1QKQA

Charcot-leyden crystal protein - mannose complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
SLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective Recognition of Mannose by the Human Eosinophil Charcot-Leyden Crystal Protein (Galectin-10): A Crystallographic Study at 1.8 A Resolution
pubmed rcsb
molecule tags Hydrolase
molecule keywords EOSINOPHIL LYSOPHOSPHOLIPASE
total genus 34
structure length 141
sequence length 141
ec nomenclature ec 3.1.1.5: Lysophospholipase.
pdb deposition date 1999-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qkqA00
4FOWA 1HLCA 5H9SA 4LBQA 5L73A 2GMMA 4FPEA 3QLQA 3OGGA 1S0DA 4Y1XA 3N7LA 1V6MA 4FPOB 2ZGUA 3IKWA 3WUCA 1HQLA 1YO8A 4Q8LA 3RMYA 2DWRA 3APBA 3USUB 1UMZA 1SBFA 3AZZA 5E89A 3CNAA 3AP6A 3UJOA 4I30A 2EXHA 1LENA 3WDTA 2A3WA 2DURA 4LBKA 1S0JA 3GNEA 3MPPG 3WDWA 4F83A 2JJ6A 2BQPA 1MS4A 2R49A 4JC1A 3POYA 3WUDA 2ERFA 3NV3A 3M1HA 4AGVA 4K20A 2D6MA 1JHNA 1CJPA 1LOCA 4K21A 5JVVA 3RS6A 3H0OA 3WV6A 4BMBA 1QNWA 3FUQA 4FVVA 1BZWA 4Q1PA 4XJAA 4BQ1A 1PZ8A 4XOGA 5CBLA 2VY0A 5JLVA 1F31A 5GLZA 4Y24A 5EYYA 3PVEA 2HYKA 4P14A 1LJ7A 1S0GA 2PHXA 3MW4A 1JOJA 2FHRA 3R4SA 2ZAAA 3M2MA 2P37A 3ZXEA 2ZMNA 5KXDA 1GLHA 2E7QA 4AYUA 2VXRA 1PZ7A 2ZA9A 2SBAA 5FRAA 3FLPA 3A0NA 1Q8PA 2NYYA 1V6IA 1IS4A 1JYCA 1HKDA 3B69A 3M3EA 2AR6A 3OBRA 4L8QA 5T5PA 5DUXA 3ZPYA 1R1ZA 4YW1A 1MR5A 1ONAA 3UL2A 2GALA 2DVAA 4YZ4A 1GZ9A 1WW4A 4PBOA 4XHBA 1GYKA 1QGLA 1SCSA 1LOBA 3M3QA 2GN3A 4DQAA 3AYDA 2CNAA 4FPKA 1FNYA 1A8DA 1LEDA 3R05A 4XTPA 2YROA 4XJUA 2P34A 1A78A 1LGNA 3WG3A 2ZABA 1KQRA 4XDQA 3HMYA 1YYNA 2A6WA 1C1LA 2PHTA 1V6OA 1S0CA 2ZACA 2H0BA 1ZA4A 3BTAA 4YFWA 5IK4A 1QOOA 2EF6A 3AZWA 2GMEA 3AJZA 2KM2A 2WT0A 3FBYA 2R0FA 1LHUA 1S0FA 1QOSA 1QOTA 2NN8A 1SCRA 3ZYRA 5DUVA 1GNZA 2AH2A 1G86A 4XILA 4D69A 4ISQA 1Q8VA 3B00A 3C2UA 3OBTA 4GWMA 3VKNA 5H9RA 5T52A 2XB6C 2UWCA 2LALA 1VIWB 4XZPA 3SLIA 2D7FA 3BOPA 1DZQA 1UN1A 2VU9A 4LBQD 2CWMA 3B9CA 1LHVA 3WVJA 1J1TA 4UW4A 2WKKA 3N3HA 3AZXA 1DQ0A 2NM1A 1NLSA 3PMEA 1IS3A 1V6NA 3V64A 4K1ZA 2NP0A 4R9BA 1C57A 1YI7A 1GSLA 1N1YA 2ZGMA 4XXPA 4GALA 4YM2A 1AJKA 4FQ4A 3UJQA 4IQPA 1KDKA 2AYHA 4YW2A 4AGRA 1WW6A 1S0EA 3IM0A 3BIWE 4PCRA 1W6PB 4GXLA 3WDUA 1HQWA 3D6EA 2CYFA 1LEMA 1Z0HA 1AX0A 1GV9A 1GZWB 1G8WA 5DZEA 2ZGTA 4YGCA 4FPLA 4M3CA 1OKQA 1TEIA 4YGDA 3OPZA 3VKOA 2DUPA 5EYXA 5EXOA 5CB7A 4AWDA 5KXBA 4XJ8A 1UZZA 1N47A 3OYWA 1WLDA 5IUQA 3SH4A 4AVTA 3ATGA 3USUA 4UW5A 1G9CA 1QNYA 4YLZA 4MYEA 1FNZA 2P3JA 1MS8A 3JU9A 5GM0A 2A3XA 2WJSA 4XBNA 4FOYA 4FOQA 1DQ6A 2Z42A 2AUYA 5F9TA 1W0PA 1ULDA 2EALA 2W68A 3ASIA 4PBPA 3T1MA 2DVFA 3AX4A 3FUOA 1LHNA 2DVDA 5DUUA 4JCKA 4YM0A 2JECA 3UK9A 1CPNA 4XJWA 1V00A 1Y7BA 2D6KA 2FMDA 2GNDA 2WLQA 3AP4A 1DIWA 3ZSLA 2B7YA 2CTVA 2OUJA 1CESA 1N1SA 4R9DA 5E8AA 4AVSA 4YM3A 1N1VA 5JOYA 3WDVA 2A71A 1MS3A 3SITA 1D0HA 1W6QA 3L2YA 1D2SA 1ENRA 2VH9A 1VALA 3HR9A 2A3YA 2DVGA 5IT6A 5CNAA 2ZKNA 4HANA 4P9WA 1DLLA 3WG1A 3WHUA 1G9BA 1XQNA 4M01A 2LTNA 1IKQA 2CY6A 2YMZA 2ZGOA 4XHXA 1I1EA 4P9YA 1AX2A 1QDOA 1DQ4A 2PHRA 4Y26A 2DUQA 5GLTA 2GDFA 4YW4A 4M00A 4DRRA 1G9DA 2ZBJA 3V0BB 3OYWB 5DG2A 1UPSA 1FV2A 2W39A 3AK0A 4AGGA 4Z8BA 4BLIA 1S0BA 2GNMA 2NMOA 1PZ9A 4ZXKA 1LULA 1VAMA 2A7AA 3WZ1A 3RSJA 1JW6A 5F5QA 5T54A 3ZXLA 2ZGLA 1RITA 2W08A 3FLTA 3DGTA 3PVOA 2YY1A 3O0WA 4SLIA 3ZSJA 5KXEA 3AFKA 3VUOA 3U4XA 3AP7A 3D4KA 1W6MB 2D44A 4BPZA 1V6LA 3WNXA 3TAYA 2CWSA 4FQZA 3VKLA 3O0VA 1WLWA 2CL2A 1DFQA 1JXNA 2ZHLA 3KQRA 1AX1A 2OUHA 4LBOA 4WVWA 2OVUA 1F5FA 1WCSA 2GN7A 1IKPA 1DYKA 4XIOA 3GALA 1LCLA 3IN9A 1CN1A 3ZSMA 4FPFA 4ITCA 1GKBA 4XTMA 4ZKTB 1UZYA 2ZHKA 3AYEA 1GBGA 3WHTA 1Q8QA 1N1TA 5GZCA 1V6JA 3LSEA 3IPVB 2A70A 3OY8B 4Y20A 4PQ9A 1LHWA 5T5LA 5T5JA 1A3KA 2P3IA 2WSVA 4RA0A 5JOWA 4ATFA 4FPCA 3T1LA 1MZ6A 1JN2P 2UWAA 3B3QE 4WV8A 1WD3A 3WG2A 1S0IA 3SISA 1APNA 3AXDA 1BJQA 5GALA 1FATA 1W6NA 1SLAA 3OJBA 4WVVA 5CA6A 5GJ6A 5GLUA 4BLJA 1ENQA 5IK5A 5HCFA 2E7TA 1LECA 3SH5A 1LESA 3IMNA 4WZFA 1Q56A 2PELA 2UWBA 4LBJA 5GZGA 2ZZJA 3TB0A 1URXA 2W52A 2VW2A 1W6QB 3NV4A 2D6NA 2WQZC 4Y1UA 1KRIA 2D6LX 3RG0A 1V6KA 2A6XA 2EXIA 3VV1A 2R1BA 2ZHMA 1SLCA 1C4RA 3B01A 2YZ4A 3WDYA 3POSA 1W0OA 2DVBA 2DUOA 1ULEA 1AXKA 4Q8KA 3RRDA 3V0BA 3A0KA 1WBLA 4P9XA 3D5OA 4GKXA 1LOAA 5AVAA 3NV2A 4Q2FA 3I8TA 5GLWA 4C1XA 1QU0A 1O4ZA 1WW7A 2DV9A 2ZMKA 4LBNA 2A6YA 1IS6A 4XJZA 5GZFA 1VAVA 1I3HA 1JBCA 4Y20B 3JUUA 2ARBA 2C5DA 4CTEA 4DS0A 4DRVA 5GLVA 2ZMLA 2D43A 1N3PA 5KXCA 1W6OA 3O12A 2VW0A 2YXSA 1W6MA 1S1AA 4W65A 2AENA 4UW6A 4DPNA 1X50A 4YG3A 3N7MA 3AP9A 4FOVA 3LSDA 1CONA 4Y1YA 1SLTA 1CIWA 3AYCA 4FPGA 4K1YA 4FP2A 2WSUA 2ARXA 1LHOA 4XIKA 2GMPA 1SACA 1Q8OA 3O0XA 3ZSKA 2ZGQA 1SBEA 3W59A 3ZXKA 3SNMA 4Q27A 1LOFA 1Q8SA 2DU1A 4FPHA 4BMEA 4XE9A 3I4IA 3ENRA 5DG1A 3AXEA 1MS1A 2VUAA 3PVNA 2A6VA 1VLNA 1BYHA 4Y1ZA 2NMNA 1MVQA 5GZDA 4XBLA 2ZGRA 3N36A 1NXD1 2AREA 3QCWA 2EAKA 4FPYA 4YG6A 2D3SA 3BODA 3WCSA 4TZDA 4Y22A 1RINA 1G9AA 4LBMA 1KJRA 2D6OX 1HDKA 3WDXA 4OZXA 3ZXJA 2JKBA 2ZGPA 3AP5A 2E6VA 5JDBA 3POWA 5T55A 5EWSA 4YZ2A 2GNTA 5BYNA 1DYPA 3KM5A 3MEPA 3NV1A 4GA9A 4PF5A 4BM8A 3SH3A 1UKGA 1W6PA 3WLUA 3Q9OA 4NOTA 1FAYA 4YW3A 3ILRA 2PHUA 1UX6A 4R9AA 1OQ1A 1AXYA 5FREA 4XXAA 5E88A 4HL0A 1MS5A 5IK8A 4LBQB 1C1FA 2A6ZA 2V73A 5JOZA 4H55A 1DBNA 1BKZA 1FX5A 4UW3A 5H9PA 4DFSA 3WOGA 2DTWA 4GWNA 1GZWA 4GKYA 5IK7A 1QMJA 1SBDA 1ULGA 2UU8A 3LCPA 4TYSA 1JYIA 1WW5A 3ILNA 1AVBA 1CPMA 3RMXA 1DQ2A 1LOFC 2C9AA 2EXKA 3MW3A 3N7JA 4LBLA 3RQ0A 1RIRA 5JOXA 3AZVA 2A5ZA 1SLLA 2GNBA 3V65A 5CAZA 1EPWA 1LU1A 2WNEA 4C1WA 1Z78A 1CR7A 1LODA 1YRZA 2YV8A 2ZHNA 4YW5A 3ZYPA 1LOEA 4YG0A 1ENSA 1GZCA 5GZEA 1CVNA 2D6PA 2DU0A 2R0HA 4R9CA 1B09A 2JE9A 4FPJA 1MACA 1LOGA 1YXWA 2Q5TA 5SV8A 1QDCA 3WG4A 2EXJA 1U0AA 3R4UA 4YFZA 1ULCA 4ASMB 1YIFA 2D3PA 2JE7A 2PHWA 3A4UA 1FV3A 1H30A 1QF3A 2ZGSA 2OW4A 1DQ1A 2ES3A 3IPVA 3OY8A 4JRAA 4Y22B 5HCAA 4FP3A 3AZYA 3ILFA 3FLRA 3V0AA 1KDMA 3WCRA 3N35A 2EIGA 3INAA 2R16A 3VKFC 3NWKA 2P2KA 5LK5A 4BOWA 1G7YA 2UURA 1MS0A 4Q1RA 4XMAA 1CQ9A 2G4IA 5JMCA 1LU2A 1SFYA 2TEPA 3ZXFA 1AJOA 1LGCA 2I2SA 3MW2A 1SLBA 2V5YA 1IOAA 1IS5A 4U36A 5HCBA 5DXDA 4YZ1A 1DHKB 4NO4A 1G9FA 3ZVXA 1F9KA 1W6NB 2PHFA 4XJ9A 3AYAA 4M3CE 2WT2A 3DUIA 2ZGKA 1WUVA 2A75A 4CZSA 2JD4A 5DZGA 1MVEA 1MZ5A 3M3OA 4YZ3A 3T2TA 1UAIA 2WT1A 1GANA 1WLCA 3W58A 1FYUA 2D3RA 4U2AA 4Y1VA 4YGEA 3V0AB 1AZDA 1WD4A 4M3CB 2ZGNA 1QKQA 5T50A 3HN1A 2R1DA 2ENRA 2RHPA 4YM1A 1W6OB 1DGLA 3FFZA 2DYCA 2XG3A 2P3KA 2AGSA 3M3CA 1AXZA 1LGBA 1LTEA 1BQPA 1O4YA 4YZ5A 1OFSA 4CRQA 2DTYA 1WBFA 4XYXA 3O5SA 1ZM1A 4ISRA 1H9PA 1JUIA 5DZFA 1N3OA 3PJQA 1BXHA 1AF9A 1DQ5A 2E51A 1GNHA 3VKMA 4M3CF 1N3QA 4AVVA 2E53A 1KITA 4Q26A 1H9WA 4XMIA 2JDZA 2SLIA 2NZ9A 4RL7A 4YGBA 5H9QA 1UL9A 2VW1A 3AJYA 5DUWA 4ATEA 1MS9A 1ULFA 1KJLA 5T5OA 1SLIA 4XBQA 1GICA 3N7KA 4KBBA
chains in the Genus database with same CATH superfamily
1IPJA 2W91A 4MG2A 2Y6FA 3MO4A 2JENA 3QLQA 4RYDA 3OGGA 3VD3A 4XABA 5F2SA 4FPOB 1PM7A 2ZGUA 1KEXA 2HLEA 3IKWA 1QJY1 2XOMA 4OHWA 4Q8LA 3N9MA 3AVRA 2TUNA 4A3ZA 2WQ4A 1OQDA 4P08A 1W03A 4XAAA 3UJOA 4CP9A 1LENA 1EAH2 2HWE3 4LMFA 1L7QA 1L7RA 1QHDA 5C5TA 3GM8A 3SMHA 3ZX7A 1C8NA 4BK5A 1S0JA 5LY1A 3WP4A 3GNEA 1AL0G 1E5RA 3MUY1 4JVAA 4KG8A 2J1RA 2BQPA 2W1SA 2P4EA 2R49A 1NQDA 1R64A 3AMNA 5E16A 4AEMA 3WUDA 4OCTA 1I6XA 3DCQA 3M1HA 3NV3A 4CPBD 4AGVA 4K20A 2Z79A 4AI2A 3DYPA 2B9VA 1AR93 4LLFA 3LKJA 4UFJA 1LOCA 5FKBA 4IEQA 4EN8B 5C3PA 1IQAA 1QNWA 1W2UA 2R043 4Q1PA 4AAXA 1POV0 2RJ2A 4WZCA 4JGZB 1KS4A 3WNLA 4OUEA 2V4VA 4ZZ5A 1RUD2 2VY0A 4MOAA 5JLVA 3LF7A 3W20A 4COUA 5BXXA 2XPJA 5LBCA 3THPA 1OUXA 3U11A 1ST8A 2BVVA 3I3EA 3K3NA 2HYKA 4P14A 1K5JA 1OA2A 4I0BA 1S0GA 4XFFA 2PHXA 2WZR1 4C8DA 2ZAAA 2VCCA 3BVCA 4IEWA 1GLHA 1GOFA 2E7QA 4AYUA 4ARYA 4AW7A 1PZ7A 2RS11 2I45A 1UQXA 3A0NA 4KU7A 5FZFA 1V6IA 3M3EA 2KXLA 1HKDA 3MBWA 4L8QA 2AR6A 2HKXA 2G9FA 5DUXA 1I5ZA 1R1ZA 4JRLA 1ONAA 2CDPA 3VBFB 3NNMA 3ZSEA 1CAUB 4BXSV 3POFA 5JAXA 2GN3A 1MPXA 4AI3A 3TEWA 4QT6A 1LEDA 2JIJA 1W8UA 3HQUA 4NIAA 2IUWA 3K75B 1UMIA 4HMZA 4BQ4A 4XDQA 5FAXA 1PIV2 3E6DA 1WCKA 1XNCA 1C1LA 2PHTA 1S0CA 2ZACA 1VBD1 1ZBE3 4IERA 2YGLA 3AKQA 3IMMA 2GMEA 2R30A 2PAEA 3VGIA 1XU2A 4KWLA 2RM23 5FOJB 1QOTA 1SCRA 5BV6A 4XQWA 4NE9A 2DBIA 4XILA 4D69A 4ISQA 1Q8VA 3K2OA 1FI2A 3J8F1 4NN0A 1JZ6A 4KQ7A 4GWMA 2O1QA 3N9QA 2GU9A 4AFBA 3O14A 3H1WA 4P5HA 5LEJA 2YYOA 3SLIA 1DZQA 2QDNA 3HN3A 4J6GA 4LKDA 4PIZA 4JTOA 1FT9A 3B9CA 3H1MA 1IG3A 1T6BX 3JXSA 3ZYFA 4UW4A 2NM1A 4KWUA 1NLSA 3PMEA 1KXGA 1IS3A 2WFF1 3V64A 2QQVA 4XCAA 1JI6A 3IDCB 4CCEA 3K46A 1HB2A 2H6BA 1C57A 2W9XA 1YI7A 1S2BA 1GSLA 2HYXA 1ZBE1 1UYPA 5LK7B 1POV1 4DUWA 4BXFA 3C7GA 2LRPA 4EN0A 2YC4A 4CE8A 2YB7A 2HBTA 5K7PA 3IBMA 3HEIA 4AGRA 3KS7A 2YBKA 5A3UA 1OF3A 2X5IA 3D6EA 1SEFA 2PAKA 4MSVA 4RR3B 1AR61 1GV9A 5FPAA 5F5AA 1CD3G 1AYM3 1EP0A 2P6HA 2ZGTA 3K3OA 4YGCA 1OKQA 5C8CC 1TEIA 5EYXA 3RNSA 5F5CA 4XJ8A 3GCWA 3MF6A 3PMSA 3V56A 2X05A 1SPPA 3SH4A 1VR3A 2QDRA 3ATGA 3T09A 3USUA 3ZYBA 1G9CA 1DDLA 4S2HA 1MS8A 4QGNA 2VTFA 2ZX3A 2BERA 3JU9A 5E1RA 3WT3A 2WJSA 4FOYA 4LQRA 2AUYA 4B4QA 3LOIA 4WVMA 3ASIA 3ZN5A 4XCBA 5FPXA 4RSUA 4QX7A 5DDJ1 5FMBA 3T1MA 2VMGA 3ZOIA 1F4HA 4ARXA 4DIQA 1NCQA 1EAH1 4K9SA 1RMU1 5J1XA 1AR92 1RYYA 4JCKA 2J1EA 4HOOA 1CPNA 5LBFA 4XJWA 3KGLA 1Y7BA 4YWAA 1HW5A 2QQMA 4EZ4A 1QJY2 1QJEA 3AP4A 1DIWA 2E63A 2XH6A 4MGYE 4TXWA 3ZSLA 3WEZA 4C90A 4YM3A 5DAXA 5E8AA 5JOYA 1OH3A 5EZWA 1ODMA 2VPVA 1WMXA 3SEEA 4DUXA 1CX1A 5FR3A 4BB3A 5ABJC 5D21A 2W1QA 4AQ6A 1DLLA 3WG1A 2Q8DA 4JGYC 1G9BA 2JG9B 4OHVA 5CU1A 4LIUA 5FZGA 3ZFGC 2CY6A 2YMZA 2ZGOA 1NA1A 4IESA 4XUQA 4B29A 4NHMA 4IGPA 2RS33 4IUGA 1LRHA 4MHUA 4J25A 3KV9A 4K40A 5FY7A 1WKYA 4Z07A 4D6SA 3ZFFB 1FV2A 3MIBA 2XHKA 2VECA 3NKGA 3ZMNA 4BLIA 1MQTB 4BE3A 1PZ9A 1YQ2A 1VAMA 2A7AA 4PQQA 5FZ3A 4AHZA 5FLHA 3VZJA 1HQNA 2ZGLA 4E4HA 2W08A 1PGW1 1AR91 3EHKA 3O0WA 3P1IA 2JDHA 3UYJA 3PU3A 4QDRA 2WQ8A 4GJZA 4LR4A 1JYWA 4LE3A 1ZA7A 2D44A 5FZLA 2WZR2 4BPZA 1V6LA 3ITQA 5A3LA 5KR7A 3O0VA 2CL2A 3MZHA 2ZHLA 3KQRA 4W6YA 1U5YA 3IIIA 2YBSA 5FY8A 4MLOA 4XFIA 3ZR6A 1IKPA 2V72A 1DYKA 2O14A 3GALA 1BMV1 4CU8A 4HG6B 3LIGA 5AFBA 3OCPA 5F37A 1EPZA 1FMD1 3ZSMA 3GYDA 5CKMA 4FPFA 1Z7S3 4ITCA 5LWBA 4CCMA 1JODA 1QY4A 2ET7A 1GBGA 3RYKA 1PIV3 1Q8QA 2BOJA 3T2QA 4XUPA 3KCCA 2OQ6A 3IPVB 1EY2A 3LSEA 4FXGB 4PQ9A 1LHWA 2OX0A 2XL9A 1A3KA 3GJAA 5FK7A 3LFMA 3ZXDA 1X9PA 4A7KA 5CFCC 5JOWA 3BYWA 3ZFEC 5I0UA 1RUJ2 1O8SA 1ASJ3 2FQPA 2R6QA 2YC0A 3B3QE 4WV8A 1W8OA 5FJKA 5FUPA 1S0IA 1Y3TA 3SISA 3WD5A 4CP0A 4E2QA 4SBVA 1CX4A 1SLAA 3O1OA 1WCUA 2HWB3 5IK5A 5HCFA 1PK6B 1OA4A 3IMNA 1O7FA 3U78A 1YFUA 4PIYA 1OQEA 4GZ9A 5K0UA 2EIBA 5FZ8A 2VGDA 1TE1B 2D6NA 4EN6B 5JPNB 4Y33A 4Y1UA 2VUJA 2D6LX 5SV5A 3RG0A 3WW3A 2A6XA 2EXIA 1RUF2 3ES1A 4HXCA 1WMFA 4ZU5A 2B39A 2JWPA 4CXYA 3UKNA 1AXKA 4PLNA 3WF3A 4AI1A 5A7SA 4Q8KA 5BNOC 4LE4A 1RUC2 2DDUA 2XVLA 5BPXA 2QQIA 5FMOL 2J1VA 3NMBA 1LOAA 3A22A 5AVAA 3AMPA 2VNOA 2YUEA 1W9YA 1H4GA 1U12A 2C4XA 1RUI3 3I8TA 5FP8A 1QU0A 1O4ZA 2QKDA 4N53A 2DV9A 3ZIWA 4C1XA 4ZS3A 3T4HB 3FMGA 5EIYB 1IS6A 3EBRA 3N9OA 3ES4A 4C0BA 5LA1A 4URAA 3JB8A 1S4CA 5GZFA 3IDBB 3PDQA 1AYM1 3ZN4A 1JBCA 5FO7B 3SEPA 3JUUA 1W8FA 2WA3A 4I09A 3QH6A 4NHYA 4CUBA 3D0SA 4DRVA 5A3PA 3J26N 1W6OA 4PLOA 2YXSA 4XACA 1W6MA 4A3XA 4DPNA 4CUCA 4UW6A 3GF6A 1NCQC 5FPVA 5A6QA 3AP9A 2VVFA 5FLJA 2VBDA 4CU9A 4YSFA 2QQNA 2R32A 4Y4YA 3AYCA 5FPBA 4NHKA 5FYBA 2PLV2 5HV0A 1ENXA 2DCKA 4BISA 4E27A 1O5LA 3AKTA 4Q4X3 2WSUA 1J84A 5K0UB 2EIEA 3ZSKA 3VBFC 5BNNB 4AFAA 1EUTA 1SBEA 3CJIA 1BK1A 2VTXJ 3W9AA 4BWOA 3PHMA 5FJHA 1W04A 4Q4Y2 4QHZA 4QQ2A 3KCXA 4BMEA 3VZLA 3RVHA 1CZSA 3ENRA 2PLV3 3GHMA 2WN2A 4OI2A 3AXEA 2VUAA 1OH4A 2HWF3 4TSVA 1BYHA 5LATA 4NPRA 1RUH1 1PVC3 3VD7A 1K5MA 3OEBA 3FL7A 2BW8A 4E2GA 1ZBE2 4L11A 1YNAA 2VD7A 1RINA 1R092 1IHMA 1KJRA 4OZXA 1AR81 3ZXJA 2RJKA 2JKBA 2ZGPA 3ZYGA 5JXGA 3RPQA 1A8MA 1CAWA 1POQA 1NOVA 2XMLA 3AP5A 3POWA 4M0HA 4Z2WA 1MEC2 1V9U1 3I2OA 1DYPA 3MEPA 1OOPB 1YIPA 1UD1A 3NV1A 4LITA 3SH3A 4BM8A 1W6PA 3LAGA 4AI0A 3WLUA 3JBG1 4JDMA 4YVWC 2VMEA 5EFUA 3LWCA 4R9AA 5FZ9A 1AXYA 1RUG1 4X6RB 5KHJA 4L0PA 5D1IA 2HWF1 2A6ZA 2W3JA 4KWJA 2JDKA 4NWVA 4QX2A 4A6OA 2VQTA 2IXJA 2J7MA 1DBNA 1BKZA 1FX5A 5H9PA 4AK3A 3RZLA 1NQJA 3TN92 2BWAA 2DTWA 3S7EA 4UWDA 1RJ8A 1SBDA 1SFNA 1O4TA 3LCPA 4LA2A 4GWIA 2R073 1AVBA 4PHZA 2C9AA 3MGUA 1HB1A 1QQP2 3N7JA 2WYFA 4WM8C 2ZCWA 3OG2A 1GP4A 1QH6A 4N7IA 4AVBA 1SLLA 4O7XA 5CAZA 4ASKA 1EPWA 2WNEA 1J58A 3VBHA 1LODA 1YRZA 2YV8A 2ZHNA 4HSJA 4Q0UA 4YW5A 3OBZA 5A3WA 4O9EA 2VZRA 3O1PA 4YG0A 1B35B 4CDWA 1GZCA 1UY2A 2BTVC 5GZEA 4R9CA 2D6PA 3KVAA 3K4AA 3MHZA 2JE9A 1ULOA 2LUWA 2Q5TA 3LE0A 4H7MA 4DB5A 1QDCA 3BU7A 2TBVA 3R4UA 3OSDA 1PMIA 1YQCA 2JE7A 2PHWA 2W2IA 1ZZ8A 1BEV2 2ZGSA 4I01A 4RS5C 5T54A 3RWKX 3PTRB 2QQPA 4FP3A 2RR12 3CJIB 2VR4A 1CAWB 4O61A 2ARAA 4A2UA 2EIGA 3AL5A 4Q0PA 2P2KA 1PGSA 1GP6A 2UURA 5F7UA 4Q1RA 4CDUB 2MHFA 1PX4A 1OPMA 1OLRA 5JMCA 5IW0A 4FAGA 5C70A 3WQ1A 1AYN1 1GOHA 1VBC3 3KCYA 2CHHA 3HPNA 2V5YA 1IOAA 1ND3C 3K51A 4N43C 3WW2A 4YW7A 1IS5A 1C8M1 1QWRA 5DXDA 4BK4A 2C1FA 4XUNA 1VBC1 2PQQA 2Q8OA 1F9KA 4XJ9A 5FZKA 3AYAA 4LHNA 1B35A 4CDWB 2A75A 3PLQA 5DDJ2 4FFGA 4CZSA 1MVEA 5L9RA 3M3OA 5CKQA 3T2TA 4EWEA 1GQHA 3OB8A 2WRAA 2WWUA 4G3YC 3FX3A 4N53B 4LEJA 4QGLA 3W58A 2C9KA 1MQTA 1FYUA 2D3RA 3O1VA 2JDPA 1OKOA 3HN1A 2R1DA 2ENRA 2OXBA 3GZUC 5FCCA 5A7OA 1YFWA 3WF4A 4AE2A 1UU5A 3GXUA 2MPFA 4P9GA 3I2JA 3M3CA 4LLOA 3THDA 3BKZA 1OA3A 1BQPA 1SG3A 4IV1A 5LBBA 5ISLA 4XF0A 1OFSA 1HRV3 1NLQA 2DTYA 2WNUB 3CEWA 3IDEA 3HJRA 5BNOA 2OQ7A 4BU2A 1OSGA 5DZFA 4I2OA 4NAMA 3PJQA 4GULA 3FJSA 4FSJA 2JIGA 4AVVA 3UNPA 1RVF3 4Y5Z0 5FXWA 1DZTA 2NZ9A 1QQP3 1COV1 4TWTA 4YGBA 1W9FA 1XNDA 2ZEZA 3QACA 4JGYA 5A80A 5F3CA 1KJLA 1AR72 1NY71 3ZXAC 3TEYA 3S0MA 3VDCA 5C5UA 1GWKA 5ACA2 1AR83 2GMMA 1PGL1 4C1WA 2CGOA 4BQ3A 2XVGA 1F2NA 1S0DA 2QZ3A 3N7LA 1W3XA 3NNJA 4E4SA 3HAGA 3A21A 5L19A 3R6SA 1YO8A 3RMYA 3I7DA 2ZEWA 3B5LB 2CSGA 2VQ0A 3AZZA 3U1XA 1RUH3 3MIDA 5JZGA 5E89A 1NYWA 1W8TA 1XE0A 3AP6A 3KV5A 3Q8CA 4I30A 4IV3A 2EXHA 4Q4W3 2ZTNA 1YHFA 3HVDA 4P02B 5A7QA 2Y0OA 3KMHA 2JDMA 3MPPG 3WDWA 1JZ3A 1CAUA 1RHI2 4JC1A 1MS4A 3U14A 3VL8A 4META 4NR1A 2DFBA 1ASJ1 3H8XA 3POYA 4KU8A 2ERFA 4NAOA 5JI7A 5CG9A 1ZBA1 5KC5A 1NUKA 1K45A 4AQ2A 1JHNA 2WNOA 1OURA 1BHGA 5JVVA 3RS6A 3H0OA 4ZZ8A 4XJAA 3JB4C 1BZWA 3MI8A 1FPN2 4Q4V2 2RR11 1H8TB 3AKPA 3PNAA 4CEYA 5C33A 1JZ2A 1W99A 3BPSA 3VZKA 1F31A 2HBUA 3G6JB 2J1AA 3A7QA 5J7MA 1HIXA 1JH5A 1VB4A 3PVEA 4JKLA 4CSWA 3DKWA 4Z1VA 2R071 3URFA 1JS9A 4YNIA 1NCRA 2FHRA 2H6CA 5LASA 1SZBA 2P37A 2ZXQA 2ZMNA 3ZPOA 1AL23 2O0OA 3MF9A 5LCWL 2ZPXA 4RQPC 4LPLA 1Q8PA 1TZOA 2VTXA 3B69A 2QQUA 4I0WB 3USSA 1VBE1 1XPWA 3HNMA 4FBFA 4A7ZA 4BQYA 2BYVE 1ZRFA 2BV4A 4B1MA 3MV01 1WW4A 4PBOA 4EZHA 1GYKA 5I0SA 1SCSA 5DAPA 4URTA 2X5IC 2X10A 4JX0A 3R05A 3H7JA 5FP9A 2BZDA 2RM21 2VOKA 4XJUA 2W1WA 2P34A 1LGNA 2ZABA 1U5IA 3HMYA 1D4M1 3LEMA 3ZFEB 2A6WA 4BYYA 1IPKA 4KWKA 4CP1A 5FZMA 2H0BA 2ORXA 3TYJA 3M7AA 4YFWA 1TMF3 2XJPA 1QOOA 2EF6A 1JMUB 5EJZB 5FZ6A 5CFDB 2JDAA 1LHUA 1MEC1 1V9U2 1RUE3 4LO8A 4NPLA 3UV9A 5I0RA 4RS5B 1M06G 3MYXA 2AH2A 5A7WA 3B00A 4KGGA 3H50A 5F8PA 1UKRA 3C2UA 5FY0A 5CZKA 5LRSA 4UAPA 2VBBA 2XB6C 2UWCA 1UY3A 2LALA 1VIWB 2D7FA 4H7LA 5HXVA 2Y33A 2Q1ZB 2VU9A 2CWMA 4JGZC 1LHVA 5A1AA 1ALYA 4D6RA 5KC6A 1DGRA 4UFIA 3AZXA 4E4DX 1DQ0A 2IXCA 5JWPA 3HOBA 1UX7A 3TN93 3WQ7A 4B7KA 3P3PA 4R9BA 5FZHA 3ZLIA 1RGSA 4XDOA 1AYN2 5T5LA 4IEYA 5DAQA 4YVSC 4JTNA 2FDIA 2ZGMA 4AVAA 1JZ4A 4YM2A 2GC1A 1XNBA 4MXVA 4IQPA 1KDKA 2E26A 3BPZA 3DXUA 2N7GA 1GQPA 2AYHA 2W92A 3MLJA 2WWSA 3POBA 4YW2A 2XLAA 1HB3A 3IB3A 1S0EA 3LPFA 1F35A 3MIHA 1W6PB 2F4PA 1HQWA 2CYFA 2FBEA 1GZWB 1G8WA 5DZEA 4ASLA 5CG8A 1O3QA 4JQTA 4B4PA 3W5MA 2B9UA 1DP0A 4YGDA 3BUCA 2DUPA 5CB7A 2BGOA 4AWDA 5FO9B 3VHPA 5LZ6A 4R4XA 1N47A 4RGAA 3G7DA 1WLDA 5IUQA 2I74A 4GB33 4AVTA 3KT4A 4IW3A 5FXVA 1ZNPA 5JIAA 1MQTC 4YLZA 3RZGA 1FNZA 2P3JA 2AZ5A 5GM0A 1ASJ2 5JXJA 1QJZA 4HBNA 1G6NA 5I93A 4XFGA 1RUD1 5FQ0A 2Z42A 1W0PA 1ULDA 2EALA 2W68A 4XFAA 3FFQA 2DCYA 2VG9A 4COYA 2GSYA 3AX4A 3FUOA 2GH8A 3MFAA 3ZMOA 4HVRA 2WR9A 2DF7A 4JKKA 2XBO2 3QH7A 3UK9A 3VBSA 5FMCA 3ZIXA 2GNDA 2WLQA 3KWVA 5I0DA 3T0DA 2YHJA 4XF9A 4R9DA 1N1SA 4P9IA 1T2XA 4AVSA 2A71A 2WO2A 3SITA 1ZRDA 2A73B 3DEMA 3L2YA 1ENRA 2VH9A 3HR9A 4HVQA 2DVGA 3O1UA 5IT6A 4XAEA 5CNAA 1X36A 1ZBA3 3HD8B 4P9WA 1Y4WA 1Q3EA 2VE1A 4M01A 3KF3A 3KQ4B 4HK9A 3TNPB 3POEA 4YYOA 1W9TA 3MLLA 1I1EA 4P9YA 5JR7B 3ZXGA 1AX2A 2JB8A 1LKNA 2JG8C 2PHRA 2JDNA 2X29A 2FDJA 3J7MA 1GQGA 1XXNA 3NJYA 2ZBJA 4LO6B 4M00A 5ERLA 4YW4A 1ZYBA 3OYWB 1F8VA 5FZ7A 2E9QA 3OUJA 1VBA3 3MIEA 3ORJA 1IZ3A 4Z92B 4ES9A 4CDWC 1PMJX 1D0GA 2VZPA 4ZXKA 3KSCA 3UT0A 3WZ1A 1JW6A 1WCDJ 4NRQA 3WQBA 3ZXLA 5L36A 4B8EA 3MV11 2R061 4PT6A 5I8YA 1V0AA 2LW8A 1YJLA 4PDWA 4XQDA 1FMD3 4FO9A 4FFFA 2YY1A 3ZSJA 2BU9A 3WNKA 5JR2A 3E1F1 1GNYA 4NJ4A 1UCXA 4CCJA 1OOPC 5C4WC 4F7ZA 1PO22 3U4XA 3UESA 3ON7A 3D4KA 4YRDA 4IEXA 5FZAA 3WNXA 3T30A 3DYOA 3ZN6A 1GZTA 1WLWA 2HJIA 1DFQA 2MEV3 5CFDC 4YARA 4OQ8A 3CZJA 4WVWA 5EJ1B 2GN7A 2JKXA 3MIGA 5JSPA 4RHV2 1JZ7A 2WZEA 3S7IA 2VCBA 2YPDA 2WABA 2Q4SA 4N43A 1YLLA 2QUOA 4NPMA 5I0TA 5AC91 4AEJA 5GZCA 1N1TA 3J9SA 2Q8EA 3O7OA 3OEAA 4IGOA 3OY8B 1XSQA 3MPBA 5FY9A 1X9TA 2P3IA 1UNBA 1YFXA 3KGZA 3LEIA 4CUAA 1OVSA 4ZONA 2G19A 1MZ6A 2IXIA 3NO8A 2UWAA 4QQOA 3BALA 5FXZA 3H42B 2G9GA 1OI6A 3AXDA 3NW4A 3WP6A 4CEYB 4WVVA 4LUKA 3OJBA 5FDBA 5CA6A 2QVSB 5GLUA 4CU6A 1ENQA 3OUIA 4BH9A 1REFA 2UWBA 3CU7A 2JXAA 2HWB2 5ACA3 5KBFA 5L7OC 1ZRCA 1GU3A 2W52A 3RYRA 1YUDA 4EJRA 2WQZC 3VZMA 4EWAA 3R0RA 4L97A 1AL22 1KRIA 3P5BA 5C8CB 1RUF1 1W8NA 1JUHA 2ZHMA 2WS91 4XZUG 3WNOA 3C7OA 5EQUA 3N9LA 1YWKA 1OD3A 3POSA 4I02A 3VD5A 2FD8A 2DVBA 3WSOA 2DUOA 1H2LA 2FMYA 2WAOA 4I0AA 4QXBA 3ZYHA 3VBOA 1COV2 1W8ZA 2WA4A 4CDQA 1DGRN 1TNRA 4CP2A 2B42B 3D5OA 4PI2A 2Y6JA 3GBWA 4WBBA 5FZ0A 4Q2FA 1X7NA 4TLGA 5F6KA 1GFF2 1WW7A 3GZEA 4AQTA 3KHCA 3GGLA 1SQ4A 3DV8A 1YEWA 4FTEA 1L3JA 1W2AX 1WWYA 4Y20B 4JGZA 5LY2A 2C5DA 4DS0A 2WNVC 4GH4B 2ZMLA 4LNVA 4BJ0A 1VBA2 3VBOB 2VW0A 1C3HA 4W65A 3E97A 3DPRC 4CCCA 3BCWA 1BBT2 2VNVA 2JD9A 2YBPA 4YVSA 3U10A 4DEVA 3LSDA 1CAXB 5JZGC 1UXZA 4QB2A 4HFSA 1EV13 1CIWA 4FPGA 5LA0A 1PHMA 2VULA 4K1YA 1XE7A 4W4ZA 5BNPA 3VHRA 2FDFA 3MICA 2BFUS 5IAVA 2UYBA 1AHSA 3ACLA 3B9IA 3PUQA 1JU3A 3H3LA 2AACA 4EE2A 5IVBA 3QOPA 3LFIA 1KD7A 4V2VA 4AOCA 1Q8SA 2DU1A 3VDDC 4V2WA 1JYVA 4XUOA 1O3TA 4UOJA 3VDBA 2D5FA 5EJ3A 3J8F3 1O3SA 1QJU2 4QU2A 1JU4A 2VNRA 4XEZA 1P8JA 3NNGA 2A6VA 4B4RA 1VLNA 4Y1ZA 3GZTB 2RS53 3DXTA 2W87A 1J83A 4QQLA 1VRBA 3PL0A 5JSRA 3LZZA 2BNNA 3QCWA 2Q0AA 1AYN3 2ZAHA 3BODA 1RHI1 2AC1A 2VZQA 2BFUL 1G9AA 3UGGA 1SHWB 4P5YA 2F17A 3C7EA 2QTWB 5A7WB 2XR4A 5C3SA 4OYUA 1UIKA 3JD71 4WM7B 3DECA 2E6VA 3T08A 1POV3 2XKPA 5BYNA 3U0ZA 1NG0A 2Z4FA 1UKGA 4QX8A 3I2HA 3VL9A 3Q9OA 4YW3A 3ILRA 5JXHA 4IXLA 1UX6A 1O3RA 1OQ1A 5FREA 4DINB 3ZYIB 4MXWA 2PHDA 4HL0A 4K3UA 3POJA 5IK8A 1UY0A 4OLLA 1C1FA 4MV2A 4O65A 5LA2A 1C5HA 3I2KA 3S30A 4H55A 4GQ7A 4ZPIA 4D3WA 4CCOA 4DFSA 1AYM2 3IDAA 5L7OB 4GWNA 5IK7A 1QMJA 3OTFA 4TYSA 4OI1A 1WW5A 3ILNA 3Q8FA 1CPMA 1DQ2A 1LOFC 3RQ0A 3LB9A 4BIFA 2BVBA 3ZM8A 5GKAC 2GNBA 3SCFA 4RHV3 5IVCA 2TNFA 5FP4A 5C3OA 4FTBA 3ZYPA 5CIRA 3S6PA 4F3JA 4E8DA 2DU0A 2VMIA 5FUIA 2VQAA 3I59B 3PUAA 1MACA 1YXWA 4CVUA 3WG4A 3H1YA 3KT1A 1ULCA 4LKEA 4OVEA 1Y9QA 3WXPA 5A6YA 1TME2 1H30A 1US2A 1RUI1 4Y22B 2OW4A 1DQ1A 4BZ4A 2W1UA 2UY8A 2VOWA 3OOXA 3UETA 5K0UC 4KI5M 1W2TA 1YFYA 3CZUA 1K5MB 4XURA 3SHRA 5C71A 1KDMA 2Q1FA 2WNVB 3N35A 4GH4C 5DN2A 2IXLA 3V0AA 3INAA 4CPBA 3NWKA 5LK5A 4MH0E 1UYXA 2R042 3UKVA 3BOWA 4XMAA 1J3QA 1ACCA 4QXKA 2QFEA 5CISA 3VZOA 1F5JA 3VBFA 3ZXFA 4Q4V1 3VBOC 5C9AB 1SLBA 3LOBA 1CZVA 1C8M3 2F6BA 4H3WA 1E57A 5HCBA 5J36A 2RJLA 4RR3C 3O1TA 2F4LA 3T2OA 1W6NB 4LKSA 1W9SA 5BNOB 3FWEA 3NAPC 1UO9A 1FMD2 5DZGA 4KH9A 2WT1A 1BK0A 4WM7A 5J96B 2QQLA 1CAVB 3DL3A 4E2SA 1ZREA 1GMMA 4YGEA 4Y1VA 1EYBA 2Z69A 3F2ZA 5A3TA 1QKQA 2PLV1 3M4FA 4YM1A 2RHPA 1VPHA 5D8AC 4BQXA 3E5XA 2Y26A 1DGLA 4MX3A 2DCTA 5FP7A 1UWWA 4QX1A 2ZJCA 4JHZA 5A1LA 3ZKYA 3JBG3 4IEOA 5LB6A 1AXZA 1IPSA 4C0HA 5IVVA 1UOFA 5KHKA 1HXS1 1D7PM 2HWC1 4DEQA 2FCUA 1GUIA 4DO0A 4YZ5A 5FPUA 2EVXA 2WO3A 2LS6A 3B94A 3VBSC 1AR73 2OA2A 2QQJA 1UYYA 3O5SA 4ISRA 4QD2A 2HWC3 1UOBA 5FV3A 5C9AC 2BPA2 3NVCA 1XYOA 2EIDA 1HRV2 3LDRA 2GC2A 3PURA 3GJBA 1KITA 4Q26A 5BNQA 1YQ6A 2JDZA 2XKOA 1VMFA 4XMIA 1RUNA 4Y4RA 4RL7A 1UL9A 2VW1A 4IEZA 4ATEA 4AHWA 4COVA 1ULFA 1UW8A 3HBKA 5A6XA 4ONUA 1SLIA 4XBQA 2GP5A 2AEZA 4AFDA 1HLCA 3QBQA 4LBQA 4HN0A 4L9BA 1UIJA 2PA7A 5L73A 3E6CC 5IVFA 2WO1A 2OYZA 2XWBB 2ADDA 2ZEXA 3MIFA 5CYYA 4AAPA 2PN5A 3WUCA 1HQLA 2D98A 1UF2C 2DWRA 1NA1B 5TSWA 1SBFA 1H6YA 2WWJA 1SDWA 1Y9GA 3AFGA 4NHXA 1HN1A 3H7YA 4AL9A 2DURA 2NPIA 3IAQA 4QPIB 1TNFA 1RUJ1 2ARCA 1OOPA 2XHNA 3GHNA 3JQXA 4P9LA 1X82A 4WM8B 4F83A 5AVPA 1JOPA 2VM9A 3KV6A 1UU6A 4A7YA 3J7NA 3I49A 4QGMA 5CFDA 3W21A 4QM9A 3E5UA 3OPTA 5FO8B 4BMBA 4D8MA 4QXCA 5C8CA 3CJXA 3RYPA 4MZUA 4J1WA 3WQ0A 1NCQB 4BQ1A 3ACGA 1PZ8A 4XOGA 4BCUA 3BU0A 5CBLA 2RMU2 1Z7S1 4GB32 4Y24A 5EYYA 1RUF3 1O6UA 1XU1A 1W2NA 2IXKA 3ETPA 4LO5B 4RGGA 3O1RA 1E5IA 1QJU3 5A3OA 1JOJA 1UPIA 4AEDC 3ZXEA 2VZVA 4QPYA 3RJ2X 1J3RA 1YQ8A 1RXGA 2SBAA 3WF2A 5IATA 1UYZA 3FLPA 5FRAA 4AVCA 3OGVA 3OPWA 1JYCA 3K4ZA 3ZPYA 4YW1A 1MR5A 1UZVA 1ZRIA 4GH4A 3UL2A 1TMF2 2IVIB 4YZ4A 2GH2A 4XHBA 4AEKA 3EMRA 3M3QA 1ZRRA 4DQAA 3AYDA 2CNAA 4FPKA 3AMMA 4S2GA 4QM8A 2VL4A 1RUE1 2Y6LA 5A33A 3L9JT 5L9BA 1O59A 5LW9A 3ABZA 4HETA 4IE5A 4W8JA 1V6OA 2ZX2A 4KL1A 1ZA4A 1PNFA 2XJSA 3BTAA 4MGTA 5IK4A 1PVC1 3AZWA 3PTYA 3AJZA 2KM2A 2WT0A 3ZFGA 3FBYA 1V70A 1S0FA 3TN91 3HIFA 5FZEA 4DNYA 4HVOA 3ZYRA 2ZX0A 1HJGA 5DUVA 2UYAA 3JD72 3VDDB 2VZTA 4K8FA 3H3UA 2HWF2 3OBTA 4QX5A 3VKNA 2YGMA 3LQCA 5T52A 3J4UH 2WBKA 3L2HA 4QKNA 4LXLA 4WVZA 1PGL2 3BOPA 1OLMA 5G04L 5HCHA 4LBQD 4BHPA 3WVJA 2BDRA 1J1TA 3PIJA 2WKKA 4QPGC 5FYZA 1V6NA 1RUG3 3ECQA 4X8NA 1SMVA 5JSOA 3CF6E 4IV3C 2RG4A 3KV4A 2PQSA 2JE8A 3ACIA 4GALA 4D6QA 4A4AA 4FQ4A 4MUVA 3UJQA 2YU1A 2Q8CA 1RUH2 4OI4A 1UZWA 1WW6A 4Q4X1 5T3NA 5JPMB 1H0BA 4JGYB 4AG4A 1LEMA 1Z0HA 1AX0A 1RXFA 4OULA 4N9IA 2BBVA 4PF1A 2WDBA 4KMQA 3C7FA 2D40A 4XF3A 3VDDA 1UY1A 3OPZA 4CCKA 3NQHA 3OYWA 3CQOA 2K2SA 2PXJA 3GBGA 3LEKA 2PHLA 2RS13 4WM7C 4FCAA 4X6QB 5FYTA 3ROUA 2VNGA 1JYNA 4UW5A 1QNYA 2DCJA 2KD7A 4MYEA 4OMDA 1PK6C 4Q4X2 4FTSA 1PO13 3OGRA 4XBNA 4NIHA 5F6LB 4EN9B 3I59A 1HV0A 1F15A 1DQ6A 3BI3A 4XFHA 3WY6A 1J3PA 2IWGB 2C24A 4PBPA 1XNAA 2DVFA 5FYIA 1VJ2A 5HBAA 1C28A 2WYSA 1RUC3 4P00B 4YM0A 2HWD3 2J1UA 2VO5A 4PI0A 2B45X 1KGYA 2WC2A 3C7HA 2CTVA 3I2GA 1CESA 5FBJA 1H4HA 1TG7A 5IAXA 3J8F2 1N1VA 3ZDVA 2WS92 1FPN3 1W6QA 1R1A2 5AFEA 2Y0IA 1D2SA 2XDVA 4E9KA 1VALA 1ZZ6A 1C5IA 2A3YA 2W0XA 2K9ZA 2ZKNA 2NLRA 4M4RA 3WHUA 1NE4A 2HWB1 4GAZA 1JZ5A 1VBD2 1XQNA 1YCIA 3VHOA 1IKQA 3O1SA 4J1XA 4F8AA 1PIV1 4JHTA 1H2MA 3HQXA 3N9PA 3S5AA 1QDOA 5J48A 1SFPA 3V0BB 2GDFA 3I2IA 4QDQA 1G9DA 2PMWB 5EV7A 4IEVA 5DG2A 2GC3A 4NMIA 1US3A 2HWD1 4Z8BA 1S0BA 2GNMA 4AI8A 2AEYA 4OFGA 2QCSB 1DGWA 1LULA 3EQEA 1TMF1 3RSJA 5F5QA 5FPZA 2W94A 1Q43A 2HEVF 4NIGA 4SLIA 1D4M3 1SPPB 4GMP1 3VBUB 1VAKA 2WZPP 1QQP1 4GWJA 2YU2A 4C91A 2FZ1A 3DN7A 4XFCA 5FZ4A 4CDUC 5KHHA 2JG9C 2WINB 3FBMA 2CWSA 4FQZA 1W0NA 3EJKA 2E7AA 1JXNA 2GC0A 3GZAA 4A6SA 1R081 1ND3B 1WCSA 1Z7S2 2RMU1 4CDQC 1LCLA 3KHBA 3HBZA 1CN1A 2HEYF 4RD7A 4D94A 3JBG2 1JYTA 3LA3A 4R4ZA 1GKBA 4XTMA 4OHZA 3B7MA 1UZYA 2CU5A 2ZHKA 3AYEA 4AFCA 4UBHA 4CUGA 4LHLA 4UFHA 2A70A 4Y20A 1VMJA 4CEWC 1AR82 3J7LA 2WSVA 4GD4A 1K5MC 2GAUA 3DF0A 4EROA 4FPCA 3T1LA 2XLFA 3I3BA 2JEMA 2WNVA 1QJX3 3P6BA 5DPNA 1T6GC 4IETA 3WG2A 1WD3A 4R8HA 1X33A 2R041 1JTZX 1BJQA 2K46A 1FATA 1W6NA 1VBC2 1K3IA 4OUSA 5GJ6A 4BLJA 2Q1MA 2VAUA 3FZ3A 4EN7B 1LECA 4Q29A 3SH5A 3X29B 4Y5TA 1Q56A 2PELA 2O8QA 1MZEA 2WFF2 3AKSA 4LBJA 3TB0A 1URXA 3ZKUA 5A70A 1QXJA 1W6QB 2HWD2 2QQWA 4Q4Y1 2W46A 5FBZA 4QX3A 3AMQA 2E32A 2VOTA 1SLCA 1VRH2 3SCHA 1C4RA 2XUMA 1HXS3 2YZ4A 1W0OA 1E5SA 2QE3A 3LA2A 1ZX5A 1ULEA 2X09A 4CU7A 2Y64A 4H2AA 3V0BA 5EHDA 1LB2A 3WNPA 2ZEYA 3A0KA 2FCTA 5I8SA 1WBLA 3AC0A 4P9XA 4MGSA 4AHYA 1JHJA 4CDXC 3TEZA 1DU3D 4QPWA 4AF9A 3OGSA 1MZFA 3I3QA 1DCSA 4WVMB 2BGPA 2ZMKA 4AXOA 4XJZA 4ZU4A 2VMDA 1VAVA 4JZRA 1RB8G 1I3HA 4CXXA 4QPGB 5CFCA 3WNMA 3KF5A 5K8SA 1J59A 4QHBA 4CTEA 3ELNA 5GLVA 2D43A 1N3PA 5ABJB 4BQ2A 4N43B 5FP3A 3O12A 3RZZA 3MFCA 2IZWA 3U4SA 3I97A 3TBDA 1HV1A 4PDWC 2BRTA 4FOVA 3WX5A 4AI9A 1GWMA 4HK8A 4Y1YA 1SLTA 3BN6A 4K8RB 1RUC1 5JI9A 4HLTA 3MLKA 4FP2A 1VBD3 5FMDA 2J22A 2GMPA 3VBHB 1SACA 3M70A 1LR5A 3M8LA 3VBSB 1RUG2 3CL1A 3O0XA 4OQ9A 2Y6KA 2ZGQA 4LTAA 3GCXA 3W59A 3SNMA 3ZXKA 5FZIA 4Q27A 4ZHNA 1LOFA 3VHNA 4COWA 4FPHA 1GR3A 1ZZCA 3OUHA 4PDWB 1VBB3 5FPLA 2WNUA 3WINE 3I4IA 2IC1A 4LT5A 4L2NA 4NROA 2IXHA 3DYMA 4AEDB 4RGKA 4XPVA 1D2QA 1B35C 2ZX1A 3LPGA 4D7YA 1R091 4XQ4A 1MVQA 5GZDA 3THCA 1ULPA 4N53C 4G9SB 1BCXA 3BGAA 3FC0A 1NXD1 3N36A 1QXPA 2EAKA 1U5XA 2XONA 4FPYA 4B1LA 1RHI3 3WCSA 3TNQA 2JX9A 2Y60A 2XL7A 3OGJA 4XDPA 4Y22A 5F39A 2JDYA 1RL3A 1MEC3 1HDKA 4BQWA 1ND2C 3WDXA 4QQPA 3RI8A 3KT7A 2JDUA 3POIA 5JDBA 4YZ2A 1NX9A 2GNTA 2XJTA 3VBRC 3KM5A 1BEV3 1TME1 4EQVA 2FZ2A 1X8MA 1WA4A 3PVBB 1LNSA 4M4PA 5D2AA 4NOTA 2RV9A 1FAYA 1NKGA 3WW4A 1IG0A 3IWZA 4YVSB 5K4LA 1VBE3 5IWFA 4QU1A 5DMYA 3ZO0B 2OT7A 2C26A 1R082 1J1LA 2P1BA 1Y9MA 4UF0A 4A44A 1YC61 2RM22 4DXTA 5BNPB 3RZHA 2CGPA 4UW3A 2BNMA 4B7EA 5B4NA 3WOGA 4UI9L 1VRH3 4G4FA 3ZFFC 1LAJA 2W95A 1GZWA 3CJIC 3VD4A 1DYOA 3THTA 1RTVA 3RMXA 2JICA 1F4AA 2EXKA 4HPKA 5JOXA 1RIRA 2WIIB 1H1IA 1VBE2 2VOXA 4M0NA 2O8OA 1O8PA 4OHXA 3B93A 2XJRA 1LU1A 2WS93 5GLTA 1Z78A 1CR7A 3CO2A 1ODNA 1PX3A 5FZDA 3C8XA 4JV4A 1LOEA 4QQHA 4HONA 2XJQA 1QJY3 1PNGA 2XJVA 4IDZA 2Q30A 4IV1B 4DUVA 2R0HA 3KVBA 4JDOA 4LHSA 3I2DA 4MO3M 5FQ0B 4E8CA 4FPJA 3HT1A 1PVXA 1LOGA 1CAVA 4LJHA 5SV8A 4DOUA 4YFZA 1U0AA 3NJZA 1VE0A 2P5BA 1YIFA 2D3PA 5J3UA 3A4UA 1HXS2 1ZZ7A 1FV3A 2RDNA 4JRAA 4DY5A 5IFPA 2ES3A 3IPVA 3AZYA 3UGHA 3ILFA 3Q8AA 5EP9A 1COV3 3WCRA 2R16A 3VKFC 5FY1A 1CJDA 2DFCA 2VVEA 3DKQA 4BOWA 5BNPC 1MS0A 5HI0A 3T2PA 1CQ9A 2G4IA 3I54A 2PAMA 1LU2A 1SFYA 2TEPA 2ILMA 5BNNC 1AJOA 1JZ8A 1LGCA 1H1AA 1REDA 5M0TA 5DDJ3 4CCDA 3MW2A 3PJYA 2L9LA 1QEXA 5JMOA 2XWJB 5A6ZA 4UXAA 2ORZA 4IE7A 4TLFA 2VZ1A 4A42A 3J7HA 2VZOA 5FYMA 1G9FA 4CYDA 4I3GA 1GP5A 1HRI1 1OVPA 2PHFA 3ZR5A 4M3CE 5F3IA 4ES8A 3NJVA 5KHGA 2WT2A 3DUIA 2ZGKA 2ATFA 1WUVA 2X53S 4AFMA 4A41A 1MZ5A 4YZ3A 1M4WA 2VZSA 1UXXX 2D5HA 5CEHA 2QNKA 2Y8KA 4LO7A 4KGQA 4PJYA 3CKHA 1AZDA 1WD4A 2ZGNA 3T0AA 3KD4A 1NXMA 1ZVFA 3CLPA 1XYPA 3FFZA 1NY72 2R063 1AR71 4IEUA 4UFLA 5APAA 2XG3A 2P3KA 2AGSA 4QPIA 1PM4A 2FDGA 4UF0B 2XVKA 3KLSA 1VBA1 1LGBA 4BDVB 4DXRA 1LTEA 1H6XA 2Y6HA 1OC1A 1O4YA 2QZ2A 3Q8EA 4ZU7A 4XYXA 2RS51 2RS52 1XB9A 1H9PA 2MEV1 1JUIA 4AR2A 1XNKA 2WFF3 4RN5A 1N3OA 3IT8A 4FT8A 3T0BA 2E51A 3VKMA 4CEYC 4EWDA 3AKRA 3D8CA 4NUBA 1H9WA 2K0GA 2SLIA 2YFZA 3H8RA 3ACFA 2XLGA 1S2KA 3AJYA 4OI0A 5T5OA 1ND2B 1GICA 1HB4A 3NV2A 4KBBA 4FOWA 5H9SA 2ET1A 2RE9A 5A7NA 4D0QA 4FPEA 5DAWA 1WLTA 5A32B 4Y1XA 1V6MA 3P3NA 4FFIA 5AC93 3FHAA 1WGPA 5JCTA 4Q4W2 4UBGA 3APBA 3PUHA 4L92A 4Y3OA 3USUB 1UMZA 2FDHA 3CNAA 3T3YA 1GOGA 4PLMA 1R083 2VC9A 3WDTA 2A3WA 2R7EB 4GJYA 4IEPA 4MGZE 4LBKA 5FFOC 1NZCA 2HH9A 5CKNA 3I3DA 1OLME 5FY5A 4BA6A 2RS32 5C4WB 2JJ6A 3OBAA 2VUCA 1UU4A 5ANNA 1XYNA 4RFT0 4QDSA 2WNUC 2D6MA 3ZFGB 2VMHA 1RMU2 1CJPA 4QWNA 3BIEA 1XOYA 4K21A 5IJRA 3WV6A 1NE6A 3FUQA 4FVVA 1QJU1 2HEWF 2OPWA 2EA7A 4KBZA 3UKTA 3ZN6B 1BEV1 1TME3 1VB2A 2BBAA 2RS12 5GLZA 4HPKB 5LRRA 1XE8A 5L9VA 1PMHX 1W8WA 5FYUA 1LJ7A 2BJSA 4XETA 2XQRA 3MW4A 3ALQA 3R4SA 4QMAA 4UT5A 3M2MA 3RI9A 1A34A 5KXDA 4YW6A 2BOIA 5I8TA 5D8AA 2VXRA 4Q4Y3 2ZA9A 4GB31 3A23A 3VZNA 2ZX4A 4O9GA 4S2FA 1DF0A 2NYYA 1IS4A 4UFMA 3OBRA 5FLIA 5T5PA 2R062 2ETEA 2B4KA 2GALA 2UY9A 5CVRA 2DVAA 1QXRA 1D4VB 3D3AA 1GZ9A 2VCMA 3Q8BA 5B4XA 3SC7X 1QGLA 1LOBA 3GBFA 4XTPA 1FNYA 1A8DA 2Y34A 2YROA 3WW1A 4N9HA 4LHKA 5A3NA 1A78A 5BNNA 4INDA 1R1A3 1KQRA 1QJX1 2WUHA 3WG3A 4D7SA 1WCQA 5F1RA 2QBXA 1YYNA 3I3MA 1YJKA 4E4ZA 5FZCA 5FIXA 1XRUA 2KA3A 2V4AA 5HV4A 2WN3A 1W2OA 5G05L 2JB4A 2C6SA 2R0FA 4FI9A 1QOSA 2NN8A 1GNZA 1PO11 1G86A 2J42A 2DCZA 3ETQA 1W39A 3ST7A 1K42A 1HX6A 3WR0A 2WFPA 5H9RA 3E5QA 3FE5A 3SXWA 2RVAA 5DAVA 4XZPA 2IFWA 2Z5WA 1UN1A 3EB7A 3NRUA 3LDKA 4PIXA 2CV6A 4MGKE 3N3HA 2XUEA 3N9NA 4N8MA 4QHOA 5BUVA 2P3YA 4K1ZA 2OZ6A 5J98B 2NP0A 4RQPA 5FZOA 4NIIA 5C7GA 3BTYA 2FDKA 3DPRB 4NHLA 4EV0A 1XNTA 5C8WA 1CIYA 1HRI3 1N1YA 2BNOA 2BUKA 4XXPA 1AJKA 4X8PA 2E31A 4XUTA 4COZA 2RDSA 3IM0A 3BIWE 4PCRA 1VMHA 3MUZ1 1STMA 2Y6GA 4GXLA 5FYYA 3WDUA 2R072 4W6WA 5F5IA 1CAXA 4HSLA 1S2EA 5IVJA 4K7JA 4FPLA 3M3IA 4QX0A 5AC92 4M3CA 4MVTA 3PU8A 3VKOA 3FN9A 5C3QA 5EXOA 1R093 4UFKA 4BQ5A 5KXBA 1FPN1 1UZZA 5LBEA 4HZFA 3RZMA 4OZOA 3ME2A 2XQXA 1W28A 1FOD2 2YG0A 4HKLA 2C0ZA 2PFWA 2VVDA 3ZFEA 2A3XA 3IIAA 5F2WA 2QQKA 4FOQA 1H2NA 1NCRC 5FTTC 3VLBB 4AEDA 5F9TA 1REEA 4GMP3 2CAVA 1BBT1 5FZBA 4Q4V3 1FXZA 4CDQB 3LEGA 1H8TA 1CWPA 1LHNA 3AVSA 1RMU3 2DVDA 2GZWA 5DUUA 4CEWB 2JECA 3LDBA 3LD8A 4QKDA 5C3RA 1V00A 2D6KA 2P17A 1OHFA 2FMDA 3VD9A 5FKCA 2B7YA 2RMU3 2OUJA 4CA9A 1I5PA 4MGIE 3WDVA 1MS3A 1VRH1 1D0HA 1Y43B 5ACA1 4IV3B 5FMOS 1CZTA 4HANA 4JDNA 5FWJA 1JYXA 2HWE1 5FYVA 1AR63 4XC9A 2B46X 2LTNA 4CEWA 4DXZA 4V1PA 1BLZA 1D4M2 5IFTA 1ZZ9A 4XHXA 2XJUA 3LIHA 1DQ4A 4Y26A 2DUQA 3EYPA 4DRRA 4FAHA 1WMEA 4AGGA 1UPSA 2W39A 3AK0A 1JOBA 1RJ7A 5A33B 1W05A 2X8KA 1OLQA 3B02A 1RUD3 3POGA 4Q5OA 2NMOA 3H8OA 5KHIA 3NL1A 3BTXA 2VCAA 2LM3A 5D8AB 4B3NA 1RITA 4HKOA 3FLTA 2OIIA 3DGTA 3OF1A 3PVOA 5HXMA 3NNLA 5L7OA 1YQ5A 1RVF2 4TN7A 2YDEA 4Z82A 4W50A 2YFUA 3UGFA 4ET7A 5BY5A 5KXEA 3AFKA 3VUOA 4CXWA 1QH7A 3OD0A 3AP7A 4HT1T 1W6MB 1ZZBA 2YC2A 4IE0A 4QKBA 2BEOA 3TAYA 2GP3A 3VKLA 1DGWX 1AX1A 2OUHA 4LBOA 2OVUA 1F5FA 1PO23 1H2KA 2BGCA 5FYHA 4XIOA 4CP9B 4ZXEA 1OUSA 3RDIA 3IN9A 2ADEA 2WL1A 5A3MA 3H3ZA 1EUUA 5ANQA 1W9WA 4ZKTB 1AUYA 2WZR3 3WHTA 1V6JA 1EAH3 4ZY9A 3S57A 3RZKA 3RGBA 3CBNA 3LGRA 1QJFA 5T5JA 3SCGA 3VBHC 4I3PA 4RA0A 1NA1C 4ATFA 1S55A 4OHYA 2EAAA 2JG8A 2RS31 4CCNA 1JN2P 2QQOA 1PO21 2WLPA 4QB6A 5JUVA 4NIDA 5E6HA 5HPOA 1VBB1 1APNA 5GALA 2J1TA 3EXUA 3U07A 4QPGA 1OPOA 5CFCB 1RVF1 2NQYA 4AQSA 3RWNA 2E7TA 4RS5A 3JQWA 5FWEA 1LESA 1U5ZA 4WZFA 4Q4W1 1UOGA 4KG0A 4N7UA 1OFNA 5GZGA 1DLCA 2ZZJA 1HN0A 5J37A 2VW2A 2CDOA 3NV4A 5IYYA 3NJXA 4XW3A 1IQDC 3CHXA 5FYCA 4AZZA 5KWRA 1RUJ3 2DBNA 5C4WA 2BWCA 1V6KA 3SKJE 3VV1A 2R1BA 3EO6A 2OZJA 2V09A 3B01A 4EYUA 4H14A 2QJVA 2YPJA 4OUMA 2X5IB 3WDYA 1X8EA 1W8HA 2XBO3 1XSRA 3I2FA 1PO12 3R4DB 3VBRB 3HWJA 3RRDA 1ND3A 4LORA 1RUI2 4WM8A 3AL6A 1IGOA 4GKXA 5F3GA 3WP5A 4ZS2A 1FOD3 1OMIA 4LO4B 5B2GB 5GLWA 4XVHA 4QAWA 4YPJA 4NRPA 5DABA 1TQ5A 1W3VA 4LBNA 2A6YA 3CIHA 1PK6A 4XF4A 3VBUA 2ARBA 1RC6A 4UYBA 3TWIA 2RDRA 4IE6A 4LIVA 4LOTA 3TOJA 4K6BA 3ZDSA 3H8UA 1NAEA 5KXCA 4Q0QA 1OT5A 2ZS6B 3VBRA 1EV12 2BP6A 1S1AA 2KR2A 2AENA 3BB6A 1X50A 3KZ4C 1H8TC 3N7MA 4RFRB 4YG3A 5K9YA 1CONA 3NAPB 3RFRA 1BMV2 3WF1A 2VMFA 3GDBA 4Y5SA 3IZOA 1AR62 2IFRA 2ARXA 4IV1C 1LHOA 1E5HA 1W90A 2PTMA 4JKMA 4Q0VA 4XIKA 4Z2AA 5IVEA 4NRMA 1DG6A 4MADA 1Q8OA 2RDQA 1YI9A 3JCIA 4XFBA 3WNNA 1KFXL 3WF0A 1OXCA 3FHIB 4NWWA 4RQPB 5FZOB 1HRI2 3CDZB 4XE9A 1PGW2 5LA9A 4KNCA 1BVVA 5DG1A 1MS1A 5I91A 3NAPA 1KFUL 3PVNA 1OD5A 2XXZA 3PIGA 1H1MA 2G1MA 2NMNA 4R52A 3U75A 2P6CA 1VBB2 3RZJA 4DMIA 2OPKA 2ZGRA 4YG6A 2AREA 4TZDA 2D3SA 5F32A 2PYTA 3PUIA 3TRSB 3RJRA 5A32A 1VP6A 2EICA 4LBMA 2D6OX 3K4DA 3MDPA 3LA7A 3K77A 5J09A 3K48A 4FXKB 5JXIA 3H9AA 2ZZQA 2WZ8A 5T55A 5EWSA 4AHXA 2V5DA 4GA9A 4P9JA 4PF5A 4Q0SA 5A7PA 1PVC2 3DPRA 3NKTA 1HJFA 1R1A1 1DZRA 2A1XA 2D97A 2PHUA 4CDUA 1UY4A 3N4MA 2JG9A 4XXAA 5E88A 1MS5A 2VUDA 4IL7A 4LBQB 4LULA 2VZUA 1XJAA 3QD6A 3SKVA 5ABJA 2V73A 1RUE2 5C9AA 5JOZA 4DXSA 5FOBB 1TVGA 1KS5A 3HNBM 4GMP0 4HKWA 4IE4A 4GKYA 4OMCA 1ULGA 4RR3A 2UU8A 1JYIA 4LBLA 5IVYA 2CAUA 1Q5OA 1EV11 3D82A 1QIQA 2IVJA 1W06A 3MW3A 3AZVA 3JZVA 2A5ZA 2B8MA 4LUMA 4DZGA 5IHRA 3V65A 1QJX2 2J1SA 2G9ZA 4LOSA 4CDXA 4GIQA 3HQRA 4QKFA 2CGNA 5F3EA 3O1MA 2B5HA 2MEV2 3AB0A 5FXXA 1ENSA 1SDDB 4ORFA 1XBFA 1CVNA 2ID4A 1WMDA 4LA3A 5FYSA 2W5FA 1B09A 4A45A 3W5NA 4N90A 2RR13 2EXJA 1GWLA 3AMHA 4MXWB 4QPIC 5FY4A 3VN4A 4XF1A 4ASMB 1O91A 2LROA 1QF3A 3VB9A 5HCAA 3OY8A 4FFHA 4JQRA 1WZXA 1NCRB 2HWE2 3IAPA 3FLRA 2I07B 5C6CA 3PUSA 1V9U3 5FUNA 5A1FA 4W6XA 4QXHA 2ZKLA 2H0VA 3F95A 3JD73 1OF4A 3WP3A 1G7YA 4YVWA 1O5UA 4IGQA 1AL21 1L7LA 2MNGA 2Y38A 3KB5A 3AM2A 4MGQA 2VOVA 2VXJA 2E33A 2I2SA 2WAAA 2ZOEB 1BBT3 4CCLA 3E6BA 4U36A 2XBO1 3VDAA 4YZ1A 1DHKB 1NZIA 3ACHA 4NO4A 2VQUA 3ZVXA 1ZBA2 1H8VA 1XC6A 1C8M2 5JZGB 1OBNA 4LK6A 1I9RA 2JD4A 3FHQA 4QB1A 1UOJA 1UAIA 4YVWB 1GANA 3ZYJB 5JIUA 3TEXA 3D0JA 3U37A 1WLCA 3SQOA 3VBUC 2XGXA 4CDXB 4JAAA 4U2AA 4D7TA 3V0AB 4M3CB 1FOD1 5T50A 3CMGA 2W47A 2OS2A 3HNYM 1RUOA 1W6OB 1NLRA 2VMCA 2OKXA 1ND2A 1CGPA 5DQ0A 2VBPA 5EPAA 2DYCA 5FK8A 4TTGA 2D93A 3NNFA 1UZ0A 1BVP1 5CADA 3C3VA 4RHV1 4DY3A 3HT2A 2FCVA 4L99A 3BTZA 2JG8B 4MHRA 3NSTA 3OD4A 2VZ3A 4S2DA 4CRQA 1HRV1 1WBFA 4LK7A 4LKFA 1NT0A 4BIOA 1A6CA 1ZM1A 2Z2SB 3T4VA 2VJXA 1BXHA 1AF9A 1DQ5A 4NVPA 3ZFFA 1GNHA 2WO7A 4M3CF 1N3QA 2HWC2 2E53A 1WA6X 5FZ1A 5H9QA 1K12A 4HN1A 5DUWA 1MS9A 3S5QA 1UMHA 4XBLA 5LEKA 3N7KA
chains in the Genus database with same CATH topology
1IPJA 2JENA 3QLQA 3OGGA 4FPOB 1PM7A 2ZGUA 3IKWA 1QJY1 4OHWA 4Q8LA 2TUNA 2WQ4A 1OQDA 3UJOA 1LENA 1EAH2 2HWE3 1QHDA 3SMHA 3ZX7A 1C8NA 1S0JA 3WP4A 3GNEA 1AL0G 4JVAA 4KG8A 5E16A 2BQPA 2R49A 3AMNA 1NQDA 4AEMA 3WUDA 1I6XA 3NV3A 3M1HA 4AGVA 4K20A 2Z79A 4AI2A 1AR93 4LLFA 3LKJA 1LOCA 4IEQA 4EN8B 1IQAA 1QNWA 1W2UA 2R043 4Q1PA 1POV0 4WZCA 4JGZB 1KS4A 1RUD2 2VY0A 5JLVA 4COUA 5BXXA 2XPJA 3THPA 3U11A 2BVVA 2HYKA 4P14A 1OA2A 4I0BA 1S0GA 4XFFA 2PHXA 2WZR1 2ZAAA 4IEWA 1GLHA 2E7QA 4AYUA 4AW7A 1PZ7A 2RS11 2I45A 3A0NA 4KU7A 1V6IA 3M3EA 2KXLA 1HKDA 4L8QA 2AR6A 2HKXA 2G9FA 5DUXA 1I5ZA 1R1ZA 4JRLA 1ONAA 3VBFB 3ZSEA 1CAUB 5JAXA 2GN3A 4AI3A 4QT6A 1LEDA 4HMZA 4XDQA 5FAXA 1PIV2 3E6DA 1WCKA 1XNCA 1C1LA 2PHTA 1S0CA 2ZACA 1VBD1 1ZBE3 4IERA 2YGLA 3AKQA 2GMEA 2R30A 2PAEA 3VGIA 1XU2A 4KWLA 2RM23 5FOJB 1QOTA 1SCRA 5BV6A 4XQWA 4XILA 4D69A 4ISQA 1Q8VA 1FI2A 3J8F1 4NN0A 4KQ7A 4GWMA 2O1QA 2GU9A 4AFBA 3O14A 3H1WA 4P5HA 5LEJA 2YYOA 3SLIA 1DZQA 2QDNA 4J6GA 4PIZA 4JTOA 1FT9A 3B9CA 3H1MA 4UW4A 2NM1A 1NLSA 3PMEA 1KXGA 1IS3A 2WFF1 3V64A 3IDCB 2H6BA 1C57A 1YI7A 1S2BA 1GSLA 1ZBE1 5LK7B 1POV1 4EN0A 5K7PA 3IBMA 4AGRA 3KS7A 2X5IA 3D6EA 1SEFA 2PAKA 4MSVA 4RR3B 1AR61 1GV9A 1CD3G 1AYM3 1EP0A 2ZGTA 4YGCA 1OKQA 5C8CC 1TEIA 5EYXA 3RNSA 4XJ8A 3MF6A 3PMSA 3V56A 3SH4A 1VR3A 2QDRA 3ATGA 3USUA 1G9CA 1DDLA 4S2HA 1MS8A 4QGNA 2ZX3A 3JU9A 3WT3A 5E1RA 2WJSA 4FOYA 2AUYA 4B4QA 3LOIA 4WVMA 3ASIA 3ZN5A 5FPXA 4RSUA 5DDJ1 3T1MA 2VMGA 1NCQA 1EAH1 4K9SA 1RMU1 1AR92 4JCKA 1CPNA 4XJWA 3KGLA 1Y7BA 1HW5A 1QJY2 3AP4A 1DIWA 2E63A 2XH6A 4MGYE 3ZSLA 4C90A 4YM3A 5E8AA 5JOYA 5EZWA 2VPVA 5ABJC 4AQ6A 1DLLA 3WG1A 1G9BA 4JGYC 2JG9B 4OHVA 5CU1A 3ZFGC 2CY6A 2YMZA 2ZGOA 1NA1A 4IESA 4B29A 4NHMA 2RS33 1LRHA 4K40A 4Z07A 3ZFFB 1FV2A 3MIBA 2XHKA 2VECA 3NKGA 3ZMNA 4BLIA 1MQTB 4BE3A 1PZ9A 1VAMA 2A7AA 5FLHA 3VZJA 1HQNA 2ZGLA 2W08A 1PGW1 1AR91 3EHKA 3O0WA 4LR4A 4LE3A 2D44A 2WZR2 4BPZA 1V6LA 5A3LA 3O0VA 2CL2A 3MZHA 2ZHLA 3KQRA 4W6YA 1U5YA 4MLOA 4XFIA 1IKPA 1DYKA 1BMV1 3GALA 5AFBA 3OCPA 1EPZA 1FMD1 3ZSMA 3GYDA 4FPFA 1Z7S3 4ITCA 1QY4A 2ET7A 1GBGA 3RYKA 1PIV3 1Q8QA 3KCCA 3LSEA 3IPVB 1EY2A 4FXGB 5T5LA 4PQ9A 1LHWA 2XL9A 3ZXEA 1A3KA 3ZXDA 4A7KA 5CFCC 5JOWA 3ZFEC 5I0UA 1RUJ2 2FQPA 1ASJ3 2R6QA 2YC0A 3B3QE 4WV8A 3SHRA 4E2QA 1S0IA 1Y3TA 3SISA 3WD5A 4CP0A 4SBVA 1CX4A 1SLAA 2HWB3 5IK5A 5HCFA 1PK6B 1OA4A 3IMNA 1O7FA 1YFUA 4PIYA 1OQEA 5K0UA 2VGDA 1TE1B 2D6NA 4EN6B 5JPNB 4Y1UA 2VUJA 2D6LX 5SV5A 3RG0A 3WW3A 2A6XA 2EXIA 1RUF2 3ES1A 1WMFA 4ZU5A 2B39A 3UKNA 1AXKA 4PLNA 5BNOC 4AI1A 4Q8KA 4LE4A 1RUC2 2XVLA 5BPXA 5FMOL 1LOAA 5AVAA 3AMPA 2VNOA 2YUEA 1H4GA 1U12A 3I8TA 1RUI3 4C1XA 1QU0A 1O4ZA 2QKDA 4N53A 2DV9A 3ZIWA 3FMGA 1IS6A 3EBRA 3ES4A 4C0BA 3JB8A 5GZFA 3IDBB 1AYM1 3ZN4A 1JBCA 5FO7B 3JUUA 2WA3A 4I09A 3QH6A 4DRVA 3D0SA 3J26N 1W6OA 4PLOA 2YXSA 1W6MA 4A3XA 4DPNA 4UW6A 3GF6A 1NCQC 3AP9A 2VVFA 5FLJA 4YSFA 4Y4YA 2R32A 3AYCA 4NHKA 2PLV2 1ENXA 2DCKA 4E27A 1O5LA 3AKTA 4Q4X3 2WSUA 5K0UB 3ZSKA 3VBFC 5BNNB 4AFAA 1SBEA 3CJIA 3W9AA 1BK1A 4BWOA 3PHMA 4Q4Y2 4QQ2A 3KCXA 4BMEA 3VZLA 3ENRA 2PLV3 3GHMA 4OI2A 3AXEA 2VUAA 2HWF3 4TSVA 1BYHA 4NPRA 1RUH1 1PVC3 1K5MA 2BW8A 4E2GA 1ZBE2 4L11A 1YNAA 1RINA 1R092 1IHMA 1KJRA 4OZXA 1AR81 3ZXJA 2RJKA 2JKBA 2ZGPA 3ZYGA 3RPQA 1A8MA 1CAWA 3AP5A 1NOVA 4Z2WA 3POWA 4M0HA 1MEC2 1V9U1 1DYPA 3MEPA 1OOPB 1YIPA 1UD1A 3NV1A 3SH3A 4BM8A 1W6PA 3LAGA 4AI0A 3WLUA 3JBG1 4JDMA 4YVWC 5EFUA 3LWCA 4R9AA 1AXYA 1RUG1 4X6RB 5KHJA 5D1IA 2HWF1 2A6ZA 4KWJA 4NWVA 2IXJA 1DBNA 1BKZA 1FX5A 5H9PA 4AK3A 1NQJA 3TN92 2BWAA 2DTWA 3S7EA 1RJ8A 1SBDA 1SFNA 1O4TA 3LCPA 4LA2A 2R073 1AVBA 2C9AA 3MGUA 1QQP2 3N7JA 4WM8C 2ZCWA 4AVBA 1QH6A 4N7IA 1SLLA 5CAZA 1EPWA 2WNEA 1J58A 3VBHA 1LODA 1YRZA 2YV8A 2ZHNA 4HSJA 4Q0UA 4YW5A 4C1WA 4O9EA 4YG0A 1B35B 4CDWA 1GZCA 2BTVC 5GZEA 4R9CA 2D6PA 2JE9A 2LUWA 2Q5TA 4H7MA 4DB5A 1QDCA 3BU7A 2TBVA 3R4UA 1PMIA 2JE7A 2PHWA 4I01A 1ZZ8A 1BEV2 2ZGSA 4RS5C 5T54A 2QQPA 4FP3A 2RR12 3CJIB 1CAWB 4A2UA 2EIGA 4Q0PA 2P2KA 1PGSA 2UURA 4Q1RA 4CDUB 2MHFA 1OPMA 1OLRA 5JMCA 4FAGA 3WQ1A 1AYN1 1VBC3 3KCYA 4N43C 2V5YA 1IOAA 1ND3C 3K51A 3WW2A 1IS5A 1C8M1 1QWRA 5DXDA 2C1FA 2Q8OA 1VBC1 2PQQA 1F9KA 4XJ9A 3AYAA 4LHNA 1B35A 4CDWB 2A75A 3PLQA 5DDJ2 4CZSA 1MVEA 3M3OA 3T2TA 4EWEA 1GQHA 4G3YC 3FX3A 4N53B 4LEJA 4QGLA 3W58A 1MQTA 1FYUA 2D3RA 3HN1A 2R1DA 2ENRA 3GZUC 5FCCA 1YFWA 4AE2A 1UU5A 2MPFA 4P9GA 3M3CA 4LLOA 1OA3A 1BQPA 4IV1A 4XF0A 1OFSA 1HRV3 2DTYA 2WNUB 3CEWA 3IDEA 5BNOA 1OSGA 5DZFA 4I2OA 3PJQA 4GULA 3FJSA 4FSJA 4AVVA 1RVF3 4Y5Z0 1DZTA 2NZ9A 1QQP3 1COV1 4TWTA 4YGBA 1XNDA 3QACA 4JGYA 1KJLA 1AR72 1NY71 3ZXAC 3S0MA 5ACA2 1AR83 2GMMA 1PGL1 2CGOA 2XVGA 1F2NA 1S0DA 2QZ3A 3N7LA 4E4SA 3HAGA 5L19A 3R6SA 1YO8A 3RMYA 3I7DA 3B5LB 2VQ0A 3AZZA 5JZGA 1RUH3 3MIDA 5E89A 1NYWA 3AP6A 4I30A 4IV3A 2EXHA 4Q4W3 2ZTNA 1YHFA 2Y0OA 3KMHA 3MPPG 3WDWA 1CAUA 1RHI2 4JC1A 1MS4A 3VL8A 4META 4NR1A 2DFBA 1ASJ1 3POYA 4KU8A 2ERFA 5JI7A 5CG9A 1ZBA1 5KC5A 4AQ2A 1JHNA 5JVVA 3RS6A 3H0OA 4XJAA 3JB4C 1BZWA 3MI8A 1FPN2 4Q4V2 2RR11 1H8TB 3AKPA 3PNAA 4CEYA 5C33A 3VZKA 1F31A 3G6JB 5J7MA 1HIXA 1JH5A 1VB4A 3PVEA 3DKWA 4Z1VA 2R071 3URFA 4YNIA 1NCRA 2FHRA 2H6CA 2P37A 2ZMNA 1AL23 2O0OA 3MF9A 2ZPXA 4RQPC 1Q8PA 3B69A 4I0WB 3USSA 1VBE1 4FBFA 4A7ZA 2BYVE 1ZRFA 1WW4A 4PBOA 1GYKA 5I0SA 1SCSA 4URTA 2X5IC 3R05A 3H7JA 2RM21 2VOKA 4XJUA 2P34A 1LGNA 2ZABA 1U5IA 3HMYA 1D4M1 3ZFEB 2A6WA 4BYYA 1IPKA 4KWKA 4CP1A 2H0BA 3TYJA 3M7AA 4YFWA 1TMF3 2XJPA 1QOOA 2EF6A 5CFDB 1LHUA 1MEC1 1V9U2 1RUE3 4LO8A 3UV9A 5I0RA 4RS5B 1M06G 3MYXA 2AH2A 3B00A 4KGGA 3H50A 1UKRA 3C2UA 5LRSA 2XB6C 2UWCA 2LALA 1VIWB 2D7FA 4H7LA 5HXVA 2Q1ZB 2VU9A 2CWMA 4JGZC 1LHVA 5KC6A 1ALYA 1DGRA 4E4DX 3AZXA 1DQ0A 2IXCA 5JWPA 4B7KA 3TN93 3WQ7A 3P3PA 4R9BA 1RGSA 1AYN2 4IEYA 4YVSC 4JTNA 2ZGMA 4AVAA 4YM2A 2GC1A 1XNBA 4MXVA 4IQPA 1KDKA 3BPZA 2N7GA 2AYHA 3MLJA 4YW2A 2WWSA 2XLAA 1S0EA 3MIHA 1W6PB 2F4PA 1HQWA 2CYFA 2FBEA 1GZWB 1G8WA 5DZEA 4ASLA 5CG8A 1O3QA 4B4PA 2B9UA 4YGDA 2DUPA 5CB7A 4AWDA 5FO9B 3VHPA 4R4XA 1N47A 4RGAA 3G7DA 1WLDA 5IUQA 2I74A 4GB33 4AVTA 3KT4A 1ZNPA 5JIAA 1MQTC 4YLZA 1FNZA 2P3JA 2AZ5A 5GM0A 1ASJ2 1QJZA 4HBNA 1G6NA 5I93A 4XFGA 1RUD1 5FQ0A 2Z42A 1W0PA 1ULDA 2EALA 2W68A 4XFAA 3FFQA 2DCYA 2VG9A 4COYA 2GSYA 3AX4A 3FUOA 2GH8A 3MFAA 3ZMOA 4HVRA 2DF7A 2XBO2 3QH7A 3UK9A 3VBSA 3ZIXA 2GNDA 2WLQA 2YHJA 4XF9A 4R9DA 1N1SA 4P9IA 4AVSA 2A71A 1ZRDA 3SITA 2A73B 3L2YA 1ENRA 2VH9A 3HR9A 4HVQA 2DVGA 5IT6A 5CNAA 1X36A 1ZBA3 3HD8B 4P9WA 1Q3EA 4M01A 4HK9A 3TNPB 4YYOA 3MLLA 1I1EA 4P9YA 5JR7B 3ZXGA 1AX2A 2JG8C 1LKNA 2PHRA 2X29A 5GLTA 4AHZA 4YW4A 1GQGA 1XXNA 4M00A 2ZBJA 4LO6B 1ZYBA 3OYWB 1F8VA 2E9QA 1VBA3 3MIEA 1IZ3A 4Z92B 4ES9A 4CDWC 1D0GA 4ZXKA 3WZ1A 3KSCA 3ZXLA 1JW6A 1WCDJ 5L36A 4B8EA 2R061 5I8YA 1YJLA 4PDWA 4XQDA 1FMD3 4FO9A 2YY1A 3ZSJA 1UCXA 1OOPC 5C4WC 4F7ZA 1PO22 3U4XA 4YRDA 3D4KA 4IEXA 3WNXA 3ZN6A 1WLWA 2HJIA 1DFQA 2MEV3 5CFDC 4YARA 4WVWA 2GN7A 3MIGA 5JSPA 4RHV2 3S7IA 2Q4SA 4N43A 1YLLA 2QUOA 5I0TA 5AC91 4AEJA 5GZCA 1N1TA 3J9SA 3O7OA 3OY8B 3MPBA 2P3IA 1YFXA 3KGZA 1MZ6A 2IXIA 3NO8A 2UWAA 4QQOA 3BALA 2G9GA 1OI6A 3AXDA 3NW4A 3WP6A 4CEYB 4WVVA 4LUKA 3OJBA 5FDBA 5CA6A 2QVSB 5GLUA 1ENQA 4BH9A 1REFA 2UWBA 3CU7A 2JXAA 2HWB2 5ACA3 5KBFA 5L7OC 1ZRCA 2W52A 3RYRA 1YUDA 4EJRA 2WQZC 3VZMA 4EWAA 3R0RA 4L97A 1AL22 1KRIA 5C8CB 1RUF1 2ZHMA 1JUHA 2WS91 4I02A 1YWKA 3POSA 2DVBA 2DUOA 1H2LA 2FMYA 4I0AA 3VBOA 1COV2 2WA4A 4CDQA 1DGRN 1TNRA 4CP2A 2B42B 3D5OA 4WBBA 3GBWA 4Q2FA 1X7NA 5F6KA 1GFF2 1WW7A 4AQTA 1SQ4A 3DV8A 4FTEA 1L3JA 4Y20B 4JGZA 2C5DA 4DS0A 2WNVC 4GH4B 2ZMLA 4LNVA 1VBA2 3VBOB 2VW0A 1C3HA 4W65A 3E97A 3DPRC 3BCWA 1BBT2 4YVSA 3U10A 3LSDA 1CAXB 5JZGC 4HFSA 1EV13 1CIWA 4FPGA 1PHMA 2VULA 4K1YA 1XE7A 5BNPA 3VHRA 3MICA 2BFUS 2UYBA 1AHSA 3ACLA 3B9IA 3QOPA 1KD7A 1Q8SA 2DU1A