1QKQA

Charcot-leyden crystal protein - mannose complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
SLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective Recognition of Mannose by the Human Eosinophil Charcot-Leyden Crystal Protein (Galectin-10): A Crystallographic Study at 1.8 A Resolution
pubmed rcsb
molecule tags Hydrolase
molecule keywords EOSINOPHIL LYSOPHOSPHOLIPASE
total genus 34
structure length 141
sequence length 141
ec nomenclature ec 3.1.1.5: Lysophospholipase.
pdb deposition date 1999-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qkqA00
3ILNA 1VAVA 4GWNA 4IQPA 1JW6A 1Q56A 4Q26A 2A6YA 2PHTA 1IKQA 2ZGMA 2ZKNA 2DTYA 5JOYA 1FNZA 1JBCA 4JCKA 4YFZA 1NXD1 4M00A 1LODA 1UMZA 3ZXFA 4R9BA 5JLVA 1ENRA 4H55A 2JKBA 1EPWA 1LHNA 4GKYA 2E53A 4GXLA 4U36A 4FQ4A 1FATA 1GYKA 1LHUA 2WKKA 3T1LA 1UZZA 1GKBA 2D3RA 3NV1A 5DUXA 2EALA 2ERFA 5DUVA 1WUVA 2ZAAA 5GLUA 1MVQA 2WT2A 3W59A 2YXSA 1HKDA 1BJQA 3IN9A 4AVTA 2WNEA 3NV3A 5DZEA 2ZGUA 3V0AB 5L73A 4XHBA 1YI7A 5GZFA 1Y7BA 4PF5A 4WZFA 2PHRA 1ULDA 1W6QA 1DQ6A 2DVBA 3HN1A 5LK5A 3WCRA 4Z8BA 1IOAA 2D6NA 1QNYA 2ZABA 4FPLA 5JDBA 4Y20B 1WBFA 1S0DA 1W0OA 4ISRA 2DUQA 3ASIA 4XJZA 3ZXLA 3RMXA 5JOXA 2KM2A 1SCSA 4YGDA 5T5PA 1JHNA 1YIFA 1JUIA 2CTVA 1B09A 2A70A 5IK7A 5EWSA 3VKMA 2P37A 1TEIA 1IS6A 2AGSA 3SISA 1JYCA 2R1BA 1C4RA 1OQ1A 1UPSA 1DZQA 2W52A 5EYXA 3SITA 3WDXA 4XXAA 3LSEA 4YG6A 1QMJA 1JOJA 3N35A 1PZ8A 1MS1A 1DQ0A 1ENQA 4FPGA 4FPHA 1GZ9A 4NOTA 3TAYA 4DQAA 5KXEA 4FOWA 3SLIA 4ZKTB 2NM1A 2VW0A 1ZM1A 2ZHMA 3AX4A 3LSDA 4WVWA 3MW2A 4XTMA 3IMNA 2AREA 1DYPA 2FMDA 3PJQA 2A71A 2D3PA 1LJ7A 3I8TA 2GNTA 3AYEA 2D6PA 2ARBA 4YGEA 3Q9OA 1UKGA 1UN1A 2EXIA 2WLQA 4L8QA 1F5FA 1LCLA 2E7QA 5CNAA 4UW3A 3ZVXA 4BMBA 1GLHA 1DGLA 3AXEA 3RMYA 2C5DA 4BOWA 3FLTA 4YM2A 3T1MA 5GLZA 5HCFA 1OKQA 2EIGA 1O4ZA 2CYFA 3OY8A 2D7FA 3AFKA 4F83A 3OPZA 3ZXEA 5CB7A 2NZ9A 4YZ5A 1QF3A 2YY1A 2ZGLA 5H9PA 4BMEA 1IS5A 3WLUA 5DXDA 2DVDA 2XB6C 4XIKA 1AX1A 1WLDA 3KQRA 4XE9A 1G9DA 1SLLA 3SH5A 3ILRA 1MZ5A 2SBAA 3LCPA 2FHRA 5GLVA 4BM8A 3AZZA 1OFSA 1QGLA 1LTEA 2RHPA 2A6VA 1GSLA 3NV4A 3V65A 2ZGKA 1V6LA 4LBMA 5H9RA 4Q27A 2PHXA 3N7LA 2WSUA 1CESA 2VU9A 4LBNA 3ZSJA 4DRRA 1N3OA 2VUAA 5H9SA 1BKZA 3M3CA 1MS4A 2A3YA 3ZYPA 3NWKA 3R05A 1LGCA 3WDYA 1WD4A 2DUOA 1W6OB 3WG1A 4BQ1A 2P3KA 4C1XA 2NMOA 3AJZA 1F31A 2AH2A 2A75A 4I30A 4Y24A 5JVVA 2LTNA 3D6EA 3ZXKA 1S0EA 1BYHA 3BIWE 4YW2A 3VKLA 3VKOA 1IKPA 3O5SA 3M3QA 3AZWA 2GNMA 5DUWA 3N7JA 5HCAA 3IPVB 4FOYA 2ZGPA 4XMAA 2CNAA 4LBQB 1GBGA 2ZGOA 4Q1RA 2ZGRA 1WLCA 2ZGNA 4OZXA 1S0GA 3JU9A 2PELA 1KJLA 2YZ4A 2PHUA 2DVAA 5T52A 2D6MA 3WDTA 3WOGA 1QOSA 3IKWA 1G9FA 1BXHA 4RA0A 2AENA 4YG0A 1SBDA 1ULCA 3W58A 2TEPA 4FPOB 3ZPYA 2WJSA 2GMMA 4JC1A 1Q8OA 5JOWA 3N36A 3OYWA 1GZCA 1G9AA 2GALA 1LEDA 3D5OA 1LU1A 3M2MA 3C2UA 4XJ9A 4K20A 4CZSA 3QLQA 1AX2A 1MS9A 2DTWA 3INAA 2C9AA 2PHWA 3SH4A 4GKXA 1Z0HA 1Q8QA 1SLTA 4RL7A 5F9TA 1FV3A 1GZWB 2A6XA 5CBLA 1XQNA 4PCRA 3ENRA 3FBYA 1LULA 2GNDA 1KDKA 2W39A 4FVVA 1CONA 1KJRA 2E6VA 2EF6A 2EXKA 4DPNA 4YW3A 2ZA9A 1WW6A 2A7AA 3AP7A 3APBA 2SLIA 4Y1UA 3GNEA 1JN2P 2DVGA 1AVBA 3O0WA 5T55A 5HCBA 4U2AA 1PZ9A 3A4UA 4AGGA 4AVSA 3VKFC 4PBPA 4XDQA 2JJ6A 1SCRA 1SLCA 3POYA 2CWSA 2ZGSA 3BOPA 4K1ZA 3IM0A 4XTPA 1DQ5A 1A8DA 1RITA 4ZXKA 1GNHA 5EYYA 1F9KA 1V6MA 1N1VA 1SLAA 1LOBA 2VW1A 4Y22A 2UU8A 1CJPA 3UK9A 2WT1A 1LHWA 5IK8A 1WLWA 3FFZA 4Y1YA 3N7MA 3RS6A 3V0AA 4MYEA 1AXZA 2ENRA 4AVVA 3O0VA 3VKNA 2JECA 4FP3A 2JE7A 2ZHLA 2PHFA 3KM5A 5H9QA 1ULEA 3ZSLA 4FPCA 2YROA 4JRAA 2CWMA 4FOVA 1I3HA 2AUYA 5GZCA 1QKQA 2R49A 2OUJA 4FPFA 1LEMA 5EXOA 1N1YA 5DG1A 2DV9A 1SFYA 5IUQA 1MVEA 1O4YA 4TZDA 4FPEA 1MR5A 4YM3A 3R4UA 1IS3A 2JE9A 4M3CA 4K21A 3AP6A 1MS5A 1W6NB 2Q5TA 3WZ1A 1S0JA 1MS3A 1C1FA 2NMNA 5KXCA 2LALA 4LBKA 4YGBA 1R1ZA 4XJAA 1W6MB 2I2SA 2JD4A 4NO4A 1GZWA 1MS0A 2P34A 2VH9A 2UWBA 3DGTA 5GZDA 3USUB 3AYAA 3V0BA 1GANA 4Q8KA 1WW5A 4M01A 1CIWA 1WCSA 3V0BB 4PQ9A 2DURA 2ZACA 1JYIA 1YYNA 4LBLA 5GM0A 1LOFC 1UAIA 3B9CA 3WG2A 3WHUA 3N3HA 3BODA 3WG4A 5IT6A 1DQ2A 4GWMA 5T54A 1CVNA 1DFQA 3O12A 2GMEA 4R9DA 1FAYA 5IK5A 3AP4A 2GMPA 1V6IA 5GJ6A 1I1EA 1LENA 1V6KA 2VY0A 1GICA 2ZGQA 4LBJA 4XBQA 4M3CB 3OY8B 3WDUA 3WHTA 1VALA 2W08A 4YW4A 3AP9A 5E88A 4ATEA 2HYKA 5GZGA 2VW2A 2ZZJA 1V6OA 4R9AA 3ZYRA 4AYUA 4YG3A 3WUDA 2E51A 1YXWA 1V6NA 3UL2A 4SLIA 1LOGA 5DG2A 5JMCA 5KXBA 1C57A 2A6WA 4M3CE 2ZHNA 4XILA 1N1TA 2ZMKA 2B7YA 2A6ZA 2A3WA 4GA9A 4YW5A 4YZ3A 4ISQA 2NP0A 3ZSMA 2D44A 1N3QA 4HANA 1QOOA 2V5YA 4TYSA 2GN3A 2R0FA 1D2SA 5E89A 2E7TA 1AF9A 5F5QA 4Y26A 3PVEA 2ZGTA 1FV2A 1CR7A 4P14A 4XYXA 1CQ9A 2AYHA 1LGBA 4K1YA 2ZMLA 1G8WA 1UL9A 1ULFA 5JOZA 3VV1A 4XBLA 4YLZA 1SLIA 1W6QB 3SH3A 4LBOA 1QU0A 2R1DA 3HMYA 4XIOA 1W6NA 2GNBA 3MW4A 5GLWA 4YFWA 4P9XA 1HQLA 3MW3A 1SBEA 4YGCA 3V64A 4M3CF 3FLPA 1BZWA 3RG0A 1G7YA 2EXHA 4Q8LA 1AZDA 1LU2A 3RQ0A 1LOEA 1S0BA 2NN8A 5DZGA 4AWDA 1ENSA 1SBFA 1Q8PA 1QOTA 4P9YA 2YMZA 5E8AA 1V00A 1MS8A 3I4IA 2BQPA 4XBNA 3B00A 3L2YA 2Z42A 2ARXA 1GV9A 3WG3A 2AR6A 1CPNA 1CN1A 1KDMA 3M3OA 1G9CA 4Y1ZA 5IK4A 2GDFA 3M3EA 1YO8A 2DVFA 4DRVA 3T2TA 1JXNA 1LOCA 2UWCA 1UZYA 3AXDA 1APNA 1DBNA 5SV8A 4LBQD 1N3PA 3NV2A 1U0AA 1WBLA 2ZBJA 4WVVA 1SLBA 3WCSA 3D4KA 1W6OA 1DLLA 4XXPA 5T5JA 2ZHKA 1HDKA 4P9WA 4C1WA 3RSJA 3AZYA 4FP2A 1LGNA 3TB0A 4YM1A 2R16A 2ZMNA 3UJQA 3A0NA 2D6OX 3B69A 3WVJA 2CL2A 1G86A 2EXJA 1IS4A 1Q8VA 1X50A 3OGGA 1WD3A 4UW5A 1C1LA 4YZ4A 3RRDA 5GLTA 5AVAA 4LBQA 2D6KA 3UJOA 1LESA 4YZ1A 1Z78A 1J1TA 1LOAA 4Q2FA 1S0IA 4WV8A 3OJBA 1AJKA 1DQ4A 1GNZA 1H9WA 1H30A 1LHVA 3ATGA 1W6PB 2R0HA 3R4SA 4UW6A 4BLJA 5CA6A 1NLSA 1KRIA 1A3KA 3AZVA 3ZSKA 4W65A 1D0HA 3POSA 1W6PA 1DHKB 1FX5A 2GN7A 3PVOA 2G4IA 3CNAA 2DU0A 3AYDA 3B01A 4YZ2A 1G9BA 1ULGA 1LHOA 4BPZA 3N7KA 1HLCA 2D43A 3AJYA 3ZXJA 2A5ZA 1LOFA 4FQZA 4AGRA 1RIRA 3QCWA 1S0CA 5T5OA 1VLNA 1AXKA 2UWAA 2V73A 1N47A 4Y22B 3WDWA 3AK0A 1W6MA 4Y1XA 3AP5A 1KQRA 1AX0A 3USUA 4DS0A 5FREA 2XG3A 4Y1VA 4ATFA 3U4XA 3PVNA 4XJWA 1UX6A 4HL0A 3WDVA 4FPYA 4KBBA 1FNYA 3GALA 1QNWA 5GALA 2H0BA 1Q8SA 1MZ6A 2VXRA 3FUQA 1A78A 4ASMB 1PZ7A 2DYCA 3MEPA 2WQZC 4BLIA 1AXYA 2NYYA 3BTAA 4YM0A 5FRAA 2D3SA 1QDCA 3DUIA 3ILFA 5CAZA 1URXA 1ZA4A 4FOQA 4DFSA 2ES3A 5GZEA 1DIWA 2CY6A 1DQ1A 2JDZA 2OVUA 3IPVA 3PMEA 4Q1PA 2P3IA 1FYUA 3A0KA 3WV6A 2P2KA 3B3QE 4XZPA 1KITA 2W68A 5KXDA 1SACA 4FPKA 1RINA 5DUUA 1DYKA 4CRQA 4XMIA 3WNXA 3M1HA 4XJ8A 3FUOA 1LECA 1ONAA 3JUUA 4UW4A 3OBTA 3WUCA 1S1AA 1YRZA 3MPPG 1AJOA 3O0XA 3POWA 4Y20A 2YV8A 4CTEA 1S0FA 1QDOA 2D6LX 4AGVA 1N1SA 1VIWB 2OW4A 1V6JA 4GALA 4XOGA 4D69A 2OUHA 2DWRA 1HQWA 2WSVA 5DZFA 1VAMA 3AYCA 5BYNA 4YW1A 1MACA 2DU1A 1CPMA 3HR9A 3OYWB 3H0OA 5T50A 3SNMA 3AZXA 4XJUA 2A3XA 3OBRA 2P3JA 4XHXA 4ITCA 2UURA 4FPJA 5T5LA 1W0PA 4R9CA 1BQPA 2DUPA 4PBOA 3VUOA 1H9PA 2EAKA 3FLRA 2WT0A 1WW4A 1WW7A
chains in the Genus database with same CATH superfamily
3ILNA 3PMSA 4IGOA 4GWNA 4IQPA 4ES8A 5FY9A 5BNPB 4H14A 1C8M1 3BU0A 3B7MA 2ZKNA 4FXGB 1RVF3 5FO9B 5JOYA 4AR2A 2W3JA 4LNVA 5FZBA 3AVSA 1NXD1 1B35C 1W99A 5F2WA 1LODA 4AE2A 1MZFA 3E5XA 1PK6C 5FY5A 1ENRA 4A7KA 1W9TA 4H55A 2JKBA 2OA2A 5F32A 3G6JB 2BOJA 3NSTA 4GXLA 2JG9C 3T4HB 1NLQA 3I3DA 1HXS2 4PLOA 3H42B 2WKKA 2TNFA 3LEGA 4PDWA 2XJUA 4BA6A 5DUVA 1SQ4A 4R4ZA 2WT2A 1KEXA 1H0BA 2WO1A 3U37A 3K77A 3NRUA 3WP3A 5BNNB 3J8F3 3SKVA 4W50A 4SBVA 5LY2A 1UXXX 2VCMA 1YI7A 4PF5A 3ON7A 2AZ5A 2XLGA 3VD5A 1GFF2 2DFBA 4QAWA 5A7NA 5FBZA 3BUCA 4LHSA 2HWB2 1OC1A 2ZABA 1J3QA 3LIGA 4OHWA 3OGVA 2GH8A 4QHBA 4UAPA 5J48A 4KH9A 1W0OA 1C5IA 3J4UH 3VD7A 3ZXLA 1DCSA 2HWF3 4YGDA 2JDAA 3S57A 3HT1A 4KGQA 1IQAA 4CPBD 1JHNA 5EPAA 1X8MA 4BQ2A 1GQPA 3OF1A 2CTVA 4CEYC 1RGSA 1NUKA 3PUHA 3U4SA 4HVQA 3LEIA 3NAPB 4LO5B 3W21A 4CU7A 1UZVA 4ZY9A 5FP3A 5DPNA 1PGW2 2IXJA 1S2KA 2QQUA 3Q8CA 4RS5A 2AGSA 4CCKA 4FSJA 2R1BA 1GOGA 1OQ1A 5EYXA 3WNKA 1WLTA 4XXAA 5FLJA 4AAPA 4FPGA 3N35A 4FFHA 1ENQA 5LA1A 4DQAA 5JXIA 3GZTB 4AHXA 4QKDA 4ZKTB 3DPRB 4X8PA 5HI0A 4WVWA 2X09A 5F2SA 4XTMA 2XPJA 4NPRA 4GWJA 2FMDA 1HRI3 1T6BX 2V4VA 3O1MA 5DDJ3 1HXS3 1X33A 4XFAA 3AYEA 2YC0A 2ZX0A 5C33A 3JB8A 4XFGA 1K42A 5FK7A 3FC0A 2WIIB 4OZOA 4CUAA 3FFQA 3B94A 3LIHA 5AFBA 4QU2A 3AM2A 3RMYA 2C5DA 2VNGA 3U11A 4OHVA 2HWF2 4NROA 5FFOC 1FOD3 4AFAA 3WQ0A 3BCWA 3VZJA 1ZVFA 5LEKA 1PO21 5D2AA 2Y33A 2CYFA 1TMF1 3OY8A 5CFDA 5FTTC 1YUDA 5CB7A 3P5BA 3UKNA 5M0TA 4G3YC 3DYMA 4PLNA 3EHKA 4ASLA 3CF6E 3EXUA 1AX1A 2FCVA 4PIXA 2DCZA 1G9DA 5IVYA 2VVFA 3ILRA 2SBAA 5GLVA 3AL5A 2ET1A 1CZVA 3LPFA 4NHMA 1OFSA 4YVWB 1VBB3 1H8TC 2WINB 1VBC2 2HEVF 3H1MA 4D3WA 2ZGKA 1GMMA 3VB9A 2WSUA 1CESA 4N7UA 5BNPC 2FDHA 4UBHA 1H6YA 3IZOA 3VDCA 4AQ2A 1N3OA 3AL6A 4N53A 3CZUA 4RGAA 4H3WA 4BWOA 3R05A 3K3NA 4DIQA 1PM4A 1J58A 1WD4A 3WG1A 2VCAA 2CU5A 4UBGA 2NMOA 3AJZA 1F31A 2AH2A 2A75A 1RUF3 4E4SA 5FQ0A 2LTNA 1QJY3 3ZXKA 3EJKA 4LHLA 2E9QA 1VAKA 3VKOA 1S4CA 3O5SA 4GAZA 5A3MA 3M3QA 2X5IB 2HWF1 3I2HA 3K3OA 1SMVA 3S7IA 3MUY1 4Q4X2 4FOYA 1PMIA 3C7GA 1UOGA 2CNAA 4IGPA 4XMAA 1GBGA 4XAEA 3BTZA 1YQ8A 3KV6A 4UFMA 3AMNA 2PELA 4IL7A 3JZVA 1KJLA 2PHUA 2D6MA 3R0RA 1XNDA 3T2PA 1G9FA 4RA0A 5ACA1 1W2AX 4YG0A 2PLV3 1COV2 4O9EA 4WM7C 2TEPA 3E6BA 4B7KA 5KHKA 1UYZA 3H1YA 2XWBB 5JOWA 1Q8OA 2RS13 4WM7A 4D94A 1RUH1 3C2UA 4IEUA 4Q5OA 4XEZA 3I3EA 3QH7A 5HXMA 3E1F1 1DZRA 1MS9A 5I0RA 2DTWA 4EWEA 1FOD1 2RDSA 2JIJA 3MI8A 2PHWA 4XUNA 2W94A 4RSUA 4GKXA 1AYN3 4A7ZA 2XVGA 5C8CA 2HEYF 4RHV1 2R041 5C3PA 1SLTA 1HN0A 3CDZB 2ID4A 4PT6A 5C5UA 5F9TA 4YW7A 1J3PA 1GZWB 2A1XA 2A6XA 3VN4A 4H2AA 4KBZA 5CBLA 4Z92B 5JPMB 3ENRA 4INDA 1UY0A 2BNOA 1LULA 1B35B 3ZDSA 3H7YA 4FVVA 1CONA 4A41A 4DPNA 2Y6LA 2XH6A 4AL9A 3GNEA 1JN2P 3ZN5A 4HETA 5IFTA 3AFGA 1AVBA 1IHMA 2WBKA 4XDPA 4BQWA 1JYTA 1VBB1 3ZFGA 5BV6A 3AKRA 2RS33 1PZ9A 3A4UA 2VNOA 4AVSA 3VKFC 2JD9A 1NCQA 4XW3A 3LAGA 4NE9A 2D40A 4B4PA 1XYPA 2CWSA 3LQCA 3VZKA 5LW9A 1FPN2 1XC6A 5CFCC 4CDXB 1MEC2 1A8DA 4DEVA 2Q8CA 4LXLA 1WKYA 3WNMA 1SLAA 2R6QA 4IE4A 1HX6A 2X8KA 4Y22A 1CJPA 1REDA 1RUI1 3LPGA 5FZ1A 4B4QA 3RS6A 4Y1YA 3V0AA 1X82A 1SFNA 2ENRA 2B45X 1VB2A 4XCBA 3VBUC 4AVVA 2JECA 5K0UC 4IDZA 3SXWA 2JE7A 1JH5A 4NN0A 2WNVC 1IG0A 2HJIA 3A23A 4OI4A 2XQXA 4DXRA 2BWAA 1QJY1 1UMIA 1E5HA 2AUYA 4Q0VA 5L9BA 3VHRA 5LA0A 5DG1A 1DG6A 2RDNA 1KD7A 2WYFA 4TZDA 3WQBA 3ZFEB 4YM3A 1NA1A 5F6LB 2JE9A 1O8SA 1RUH3 2WZR2 5EP9A 5L7OB 4K21A 1K5MC 2BGCA 3AP6A 5JSPA 4L99A 4WM8C 4I3PA 4Q4X1 1C1FA 5KXCA 4LBKA 4XJAA 2RMU1 4LKDA 1W8ZA 2I2SA 2VQ0A 4XF4A 1GZWA 2P34A 2VH9A 4ZU7A 3N4MA 3V0BA 3NKGA 3ZXGA 4F3JA 3GZAA 5J36A 2ZX3A 4DUWA 4M01A 1CIWA 3T09A 5LCWL 1JYIA 1FMD2 3O1PA 1DDLA 2IXKA 1ZZCA 2JWPA 4P9GA 3BODA 5JWPA 3WG4A 1DQ2A 3QBQA 1CVNA 1DFQA 1XU2A 3DKWA 5JZGB 4H7LA 4R9DA 1CAUA 4AOCA 1WCQA 2ARAA 1XE7A 3PTYA 4WM7B 5HV4A 4CCNA 5GJ6A 4QX1A 1JYNA 2Y38A 3CMGA 2EA7A 4LBJA 1VR3A 3I2GA 2VMCA 3C7HA 4MX3A 2YYOA 4BDVB 1QY4A 1RHI2 5E88A 2HYKA 1H4GA 2VW2A 5FZAA 3UESA 1V6OA 2W1SA 1LKNA 2WZR3 2MHFA 3LOIA 4YVSB 1GWKA 1RMU3 2HKXA 1PVC2 1VBA2 1YXWA 1OA2A 5FYSA 4SLIA 1LOGA 2WNOA 4HK9A 4AEJA 5JMCA 5KXBA 4OQ9A 4M3CE 5JLVA 2ZMKA 1LNSA 3WEZA 4HPKB 3M3IA 3WX5A 4YZ3A 3RGBA 2D44A 4AZZA 4XFIA 4B7EA 4CVUA 2JICA 3RNSA 3T4VA 4Y26A 4KWKA 4IGQA 2ZGTA 4Q4Y2 5EFUA 1ZRIA 1O3SA 2ZTNA 5DDJ2 1US2A 1K12A 1QQP3 4P08A 4IEXA 3LOBA 1UYYA 1ULFA 1WMEA 4Q4W2 5JOZA 4CEWB 2UYBA 2JE8A 4CDXA 1ST8A 4MLOA 3SMHA 1W0NA 4XF1A 1SBEA 4MGKE 3NNLA 1FT9A 3NO8A 3OBAA 5FPBA 4Y5SA 3FWEA 5FOBB 1TG7A 4XURA 3O1RA 3USSA 1OXCA 2RS12 3BTYA 2XKOA 2FDKA 1BMV1 2BQPA 4XBNA 3D3AA 4XABA 1CWPA 2QQNA 5IVBA 2OX0A 2VR4A 2JG8A 5A32B 3E6CC 3FHAA 2Q4SA 3H8OA 3M3EA 5BNQA 2BDRA 1BBT1 4QPIA 3GHNA 2FCUA 1UZYA 2RM23 4MOAA 1UZWA 3LF7A 3MV11 1RMU2 3PUIA 1HRI1 1N3PA 4LBQD 4CCLA 1WBLA 2G9ZA 3CJIA 1SLBA 3EB7A 3Q8BA 4KG0A 4Q4X3 4QKNA 5C8CB 3OD4A 1NT0A 2ZHKA 1RHI3 3VHPA 2Q1MA 3ZXDA 5BNOB 4FAHA 4QD2A 4YARA 3AZYA 1RUC2 1LGNA 3TB0A 3VBHB 4QGLA 1BLZA 2WUHA 1DP0A 5F3IA 5FP7A 5CADA 1DYOA 3UJQA 4Q0UA 4OFGA 3K4ZA 2WFF3 3WVJA 1G86A 4ZS2A 1IS4A 1RUE1 3LDRA 1Q8VA 3ZM8A 1AL22 3ZKYA 1C1LA 2G9FA 2XONA 5F7UA 2ILMA 5FP8A 4L92A 1ZRFA 3DXUA 4BQYA 3PIGA 2R30A 4YYOA 2DF7A 4ARYA 5KC5A 1S0IA 3OJBA 4I02A 5CFCA 3GZEA 4G4FA 1W6PB 3KMHA 1J83A 4BH9A 5IATA 1G6NA 5CA6A 4IXLA 4CU8A 4IETA 4BIOA 1OPMA 3KS7A 4MHUA 3ZSKA 4ES9A 2IVIB 1W6PA 3HJRA 4JAAA 1DHKB 3PVOA 1RMU1 3I2FA 3CZJA 4CEWA 2DU0A 1EPZA 2ZJCA 4P5YA 5A3OA 1DF0A 5K4LA 1OA3A 4EN8B 2VOVA 4YZ2A 2MEV2 3N7KA 2D43A 3ZYHA 3ZXJA 4JKLA 1LOFA 1Y9MA 2VL4A 5ANNA 3OG2A 2Y0OA 1S0CA 2YBPA 1VLNA 4CCCA 1ZBA1 2V73A 3EMRA 3R4DB 1VBA1 3VDAA 1TME1 1UF2C 1W6MA 1VJ2A 3FE5A 1ZZ8A 3USUA 5FREA 4Y1VA 3U4XA 2QE3A 2VMEA 4HL0A 5A3NA 3WDVA 4IE0A 2CDPA 4FPYA 4Z2WA 4QHOA 2H0BA 4HPKA 4Y5TA 1OQDA 1W3VA 1A78A 5F5AA 4ASMB 2D5FA 2QZ2A 2WQZC 4BLIA 1UY4A 1FXZA 3TEWA 5JAXA 3BTAA 1UNBA 4YM0A 3LDKA 5C5TA 5FP9A 4QPIB 3M7AA 4QB2A 3H9AA 3OGRA 3MLLA 4Z07A 4D7YA 2YU2A 5L7OC 4LLFA 5IWFA 3Q8EA 4UF0A 4FOQA 4COYA 3ZO0B 1AR71 2JDHA 1DIWA 2CY6A 5I8TA 1BCXA 2OYZA 3A0KA 4TXWA 3B3QE 2IC1A 4HG6B 3VDDA 1COV1 3FL7A 2RJLA 1RINA 2K9ZA 5DUUA 3VBSA 5J09A 3MFAA 2VTXA 4OHXA 3VBOA 2WNVA 4UT5A 4CRQA 2WO7A 1VRH2 5FMDA 4JTOA 2E31A 3JUUA 4HKLA 4OUSA 3LE0A 2WNUB 3LWCA 5G05L 5C4WC 1S1AA 3O0XA 4NUBA 5DAVA 2O8QA 4CTEA 1S0FA 3VBRC 2D6LX 2EIEA 2YPDA 3WY6A 4AGVA 2RVAA 4GALA 4XOGA 1U5ZA 4D69A 2PA7A 2DWRA 3I3BA 1MPXA 5T3NA 1RUNA 3JBG1 1MACA 2ZX4A 3HR9A 1HRI2 2HWB3 3NMBA 2WFF1 3WR0A 4COWA 1KXGA 2R32A 1R1A2 4XHXA 3ZFGC 2UURA 5T5LA 3HT2A 4Z82A 5KWRA 5FMCA 1BQPA 5D21A 3RI8A 3H3LA 3JD71 3PUQA 4KWLA 2OZ6A 4Q1PA 3M4FA 4ZPIA 5JI9A 4TTGA 4YRDA 2BYVE 2EVXA 2VAUA 1MQTB 2VMIA 1Q56A 2FMYA 3LKJA 3DF0A 4GB31 2A6YA 2BP6A 2PHTA 1IKQA 2HWC3 2W9XA 5FY0A 5KC6A 2BERA 4ORFA 1UYXA 2CGOA 3KF3A 4JCKA 4L2NA 4RYDA 1OQEA 5FXZA 3ZXFA 1ZA7A 4R9BA 4A44A 3CIHA 4I0AA 4Q29A 4K8RB 1CAUB 4AXOA 1EPWA 1VBC3 3ZSEA 5F37A 4FQ4A 3I3QA 1QJX3 1GYKA 5I0SA 1AYM2 1PO22 3T1LA 3NV1A 1TNRA 5DUXA 2EALA 2ZAAA 4P9IA 2YFUA 3KCXA 4NHYA 3K4AA 3OBZA 4AVTA 1BJQA 4MGSA 5FWJA 5DZEA 1EAH3 3BVCA 5L73A 1NZIA 1EY2A 3PDQA 1MEC3 1GZTA 1W6QA 1DQ6A 1NLRA 1QJY2 2YB7A 5ACA3 4PDWC 1AR62 5I91A 4QDSA 1IOAA 3BTXA 4LULA 1QNYA 3AKPA 2EIDA 4FPLA 3W5MA 2P5BA 2B9UA 3F95A 3CKHA 3MIFA 4Y20B 3B02A 3HIFA 4GB32 5JOXA 4KU8A 3ASIA 3RMXA 2KM2A 2QZ3A 4BQ4A 1T2XA 2W46A 3ZOIA 4FFGA 2IVJA 2XJPA 5FAXA 1Z7S3 3UGFA 5FJHA 3N9LA 1AR61 3VKMA 5I8YA 2P37A 1TEIA 2JX9A 1IS6A 4LK7A 1XRUA 5FZ7A 3GBFA 1C4RA 4LHNA 4M0NA 4QXKA 4AEDC 5LK7B 3O7OA 3LSEA 4O9GA 4YG6A 1QMJA 1JOJA 5DZGA 4CEYA 5KXEA 4HKWA 3SKJE 4NOTA 2E33A 3IWZA 1E5RA 3I54A 4BB3A 2WAOA 1FMD1 4QPWA 4MZUA 1HB2A 2JDKA 2ZHMA 1P8JA 3AX4A 1R1A3 4PQQA 2QBXA 4YNIA 3HNMA 3GHMA 1NQDA 1VRH1 5A6ZA 3AMPA 3LA7A 5BNOC 4FT8A 5IFPA 2A71A 5JMOA 1LJ7A 3HNYM 2D6PA 1CAXA 4KU7A 4EWAA 4P02B 2BTVC 3S5AA 4L8QA 1F5FA 3POJA 2E7QA 3S30A 4BMBA 3CQOA 2RR11 4AQSA 5FDBA 4YM2A 3PLQA 1VBD1 2QQPA 1GUIA 1H1IA 4Q4W1 3TN93 3H1WA 2XL7A 2X53S 1D4M1 3I3MA 2VQUA 1QXPA 2HWE2 5A3UA 1BHGA 2OKXA 1QF3A 1W9WA 5FCCA 4PI2A 1MZEA 4RR3C 4CP1A 2YY1A 2VUCA 4CCMA 2KD7A 3ZYIB 2B39A 1YFWA 2XB6C 4XIKA 5FYTA 1U5IA 3AKTA 4JV4A 4BM8A 1MZ5A 3AZZA 1QGLA 1NKGA 1QJX1 2RHPA 5HPOA 5D8AB 2A6VA 2X05A 1V6LA 4LBMA 2R071 4Q27A 2PHXA 5FZOA 5H9RA 4LBNA 3ZSJA 1UIJA 4N7IA 1BKZA 3M3CA 4KI5M 5LZ6A 2A3YA 3DYPA 1VBD2 4UI9L 2NQYA 1AR63 2RMU3 5JVVA 4Y24A 1NCQB 3D6EA 3HEIA 4TWTA 1BMV2 3EBRA 2Y6FA 1BYHA 2Y6HA 4YW2A 1PHMA 3VBOB 3ES4A 5FKBA 1IKPA 2QTWB 1OHFA 2Y6JA 4LA2A 3DN7A 3S6PA 2AEYA 1E5SA 2C24A 2WRAA 2GNMA 2QQOA 2IXHA 3IPVB 1CAVB 3TWIA 3U78A 3ITQA 4DZGA 4BU2A 5BUVA 2VGDA 1BBT3 1O59A 2WZ8A 1RJ8A 2BU9A 1WLCA 2F17A 2ZGRA 3P1IA 1LB2A 5F6KA 3SHRA 4HFSA 5T52A 2DVAA 4A3ZA 2PQSA 1U12A 1UKRA 1RHI1 3MUZ1 1RUC1 4JQTA 2XVLA 1ULCA 3VL8A 1E57A 4FPOB 4ONUA 3ZPYA 5IVCA 2VZRA 2GMMA 2DCTA 2WN3A 3FHQA 4IV1A 1IGOA 4RHV2 3VHNA 3VDBA 1LEDA 1ZZ9A 2EICA 1OOPA 4RR3B 4XJ9A 4K20A 4TLFA 1LR5A 1U5YA 1NAEA 3GXUA 3QLQA 3WD5A 5AC92 5C9AC 2QFEA 3ETPA 2YU1A 5C9AB 2VPVA 3INAA 4Y4YA 5FWEA 3VD3A 1GP5A 2R072 2VCBA 5EQUA 3SH4A 3NJXA 2QQMA 1D4M3 1ZBA2 4XAAA 1FV3A 3RZJA 1R64A 1K5MA 1XSRA 2RS51 4Q0PA 4OLLA 2ZX2A 4RQPC 3MIHA 1HN1A 2DFCA 2GNDA 4K6BA 1KDKA 2W39A 5J98B 3P3NA 1KJRA 2E6VA 2EF6A 4C91A 2EXKA 4LO8A 2WLPA 5F3CA 4FAGA 2QDNA 1ZBE1 2LUWA 3APBA 4W6YA 2MEV1 4GMP1 4Q4V3 5E16A 1C3HA 2DVGA 1NE6A 2ZS6B 1WMFA 1R081 5B2GB 1AR83 2LW8A 4XQ4A 2VZTA 4XDQA 3ZYFA 2JJ6A 4WM8B 3UKTA 3AVRA 3I2IA 4DEQA 2PFWA 1SCRA 3POYA 4IE5A 4K1ZA 3BOPA 4NWVA 2BV4A 4OULA 3NKTA 1DQ5A 3RFRA 4AI0A 1RITA 4ZXKA 1GNHA 4RFRB 4ZU4A 4HN1A 4CDUC 2WA4A 4CDQA 2GC2A 2WQ4A 3POIA 4ZXEA 1EV11 3KT4A 1UD1A 3UK9A 5FZEA 5IK8A 4RD7A 5FZKA 4HSJA 1LRHA 1WZXA 3K4DA 3LFIA 3N7MA 3WSOA 2BPA2 1AXZA 1POQA 3O0VA 3VKNA 4HN0A 5CKMA 1M4WA 1NZCA 4AFDA 2WNVB 2ZHLA 2BUKA 2PHFA 4AI1A 5H9QA 3VBSC 4FPCA 3RDIA 3GF6A 5L36A 5A3PA 1RXFA 1I3HA 2VVEA 5GZCA 3QACA 1IPSA 2WFPA 5FZDA 1YI9A 2OUJA 1LEMA 3HD8B 2BWCA 1NA1B 3ZFFA 5IUQA 1RUJ3 1MVEA 1O4YA 3I7DA 4FPEA 3THTA 4QT6A 4XFHA 1NY71 3HQXA 4KWUA 2BVVA 5FLHA 1MS5A 5FQ0B 1TZOA 3VBFC 2Q5TA 1S0JA 1QJU1 4KMQA 2OIIA 5F8PA 2LALA 3KVBA 2Y6GA 3VBOC 2JB8A 2JD4A 1JYWA 1W90A 4DY5A 1EUTA 1MS0A 3DGTA 3K2OA 5CKQA 3PU3A 3WNLA 1K5MB 4IEYA 1QJFA 4MG2A 1GANA 2AC1A 3TEZA 1WW5A 2VVDA 4QGNA 1WCSA 4PQ9A 3AMHA 4KWJA 5CIRA 5F5CA 1YYNA 4LBLA 5GM0A 1LOFC 2VBBA 3B9CA 3WHUA 1OD3A 4PLMA 5IT6A 3IIIA 2OXBA 4CEYB 2GMEA 3DEMA 1VBA3 2VMGA 4AFCA 1KFXL 1TME3 4V2WA 1JZ7A 3AP4A 1W8WA 3CJIC 4M3CB 3DXTA 3WHTA 5LA9A 2X5IA 3ACIA 4YW4A 3TEXA 3AP9A 5EJ3A 3T30A 4YSFA 2FBEA 2FDJA 1H8VA 2H6CA 1QQP1 3N9PA 4XFCA 1V6NA 3M8LA 1YQCA 4OCTA 5DG2A 5JIAA 3RZLA 2RV9A 1C57A 2A6WA 4FFIA 2ZHNA 4XILA 1N1TA 4GA9A 1JUHA 1AR81 1E5IA 2A6ZA 2GZWA 4QX3A 2J1SA 1B35A 2V09A 4LE3A 5FZIA 2NP0A 4E2SA 1QOOA 4NAOA 4TYSA 4N53B 2R0FA 4IERA 2E7TA 1I5ZA 5IHRA 3GCWA 3PVEA 1CR7A 2PAKA 5FMOL 4XYXA 1DGWX 1CQ9A 1PK6B 4RN5A 1AR92 1NE4A 4K1YA 1O7FA 1H2KA 5LWBA 4BISA 1UL9A 5FYMA 1XXNA 3THDA 5JIUA 1DGRA 4XBLA 1W03A 1HIXA 2ZOEB 1X9TA 2Q8EA 5KHJA 3O1TA 1GR3A 1W6NA 1RL3A 4RGGA 4YFWA 4P9XA 1HQLA 1PIV1 2V4AA 3MW3A 3ORJA 4BK4A 3RZZA 1PM7A 4AAXA 5A1FA 3FLPA 3RG0A 5DAWA 4Q8LA 5HXVA 2TUNA 4ET7A 1AZDA 2BGPA 4LO4B 2PMWB 4Q4Y3 3RQ0A 1ENSA 3LGRA 4J1WA 4Q0QA 1VRBA 1V00A 1MS8A 3K46A 4LO6B 3ZR5A 1NQJA 1X9PA 1GV9A 2LROA 3WG3A 2AR6A 2WR9A 3JD72 1KDMA 1YNAA 2DCKA 3MHZA 5IK4A 2GDFA 3GCXA 2DVFA 3OPTA 4QPIC 1PNFA 4P00B 1LOCA 1QXRA 1DBNA 3GJAA 4HMZA 5SV8A 2ZBJA 4WVVA 2BGOA 3D4KA 1NXMA 4FFFA 2VO5A 4XXPA 5T5JA 3ACHA 4P9WA 1HDKA 1SPPB 2XVKA 3I59B 4E27A 5J96B 1HV0A 1H1AA 4MHRA 1SZBA 3KV9A 4YM1A 2R16A 5IAXA 4AG4A 5JPNB 2XJRA 3B69A 2YUEA 3TNQA 2OS2A 1RUF1 1GNYA 3KQ4B 1D7PM 4UW5A 5FZLA 2CAUA 4MUVA 2PHDA 5LA2A 3MYXA 3RRDA 4YVWA 3A21A 4E8CA 3T0DA 4HZFA 2D6KA 2VTXJ 2W1WA 1CZTA 3HAGA 1ZRCA 1LESA 4EN7B 1LOAA 2GH2A 2TBVA 4LKEA 1LAJA 1JI6A 1CJDA 1ND2C 3BYWA 1KS5A 1H30A 3ATGA 4MADA 4N9HA 4UW6A 4BLJA 1NLSA 3JBG2 4MSVA 3NQHA 4XF9A 5LB6A 3AZVA 4W65A 1Y43B 4COVA 5JZGA 1IPKA 1RUG3 2GN7A 4IW3A 1OI6A 2G4IA 3KB5A 4NHLA 3SC7X 3AYDA 3B01A 1G9BA 1ULGA 4XUOA 3VDDB 2VOTA 1HLCA 2W47A 4FQZA 3V56A 2R073 4LOTA 1PNGA 5E6HA 3IDBB 1FPN3 2QQLA 4IUGA 4NIHA 1QQP2 1N47A 1RUD3 2QVSB 2O8OA 3HBKA 1EP0A 4XUTA 3AP5A 3C7EA 1KQRA 2XG3A 4XJWA 4RHV3 4KBBA 2HWD2 1PO13 1H2NA 1Q8SA 1YQ5A 1MZ6A 1COV3 3P6BA 2E63A 1ZZBA 1JODA 2B42B 5DQ0A 5HV0A 3THPA 2XBO1 4R52A 3MEPA 4R4XA 4WM8A 3I49A 3T08A 1AXYA 1J3RA 1CGPA 4LUKA 1UWWA 5FRAA 3DUIA 3JB4C 4X6RB 3LA3A 2BVBA 2L9LA 3ES1A 1VRH3 1ZA4A 5HBAA 5FUIA 4LTAA 3ZN6A 1ACCA 1W8HA 1DQ1A 2JDZA 4NRQA 3PMEA 2MPFA 2H6BA 2P2KA 3MBWA 1POV0 4JDMA 4XZPA 2W68A 5CZKA 2Y60A 1DYKA 2HEWF 1W8FA 3POFA 5FUPA 3GBGA 5A1LA 3AMQA 4XMIA 3WNXA 3M1HA 2WWUA 4XJ8A 1VBD3 2CDOA 1LECA 4RFT0 1K5JA 4G9SB 1TMF2 2W5FA 4QQLA 3NL1A 4LA3A 1RUI3 3KHBA 5CKNA 3KHCA 4GH4A 3VGIA 2OW4A 1DGRN 4MXWB 4NHXA 1V6JA 2VZOA 2OUHA 1WMDA 3S7EA 2WSVA 5C3QA 3DCQA 4YW1A 1PK6A 4GB33 4IEQA 2XJSA 1CPMA 3OYWB 2HWC1 2VOWA 5FMOS 4RS5B 3MFCA 3BI3A 1QH6A 2A3XA 3OBRA 2OPKA 4CDQC 2WN2A 3ZYBA 4GWIA 5EJZB 3RYKA 2Z79A 4DOUA 4ITCA 2G1MA 1X7NA 3QD6A 4GZ9A 1ZBE3 4EN6B 1R091 4NMIA 4GMP3 1MQTA 3JQXA 2DUPA 3NAPC 4Q4V1 1SG3A 2C26A 3SQOA 3VUOA 2RJ2A 1YIPA 4D7TA 3ZVXA 5AFEA 1RUF2 1VAVA 2XUEA 4DO0A 1SDWA 2J22A 3IAQA 2DTYA 1JU3A 3PVBB 3ZPOA 2C4XA 2J1EA 4NIAA 1RUD1 3CHXA 4YFZA 4M00A 3SEPA 4AK3A 1OH4A 5FZ6A 4BZ4A 5FZGA 4A6OA 1MEC1 4CE8A 1CD3G 5E1RA 4UXAA 4NRPA 1KFUL 5B4NA 1LHNA 4GKYA 1PO11 4XCAA 4U36A 1FATA 1VBE3 4L97A 4C0BA 2GP3A 1LHUA 5FJKA 4CEWC 1UZZA 3HQRA 2XLAA 5GLUA 2ERFA 2I45A 2PQQA 1WUVA 1FPN1 2N7GA 3LZZA 4WVZA 2W1QA 5FY4A 3W59A 1J59A 1OH3A 1SPPA 1GOHA 2WNEA 4JX0A 2J1AA 5CVRA 3V0AB 4GMP0 5J37A 1HRV3 4QDQA 3E6DA 4KGGA 1CAWB 1Y7BA 2JG9B 1GP4A 1ULDA 1RUC3 3KCYA 3C8XA 5LK5A 4PJYA 2D6NA 4JGYB 3K51A 4PHZA 4COUA 5FPXA 5JDBA 1ODMA 4OI0A 1C8M2 1F2NA 1QHDA 3H3UA 5BNPA 1W2UA 1S0DA 1QJX2 2DUQA 1RUJ1 4XJZA 4CP2A 5C8CC 2VZQA 1PX3A 1SCSA 5J1XA 3QH6A 1H8TA 1CZSA 5IVFA 1HW5A 1W8UA 1NY72 2BEOA 2NLRA 2WZR1 5K8SA 2FZ2A 2VQAA 1JUIA 1MQTC 2X29A 3NAPA 1B09A 4HKOA 4QB1A 5LBCA 3T2OA 4DNYA 1WCUA 4D6SA 2Y26A 4RGKA 1VMFA 3RZKA 3OUJA 1JYCA 2H0VA 3IT8A 3MIDA 1UPSA 4JZRA 5CFDB 1RUD2 3SITA 4OI1A 3T0BA 4FPHA 1MS1A 1DQ0A 2WWJA 2RDRA 1GZ9A 3TAYA 3MIBA 4DY3A 4MGIE 1R082 3E97A 4LLOA 3PTRB 5C8WA 2MEV3 3POEA 3SLIA 2NM1A 1ZM1A 5FYIA 1S55A 3MW2A 4AVBA 3VBFA 2JXAA 2RR12 3TN91 2XLFA 5A3WA 3PJQA 1L7LA 2GSYA 2XMLA 4BYYA 1ALYA 4X8NA 2YG0A 4K3UA 1YCIA 4PF1A 1YHFA 5FZOB 3J7HA 1RTVA 4XF0A 2WLQA 4LMFA 5CNAA 4UW3A 1U5XA 1GLHA 1JYVA 1V0AA 5L9RA 4IV1B 4IE6A 1OKQA 2VM9A 2YHJA 5BY5A 4E4ZA 3UNPA 3H8UA 1O4ZA 4JRLA 3U0ZA 3WF2A 3B93A 4FTBA 4CCEA 2VULA 4NIDA 2D7FA 3Q8FA 3AFKA 4B1MA 3ZXEA 1UY1A 1POV3 2OT7A 3OTFA 4CXYA 4NIIA 2ZGLA 4BMEA 2VC9A 2ZXQA 4CU9A 1IS5A 2KR2A 3HOBA 3GBWA 1UY2A 3KQRA 3U1XA 4XE9A 1SLLA 2UYAA 4A2UA 4Z1VA 4YPJA 2VTFA 2W91A 1F4AA 1VBE2 1LTEA 1GSLA 5A7OA 4ASKA 1Y4WA 4BQ3A 3V65A 4BXFA 3OCPA 4DUXA 5CFDC 1FMD3 3N7LA 5F1RA 4N43A 5CEHA 1W28A 2VUAA 4N9IA 4DXTA 5FYHA 3JXSA 3NNGA 3ZYPA 3NWKA 5J7MA 3OUHA 2VZSA 3ZX7A 3WDYA 1JMUB 2DUOA 5BNNA 1W6OB 1ZREA 4C1XA 3MIEA 5A7SA 5C4WA 3KF5A 3MIGA 3PU8A 2B8MA 3H7JA 1BK0A 3NJZA 5A6QA 2ARCA 1PGL2 4PIYA 4FTSA 1HRV2 3ZFEA 1BEV3 4QQOA 3AZWA 3OSDA 2VJXA 1F4HA 4QKBA 5IVVA 4QXHA 5DUWA 4A3XA 3N7JA 4AHWA 1UPIA 4AEKA 4XC9A 1W8TA 4Q4W3 2Q8DA 4LBQB 1OMIA 2RM22 1FI2A 1XE0A 1VMJA 3MO4A 5K0UB 3JU9A 3J7MA 2ETEA 3LA2A 3WDTA 3IKWA 2QQIA 4EJRA 1ZRRA 2JDMA 2VZ1A 4OQ8A 1W9SA 5F5IA 3UGHA 4IV1C 1I6XA 2P3YA 3OPWA 4JC1A 1TMF3 5EJ1B 4CSWA 4NIGA 3M2MA 5KHHA 3ACGA 2HBTA 1AL23 3ZMNA 3PL0A 4JTNA 4OHZA 4LIUA 4C90A 1ND2A 2C9AA 1Y9GA 3U07A 2KA3A 4GJZA 3WQ1A 1YQ6A 3J9SA 4CP9B 1CAWA 1Z0HA 1Q8QA 4XUPA 5F3GA 4RL7A 1BVVA 1O5UA 2VZVA 1OF4A 3HNBM 1AR73 3LB9A 3VBSB 3CL1A 4AI2A 1JZ3A 1QEXA 2HYXA 5FPLA 3WP6A 2C0ZA 1ENXA 1CX4A 3A7QA 1RUOA 4YW3A 5KBFA 3AP7A 3GDBA 2SLIA 3FN9A 3WW2A 4Y1UA 4WVMA 1K3IA 4LT5A 4HVOA 2IUWA 3S5QA 2Y6KA 1ASJ2 1UO9A 3LEKA 2ZAHA 4TSVA 4CUCA 2WO3A 2DBIA 3WNPA 1QWRA 4S2HA 4BK5A 2JKXA 1PGSA 1ZYBA 2WNUC 3IM0A 4BJ0A 3MICA 4LE4A 1K45A 1QJZA 4M0HA 3BU7A 1N1VA 1GQGA 2C9KA 3F2ZA 1LOBA 4LJHA 3IB3A 4X6QB 1VMHA 2XUMA 4M4PA 2Y64A 4QX2A 1LHWA 5C70A 1XB9A 4QPGB 3D0SA 1TME2 3FFZA 2WAAA 3ST7A 4QPGC 4KNCA 1UW8A 4TLGA 3BB6A 4FP3A 1WA4A 3CBNA 2ORXA 3JCIA 3KM5A 2RS11 5LBFA 1W3XA 3JD73 3MF6A 3ZSLA 4CA9A 5LRRA 2J1VA 2IFRA 3ZN4A 2HWD3 2WWSA 4Y5Z0 5FZ9A 2R061 1JZ6A 2E32A 2HWC2 3ZN6B 5FYUA 4XDOA 1XYNA 3VBHC 5EXOA 2ADEA 5JUVA 2DV9A 3UGGA 1SFYA 3KV5A 4BXSV 1KGYA 3K75B 3ZMOA 2JEMA 3R4UA 1H2MA 1IQDC 5IJRA 5JXGA 1VBC1 2Z69A 1O3QA 5LATA 4IV3A 4META 4Y33A 1W6NB 2D98A 2I74A 3WZ1A 2P6CA 1VPHA 2VOKA 3O1UA 2NMNA 4L9BA 4FO9A 1IPJA 4YGBA 2Y0IA 1CIYA 2D93A 4NO4A 4I0WB 1PMHX 4MVTA 5DAPA 5FXWA 3VDDC 2RDQA 4E2QA 2AEZA 4QDRA 3CEWA 4Q8KA 2XWJB 5KHGA 1OT5A 2B9VA 3HWJA 4CDWC 5ABJA 3V0BB 2DURA 2Y8KA 2IFWA 2ZKLA 4IEOA 2XHKA 1UAIA 2YC2A 2YFZA 3N3HA 4PDWB 2Q1FA 4F7ZA 2CV6A 1ULOA 5JSRA 1FAYA 2B4KA 4XFBA 2I07B 1WA6X 5ANQA 1I1EA 2GMPA 1V6IA 4XPVA 1Z7S1 2DDUA 1GICA 2VY0A 2ZGQA 2QQWA 2ZEXA 4LOSA 4XBQA 3X29B 3OY8B 4QWNA 4ATEA 3GZUC 2ZZJA 1UIKA 4OHYA 4R9AA 1JOBA 4LK6A 3ZYRA 2YBKA 4YG3A 3WUDA 2R7EB 4AYUA 4W6WA 2Z5WA 2OPWA 4QHZA 5A7PA 1OSGA 4C8DA 3UL2A 1RUJ2 1XBFA 1AR93 2E7AA 3KGLA 2VMDA 3IBMA 1YFUA 4OYUA 4A6SA 1HB3A 4W8JA 4YW5A 2D97A 3WP5A 1QJEA 5F3EA 3MGUA 4JGYA 3ZIXA 3W5NA 1R1A1 1JOPA 2Q1ZB 2V5YA 5E89A 2XDVA 5F5QA 5FYCA 2F6BA 3ZFFC 2PTMA 1FV2A 4P14A 1PGW1 1IG3A 1PIV2 2AYHA 2OZJA 5FYBA 1W9YA 2LM3A 5A6XA 2WZPP 2ZMLA 3AC0A 3RJRA 3O1OA 1G8WA 4EYUA 1DU3D 4AVCA 4S2FA 4XUQA 3H8XA 1O3TA 4N53C 3VV1A 1W2NA 3VBHA 1XJAA 3SH3A 1QU0A 5FZCA 3HMYA 2BNMA 2FQPA 4XIOA 1JZ4A 2GNBA 1TVGA 3MPBA 1GQHA 2ADDA 1OVPA 3V64A 3VZNA 2J1UA 4W4ZA 4M3CF 4JDOA 1BZWA 1PVC1 1C28A 1SDDB 1XYOA 3AKQA 3SCGA 4P5HA 5CU1A 1LOEA 2NN8A 4LIVA 2P17A 1QOTA 5E8AA 1W8NA 1VP6A 3I4IA 4K7JA 3B00A 4LKSA 4GIQA 1UOFA 4QGMA 2R042 3UYJA 2ARXA 3ZXAC 3M3OA 4COZA 4J6GA 4HXCA 4F8AA 4IEZA 4Y1ZA 3WP4A 2BFUS 3T2TA 4DRVA 1JXNA 3AXDA 4LO7A 1APNA 5I0UA 1YJLA 2GC3A 3NV2A 1JU4A 3WXPA 3WCSA 2PHLA 4IE7A 2CSGA 1W39A 2VNVA 3RYPA 1HJFA 3RSJA 3MDPA 5DAQA 4NWWA 4BHPA 4CCDA 4IEWA 3S0MA 2FD8A 4LEJA 4CCJA 4EZHA 3M70A 3OEBA 4HOOA 1UXZA 4MO3M 4UOJA 1OF3A 2HBUA 1O91A 1RUH2 1YC61 2CL2A 2EXJA 2RMU2 3G7DA 3N9QA 4WBBA 3OGGA 1X50A 5BNOA 2CAVA 5F39A 1O8PA 5FP4A 1BVP1 3T2QA 5IW0A 2RS32 3VBFB 3UV9A 3BKZA 1W8OA 5FZ8A 3E5UA 4YZ1A 4CDXC 4O7XA 4Q2FA 4WV8A 4EV0A 4MV2A 4QX8A 1DQ4A 1GNZA 1H9WA 3OGJA 1LHVA 1VB4A 2QUOA 2R0HA 4Y4RA 4QQ2A 2JG8B 2OQ6A 1KRIA 4R8HA 2PXJA 2JDPA 5EHDA 1KS4A 1FX5A 1AYM1 4GULA 5APAA 3CNAA 5EV7A 2VUJA 1OLRA 3FX3A 4AI8A 4BPZA 1LHOA 1GWMA 4AGRA 2BW8A 2A5ZA 1REFA 1RIRA 2XJTA 5FZMA 3QCWA 5C4WB 5FO8B 3B5LB 2PAMA 1WCKA 2XBO2 4IESA 2RJKA 3WF1A 2IWGB 1RUE2 4Y22B 3WDWA 4P9LA 3AK0A 1AX0A 2P4EA 3ZLIA 4NRMA 4N43B 2GC0A 3PVNA 2VQTA 5D1IA 3ZFEC 1FNYA 1WWYA 1QNWA 4GH4B 4LHKA 3SCFA 3U14A 3WW4A 5ABJB 5FYYA 2K46A 5FXXA 1L7QA 1PZ7A 3MF9A 1QIQA 3BN6A 4HK8A 3TEYA 1L7RA 1QH7A 2NYYA 3PJYA 3UETA 1AYN1 4D8MA 3HBZA 5CYYA 2D3SA 3ZFGB 3ALQA 3ACLA 2VOXA 3ZYJB 4E8DA 3ILFA 5CAZA 2YDEA 1URXA 5A7WB 2OQ7A 3NW4A 4GD4A 4JHTA 4DFSA 5GZEA 3IPVA 4NPLA 2RE9A 1R083 3GJBA 2VD7A 2JDUA 4M4RA 5KXDA 1I9RA 2WA3A 3DKQA 4FPKA 4N8MA 1STMA 2BJSA 2W95A 3SCHA 1EAH1 2YGMA 2EIBA 4XFFA 5FR3A 4DMIA 1ONAA 1RUG1 4Z2AA 1DLCA 2IXIA 3LDBA 4HLTA 1ASJ3 1YRZA 2VZ3A 1EV13 2YGLA 3EYPA 3POWA 4Y20A 3NNFA 1OLQA 2QQKA 1QDOA 4EE2A 1T6GC 3J8F1 2WC2A 3OD0A 1POV1 1I5PA 4MGYE 2FDGA 2BZDA 2VG9A 1EUUA 5DZFA 3VBUA 5C3RA 3GGLA 3AYCA 1OA4A 5BYNA 2XGXA 4Q0SA 3QOPA 1RVF2 1TE1B 3LEMA 4JDNA 2DU1A 4XF3A 5LBEA 5HCHA 3H0OA 5T50A 3WNOA 3ZYGA 3MV01 3SNMA 5JCTA 3AZXA 4LQRA 3VBRB 4J1XA 4RS5C 3I2OA 4A45A 2Y34A 3VHOA 3T3YA 1D4M2 1ZBA3 2P3JA 1UU4A 4FPJA 1TNFA 1OD5A 4LR4A 3VZOA 4R9CA 4XQDA 4PBOA 5FBJA 3VZLA 1H9PA 3OUIA 2WT0A 2VCCA 5BPXA 5AC93 3RWKX 3KVAA 1JW6A 5I0TA 4Q26A 4KQ7A 4UFLA 2ZGMA 3CU7A 5CG8A 4QXBA 1FNZA 1JBCA 1HRV1 1OKOA 1UMZA 4JGZC 4D0QA 2WS92 3WW1A 4JKKA 3EO6A 4LKFA 4AFMA 4AEDA 4CU6A 1GU3A 3W20A 2C1FA 2E53A 2D3RA 1GKBA 1F15A 2RR13 4XZUG 4K40A 4BQ5A 4XACA 5DDJ1 1MVQA 4NHKA 4E9KA 2HLEA 2JENA 2YXSA 1J84A 1HKDA 3BOWA 3IN9A 2XR4A 5C3SA 2JG9A 3NV3A 2ZGUA 2WQ8A 2FDFA 4XHBA 3WF0A 1ZBE2 4URAA 3K48A 5GZFA 1X36A 4QKFA 2VMFA 4WZFA 4CP0A 2PHRA 3P3PA 4QM9A 3U10A 2K0GA 4B8EA 2DVBA 3HN1A 4UFJA 2X5IC 3WCRA 4Z8BA 1ZRDA 4QU1A 3VD4A 2IXCA 1UYPA 1WBFA 1XNTA 3OEAA 3ACFA 4ISRA 2LS6A 5ABJC 2QDRA 5K7PA 2J7MA 3KSCA 3H3ZA 4V1PA 5FPZA 5T5PA 1F35A 2QNKA 1YIFA 3GYDA 2A70A 3Q8AA 5IK7A 1UY3A 4K8FA 2HWB1 4PIZA 1EV12 1NCRC 5EWSA 3CO2A 5A33A 4BIFA 3LD8A 4DUVA 5EZWA 1WCDJ 1XE8A 2UY8A 2XL9A 5FZHA 1JZ5A 3SISA 1RYYA 3VLBB 4IEVA 2WL1A 2BRTA 3BPZA 2XOMA 1DZQA 2W52A 3WDXA 5A6YA 5J3UA 4FTEA 1PZ8A 1XNKA 3OB8A 2AACA 3HQUA 4OMDA 4FOWA 4RQPB 5SV5A 1ASJ1 1W05A 2GC1A 2V5DA 3I59A 2VW0A 5I93A 1HB4A 2VBDA 5JSOA 3LSDA 1AHSA 4O61A 5IVEA 3JQWA 4UFIA 5LRSA 3IMNA 5C71A 1RJ7A 5LY1A 2AREA 1DYPA 2EAAA 2D3PA 2NPIA 2GP5A 3DPRA 1CAXB 3I8TA 4FXKB 3VD9A 4P9JA 1OBNA 2GNTA 5FOJB 1QXJA 2ARBA 4YGEA 1Z7S2 3Q9OA 3PHMA 1UZ0A 1UKGA 5FY7A 1UN1A 2VECA 2EXIA 4FI9A 4HSLA 1LCLA 3BGAA 4BCUA 2G9GA 2JB4A 1DGLA 3AXEA 2V72A 4BOWA 2CGNA 3FLTA 4N90A 4Q4Y1 5GLZA 5HCFA 4QM8A 3T1MA 2EIGA 3IAPA 4I01A 1UQXA 5A7WA 4EQVA 3AKSA 2A73B 4B4RA 3VZMA 5K0UA 4W6XA 1UMHA 4K9SA 4F83A 3OPZA 4GH4C 1YLLA 2NZ9A 4AHYA 4YZ5A 5I0DA 3POBA 1ZZ7A 2R062 4YVSA 3BALA 2P1BA 5H9PA 4D6QA 1S2BA 1OUXA 4DINB 3WLUA 4Y3OA 5DXDA 2DVDA 5FO7B 1PVXA 2J42A 1WLDA 1RC6A 2Z4FA 1NCRA 3D8CA 4XETA 3SH5A 3LCPA 1TQ5A 2CHHA 2FHRA 5ERLA 4UFHA 3KLSA 5FY1A 3NV4A 3L2HA 3HPNA 4XVHA 1BK1A 5DAXA 2K2SA 3B9IA 3PUSA 5FIXA 2WS93 2QQJA 2VU9A 3LFMA 4DRRA 3I97A 5BXXA 5H9SA 2E26A 3KT1A 5FYVA 1MS4A 1H4HA 4NR1A 3DYOA 1DZTA 1LGCA 2BFUL 4AQ6A 4BQ1A 2P3KA 1UCXA 5L7OA 1RUE3 4I30A 3HN3A 1S0EA 3BIWE 4ZS3A 3VKLA 4RQPA 2WABA 4OUMA 5IAVA 1OOPC 5HCAA 4EN9B 4PI0A 2ZGPA 2RS31 1AL21 1C5HA 1OUSA 4LPLA 4QMAA 4AI9A 2ZGOA 4Q1RA 1CAVA 3THCA 2ZGNA 4OZXA 1S0GA 5FKCA 2BOIA 3HVDA 2YZ4A 2F4PA 5KR7A 3WOGA 1SHWB 1QOSA 2Q8OA 1BXHA 2ORZA 4ZZ5A 5C7GA 2AENA 2J1RA 1SBDA 2VZUA 4BE3A 3W58A 4MGQA 2WJSA 2ZEZA 5DN2A 3N36A 3OYWA 5FYZA 2D5HA 1GZCA 3ABZA 2GALA 3D5OA 3WINE 1LU1A 3CJIB 1G9AA 4OI2A 2O0OA 4GJYA 4TN7A 4CZSA 3IDCB 1AX2A 3U75A 4E4DX 2XBO3 1ZX5A 3J7LA 2VMHA 2WFF2 4IEPA 5A1AA 2FDIA 3KD4A 1D0GA 4QX5A 4JQRA 1UOBA 2PLV1 4IV3B 4JGZA 1XQNA 4IV3C 4S2DA 4PCRA 1NCRB 1YQ2A 3FBYA 1XNBA 3NVCA 3T0AA 4CXWA 2ZPXA 1M06G 5FZFA 4J25A 4WVMB 1YEWA 1CX1A 3IDAA 5FV3A 1H8TB 2WDBA 2ZA9A 1WW6A 3FZ3A 4HONA 2A7AA 4AEDB 4UWDA 5EIYB 3RZHA 1BEV1 4ZHNA 2DBNA 3O0WA 4A4AA 4OUEA 4ZZ8A 1ZZ6A 5T55A 5HCBA 4DXZA 4U2AA 1JYXA 1YJKA 3L9JT 4QB6A 1C8M3 2GU9A 4MXVA 3ECQA 4PBPA 3KT7A 3ZFFB 5FPAA 1ND3A 4AGGA 1W04A 4CUGA 1PVC3 1SEFA 2PAEA 1SLCA 1AR72 4XTPA 2ZGSA 2G19A 4EZ4A 3C7FA 2B5HA 3ROUA 2YBSA 1F8VA 4UYBA 1DGWA 1W9FA 4O65A 1F9KA 1OFNA 1V6MA 4QPGA 5EYYA 5JR7B 2HWD1 3R6SA 5FLIA 1EAH2 2JDNA 2VW1A 2UU8A 2WT1A 3KGZA 1WLWA 2RS52 3RJ2X 4QX7A 1RUG2 2GAUA 3DECA 1JHJA 1PO23 4HVRA 3PIJA 4MYEA 5FY8A 1A6CA 2WNUA 4E4HA 5JI7A 2W2IA 2W92A 5A3TA 1ODNA 2WYSA 4OVEA 5FK8A 3JBG3 1R093 5A70A 4MXWA 5FMBA 1ULEA 3ME2A 3RWNA 1C8NA 3C7OA 2YROA 2C6SA 2PLV2 4JRAA 4QPYA 1HV1A 2CWMA 4FOVA 1W2OA 4QXCA 3MZHA 1V9U2 1GP6A 1QKQA 2R49A 3WNNA 1IZ3A 2CGPA 4UF0B 5DMYA 4FPFA 3ZR6A 1N1YA 4YW6A 1NX9A 1UOJA 4B29A 4QX0A 1HB1A 1MR5A 1IS3A 3ZKUA 4M3CA 2YPJA 5LBBA 1W2TA 1O3RA 2Q0AA 4FBFA 4EN0A 3POGA 1MS3A 2BNNA 2WO2A 1EYBA 4AF9A 3TBDA 1R1ZA 2QCSB 1REEA 3GM8A 1W6MB 3RI9A 3CLPA 1PIV3 3NNMA 1O6UA 4JGZB 5GZDA 3USUB 2UWBA 4HT1T 5JXHA 3H50A 3AYAA 1O5LA 1V9U3 2O14A 2X10A 2LRPA 3RYRA 2PN5A 2ZACA 2ATFA 1L3JA 5FZ4A 3WG2A 5FXVA 1R092 2RG4A 2WZEA 4AI3A 1VBB2 5T54A 1H2LA 4GWMA 4ZU5A 4CDUB 1XU1A 3O12A 1Q5OA 5FZ3A 2VNRA 5AC91 1AR91 4EROA 1V70A 3WW3A 1XPWA 3I2JA 1JZ2A 5IK5A 1J1LA 1UU5A 3I2KA 1LENA 1V6KA 4I0BA 2VZPA 3BPSA 5G04L 4EWDA 5LEJA 3WDUA 3SEEA 1VALA 2W08A 4JGYC 1AYN2 1PMJX 5GZGA 2FZ1A 1QJU2 1OLME 3W9AA 3DV8A 4NJ4A 2E51A 4FCAA 2VBPA 2QQVA 3AB0A 1OVSA 4YVWC 2ET7A 5CG9A 1AUYA 2B7YA 2A3WA 3TOJA 5L9VA 1UU6A 4ISQA 3ZSMA 2ZX1A 5FPUA 1N3QA 4HANA 2FCTA 2KXLA 2GN3A 2XQRA 1D2SA 5DABA 3RZMA 2Z2SB 3I2DA 1AF9A 3H8RA 4L11A 5D8AA 5IVJA 3N9MA 3EQEA 1O4TA 2XKPA 3FJSA 1LGBA 2UY9A 1NCQC 1ND2B 1XNCA 3NNJA 4L0PA 2W1UA 1GWLA 3FMGA 3KV4A 1QJU3 1SLIA 4YLZA 1W6QB 5AVPA 4QQPA 4LBOA 4KL1A 1A8MA 1US3A 2R1DA 3PURA 3D82A 3MW4A 3FHIB 5GLWA 1H6XA 4NAMA 4YGCA 5GKAC 4S2GA 5A7QA 4D7SA 1G7YA 5FPVA 2EXHA 2ZCWA 4LUMA 2ZZQA 5KHIA 5JXJA 1LU2A 4AWDA 1D2QA 1S0BA 1XSQA 1JS9A 1SBFA 1AR82 1Q8PA 3KCCA 3TRSB 4P9YA 2YMZA 2IZWA 3IIAA 4MGZE 4DXSA 5BNNC 2PYTA 2BBVA 1HJGA 4CUBA 3L2YA 1XNAA 2Z42A 3OGSA 1ULPA 3IDEA 1CPNA 1CN1A 4Q4V2 3PNAA 4B3NA 1G9CA 1V9U1 2ZEWA 4H7MA 1YFXA 4CDUA 1YO8A 1F5JA 2UWCA 5A80A 3ZDVA 3ZIWA 4JHZA 4C0HA 1U0AA 2MNGA 3URFA 1W6OA 1JZ8A 2W0XA 1DLLA 2XHNA 2HWE1 3WF3A 4C1WA 3WT3A 1HQNA 4FP2A 5ACA2 4E2GA 4AQTA 2ZMNA 2P6HA 3A0NA 2D6OX 3IMMA 4A42A 1VE0A 5C9AA 4YVSC 2BBAA 2VE1A 3DPRC 3J26N 1A34A 4CYDA 5IYYA 1WD3A 5FZ0A 2JDYA 2QKDA 2VUDA 5D8AC 4YZ4A 5GLTA 2RM21 5AVAA 4LBQA 5I8SA 4I09A 4CDWA 1X8EA 4D6RA 1FOD2 1SFPA 3UJOA 1Z78A 1J1TA 3A22A 3AMMA 3NJYA 5K9YA 2R043 4MGTA 3RZGA 5L19A 1AJKA 1W06A 1YWKA 3R4SA 4WZCA 3FBMA 1RVF1 4JKMA 1OPOA 1A3KA 3CJXA 3UKVA 1YFYA 4V2VA 1D0HA 3POSA 3WQ7A 3ETQA 5FUNA 2HH9A 1NG0A 4I3GA 3KZ4C 5JR2A 1NOVA 3MLKA 2QJVA 4CXXA 4CPBA 1GOFA 4MH0E 5JZGC 3AJYA 1S2EA 3WF4A 4AVAA 1D4VB 2UWAA 1AXKA 5T5OA 4B1LA 2DCJA 4HBNA 4NPMA 1Y9QA 4Y1XA 2YC4A 4DS0A 4ZONA 2XJVA 3MLJA 3DL3A 4ATFA 3RVHA 1UX6A 3KWVA 4UFKA 3GALA 5GALA 2Q30A 3C3VA 5A32A 3BIEA 2JIGA 2VXRA 3FUQA 1ND3B 2DYCA 3ELNA 3N9OA 2ZEYA 4CCOA 1RUI2 1H1MA 5A3LA 3N9NA 1QDCA 1RXGA 5CISA 3PUAA 1BBT2 5A33B 3O1VA 1OLMA 1PX4A 2RS53 3D0JA 1OURA 3NJVA 2ES3A 1VBE1 1WGPA 2OVUA 3VL9A 1NYWA 2P3IA 1FYUA 5B4XA 3O14A 4NVPA 3WV6A 4I2OA 1KITA 1NA1C 1SACA 2W87A 4AFBA 2DCYA 2XJQA 3J8F2 2HWE3 4URTA 1Y3TA 1Q43A 2F4LA 4ARXA 1UX7A 3FUOA 2IXLA 3UT0A 3TN92 1AYM3 2J1TA 3OOXA 4UW4A 3OBTA 3RPQA 3TNPB 3WUCA 4CDWB 5C6CA 3O1SA 3MPPG 4JVAA 1AJOA 4LITA 1AL0G 1XOYA 2YV8A 4QQHA 3VBUB 5CFCB 5ISLA 1N1SA 1VIWB 1PGL1 1JTZX 4AHZA 1Q3EA 1HQWA 1OOPB 3J7NA 4RR3A 4DB5A 1HXS1 1PO12 2JG8C 1VAMA 4OMCA 4XQWA 4KG8A 3E5QA 3VBRA 4AEMA 1ZNPA 5C3OA 2B46X 4CP9A 4GQ7A 2O1QA 4XJUA 3TYJA 2VXJA 5TSWA 2XXZA 4N43C 1RB8G 4CDQB 4A7YA 5LASA 2R063 1BEV2 1W0PA 4LORA 4AW7A 4YWAA 1WMXA 4BQXA 2WS91 1ND3C 2EAKA 3FLRA 1WW4A 1WW7A
chains in the Genus database with same CATH topology
3ILNA 3PMSA 4IQPA 4GWNA 4ES8A 5BNPB 4H14A 1C8M1 3B7MA 2ZKNA 4FXGB 1RVF3 5FO9B 5JOYA 4LNVA 1NXD1 1B35C 1LODA 4AE2A 1MZFA 3E5XA 1PK6C 4A7KA 1ENRA 4H55A 2JKBA 2OA2A 3G6JB 3NSTA 4GXLA 2JG9C 1HXS2 4PLOA 2WKKA 2TNFA 4PDWA 2XJUA 4BA6A 5DUVA 1SQ4A 4R4ZA 2WT2A 1H0BA 3WP3A 5BNNB 3J8F3 4SBVA 1YI7A 4PF5A 2AZ5A 2XLGA 1GFF2 2DFBA 5FBZA 2HWB2 2ZABA 1J3QA 4OHWA 4QHBA 2GH8A 5J48A 4KH9A 1W0OA 1C5IA 3J4UH 3ZXLA 2HWF3 4YGDA 3HT1A 4KGQA 1IQAA 1JHNA 1X8MA 3OF1A 2CTVA 4CEYC 1RGSA 4HVQA 3NAPB 4LO5B 1PGW2 2IXJA 1S2KA 4RS5A 2AGSA 4FSJA 2R1BA 1OQ1A 5EYXA 1WLTA 4XXAA 5FLJA 4FPGA 3N35A 1ENQA 4DQAA 3GZTB 4AHXA 4ZKTB 3DPRB 4X8PA 5HI0A 4WVWA 4XTMA 2XPJA 4NPRA 2FMDA 1HRI3 5DDJ3 1HXS3 1X33A 4XFAA 3AYEA 2YC0A 2ZX0A 5C33A 3JB8A 4XFGA 3FC0A 2WIIB 3FFQA 3B94A 5AFBA 4QU2A 3AM2A 3RMYA 2C5DA 2VNGA 3U11A 4OHVA 2HWF2 5FFOC 1FOD3 4AFAA 3WQ0A 3BCWA 3VZJA 1ZVFA 5LEKA 1PO21 2CYFA 1TMF1 3OY8A 5CFDA 5FTTC 1YUDA 5CB7A 3UKNA 4G3YC 4PLNA 3EHKA 4ASLA 3CF6E 3EXUA 1AX1A 4PIXA 2DCZA 1G9DA 2VVFA 3ILRA 2SBAA 5GLVA 2ET1A 4NHMA 1OFSA 4YVWB 1VBB3 1H8TC 2WINB 1VBC2 2HEVF 3H1MA 4D3WA 2ZGKA 2WSUA 1CESA 4N7UA 5BNPC 4UBHA 4AQ2A 1N3OA 4N53A 4RGAA 4H3WA 4BWOA 3R05A 1J58A 1WD4A 3WG1A 4UBGA 2NMOA 3AJZA 1F31A 2AH2A 2A75A 1RUF3 4E4SA 5FQ0A 2LTNA 1QJY3 3ZXKA 3EJKA 4LHLA 2E9QA 1VAKA 3VKOA 3O5SA 5A3MA 3M3QA 2X5IB 2HWF1 1SMVA 3S7IA 4Q4X2 4FOYA 1PMIA 4XMAA 2CNAA 1GBGA 3AMNA 2PELA 4IL7A 3JZVA 1KJLA 2PHUA 2D6MA 3R0RA 1XNDA 1G9FA 4RA0A 5ACA1 4YG0A 2PLV3 1COV2 4O9EA 4WM7C 2TEPA 3E6BA 4B7KA 5KHKA 3H1YA 2XWBB 5JOWA 1Q8OA 2RS13 4WM7A 4D94A 1RUH1 3C2UA 4IEUA 4XEZA 3QH7A 1DZRA 1MS9A 5I0RA 2DTWA 4EWEA 1FOD1 3MI8A 2PHWA 4RSUA 4GKXA 1AYN3 4A7ZA 2XVGA 5C8CA 2HEYF 4RHV1 2R041 1SLTA 5F9TA 1J3PA 1GZWB 4Z92B 2A6XA 3VN4A 5CBLA 5JPMB 3ENRA 4INDA 2BNOA 1LULA 1B35B 3ZDSA 3H7YA 4FVVA 1CONA 4DPNA 2XH6A 3GNEA 1JN2P 3ZN5A 4HETA 3AFGA 1AVBA 1IHMA 1VBB1 3ZFGA 5BV6A 3AKRA 2RS33 1PZ9A 3A4UA 2VNOA 4AVSA 3VKFC 1NCQA 4XW3A 3LAGA 2D40A 4B4PA 1XYPA 2CWSA 3VZKA 1FPN2 5CFCC 4CDXB 1MEC2 1A8DA 1SLAA 2R6QA 1HX6A 2X8KA 4Y22A 1CJPA 1REDA 1RUI1 4B4QA 3RS6A 4Y1YA 3V0AA 1X82A 1SFNA 2ENRA 2B45X 1VB2A 4AVVA 3VBUC 2JECA 5K0UC 3SXWA 2JE7A 1JH5A 4NN0A 2WNVC 2HJIA 4OI4A 2BWAA 1QJY1 2AUYA 4Q0VA 3VHRA 5DG1A 1DG6A 1KD7A 4TZDA 3ZFEB 4YM3A 1NA1A 5F6LB 2JE9A 1RUH3 2WZR2 5L7OB 4K21A 1K5MC 2BGCA 3AP6A 5JSPA 4L99A 4WM8C 4I3PA 4Q4X1 1C1FA 5KXCA 4LBKA 4XJAA 2RMU1 2I2SA 2VQ0A 4XF4A 4ZU7A 1GZWA 2P34A 2VH9A 3N4MA 3V0BA 3NKGA 3ZXGA 4F3JA 3GZAA 5J36A 2ZX3A 4M01A 1CIWA 1JYIA 1FMD2 1DDLA 2IXKA 1ZZCA 4P9GA 3BODA 5JWPA 3WG4A 1DQ2A 3QBQA 1CVNA 1DFQA 1XU2A 3DKWA 5JZGB 4H7LA 4R9DA 1CAUA 1XE7A 3PTYA 4WM7B 5GJ6A 2Y38A 2EA7A 4LBJA 1VR3A 4MX3A 2YYOA 1QY4A 1RHI2 5E88A 2HYKA 1H4GA 2VW2A 1V6OA 1LKNA 2WZR3 2MHFA 3LOIA 4YVSB 1RMU3 2HKXA 1PVC2 1VBA2 1YXWA 1OA2A 4AEJA 4SLIA 1LOGA 4HK9A 5JMCA 5KXBA 4M3CE 5JLVA 2ZMKA 4HPKB 3M3IA 3WX5A 4YZ3A 2D44A 4XFIA 4B7EA 2JICA 3RNSA 4Y26A 4KWKA 2ZGTA 4Q4Y2 5EFUA 1O3SA 2ZTNA 5DDJ2 1QQP3 3LOBA 4IEXA 1ULFA 1WMEA 4Q4W2 5JOZA 4CEWB 2UYBA 4CDXA 4MLOA 3SMHA 4XF1A 1SBEA 4MGKE 1FT9A 3NO8A 3FWEA 5FOBB 3USSA 2RS12 2XKOA 1BMV1 2BQPA 4XBNA 5A32B 2JG8A 3E6CC 2Q4SA 3M3EA 5BNQA 1BBT1 4QPIA 3GHNA 1UZYA 2RM23 1RMU2 4LBQD 1HRI1 1N3PA 1WBLA 3CJIA 4Q4X3 1SLBA 4KG0A 5C8CB 3OD4A 3ZXDA 2ZHKA 1RHI3 3VHPA 2Q1MA 4FAHA 4QD2A 4YARA 3AZYA 1RUC2 1LGNA 3TB0A 3VBHB 4QGLA 5CADA 3UJQA 4Q0UA 4OFGA 3WVJA 2WFF3 1G86A 1IS4A 1RUE1 1Q8VA 1AL22 1C1LA 2G9FA 2ILMA 1ZRFA 4L92A 2R30A 4YYOA 2DF7A 5KC5A 1S0IA 3OJBA 4I02A 5CFCA 4G4FA 1W6PB 3KMHA 4BH9A 1G6NA 5CA6A 4IXLA 4IETA 4BIOA 1OPMA 3KS7A 3ZSKA 4ES9A 1W6PA 4JAAA 1DHKB 3PVOA 1RMU1 4CEWA 2DU0A 1EPZA 2ZJCA 4YZ2A 1DF0A 4EN8B 1OA3A 2VOVA 2MEV2 3N7KA 2D43A 3ZXJA 1LOFA 2Y0OA 1S0CA 1VLNA 1ZBA1 2V73A 3R4DB 1VBA1 1TME1 1UF2C 1W6MA 1VJ2A 3FE5A 1ZZ8A 3USUA 5FREA 4Y1VA 3U4XA 2QE3A 4HL0A 3WDVA 4Z2WA 4FPYA 2H0BA 4HPKA 1OQDA 1A78A 4ASMB 2D5FA 2QZ2A 2WQZC 4BLIA 1FXZA 5JAXA 3BTAA 4YM0A 4QPIB 3M7AA 3H9AA 4Z07A 3MLLA 4D7YA 5L7OC 4LLFA 4FOQA 4COYA 3ZO0B 1AR71 1DIWA 2CY6A 5I8TA 1BCXA 2OYZA 3A0KA 3B3QE 2IC1A 3VDDA 1COV1 2RJLA 1RINA 2K9ZA 5DUUA 3VBSA 5J09A 3MFAA 4OHXA 3VBOA 2WNVA 4CRQA 1VRH2 4JTOA 3JUUA 4HKLA 4OUSA 5C4WC 2WNUB 3LWCA 1S1AA 3O0XA 2O8QA 4CTEA 1S0FA 3VBRC 2D6LX 4AGVA 3WY6A 4GALA 4XOGA 1U5ZA 4D69A 2DWRA 2PA7A 5T3NA 1RUNA 3JBG1 1MACA 2ZX4A 3HR9A 1HRI2 2HWB3 2WFF1 3WR0A 4COWA 1KXGA 2R32A 1R1A2 4XHXA 3ZFGC 2UURA 5T5LA 3HT2A 4Z82A 5KWRA 1BQPA 3RI8A 3JD71 4KWLA 4Q1PA 2OZ6A 5JI9A 3M4FA 4YRDA 2BYVE 2EVXA 4GB31 1MQTB 2VMIA 1Q56A 2FMYA 3LKJA 3DF0A 2A6YA 2PHTA 1IKQA 2HWC3 5KC6A 4ORFA 2CGOA 4JCKA 4L2NA 1OQEA 3ZXFA 4R9BA 4I0AA 4Q29A 1CAUB 4AXOA 1EPWA 1VBC3 3ZSEA 4FQ4A 1QJX3 1GYKA 5I0SA 1AYM2 1PO22 3T1LA 3NV1A 1TNRA 5DUXA 2EALA 2ZAAA 4P9IA 3KCXA 4AVTA 1BJQA 5DZEA 1EAH3 5L73A 1EY2A 1MEC3 1W6QA 5ACA3 1DQ6A 1NLRA 1QJY2 4PDWC 1AR62 5I91A 1IOAA 4LULA 1QNYA 3AKPA 4FPLA 2B9UA 3MIFA 4Y20B 3B02A 3HIFA 4GB32 5JOXA 4KU8A 3ASIA 3RMXA 2KM2A 2QZ3A 2XJPA 5FAXA 1Z7S3 1AR61 3VKMA 5I8YA 2P37A 1TEIA 2JX9A 1IS6A 1XRUA 3GBFA 1C4RA 4LHNA 4M0NA 4QXKA 4AEDC 5LK7B 3O7OA 3LSEA 4O9GA 4YG6A 1QMJA 1JOJA 5DZGA 4CEYA 5KXEA 4HKWA 4NOTA 3IWZA 3I54A 1FMD1 4MZUA 2ZHMA 3AX4A 1R1A3 4YNIA 3GHMA 1NQDA 1VRH1 3AMPA 3LA7A 5BNOC 4FT8A 2A71A 1LJ7A 2D6PA 1CAXA 4KU7A 4EWAA 2BTVC 4L8QA 1F5FA 2E7QA 3S30A 4BMBA 2RR11 4AQSA 5FDBA 4YM2A 3PLQA 1VBD1 2QQPA 1H1IA 4Q4W1 3TN93 3H1WA 2XL7A 2X53S 1D4M1 1QXPA 2HWE2 1QF3A 5FCCA 1MZEA 4RR3C 4CP1A 2YY1A 3ZYIB 2B39A 1YFWA 2XB6C 4XIKA 1U5IA 3AKTA 4JV4A 4BM8A 1MZ5A 3AZZA 1QGLA 2RHPA 1QJX1 5D8AB 2A6VA 1V6LA 4LBMA 2R071 4Q27A 2PHXA 5H9RA 4LBNA 3ZSJA 1UIJA 4N7IA 1BKZA 3M3CA 2A3YA 1VBD2 2NQYA 1AR63 2RMU3 5JVVA 4Y24A 1NCQB 3D6EA 1BMV2 4TWTA 3EBRA 1BYHA 4YW2A 1PHMA 3VBOB 3ES4A 1IKPA 1OHFA 4LA2A 3DN7A 3S6PA 2GNMA 2IXHA 3IPVB 1CAVB 3TWIA 4DZGA 5BUVA 2VGDA 1BBT3 1RJ8A 2ZGRA 1WLCA 1LB2A 5F6KA 3SHRA 4HFSA 5T52A 2DVAA 1U12A 1UKRA 1RHI1 1RUC1 2XVLA 1ULCA 3VL8A 1E57A 4FPOB 4ONUA 3ZPYA 4IV1A 2GMMA 2DCTA 3VHNA 4RHV2 1IGOA 1LEDA 1ZZ9A 1OOPA 4RR3B 4XJ9A 4K20A 4TLFA 1LR5A 1U5YA 3WD5A 3QLQA 5C9AC 5AC92 2QFEA 5C9AB 2VPVA 3INAA 4Y4YA 2R072 3SH4A 1D4M3 1ZBA2 1FV3A 1K5MA 2RS51 4Q0PA 4OLLA 2ZX2A 4RQPC 3MIHA 2DFCA 2GNDA 4K6BA 1KDKA 2W39A 5J98B 3P3NA 1KJRA 2E6VA 2EF6A 4C91A 2EXKA 4LO8A 2WLPA 4FAGA 2QDNA 1ZBE1 2LUWA 3APBA 4W6YA 2MEV1 4GMP1 4Q4V3 5E16A 1C3HA 2DVGA 1NE6A 2ZS6B 1WMFA 1R081 5B2GB 1AR83 4XQ4A 4XDQA 2JJ6A 4WM8B 3UKTA 2PFWA 1SCRA 3POYA 4NWVA 4K1ZA 3BOPA 4OULA 4AI0A 3NKTA 1DQ5A 1RITA 4ZXKA 1GNHA 4ZU4A 4HN1A 4CDUC 2WA4A 4CDQA 2GC2A 2WQ4A 1EV11 3KT4A 1UD1A 3UK9A 5IK8A 4RD7A 4HSJA 1LRHA 3N7MA 2BPA2 1AXZA 3O0VA 3VKNA 4HN0A 1M4WA 1NZCA 4AFDA 2WNVB 2ZHLA 2BUKA 2PHFA 4AI1A 5H9QA 3VBSC 4FPCA 3RDIA 3GF6A 5L36A 1I3HA 2VVEA 5GZCA 3QACA 2WFPA 1YI9A 2OUJA 1LEMA 3HD8B 2BWCA 1NA1B 3ZFFA 5IUQA 1RUJ3 1MVEA 1O4YA 3I7DA 4FPEA 3THTA 4QT6A 4XFHA 1NY71 3HQXA 5FLHA 2BVVA 5FQ0B 1MS5A 3VBFC 2Q5TA 1S0JA 1QJU1 2OIIA 2LALA 3VBOC 2JD4A 4DY5A 1MS0A 3DGTA 1K5MB 4IEYA 1GANA 1WW5A 2VVDA 4QGNA 1WCSA 4PQ9A 3AMHA 4KWJA 5CIRA 1YYNA 4LBLA 5GM0A 1LOFC 3B9CA 3WHUA 4PLMA 5IT6A 4CEYB 2GMEA 1VBA3 2VMGA 4AFCA 1KFXL 1TME3 3AP4A 3CJIC 4M3CB 3WHTA 5K0UB 2X5IA 4YW4A 3AP9A 5EJ3A 4YSFA 2FBEA 1H8VA 2H6CA 1QQP1 4XFCA 1V6NA 3M8LA 5DG2A 5JIAA 1C57A 2A6WA 4EN9B 2ZHNA 4XILA 1N1TA 4GA9A 1JUHA 1AR81 2A6ZA 2GZWA 2V09A 1B35A 4LE3A 2NP0A 4E2SA 1QOOA 4TYSA 4N53B 2R0FA 4IERA 2E7TA 1I5ZA 3PVEA 1CR7A 2PAKA 5FMOL 4XYXA 1DGWX 1CQ9A 1PK6B 1AR92 1NE4A 4K1YA 1O7FA 1H2KA 1UL9A 1XXNA 5JIUA 1DGRA 4XBLA 1HIXA 2ZOEB 5KHJA 1GR3A 1W6NA 1RL3A 4RGGA 4YFWA 4P9XA 1HQLA 1PIV1 3MW3A 3RZZA 1PM7A 3FLPA 3RG0A 4Q8LA 5HXVA 2TUNA 1AZDA 4LO4B 3RQ0A 4Q4Y3 1ENSA 3LGRA 4J1WA 4Q0QA 1V00A 1MS8A 4LO6B 1NQJA 1GV9A 3WG3A 2AR6A 3JD72 1KDMA 1YNAA 2DCKA 5IK4A 2GDFA