2QVSB 3IKWA 4PBOA 1G7YA 3U07A 1R093 3A4UA 4FPKA 2UWCA 4XJ8A 5I8SA 2BVBA 1N47A 4LA2A 3ZXGA 4IEXA 4XPVA 3B93A 5AFEA 1DQ0A 2EIGA 2I45A 2JE9A 2R062 1C8M3 2NN8A 4AHYA 1FT9A 1RUOA 3OGGA 4E4ZA 1GR3A 5LEKA 2A6WA 4JV4A 5CFCC 1DGRN 2GDFA 2DUPA 1PVC1 2B39A 1NCQA 2ZX1A 2DVFA 2NMOA 3ZYPA 3USUA 3B5LB 1AXYA 1MEC1 2QDNA 3GBFA 4GKXA 1YJLA 1RUE2 4YGBA 2VMGA 3SMHA 3BB6A 1MS1A 4QMAA 4A7YA 2BQPA 4JDOA 4CDWB 1S0FA 4N53C 1O3TA 3CF6E 2WZR3 2CAUA 3O7OA 4Q4Y1 1Q3EA 2TNFA 4OI2A 1XXNA 4YW4A 2YDEA 2A7AA 1HV0A 4MGYE 1MS8A 4AVCA 3JBG3 1YIPA 3RWNA 1NA1B 1AYM2 3PNAA 1Z0HA 4YVSC 2ETEA 4AGGA 2DCKA 3LAGA 4Q27A 2NYYA 2P17A 1PO13 1YIFA 1QJX2 3I8TA 1A8MA 2RJLA 2RS52 2XG3A 2FZ1A 1BMV1 4JGYC 1CAWB 4LO7A 2ET7A 3RG0A 1ENRA 4K1ZA 4PDWC 1MS4A 4ASMB 3SITA 2Y0OA 4PJYA 2DWRA 4QQOA 2PQQA 5HXVA 5CG8A 4Q1RA 1SBDA 4DB5A 1U5YA 3NL1A 2PAKA 4HZFA 1H4HA 1WA4A 5FO7B 3ZXKA 2RS32 2GC1A 4ASLA 1Q8PA 2D97A 3EHKA 2VOWA 3ZFEA 2A75A 1ZYBA 1W6PB 5IK4A 1R1A3 2YV8A 1SLLA 1OQDA 1SCSA 1WBLA 4MLOA 2ZGLA 2UU8A 4AFCA 5K0UC 4UW5A 4N53B 4YARA 1O5UA 3UV9A 1RUI3 4I09A 2D6PA 2IFRA 4Q2FA 4EJRA 2DU0A 2WSVA 1LCLA 1M06G 1G8WA 1LTEA 4JRAA 4CDXB 1SBEA 2K0GA 1RUJ3 4IEPA 2BW8A 2UY9A 4KH9A 2PHXA 4UBGA 4W6WA 2GN7A 2WS92 3J26N 2YC0A 3JB8A 3OCPA 4DQAA 5FPXA 5FLIA 2SLIA 3AXDA 3VL9A 4A7KA 3WDYA 1HRI1 2ILMA 1ZBE3 2IZWA 2WL1A 4NWWA 4AGVA 1NCRA 3AKSA 2GH8A 3WCRA 3D0SA 4U36A 2VECA 3WDWA 4L97A 2DVBA 1LOFA 2PLV3 2Y26A 2D6LX 4X8NA 1EAH3 4YVWA 4IV1B 1LENA 3RYKA 4AHWA 1JUIA 1RUC1 1Q8VA 3CJXA 1SLBA 1ENXA 1ULEA 3E6CC 1AHSA 4QPYA 2Q0AA 3C3VA 1CESA 2UWBA 1WW7A 4JTNA 4QHBA 4IEQA 1JXNA 4N7IA 2YROA 1S0CA 3OGJA 4QT6A 4YSFA 1MEC2 4ZU5A 1H2MA 1DFQA 3HT2A 4HVRA 3ZDSA 4KG0A 3LA7A 3UKVA 5FTTC 1MQTC 2X53S 5ABJC 4R4XA 1RUH2 2XVGA 2R1BA 1AVBA 1QJY2 3KQRA 4COWA 1ND2C 1TME2 5K0UB 1W6MB 4YFWA 4AFBA 1B35C 1ASJ1 4BLJA 1DLLA 5JSRA 4IV3B 4C1XA 1BYHA 1ND3B 4JCKA 1AX1A 3PVBB 1I6XA 4NVPA 1LODA 3AZXA 4CEYA 2BWAA 1MQTA 3D6EA 2RMU1 5DDJ3 2JG9B 2WT0A 5EXOA 1LHOA 1BMV2 4IEOA 1NG0A 2JG8C 1VRH2 2XHKA 2YZ4A 3J8F1 4PIZA 1PMIA 2OUJA 1H1IA 3WX5A 4LBKA 1ZRFA 1W6QA 3KSCA 3VBHB 4M0HA 4KG8A 4TSVA 3D82A 3PVOA 4I01A 1HIXA 3LSDA 1AJKA 1BZWA 4GMP0 5BYNA 5FREA 3SNMA 3TWIA 1VLNA 1WD4A 3OBTA 4XF9A 3M70A 5DG2A 2A73B 3KS7A 4Q0VA 2CV6A 2VGDA 2H0VA 1H9WA 4AEJA 5FRAA 4LNVA 5IUQA 1HXS1 3LA2A 4P9YA 3VDDB 3WW2A 3VKNA 1Y43B 1OA4A 1QHDA 5KXBA 4AI3A 2X5IA 4XMAA 1RUD3 2W68A 3MLKA 2HWF3 5AVAA 2VQAA 1AJOA 1SACA 4O9EA 4FAGA 4IESA 4D7SA 5JMCA 1V6JA 3VZOA 4AG4A 4YLZA 5BNPB 5D8AA 4E2GA 4PIYA 3OYWA 1B35B 4QQLA 3VBOA 3ZFGB 4FPLA 4JGZC 1FPN3 1AF9A 1D4M2 4XMIA 4AI1A 5AVPA 4QGMA 1WCKA 4MXVA 3IMNA 4RS5A 1W0OA 2JX9A 4BH9A 3RJRA 4MGIE 3TRSB 3N3HA 3KCYA 2E7QA 5KHGA 2G4IA 1R091 1GQGA 1JH5A 4HK8A 4Q4X2 2CWMA 1QY4A 4J1WA 5A3LA 2MEV2 1UPSA 1QDCA 2DTYA 4OI1A 3WDXA 1C8M1 4QPGC 4ES8A 5A32B 4LLOA 4AQTA 1YHFA 3FMGA 1M4WA 5F6LB 3KMHA 1RUC2 5EYYA 2GNTA 3AFKA 4LULA 3POWA 2GSYA 2ZMKA 1SLCA 4RFT0 2WC2A 2WFF3 5JIUA 4HK9A 1H30A 4YZ1A 2R49A 3B9IA 4HVOA 2XL7A 2WZR1 2FBEA 1O91A 2D3PA 3D8CA 2B9UA 3VHPA 3V0AA 2P37A 3JBG1 2WNUA 2VMIA 5JOXA 3CLPA 3WOGA 4KWJA 1DG6A 2GZWA 4RR3A 4AF9A 4MUVA