1QL8A

Factor xa specific inhibitor in complex with bovine trypsin
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Ph-Dependent Binding Modes Observed in Trypsin Crystals: Lessons for the Structure-Based Drug Design
pubmed doi rcsb
molecule tags Serine protease
total genus 47
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ql8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ql8A02
2ZHEH 1GHBG 1MD8A 4I32A 1C4V2 4O3UA 1P12E 4J1YA 1EAXA 1O2LA 1ZHMA 5FCKA 1P2OA 2F9NA 3P8FA 3K9XB 1D6WA 1H4WA 2GZ9A 1CQQA 3QN7A 4B74A 1EKBB 4ABGA 3E16B 1CHOG 1UTPA 1A5HA 1P2JA 1TGNA 4D7GA 2UUYA 3F9EA 1O2JA 3ATKA 1CVWH 1QURH 3MO6A 4X2YA 1AWFH 3U8TH 3VXEH 1H9IE 1LCYA 1MBMA 1OP2A 1WU1A 4R8TB 4DJZB 2OXSA 2GCTB 3PMBB 2VJ1A 5B6OA 1RTFB 3QUMP 1GMDF 1OSSA 2CMYA 1SGTA 1XUHA 3EDXB 2AS9A 2WUCA 2PLXA 2TIOA 2FLBH 1MKWH 3MO3A 5C1UA 1IOEA 4O97A 1HJAB 2GGVB 1GCDA 2GDDA 3SV7A 2W5EA 3RXBA 3TGKE 4E06H 1MCTA 2C90B 2V3HH 3PV4A 5I25A 1TNJA 2P8OC 3Q3XA 1PPEE 1LO6A 1BT7A 4J2YB 2YNBA 1ZMNA 3B8JA 4IGDA 3BEFB 3NKKA 4ZKSU 1UTKA 3OTJE 6ESTA 3U1IB 4FU7A 1GBTA 3RM2H 4I8LA 1BTUA 1V2TT 2WPKS 2OUAA 2EI8A 3ZV8A 4X1NU 1AIXH 5HM9A 1ELVA 1BOQA 1SQOA 3SNAA 1FIWA 3A86A 2TGPZ 1FMGA 2ZU4A 4ABAA 1YP9A 4BXSA 1V2UT 4X6MA 1AZZA 2VH6A 3M7QA 1GDNA 5FCRA 1AMHA 1O3NA 1ZOMA 1PPZA 1BUIA 2WV4A 2FMJA 4MNVA 1N8OC 1TOCB 1QL7A 4BNRA 4X2VA 1F5LA 2UWPA 1WCZA 1DANH 1K1MA 1SHHB 3UQVA 2O8LA 4LZ4B 1E35B 1KLJH 7KMEH 1JMOH 1LVMA 1O33A 3TK6A 5EG4A 1AQ7A 1P03A 1O2MA 1RS0A 4LK4A 3A84A 2IPHA 4DURA 1ABIH 1UK3A 1O34A 1MU8B 1N1LA 2PTCE 5A2MH 2H2ZA 1ABJH 1C2JA 1HAIH 1EB2A 1ANBA 3SGBE 1CGJE 2SFAA 1W0YH 1VZQH 4IMQA 3U9AH 3GCHC 3SUGA 3RXPA 3ZVFA 3LGIA 4KTSA 2NWNA 1GMHF 3TH4H 4JYTA 2OCVB 1FUJA 3BTTE 3OSYA 3SV8A 2H5DA 2ZU2A 1C1MA 3EQ0H 2WINI 1QIXB 1C5VA 1CU1A 1C5NH 2CN0H 4I31A 1BITA 4H6SB 2XW9A 2PKAB 2UWOA 4UFDH 1GHWH 1TLDA 3ZYDA 1UK2A 1WUNH 1O3LA 5AVDA 1O3AA 1QQ4A 3SGAE 1TNIA 3ELAH 2VVUA 3RXJA 1Y3VA 1G36A 3MI4A 3LONA 3TH3H 1Z8JB 2NU0E 3AW1A 1P2NA 3UIRA 1IAUA 3GY4A 1EPTB 9ESTA 3SJ9A 1L1GA 1P2KA 2ZTXA 1OPHB 1LHEH 3SNCA 2CGAA 4MNWA 2VWOA 1TOMH 1TGTA 3RLWH 2H9TH 4Y8ZA 2AFQB 2AGIX 3UNSA 1P01A 1C5MD 1CO7E 1WQVH 1DS2E 3LGYA 3RXHA 1YPJH 2DE8A 3QK1A 1QGFA 3ATLA 1V2LT 4ISLA 1O2TA 1GWAA 4NSVA 4JYVH 2O9QA 3RC4A 3JZ2B 1NS3A 6CHAC 2GV7A 2TBSA 1QFKH 2VWNA 4KGAA 4NSYA 1BMNH 4BAMB 1MMJN 4H6TA 1GCTC 1C1PA 2ZU5A 2AYWA 3G01A 2Q6GA 5TCAA 1XUIA 3U69H 2ZQ2A 5A0CA 3A83A 2FZZA 1C2KA 2JETB 1C1TA 2ASUB 2FTMA 4IW4E 1HUTH 1H9LB 1AO5A 1FN8A 1C5OH 3BV9B 5EXNA 3A7YA 4UFEH 7GCHF 3S7KB 5DP8A 4FUJA 1TMTH 2KAIB 4INLA 1RIWC 2BVXH 3KF2A 4OS5A 3VXFH 1FZZA 1RJXB 1C1QA 1DE7H 1YPGH 3HKIB 2A5KA 2EI6A 3Q00A 1BMMH 3RXOA 4X1RU 2FP7B 1PQAA 1GJ8B 2F9BH 3SU2A 4UDWH 3LGWA 1A5GH 1GBHA 1ZYOA 1HPGA 7ESTE 3QX5H 1UJ1A 2OC8A 5FBEA 4OS1A 2FODA 1P04A 2QAAA 2W3KA 3GYMA 3I78A 2C4FH 2O8WA 3M5NA 3PMHB 2ZGBH 1O2QA 2OQ5A 1GBFA 3ENSB 3DD2H 4X8TH 3M7UA 3PYHA 4U01A 2P3FH 1KDQB 2UWLA 2FS9A 1TRMA 4MPXA 1O2RA 2GCTC 3CS7A 4GHQA 1C5YB 4Q7XA 2PUQH 3M37A 1BQYA 3QZQA 2ZC9H 4YO9A 1YF4A 2WUBA 1W2KH 2ODYB 1ZRBA 1NESE 1EB1H 1THPB 4OS4A 4UE7H 3GISB 2ZCHP 2R0LA 4B2CA 2ZO3H 1D6RA 1MH0A 3P95A 3T2NA 3TK9A 1PYTC 1DY9A 2P3UB 1M9UA 3A7XA 2BXUH 1GJ7B 1NM6A 1Z8GA 1ZJKA 2ANYA 1P3EA 4QT8C 2R2MB 1NRNH 3F6UH 1A1RA 2P95A 1C9PA 1HIAB 1P9UA 2A4OA 3RMOH 3SN8A 1KXBA 5FBIA 2QIQA 1ANCA 2OP9A 2ZFFH 5JPMH 1WBGB 1BCUH 4BOHA 3A7ZA 3OY6U 1TFXA 4Y6DA 4DVAU 1O3PB 2PFEA 3RXRA 1EOJA 3A8BA 4K1TA 4A7IB 3SNDA 2FOAA 3FP6E 3GDSA 1NFYA 1G3EA 3LGVA 4IMZA 4CREA 2O8MA 3KQBA 2LNCA 3M3TA 4CBOA 2BD4A 2W7UA 3PTBA 1UVTH 1L2EA 4Q2KA 3EE0B 1E0FD 1GHZA 1QB1A 1HXEH 4UONA 1C2MA 4H42U 5L2YH 4O9VA 3QGJA 4JZDH 1LVOA 3S7HB 1O3JA 2A31A 3V13A 3A7TA 1S0RA 1LHCH 1B5GH 3ZZ4A 3E91A 1Y5AT 5C1XA 1EASA 1GI5A 5DG6A 2EI7A 3ZZ9A 3D49H 2XBWA 1FNIA 1Y3YA 3K6YA 3SV2H 1AU8A 1E34B 1QB9A 3RXAA 1SFQB 3CS0A 1FAXA 4RKJB 3U98H 6GCHF 2OLGA 2R0KA 2ZQ1A 1W10U 1EZSC 2SGDE 3TGJE 4BANB 2ULLA 1GHBF 4Y8XA 4CRDA 1TE0A 3A8DA 3GY3A 2VINA 1LPZB 4Z0KA 1WV7H 2QXJA 5EW2H 4ZMAH 2VIOA 3ODDA 1CHOF 2C8XB 1SGPE 1MAYA 2AIQA 2EA3A 3UR9A 4OGXA 1EPTA 5JDUB 2VGCB 1O2HA 4WMDA 1IQFA 1TGCA 3VB7A 2JH6D 4Y79A 3ZZ5A 1RXPA 2ZHDA 3T62A 2OBQA 4NZLA 1YLCA 1ESBA 5FX5A 1NO9H 3S69A 1HAOH 1KXDA 2GCHF 1F0TA 1CGHA 4K1SA 3PMAB 2ILNA 2XWBI 4D7FA 3SZNA 4X1SU 1PPBH 3STIA 1GBMA 3FP7E 1HAVB 2OC0A 2XC5A 3GICB 1HAHH 4JZEH 5C3NA 1SLWB 1B7XB 4Y7BA 4XOJA 2BOKA 3T5FH 3U1JB 1IQNA 1HAYB 2C8YB 1XMNB 1XKAC 3V7TA 3UPEA 2Y7XA 2C93B 1VCWA 1GVZA 2BQ7B 4O03A 2PGBB 2Y80A 1MUEB 1S84A 4FUBA 5GJ4B 1GJ4H 3M3VA 1YPKH 1QA0A 1AB9B 3DHKH 3S9CA 2AH4X 1QCPA 2FYRA 1SQAA 1V2MT 4CHAB 3NCLA 1BJUA 4KTCA 1YKTA 3LH1A 1TGBA 2KAIA 3SV6A 3E8LA 1GGDB 2AIPA 1LVYA 3ZZAA 2P94A 1AN1E 1V2ST 2JETC 2W3IA 1O37A 5PTPA 3E6PH 1OWJA 4WMEA 1C1UH 1OXGA 1ZZZA 2QA9E 2FOCA 2WPMS 2WYJA 1LHDH 2J34A 1JRSA 1K1OA 2TGAA 4HZHA 8GCHF 1C1WH 1SC8U 3JZ1B 5DP9A 3RU4D 3EGKH 3LDXH 1YCPK 4U32A 2GVFA 2NU1E 2PHBA 1INCA 2BYAX 4NFFA 5AFYH 3OY5U 3MNCA 1A3EH 4ISHH 4AORA 2BD7A 3S9AA 2GT7A 2V0BA 2ZP0H 5T6GA 1KDQA 5IDKA 3ZVCA 1ORFA 3DFJA 1O2GH 3ATMA 1IQKA 1ID5H 1SQTA 2Z9IA 1K22H 2ZFSA 1MD7A 3F9FA 2WYGA 1AUJA 3PROA 1QR3E 4AFZA 3RXDA 1VITH 1O3HA 1P8VC 2SGFE 4B2BA 2Z9GA 1BIOA 1TMBH 2OC7A 1HAPH 3SJIA 1XXDA 3M35A 4LOYH 1ELDE 2ZTYA 1P09A 3BSQA 4X2XA 2IOTA 1EZUC 3TIUA 3RMMH 1GL1A 1UVOA 2BDHA 4B76A 4ABDA 1P11E 3MHWU 1DITH 3PO1B 1HIAA 1O5CB 1TBQH 5A0BA 1ZTKA 1XX9A 1GJAB 2J38A 2VIDA 5EPYA 5L30H 1VITF 1S6HA 3E0NB 3VEQB 4OS6A 1GHVH 3SJ8A 2R2WU 1B0EA 1IQIA 1G3CA 2STAE 4U30A 3PB1E 4AX9H 4SGBE 1UCYH 1GBAA 1FPHH 4D9QA 1WYKA 1UTQA 3UWJH 4OS2A 4CH2B 4LXBH 4E7RG 1UO6A 3SU3A 2XBYA 3SU5A 3M36A 1YC0A 1O2OA 2NU4E 2FYQA 5CE1A 4WWYA 1K9OE 2V3OH 2Z3CA 4X1QU 4NIWA 3SO3A 1QTFA 2OD3B 1NY22 1ARBA 3DA9B 1MTNB 1C5PA 1KYNA 1RTLA 2WV5A 4ZROA 2HOBA 3LH3A 2Y82A 3GOVB 3KIDU 4JK5A 4Y0YE 1YPLH 1SG8B 4NWKA 1YGCH 1H8DH 2R9PA 5DPAA 2CF8H 3GY6A 1P10A 1ZMLA 4ISOA 3ZVAA 1HJ9A 3KQCA 1GJCB 3UNRA 1TX8A 2F3CE 4AGKA 1ZSKA 2UUKB 2ANWA 1C5TA 1NTPA 3P17H 4XE4A 4D9RA 3LGTA 1FQ3A 4X8UH 3P8NA 3S9BA 4Y8YA 4UFGH 5I46H 3GYLB 2A5AA 1GI4A 1NZQH 5E0GA 3TH2H 1C5SA 1CE5A 1ZTLA 1MTVA 4ASHA 1E36B 1TA6A 3MU4A 1DFPA 1C2HA 1ELFA 3QWCH 1YBWA 5DKMA 2QCYA 3GY5A 3TPIZ 4NWLA 3RXLA 3SHCH 3NWUA 1QRZA 4ZHAA 1A2CH 1KY9A 2A1DB 1W7GH 5EGMA 1RRKA 1J16A 1O2UA 1XUKA 2Y5FA 3NK8A 5ETXA 3KL6A 1SGIB 3Q3KA 4LZ1H 1JIMA 2FM2A 4ZXYH 1EXFA 3QTOH 1O36A 1O3MA 4CRFA 1AWHB 3M3SA 2ZU1A 1TQ0B 1IQGA 3SGQE 2V6NA 1Y5UT 1MAXA 2HLCA 1KLIH 1IHSH 1FLEE 2I6QA 2TRMA 3DUXH 2VGCC 3P92A 4Y10E 1QRWA 3BTFE 1RTKA 3SI3H 4AYVB 4YT6H 1HAVA 3BTQE 4JZ1A 1GHYH 1ZGIA 3LC3A 2AMQA 3BEIB 3P6ZB 1TB6H 4AG2A 1K2I1 5AHGH 2J95A 2ZU3A 1K28D 2H1UA 3HK6B 2FI3E 3BTGE 3MU1A 1O2VA 1GDQA 2Z7FE 2XNIA 1CBWC 4K69A 2K1QA 1EX3A 4ZKOU 1TABE 1EP5A 3PMJA 3O8CA 2Z94A 2J9NA 3P8OA 3RM0H 2VH0A 1S83A 2A45B 3SORA 4B73A 3TVJB 2BQ6B 2XWAA 1H9HE 3CP7A 3RXQA 1MTWA 5E0HA 5G4BA 1D3DB 2FTLE 1XUJA 3VGCB 1F92A 3MFJA 1GI8B 4KTUA 4KKDA 1BHXB 1OWEA 1MCVA 1GJ6A 2BDCA 3SUEA 1AB9C 2OINA 2ZPSA 4FUFA 5GCHF 1ELCA 4GCHG 1UTNA 4NCYA 2BY6X 4CHAC 3FP8E 4ABEA 1DWBH 1T32A 1VGCC 2A7CA 1QJ6B 5JB9S 1AGJA 2ZDMA 4FU9A 1P2IA 1GBLA 4AYYB 1AKSB 5GXPA 1TPPA 2Z3EA 3BG4C 2BTCE 1CA0B 1W3CA 1C1NA 4B75A 1W14U 3SU1A 2ZZUH 1AE5A 4JMYA 3ZZ6A 3VFEA 3P8GA 1HXFH 2RCEA 1JRTA 3U8RH 1KXAA 1O5BB 3VB3A 4Y7AA 4NIXA 3T25A 1RFNA 4FXGH 3R3GB 3BF6H 1ELTA 4BTIB 2BY9X 3RP2A 1O30A 3VB6A 2XBVA 1BJVA 1TALA 1AUTC 1MQ6A 1O2KA 3ZZDA 2SGAA 1SGCA 4K2YA 1O3EA 1IQJA 1EOLA 4MNYA 1T8MA 1LKBA 1D4PB 3BTEE 2PW8H 1GHAF 4ISIH 4DT7B 1G30B 2RDLA 3PLPA 5HYOA 3NZIA 1UTOA 2F83A 1O3OA 4RKOB 2AEIH 1V6DA 1QA7A 4JCNA 1LKAA 1ELBA 3AVZA 5CHAB 4K5ZA 5EU8A 3A80A 1L0ZA 3GDUA 2ALPA 1PQ8A 1TA2A 2B0FA 2ZG0H 4MPVA 1C1RA 2C8WB 2D8WA 1E38B 1F5RA 2ANKH 1Q3XA 3EAJA 1KSNA 1PPHE 3B23B 2F91A 1O5DH 5E8EH 3PO1C 1GMDG 1OKXA 2ZFQH 1AE8H 4INKA 2BMGB 1C2IA 1YYY1 4FU8A 3GCTG 1F7ZA 2R3YA 4ZHMU 1O31A 1OS8A 1UTLM 3RXIA 1O2IA 4YLQH 5A8ZA 2ZPRA 1G2LA 2C8ZB 3KEEA 1K1NA 5JYIA 2J94A 2ZHQH 3L6PA 4MLFB 4GLYA 3QGNB 4NA9H 3TK5A 4JZFH 3UY9A 3SBKA 1FY5A 1PPGE 2VU8E 1GJ5H 1LQEA 4IC5A 2BDBA 1CT4E 3RC6A 2HWLB 4MQAA 1OWDA 6LPRA 2BVSH 1G32B 1K1IA 5L6NH 2VIPA 4WXVA 1O5AB 3A89A 1MTNC 2ZDKA 4O3TA 1BMAA 4GUXA 3CENA 4GPGA 5DP4A 1Y59T 1O3FA 3GY2A 4NZQA 1FONA 1SOTA 1DXPA 2FXRA 1GPZA 1F0UA 1FY8E 1W8BH 2Y5HA 4X8SH 1DWCH 1YLDA 4FUCA 2G4UA 1OP0A 3RXGA 1UHBB 3UFAA 2PSYA 3O8DA 4YM9A 1GJBB 2FWWA 4DG4A 1ZRKA 4KP0A 1HJAC 1V2VT 5EXMA 1TPOA 2JH0D 2AGGX 1HAGE 1YPEH 1NRPH 5E2OA 1O0DH 1ZJDA 2FO9A 2GX4A 2B7DH 1ZLRA 2QXGA 3D65E 4H4FA 2BZAA 3QLPH 4BAOB 1C5XB 1THSH 1TONA 2IN2A 1EJNA 2Z9JA 2ZGHA 3QZRA 4YOIA 3SW2B 3SNEA 5C67A 3TGIE 1N6YA 1EZXC 1SI5H 1LTOA 1FIZA 4OGYA 1L4ZA 5E0JA 4Q80A 3PM3A 2BHGA 2D1JA 1BRCE 2BOHB 1BTHH 1GMHG 1OWKA 1AI8H 3E1XB 4K1EA 3M5OA 4YLUA 4K3JA 2AMPA 1C2EA 2ZCLP 1O3GA 3T29A 1T8OA 2ZTZA 3MH5A 1FN6A 3L33A 3SHAH 4HTCH 2SGQE 1OWHA 3R0FA 3ZZ3A 2H9EH 3GDVA 4WH6A 2W26A 4NIYA 3RXEA 4FUEA 3M5MA 5DGJA 4HI3A 3H7OA 1PQ5A 2BD5A 2Z3DA 5C20A 4WVPE 1MKXK 1TIOA 1FJSA 2QXHA 1VCPA 1EUFA 1MU6B 2WPLS 1SB1H 4CRBA 3OU0A 3VB5A 1IHTH 3EA9A 1O5EH 1MTSA 1Q31A 3LIWA 1GBIA 3RU4T 3C27B 1EAIA 3PTNA 2PKAA 1D9IA 2A4RA 1GBCA 1SLUB 1PJPA 1O32A 4GVUA 4ZUHA 4B71A 3PWCA 1BTYA 2BX3A 5A09A 4NGAH 2EEKA 2GDEH 2NU3E 5BRRE 3TNSA 1AKSA 3GCOA 2A2XH 4HGCA 3IG6B 1O3CA 2BB4A 1ELEE 5HXFA 4ABJA 5JB8S 5HMAA 1QQUA 1W12U 1BTZA 3SNBA 4ABFA 3ZVDA 1A0JA 1S82A 3NPSA 4Y0ZE 4X6NA 4SGAE 3K6ZA 1NFUA 2RA0A 2G81E 4A1XA 5EOKA 1HRTH 5DO4H 3RUOA 2A4QA 2ZDLA 1RD3B 2PWXA 3LJOA 2P16A 5L2ZH 2PTNA 3WY8A 1CA0C 1O3DA 2GT8A 2ZFRH 2QF3A 4XBDA 2BZ6H 2ZKSA 4TPIZ 3NXPA 1G9IE 1EPTC 1JXPA 2C3SA 1IQLA 2G5NA 4XBBA 4NG9H 3ZZCA 7GCHG 2A7HA 5JBBS 2Y81A 4UFFH 4YT7H 5EPNA 1ZSJA 3UOUA 5C2ZA 1KTSB 3MO9A 3UWIA 1CA8B 2BY5X 4ABHA 1CSOE 3N7OA 2ZECA 3MTYA 3O8BA 1WTHD 1W0ZU 3ZVEA 1IQMA 1JOUB 3ITIA 3LJJA 3RMNH 3LGUA 2H5CA 2XBXA 3P70B 5FXLA 4MG3A 4ZKRU 2G51A 1NFWA 4BTTB 1DPOA 4K60A 3SOSA 2BQWB 3ZZBA 1V2QT 4FUGA 5LGOA 3M7TA 3QTVH 1NU7B 2CHAB 4YZUA 1FY4A 1ZGVA 3MH4A 3A88A 1A4WH 2QC2A 1GDUA 3FZDA 4E7NA 2BLWA 4JK6A 5FAHA 2FI4E 2G00A 1A5IA 5F6MA 4AZ2B 4CBNA 3TJOA 2WPHS 3A8CA 5AF9H 1HDTH 2D26C 4F49A 4MPWA 1S81A 2PSXA 1AD8H 2W7SA 3KCGH 1Z6EA 4TY6A 1ZMJA 5DP5A 5A8YA 2G4TA 3SJKA 3TJNA 1K1PA 2H6MA 2ZFTA 3MYWA 4ABIA 1BTWA 1RGQA 4Y11E 2VWLA 3UR6A 2HNTC 2F9PA 3GY7A 2OC1A 2FDAA 2FOHA 2FOGA 2CXVA 2FEQH 2FI5E 2ALVA 1V2OT 3TNTA 3Q3YA 2GZ8A 1SGRE 1U6QA 4ZKNU 2QN5T 3KQEA 1SMFE 3BN9A 1FDPA 1O39A 4DY7B 4XDEA 1O38A 2BXTH 2IJOB 2SGEE 4FUIA 4UEHH 8LPRA 2GZ7A 1QB6A 4NIVA 4WXIA 5LH8A 1GBDA 4PROA 1D3QB 1GBEA 1A3BH 1QL9A 2UUFB 4VGCB 1TGSZ 4X0WU 1MZDA 1Z1IA 3BTME 1TRYA 1GI7B 1MKWK 1ELGA 1GG6B 1XKBC 2ZGJA 1TBRH 1DSTA 1TPAE 1HV7A 3SQEE 1ANDA 1KLTA 2PV9B 3SJOA 3O8RA 4Y76A 2VIQA 1A0LA 5J4QA 1AVWA 1T8LA 2VVVA 1S5SA 4FVDA 1EAWA 5F8ZA 1GI0A 2XCFA 2ZGXH 4XBCA 3UQOA 1K21H 2FPZA 4ISNA 3Q76A 1O2YA 5FHTA 2O8UA 1ANEA 3H7TA 2GMTB 5GWZA 4NA8A 1TBZH 1YCPM 4IN2A 1RIWB 1YCPH 1Z1JA 6GCHG 3URCA 1BTPA 5FX6A 1ESTA 1QBNA 1UTJA 1XM1A 3HGNA 1ETTH 2G55A 4IS5A 1DX5M 2ZHWH 3UREA 1C4U2 4BAKB 1ZHPA 3RDZA 1BMLA 3SU0A 4YTAA 5EODA 4CRGA 1THRH 2BD2A 1P05A 3UNQA 3MNBA 1DOJA 1HAZB 4BTUB 1A61H 1SBWA 8KME2 4X6OA 5F03A 4AB8A 3IITA 1C5RA 2QY0B 1DUAA 1DXWA 1GBKA 3KGPA 3D62A 2XYAA 3T28A 1SL3A 2GCHG 1UMAH 2P93A 2YOLA 3GCTF 3ODFA 1TPSA 2HGTH 1TWXB 1W13U 2GTBA 1GHXH 1HFDA 2A32A 4WJG2 1KXEA 2VB0A 1UTMA 1GBJA 3HGPA 2Q6DA 1HB0B 1CHGA 1G37A 5F8TA 2P3TB 1SSXA 4MNXA 1C1VH 1GL0E 4TWYA 2F9VA 4AFSA 1UVUH 1DT2A 1O2XA 2BDYA 1DDJA 4JZIA 3OX7U 1ZTJA 1F5KU 3UTUH 1C5ZB 2FESH 2BD3A 3I77A 1YM0A 3V0XA 1AFEH 2ZCKP 1VCQA 1BZXE 2PR3A 5A0AE 2A0QB 2ODPA 1GMCG 3FVFB 3ESTA 2HALA 2GD4B 1HJ8A 3A81A 3V3MA 1EQ9A 3HPTB 3SU4A 2HPQH 3ZV9A 2RG3A 1C2DA 1LPKB 1H8IH 2FOMB 3FZZA 3FAOA 4BXWA 3RMLH 3ZZ8A 2FIRH 3SQHE 1A7SA 1DUEA 3MNXA 2FS8A 4GAWA 3TLOA 2I6SA 3MU8A 2F9OA 3TITA 8GCHG 1N6XA 1ETRH 1ARCA 2QXIA 1GI9B 1T4VH 2GP9B 5EW1H 2XCNA 1XVOA 5T3HA 1AFQB 1A0HB 4CRAA 2M5TA 1PFXC 1UVSH 3MU5A 2D2DA 1OWIA 3HATH 2A7JA 3LPRA 4DIHH 3PLKA 1X7AC 2THFB 3ZZ7A 1TX7A 1HGTH 3RXUA 1T31A 2STBE 1FAKH 2OQUA 4TY7A 4Q7ZA 1P02A 2OTVA 2BLOA 1LDTT 5CMXH 1FXYA 1NRRH 2CHAC 1XUFA 3BTKE 3U8OH 4A5TS 1V2JT 5FPTA 2O8TA 1GGDC 1F2SE 1YPMH 5TCCA 1V2PT 3H5CB 2NU2E 1QJ1B 3BEUA 4OS7A 1AZ8A 2ZPQA 3LT3A 1PPCE 3LU9B 2BLVA 3F1SB 2FOBA 4DOQA 4AFUA 1EJAA 2G8TA 4WH8A 1GI6A 1FI8A 4FUDA 4I8KA 1F0SA 2Y5GA 1TMUH 1J8AA 2J92A 3HK3B 3LOXA 3T26A 1SGNE 1VITG 1FY3A 3FFGA 3MOCA 5FPSA 1EJMA 2EC9H 2CV3A 1J15A 1UVPA 2ZDNA 1J9CH 1SGQE 1W7XH 1NFXA 3RXMA 1GVKB 2A4GA 1SGDE 3RXTA 2P59A 1DSUA 2R3UA 2RA3A 1S6FA 3BIUH 1G3BA 3D23A 4I8HA 2BDAA 4UD9H 1TAWA 1K1LA 3SV9A 1SLXB 1GI1A 3V12A 3BTHE 3L3TA 3F68H 3MMGA 1P9SA 2H9HA 1LQDB 4AGJA 1O2WA 4X8VH 5GDSH 3A8AA 4VGCC 1J14A 1OOKB 5ESBA 1SR5C 2ZNKH 1XUGA 1GG6C 4GSOA 2Q6FA 2SNVA 3BTDE 3TU7H 4CR9A 4A6LA 1Y3XA 3ZVBA 1DLEA 1NRSH 3E90B 2ZDAH 5T6FA 1QRXA 3TJVA 3QDZB 2UUJB 2CJIA 4MTBA 5JBTA 1O2NA 4YESB 2DUCA 3QO6A 7LPRA 2JKHA 2ZI2H 1T8NA 2HVXA 2GMTC 3C1KA 1P06A 3W94A 4XSKU 2ANMH 1O5FH 4WF8A 5EQQA 3RC5A 2ODQA 2A2QH 1C2GA 3M5LA 4DGJA 4K8YA 1DVAH 1L1NA 1P57B 3BIVH 2QF0A 3EA7A 1HBTH 1F0RA 4B2AA 2HPPH 3PLBA 4AN7A 2G5VA 2VWMA 5AFZH 5JBCS 1DLKB 4Y71A 1O3KA 4DCDA 3IWMA 1NC6A 1C5QA 1OYQA 3MWIU 9LPRA 5ABWA 1K1JA 4I7YH 5E2PA 3RXFA 1HAXB 1D3TB 2ZEBA 1BA8B 1QBVH 1TNLA 4MDSA 1CGIE 1NN6A 5DP3A 2GKVE 2Q1JA 3RLYH 3UUZA 4Q7YA 4JYUH 1TNKA 1OP8A 1C2LA 1S85A 2XC0A 1EZQA 3E0PB 1TNHA 2PKSB 3Q77A 2AERH 1P2QA 3OYPA 1ESAA 2J4IA 3SI4H 2LPRA 1UK4A 1PYTD 1QBOA 2V35A 1MZAA 1WSSH 1OX1A 4CR5A 2QYIA 1E37B 2G52A 1TQ7B 4X2WA 3KNXA 3I29A 5DP6A 1H1BA 1HLTH 4FUHA 1MQ5A 1NU9A 2TPIZ 5H4IB 2BY7X 1O3IA 5EXLA 1SHYA 1C9TA 1QJ7B 2TGTA 1D3PB 2BY8X 1MBQA 2XTTB 1J17T 3MH7A 1GI3A 3KHVA 4KELA 1ZPCA 3EYDA 4I8JA 2BDGA 2ZA5A 4IBLH 2B9LA 1G2MA 1AY6H 1FV9A 2BM2A 1C2FA 1FY1A 2Z6BD 3FANA 3A87A 5SGAE 1EATA 4THNH 3EA8A 1DY8A 1SGFA 1C5WB 5FPYA 1ZR0A 5GCHG 1GBBA 4R0IA 3RU4E 2XXLA 5HGGA 2FOEA 4AB9A 2HNTE 2VIWA 2XC4A 3RXCA 3VB4A 1SFIA 1L1JA 2BVRH 1PQ7A 3A82A 1ZPZA 1KTTB 1Y3WA 2QV1A 4MPUA 1GVLA 1V2NT 4ZAEA 3RXKA 1P3CA 2ZDVH 1KXFA 1BRUP 2BD8A 3SUFA 5DP7A 4FVBA 1Y3UA 1CT0E 1TRNA 2ZF0H 4DW2U 1WAYB 1Z8IB 1Z8RA 1SLVB 1V2WT 2AGEX 1AFQC 2VNTA 4XFQA 1TYNA 1YPHE 1W11U 1ETSH 1CT2E 2P8OB 2Y6TA 1BHXF 1TX6A 4NA7A 4AFQA 4HFPB 1PPFE 2BDIA 3GCNA 4IC6A 1NRQH 3VGCC 5LPFA 2WPJS 3K2UA 2BD9A 5J4SA 4AG1A 1O3BA 3S0NA 2DE9A 4X1PU 2A5IA 4M7GA 3MNSA 4INHA 1C1SA 2SGPE 1GHAG 5GPIB 4D76A 1DWEH 4A92A 1BBRE 1LHFH 4AOQA 1O2ZA 4RN6A 3ZYEA 1JWTA 1NT1A 2QGRA 5K7RA 2AMDA 2VVCA 1VJ9U 1XXFA 1WTGH 3RXSA 1EAUA 4ZXXH 3URDA 1ZSLA 1QL8A 5EQRA 4B1TA 1GI2A 1AVGH 5JBAS 3RXVA 1WQSA 2PUXB 1JBUH 4BAQB 3W95A 4TYDA 4TWWA 1LHGH 4CRCA 3AAVA 4IN1A 1N8OB 1BBRK 1GJ9B 1WOFA 3GY8A 4GHTA 1MKXH 3LKWA 2ZIQH 2BLQA 1EP6A 1Y8TA 1AVXA 2B8OH 1O5GH 1L4DA 1DWDH 1CBWB 1V2RT 3MH6A 1NPMA 5T6DA 1IQHA 3PWBA 2XRCA 1BRAA 2ZFPH 3MU0A 1DICA 5GIBA 5C5OA 2Z9LA 4K8BA 2JH5D 1VR1H 4BAHB 4RSPA 1O35A 1XVMA 1AHTH 3AASA 3SU6A 4D8NA 3KN2A 3GCHB 1HNEE 2CF9H 1UCYE 5CHAC 2ESTE 1KXCA 1LPGB 4MVNA 1MTUA 2PGQB 1BDAA 1QHRB 1JIRA 1C1OA 4ZH8A 3VPKA 2OBOA 1IQEA 1DM4B 1Y5BT 2GV6A 2TGDA 3STJA 5A8XA 5IYTA 1Q2WA 4TPYA 3NUMA 3BG8A 1V3XA 3B9FH 1LVBA 5DJ7A 1GMCF 3A7VA 3LC5A 5F8XA 3UOPA 1C5LH 1VGCB 1G3DA 1ZPBA 1GJDB 3AW0A 4WY3A 1KIGH 4I33A 1B0FA 3A7WA 1ZHRA 2HNTF 4ESTE 3BG4B 1A46H 2FLRH 1BRBE 4E05H 5K0HA 1UCYK 4I8GA 1T4UH 1QY6A 1LMWB 5LPRA 4ABBA 1P2MA 3DT0H 2VIVA 2ZGCA 2F9UA 2FX6A 3DFLA 4A1TA 1BTXA 2Y7ZA 1HYLA 3M61U 1C5UA 1ACBE 3ATWA 1NROH 3BTWE 1UHBA 4WMFA 1C4Y2 1QNJA 1BBRH 5DK1A 1FPCH 1S0QA 4F4OC 1T7CA 2FX4A 2J2UA 1V2KT 4YOGA 5EQSA 1SGYE 4YOJA 2HRVA 3HKJB 2ZHFH 1Z7KA 5C5NA 1O2SA 5BPEA 4A1VA 3ATIA 4DIIH 1SVPA 3SUDA 4GCHF 1HCGA 4CH8B 1YPHC 2FOFA 6CHAB 1O2PA 1SGFG 4Z6AH 2BX4A 5ESTE 3F9HA 1SPJA 3K65B 5LPEA 1TNGA 4NFEA 1SGEE 3E3TA 1GCTB 8ESTE 4ZHLU 3A85A 4X6PA 2YNAA 2PKSC 3KQDA 1OYTH 2B5TB 1SOZA 3AAUA 2Z9KA 1Z6JH 1ELAA 1P0SH 3T27A 5HM2A 5TJXA 2SNWA 4U2WA 1VJAU 2ZWLH 3F9GA 3ZVGA 3TJUA 1Z71A 5C1YA 1BB0B 2WPIS
chains in the Genus database with same CATH superfamily
2ZHEH 1GHBG 1MD8A 4I32A 1C4V2 4O3UA 1P12E 4J1YA 1EAXA 1O2LA 1ZHMA 5FCKA 1P2OA 2F9NA 3P8FA 3K9XB 1OHHD 5F53A 1D6WA 1H4WA 2GZ9A 3F2HA 1CQQA 3QN7A 4B74A 1EKBB 4ABGA 3E16B 1CHOG 1UTPA 1A5HA 1P2JA 1TGNA 5KGOA 4D7GA 2UUYA 3F9EA 1O2JA 3ATKA 1CVWH 1QURH 3MO6A 4X2YA 1AWFH 3U8TH 3VXEH 1H9IE 1LCYA 1MBMA 1OP2A 1WU1A 4R8TB 4DJZB 5CDFE 2OXSA 2GCTB 3PMBB 2VJ1A 5B6OA 1RTFB 3QUMP 1GMDF 1OSSA 2CMYA 1SGTA 1XUHA 3EDXB 2AS9A 2WUCA 2PLXA 2TIOA 2FLBH 1MKWH 3MO3A 5C1UA 1IOEA 4O97A 1HJAB 2GGVB 1GCDA 1FX0B 2GDDA 3SV7A 2W5EA 3RXBA 3TGKE 4E06H 1MCTA 2C90B 2V3HH 3PV4A 5I25A 1TNJA 2P8OC 3Q3XA 1PPEE 1LO6A 1BT7A 4J2YB 2YNBA 1ZMNA 3B8JA 4IGDA 3BEFB 1SKYE 3NKKA 4ZKSU 1UTKA 3OTJE 6ESTA 3U1IB 4FU7A 1GBTA 3RM2H 4I8LA 1BTUA 3OFND 1V2TT 3VG8A 2WPKS 2OUAA 2EI8A 3ZV8A 4X1NU 1AIXH 5HM9A 1ELVA 4YXWD 1BOQA 1SQOA 3SNAA 1FIWA 3A86A 2TGPZ 1FMGA 2ZU4A 4ABAA 2GJGA 1YP9A 4BXSA 1V2UT 4X6MA 1AZZA 2VH6A 3M7QA 1GDNA 5FCRA 1AMHA 1O3NA 1ZOMA 1PPZA 1BUIA 2WV4A 2FMJA 4MNVA 1N8OC 1TOCB 1QL7A 4BNRA 1UW7A 4X2VA 1F5LA 2KM0A 1WCZA 2UWPA 1DANH 1K1MA 1SHHB 3UQVA 2O8LA 4LZ4B 1E35B 1KLJH 7KMEH 1JMOH 1LVMA 1O33A 1NBMD 3TK6A 5EG4A 1AQ7A 1P03A 1O2MA 1RS0A 4LK4A 3A84A 3W1EA 2IPHA 4DURA 1ABIH 1UK3A 1O34A 3FN8A 1MU8B 1N1LA 2PTCE 5A2MH 2H2ZA 1ABJH 1C2JA 1HAIH 1EB2A 1ANBA 3SGBE 1CGJE 2SFAA 1W0YH 1VZQH 4IMQA 3U9AH 3GCHC 3SUGA 2WV9A 3RXPA 3ZVFA 3LGIA 4KTSA 2NWNA 1GMHF 3TH4H 4JYTA 2OCVB 1FUJA 3BTTE 3OSYA 3SV8A 2H5DA 2ZU2A 4TT3D 1C1MA 2KCYA 3EQ0H 3F3BA 2WINI 1QIXB 1C5VA 1CU1A 1C5NH 2CN0H 4I31A 1BITA 4H6SB 2XW9A 2PKAB 2UWOA 3N99A 4UFDH 1GHWH 1TLDA 3ZYDA 1UK2A 1WUNH 1O3LA 5AVDA 1O3AA 1QQ4A 3SGAE 1TNIA 3ELAH 2VVUA 3RXJA 1Y3VA 1G36A 3MI4A 3LONA 3TH3H 1Z8JB 2NU0E 3AW1A 1P2NA 3UIRA 1IAUA 3GY4A 1EPTB 9ESTA 3SJ9A 1L1GA 1P2KA 2ZTXA 1OPHB 5CHBA 1LHEH 3SNCA 2CGAA 4MNWA 2VWOA 1TOMH 1TGTA 3RLWH 3OEHD 2H9TH 4Y8ZA 2AFQB 2AGIX 3UNSA 1P01A 1C5MD 1CO7E 1WQVH 1DS2E 3LGYA 3RXHA 1YPJH 2DE8A 3QK1A 3F2FA 1QGFA 5HIYA 3ATLA 1V2LT 4ISLA 5EJ1A 1O2TA 1GWAA 4NSVA 4JYVH 2O9QA 3RC4A 3JZ2B 1NS3A 6CHAC 2GV7A 2TBSA 1QFKH 2VWNA 4KGAA 4NSYA 1BMNH 4BAMB 1MMJN 4H6TA 1GCTC 1C1PA 2ZU5A 2AYWA 3G01A 2Q6GA 5TCAA 1XUIA 3U69H 2ZQ2A 5A0CA 3A83A 2FZZA 1C2KA 2JETB 1C1TA 2ASUB 2FTMA 4IW4E 1HUTH 1H9LB 1AO5A 1FN8A 1C5OH 3BV9B 5EXNA 3A7YA 4UFEH 7GCHF 3S7KB 5DP8A 4FUJA 1TMTH 1W0JD 2KAIB 4INLA 1RIWC 2BVXH 3KF2A 4OS5A 3VXFH 3N7DA 1FZZA 1RJXB 1C1QA 4F55A 1DE7H 1YPGH 3HKIB 2A5KA 2EI6A 2IPQX 3Q00A 1BMMH 3RXOA 4X1RU 2FP7B 1PQAA 1GJ8B 2F9BH 3SU2A 4UDWH 3LGWA 1A5GH 1GBHA 1ZYOA 1HPGA 7ESTE 3QX5H 1UJ1A 2OC8A 2HLDD 5FBEA 4OS1A 2FODA 1MABB 1P04A 2QAAA 2W3KA 3GYMA 3I78A 2C4FH 2O8WA 3M5NA 3PMHB 2ZGBH 1O2QA 2OQ5A 1GBFA 3ENSB 3DD2H 4X8TH 1KMHB 3M7UA 3PYHA 4U01A 2P3FH 1KDQB 2UWLA 2FS9A 1TRMA 4MPXA 1O2RA 2GCTC 3CS7A 4GHQA 1C5YB 4Q7XA 2PUQH 3M37A 1BQYA 3QZQA 3EE7A 2ZC9H 4YO9A 1YF4A 2WUBA 1W2KH 2ODYB 1ZRBA 1NESE 1EB1H 5C0TA 1THPB 4OS4A 4UE7H 3GISB 1E1QD 2R0LA 2ZCHP 2ZO3H 4B2CA 1D6RA 1MH0A 3P95A 3T2NA 3TK9A 1PYTC 1DY9A 2P3UB 1M9UA 3A7XA 2BXUH 1GJ7B 1NM6A 1Z8GA 1ZJKA 2ANYA 1P3EA 4QT8C 2R2MB 1NRNH 3F6UH 1A1RA 1C9PA 1HIAB 2P95A 1P9UA 2A4OA 3RMOH 3SN8A 1KXBA 5FBIA 2QIQA 1ANCA 2OP9A 2ZFFH 5JPMH 1WBGB 1BCUH 4BOHA 3A7ZA 3OY6U 1TFXA 4Y6DA 4DVAU 1O3PB 2PFEA 3RXRA 1EOJA 3A8BA 4K1TA 4A7IB 3SNDA 2FOAA 3FP6E 3GDSA 1NFYA 1G3EA 3LGVA 4IMZA 4CREA 2O8MA 3KQBA 2LNCA 3M3TA 4CBOA 2BD4A 2W7UA 3PTBA 1UVTH 1L2EA 4Q2KA 3EE0B 1E0FD 1GHZA 1QB1A 1HXEH 4UONA 1C2MA 4H42U 5L2YH 4O9VA 3QGJA 4JZDH 1LVOA 3S7HB 1O3JA 2A31A 4F48B 3V13A 3A7TA 1S0RA 1LHCH 1B5GH 3ZZ4A 3E91A 1Y5AT 5C1XA 1EASA 1GI5A 5DG6A 4AC9A 2EI7A 3ZZ9A 3D49H 2XBWA 1FNIA 1Y3YA 5C94A 3K6YA 3SV2H 1AU8A 1E34B 1QB9A 3RXAA 1SFQB 3CS0A 1FAXA 4RKJB 3U98H 6GCHF 2OLGA 2R0KA 2ZQ1A 1W10U 1EZSC 2SGDE 3TGJE 2KZ4A 4BANB 2ULLA 1GHBF 4Y8XA 4CRDA 1TE0A 3A8DA 2QE7D 3GY3A 2VINA 1LPZB 4Z0KA 1WV7H 2QXJA 5EW2H 4ZMAH 2VIOA 3ODDA 1CHOF 2L74A 2C8XB 1SGPE 1MAYA 2AIQA 2EA3A 3UR9A 4OGXA 1EPTA 5JDUB 2VGCB 1O2HA 4WMDA 1IQFA 1TGCA 3VB7A 2JH6D 4Y79A 3ZZ5A 1RXPA 2ZHDA 3T62A 2OBQA 4NZLA 1YLCA 2QF5A 1ESBA 5FX5A 1NO9H 3S69A 1HAOH 1KXDA 2GCHF 1F0TA 1CGHA 4K1SA 3PMAB 2ILNA 2XWBI 4D7FA 3SZNA 4X1SU 1PPBH 3STIA 1GBMA 3FP7E 1HAVB 2OC0A 2XC5A 3GICB 1HAHH 4JZEH 5C3NA 1SLWB 1B7XB 4Y7BA 4XOJA 2BOKA 2AHME 3T5FH 3U1JB 1IQNA 1HAYB 2C8YB 1XMNB 1XKAC 3V7TA 3UPEA 2Y7XA 2C93B 1VCWA 1GVZA 2BQ7B 4O03A 2PGBB 2Y80A 1MUEB 1S84A 4FUBA 5GJ4B 1GJ4H 3M3VA 1YPKH 1QA0A 1AB9B 3DHKH 3S9CA 2J98A 2AH4X 1QCPA 2FYRA 1SQAA 1V2MT 4CHAB 3NCLA 1BJUA 4KTCA 1YKTA 3LH1A 1TGBA 2KAIA 3SV6A 3E8LA 1GGDB 2AIPA 1LVYA 3ZZAA 2P94A 1AN1E 1V2ST 2JETC 2W3IA 1O37A 5PTPA 2RFKC 3E6PH 1OWJA 4WMEA 1C1UH 1OXGA 1ZZZA 2QA9E 2FOCA 2WPMS 2WYJA 1LHDH 2J34A 1JRSA 1K1OA 2TGAA 4HZHA 4Q63A 8GCHF 1C1WH 1SC8U 3JZ1B 5DP9A 2K8IA 3RU4D 1EFRD 3EGKH 3LDXH 1YCPK 4U32A 2GVFA 2NU1E 2PHBA 1INCA 2BYAX 4NFFA 5AFYH 3OY5U 3MNCA 1A3EH 4ISHH 4AORA 2BD7A 3S9AA 2YMSB 2GT7A 2V0BA 2ZP0H 5T6GA 1KDQA 5IDKA 3ZVCA 1ORFA 3DFJA 1O2GH 3ATMA 1IQKA 1ID5H 1SQTA 2Z9IA 1K22H 2ZFSA 1MD7A 3F9FA 2WYGA 1AUJA 3PROA 1QR3E 4AFZA 3RXDA 1VITH 1O3HA 1P8VC 2SGFE 4B2BA 2Z9GA 2EY4C 1BIOA 1TMBH 2OC7A 1HAPH 3SJIA 1XXDA 3M35A 4LOYH 1ELDE 2WPDD 2ZTYA 1P09A 3BSQA 4X2XA 2IOTA 1EZUC 3TIUA 3RMMH 1GL1A 1UVOA 2BDHA 4B76A 4ABDA 1P11E 3MHWU 3WW7A 1DITH 3PO1B 1HIAA 1O5CB 1E1RD 1TBQH 5A0BA 1ZTKA 1XX9A 1GJAB 2J38A 2VIDA 5EPYA 5L30H 1VITF 1S6HA 3E0NB 3VEQB 4OS6A 1GHVH 3SJ8A 2R2WU 1B0EA 1IQIA 1G3CA 2STAE 4U30A 3PB1E 4AX9H 4SGBE 1YLNA 1UCYH 1GBAA 1FPHH 4D9QA 1WYKA 1UTQA 3UWJH 3OEED 4OS2A 4CH2B 4LXBH 4E7RG 1UO6A 2CK3D 3SU3A 2XBYA 3SU5A 3M36A 1H8ED 1YC0A 1O2OA 2NU4E 2FYQA 5CE1A 2KCPA 4WWYA 1K9OE 2V3OH 2Z3CA 4X1QU 4NIWA 3SO3A 1QTFA 2OD3B 3WWBA 1NY22 1ARBA 3DA9B 1MTNB 1C5PA 1KYNA 1RTLA 2WV5A 4ZROA 2HOBA 3LH3A 2Y82A 3GOVB 3KIDU 4JK5A 4Y0YE 1YPLH 1SG8B 4NWKA 1YGCH 1H8DH 2R9PA 5DPAA 2CF8H 3GY6A 1P10A 1ZMLA 4ISOA 3ZVAA 1HJ9A 3KQCA 1GJCB 3UNRA 1TX8A 2F3CE 4AGKA 1ZSKA 2UUKB 2ANWA 1C5TA 1NTPA 3P17H 4XE4A 4D9RA 3LGTA 1FQ3A 4X8UH 3P8NA 3S9BA 4Y8YA 4UFGH 5I46H 3GYLB 2A5AA 1GI4A 1NZQH 5E0GA 3TH2H 1C5SA 1CE5A 1ZTLA 1MTVA 4ASHA 1E36B 1TA6A 3MU4A 1DFPA 2EQNA 1C2HA 1ELFA 3QWCH 1YBWA 5DKMA 2QCYA 3GY5A 3TPIZ 4NWLA 3RXLA 3SHCH 3NWUA 1QRZA 4ZHAA 1A2CH 1KY9A 2A1DB 1W7GH 5EGMA 1RRKA 1J16A 1O2UA 1XUKA 2Y5FA 3NK8A 5ETXA 3KL6A 1SGIB 3Q3KA 4LZ1H 1JIMA 2FM2A 4ZXYH 1EXFA 3QTOH 1O36A 1O3MA 4CRFA 1AWHB 3M3SA 2ZU1A 1TQ0B 1IQGA 3SGQE 2V6NA 1Y5UT 1MAXA 2HLCA 1KLIH 1IHSH 1FLEE 2I6QA 2TRMA 3DUXH 2VGCC 3P92A 4Y10E 1QRWA 3BTFE 1RTKA 3SI3H 4AYVB 4YT6H 1HAVA 3BTQE 4JZ1A 1GHYH 1ZGIA 3LC3A 2AMQA 2M2AA 3BEIB 1TB6H 3P6ZB 4AG2A 1K2I1 5AHGH 2J95A 1SQRA 2ZU3A 1K28D 2KCOA 2H1UA 3HK6B 2FI3E 3BTGE 3MU1A 1O2VA 1GDQA 2Z7FE 2XNIA 3F0PA 1CBWC 4K69A 2K1QA 1EX3A 4ZKOU 1TABE 1EP5A 3PMJA 4M9FA 3O8CA 2Z94A 2J9NA 3P8OA 3RM0H 2VH0A 1S83A 2KFWA 1S6LA 2A45B 3SORA 4B73A 3TVJB 2BQ6B 2XWAA 1H9HE 3CP7A 3RXQA 1MTWA 5E0HA 5G4BA 1D3DB 2FTLE 1XUJA 3DSOA 3VGCB 1F92A 3MFJA 1GI8B 4KTUA 4KKDA 1BHXB 1OWEA 1MCVA 1GJ6A 2BDCA 3SUEA 1AB9C 2OINA 2ZPSA 4FUFA 5GCHF 1ELCA 4GCHG 1UTNA 4NCYA 2BY6X 4CHAC 3FP8E 4ABEA 1DWBH 1T32A 1VGCC 2A7CA 1QJ6B 5JB9S 1AGJA 2ZDMA 4FU9A 1P2IA 1GBLA 4AYYB 1AKSB 5GXPA 1TPPA 2Z3EA 3BG4C 2BTCE 1CA0B 1W3CA 1C1NA 4B75A 1W14U 3SU1A 2ZZUH 1AE5A 4JMYA 3ZZ6A 3VFEA 3P8GA 1HXFH 2RCEA 2YMSD 5EJLA 1JRTA 3U8RH 1KXAA 1O5BB 3VB3A 4Y7AA 4NIXA 3T25A 1RFNA 4FXGH 3R3GB 3BF6H 1ELTA 4BTIB 2LP6A 5C0UA 2BY9X 3RP2A 1O30A 3VB6A 1H8HD 2XBVA 1BJVA 1TALA 1AUTC 1MQ6A 1O2KA 3ZZDA 2SGAA 1SGCA 4K2YA 1O3EA 1IQJA 1EOLA 4MNYA 1T8MA 1LKBA 1D4PB 3BTEE 4TSFD 2PW8H 1GHAF 4ISIH 4DT7B 1G30B 2RDLA 3PLPA 5HYOA 3NZIA 1UTOA 2F83A 1O3OA 4RKOB 2W6ID 5C17A 2AEIH 1V6DA 1QA7A 4JCNA 1LKAA 3SYJA 1ELBA 3AVZA 5CHAB 4K5ZA 5EU8A 3A80A 1L0ZA 3GDUA 2ALPA 1PQ8A 1TA2A 2B0FA 2ZG0H 4MPVA 1C1RA 2C8WB 2D8WA 1E38B 1F5RA 2ANKH 1Q3XA 3EAJA 1KSNA 1PPHE 3B23B 2F91A 1O5DH 5E8EH 3PO1C 1GMDG 2W6JD 1OKXA 2ZFQH 1AE8H 4INKA 2BMGB 1C2IA 1YYY1 4FU8A 3GCTG 1F7ZA 2R3YA 4ZHMU 1O31A 1OS8A 1UTLM 3RXIA 1O2IA 4YLQH 5A8ZA 2ZPRA 1G2LA 2C8ZB 3KEEA 1K1NA 3DSGA 5JYIA 2J94A 2ZHQH 3L6PA 4MLFB 4GLYA 3QGNB 4NA9H 3TK5A 4JZFH 3AK5A 3UY9A 3SBKA 1FY5A 1PPGE 2VU8E 1GJ5H 1LQEA 4IC5A 2BDBA 1CT4E 3RC6A 2HWLB 4MQAA 1OWDA 6LPRA 2BVSH 1G32B 1K1IA 5L6NH 2VIPA 4WXVA 1O5AB 3A89A 1MTNC 2ZDKA 4O3TA 1BMAA 4GUXA 3MQKC 3CENA 4GPGA 5DP4A 1Y59T 3OAAD 1O3FA 3GY2A 4NZQA 1FONA 1SOTA 1DXPA 2FXRA 1GPZA 1F0UA 1FY8E 1W8BH 2JIZD 2Y5HA 4X8SH 1DWCH 1YLDA 4FUCA 2G4UA 1OP0A 3RXGA 1UHBB 3UFAA 2PSYA 3O8DA 4YM9A 1GJBB 2FWWA 4DG4A 1ZRKA 4KP0A 1HJAC 1V2VT 5EXMA 1TPOA 2JH0D 2AGGX 1HAGE 1YPEH 1NRPH 2IJD1 5E2OA 1O0DH 1ZJDA 2FO9A 2GX4A 2B7DH 1ZLRA 2QXGA 3D65E 4H4FA 2BZAA 3QLPH 2LELA 4BAOB 1C5XB 1THSH 1TONA 2IN2A 1EJNA 2Z9JA 2ZGHA 3QZRA 4YOIA 3SW2B 3SNEA 5C67A 5DN6D 3TGIE 1N6YA 4I86A 1EZXC 1SI5H 1LTOA 1FIZA 4OGYA 1L4ZA 5E0JA 4Q80A 3PM3A 2BHGA 2D1JA 1BRCE 2BOHB 2V3MA 2J97A 1BTHH 1GMHG 1OWKA 1AI8H 3E1XB 4K1EA 3M5OA 4YLUA 4K3JA 2AMPA 1C2EA 2ZCLP 4HG6A 1O3GA 3T29A 1T8OA 2ZTZA 3MH5A 1FN6A 3L33A 3SHAH 4HTCH 2SGQE 1OWHA 3R0FA 3ZZ3A 2H9EH 3GDVA 4WH6A 2W26A 4NIYA 3RXEA 4FUEA 3M5MA 5DGJA 4HI3A 3H7OA 1PQ5A 2BD5A 2Z3DA 5C20A 4WVPE 1MKXK 1TIOA 1FJSA 2QXHA 1VCPA 1EUFA 1MU6B 2WPLS 1SB1H 4CRBA 3OU0A 3VB5A 1IHTH 3EA9A 1O5EH 1MTSA 1Q31A 3LIWA 1GBIA 3RU4T 3C27B 1EAIA 3PTNA 2PKAA 1D9IA 2A4RA 1GBCA 1SLUB 1PJPA 1O32A 4GVUA 4ZUHA 4B71A 3PWCA 1BTYA 2BX3A 5A09A 4NGAH 4Z1MD 2EEKA 2GDEH 2NU3E 5BRRE 3TNSA 1AKSA 3GCOA 2A2XH 4HGCA 3IG6B 1O3CA 2BB4A 1ELEE 5HXFA 4ABJA 5JB8S 5HMAA 1QQUA 1W12U 1BTZA 3SNBA 4ABFA 3ZVDA 1A0JA 1S82A 3NPSA 4Y0ZE 4X6NA 4SGAE 3K6ZA 1NFUA 2RA0A 2G81E 4A1XA 5EOKA 1HRTH 5DO4H 3RUOA 2A4QA 2ZDLA 1RD3B 2PWXA 3LJOA 2L6OA 2P16A 5L2ZH 2PTNA 3WY8A 1CA0C 1O3DA 2GT8A 2ZFRH 3KYGA 2QF3A 4XBDA 2BZ6H 2ZKSA 4TPIZ 3NXPA 1G9IE 1EPTC 1JXPA 2C3SA 1IQLA 2G5NA 4XBBA 4NG9H 3ZZCA 7GCHG 2A7HA 5JBBS 2Y81A 4UFFH 4YT7H 2WHXA 5EPNA 4OM9A 1ZSJA 3U28C 3UOUA 5C2ZA 1KTSB 3MO9A 1E79D 3UWIA 1CA8B 2BY5X 4ABHA 1CSOE 3N7OA 2ZECA 3MTYA 3O8BA 1WTHD 1W0ZU 3ZVEA 1IQMA 1JOUB 3ITIA 3LJJA 3RMNH 3LGUA 2H5CA 2XBXA 3P70B 5FXLA 4MG3A 4ZKRU 2G51A 1NFWA 4BTTB 1DPOA 4K60A 3SOSA 2BQWB 3ZZBA 1V2QT 4FUGA 5LGOA 3M7TA 3QTVH 1NU7B 2CHAB 4YZUA 1FY4A 1ZGVA 3MH4A 3A88A 1A4WH 2QC2A 1GDUA 3FZDA 4E7NA 2BLWA 4JK6A 5FAHA 5GNDA 2FI4E 2G00A 1A5IA 5F6MA 4AZ2B 4CBNA 3TJOA 1YWUA 1WXRA 2WPHS 3A8CA 5AF9H 1HDTH 2D26C 4F49A 4MPWA 1S81A 2PSXA 1AD8H 2W7SA 3KCGH 1Z6EA 4FETA 4TY6A 1ZMJA 5DP5A 5A8YA 2G4TA 3SJKA 3TJNA 1K1PA 1QZ8A 2H6MA 2ZFTA 3MYWA 4ABIA 1BTWA 1RGQA 4Y11E 2VWLA 3UR6A 2HNTC 2F9PA 3GY7A 2OC1A 2FDAA 2FOHA 2FOGA 2XOKD 2CXVA 2FEQH 2FI5E 2ALVA 1V2OT 3TNTA 3Q3YA 2GZ8A 1SGRE 1U6QA 4ZKNU 2QN5T 3KQEA 1SMFE 3BN9A 1FDPA 1O39A 3NRLA 1VKYA 4DY7B 4XDEA 1O38A 2BXTH 2IJOB 2SGEE 4FUIA 4UEHH 8LPRA 2GZ7A 1QB6A 4NIVA 4WXIA 3FO8D 5LH8A 1GBDA 1NBME 1K0HA 4PROA 1D3QB 1GBEA 1A3BH 1QL9A 2UUFB 4VGCB 1TGSZ 4X0WU 1MZDA 1Z1IA 3BTME 1TRYA 1GI7B 1MKWK 5EJZA 1ELGA 1GG6B 1XKBC 2ZGJA 1TBRH 1DSTA 1TPAE 3KYFA 1HV7A 2KR7A 3SQEE 1ANDA 1KLTA 2PV9B 3SJOA 3O8RA 4Y76A 2VIQA 1A0LA 5HIZA 5J4QA 1AVWA 1T8LA 2VVVA 1S5SA 4FVDA 1EAWA 5F8ZA 1GI0A 2XCFA 2ZGXH 4XBCA 3UQOA 1K21H 2FPZA 4ISNA 4P00A 3Q76A 1O2YA 5FHTA 2O8UA 1ANEA 3H7TA 2GMTB 5GWZA 4NA8A 1TBZH 1YCPM 4IN2A 1RIWB 1YCPH 1Z1JA 6GCHG 5DSFA 3URCA 1BTPA 5FX6A 5KEDA 1ESTA 1QBNA 5KECA 1UTJA 1XM1A 3HGNA 1ETTH 2G55A 4IS5A 1DX5M 2ZHWH 3UREA 1C4U2 4BAKB 1ZHPA 3RDZA 1BMLA 3SU0A 4YTAA 5EODA 4CRGA 1THRH 2BD2A 1P05A 3UNQA 3F2GA 3MNBA 1DOJA 1HAZB 4BTUB 1A61H 1SBWA 8KME2 4X6OA 5F03A 4AB8A 3IITA 1C5RA 2QY0B 1DUAA 1DXWA 1GBKA 3KGPA 3D62A 2XYAA 3T28A 1SL3A 2GCHG 1UMAH 2P93A 2YOLA 2VBCA 3GCTF 3ODFA 2XNDD 5IK2D 1TPSA 2HGTH 1TWXB 1W13U 2GTBA 1GHXH 1HFDA 3WWFA 2A32A 4WJG2 3FKSD 1KXEA 2VB0A 1UTMA 1GBJA 3HGPA 2Q6DA 1HB0B 1CHGA 1G37A 5F8TA 2P3TB 1SSXA 4MNXA 1C1VH 1GL0E 4TWYA 2F9VA 4AFSA 1UVUH 1DT2A 1O2XA 2BDYA 1DDJA 4JZIA 3OX7U 1ZTJA 1F5KU 3UTUH 1C5ZB 2FESH 2BD3A 3I77A 1YM0A 3V0XA 1AFEH 2ZCKP 1VCQA 2OK5A 1BZXE 2PR3A 5A0AE 2A0QB 2ODPA 1GMCG 3FVFB 3ESTA 2HALA 2GD4B 1HJ8A 3A81A 3V3MA 1EQ9A 3HPTB 3SU4A 2HPQH 3ZV9A 2RG3A 1C2DA 1LPKB 1H8IH 2FOMB 3FZZA 3N7EA 3FAOA 4BXWA 3RMLH 3ZZ8A 2FIRH 3SQHE 1A7SA 1DUEA 3MNXA 2FS8A 4GAWA 3TLOA 2V7QD 2I6SA 3MU8A 3GS9A 2F9OA 3TITA 8GCHG 1N6XA 1ETRH 1ARCA 2QXIA 1GI9B 1T4VH 2GP9B 2HVYB 5EW1H 2XCNA 1XVOA 5T3HA 1AFQB 1A0HB 4CRAA 2M5TA 1PFXC 1UVSH 3MU5A 4Q4LA 2D2DA 1OWIA 3HATH 2A7JA 3LPRA 4DIHH 3PLKA 3DSPA 1X7AC 2THFB 3ZZ7A 1TX7A 2WSSD 2F43B 1HGTH 3RXUA 1T31A 2STBE 1FAKH 2OQUA 4TY7A 4Q7ZA 1P02A 2OTVA 2BLOA 1LDTT 5CMXH 1FXYA 1NRRH 2CHAC 1XUFA 3BTKE 3U8OH 4A5TS 1V2JT 5FPTA 2O8TA 1GGDC 1BMFD 1F2SE 1YPMH 5TCCA 1V2PT 3H5CB 2NU2E 1QJ1B 2JDID 3BEUA 4OS7A 1AZ8A 2ZPQA 3LT3A 3UB0A 1PPCE 3LU9B 2BLVA 3F1SB 2FOBA 4DOQA 3UAIC 4AFUA 1EJAA 2G8TA 4WH8A 1GI6A 1FI8A 4FUDA 4I8KA 1F0SA 2Y5GA 1TMUH 1J8AA 2J92A 3HK3B 3LOXA 3T26A 1SGNE 1VITG 1FY3A 3FFGA 3MOCA 2YMSC 5FPSA 1EJMA 2EC9H 2CV3A 1J15A 1UVPA 2ZDNA 1J9CH 1SGQE 2QF4A 1W7XH 1NFXA 3RXMA 1GVKB 2A4GA 1SGDE 3PRDA 3RXTA 2P59A 1DSUA 2R3UA 2RA3A 1S6FA 3BIUH 1G3BA 3SZEA 3D23A 4I8HA 2BDAA 4UD9H 1TAWA 1K1LA 3SV9A 1SLXB 1GI1A 3OTPA 3V12A 3BTHE 3L3TA 3F68H 3MMGA 1P9SA 2H9HA 1LQDB 4AGJA 1O2WA 4X8VH 5GDSH 3A8AA 4VGCC 1J14A 1OOKB 5ESBA 1SR5C 2ZNKH 1XUGA 1GG6C 4GSOA 4ACBA 2Q6FA 2SNVA 3BTDE 3TU7H 4CR9A 4A6LA 1Y3XA 3ZVBA 1DLEA 1NRSH 3E90B 2ZDAH 5T6FA 1QRXA 2K0QA 3TJVA 5B6LA 3QDZB 2UUJB 2CJIA 4MTBA 5JBTA 1O2NA 4YESB 2DUCA 3QO6A 7LPRA 2JKHA 2ZI2H 5FL7D 1T8NA 1WDIA 2HVXA 2GMTC 3C1KA 1P06A 2J98B 4XSKU 2ANMH 1O5FH 3W94A 4WF8A 5EQQA 3RC5A 2ODQA 2A2QH 1C2GA 3M5LA 4DGJA 4K8YA 1DVAH 1L1NA 1P57B 3BIVH 2QF0A 3EA7A 2JJ1D 1HBTH 1F0RA 4B2AA 2HPPH 3PLBA 4AN7A 2G5VA 2VWMA 5AFZH 5JBCS 1DLKB 4Y71A 1O3KA 3CNRA 4DCDA 3IWMA 1NC6A 1C5QA 1OYQA 3MWIU 9LPRA 5ABWA 1K1JA 4I7YH 2PP6A 5E2PA 3RXFA 1HAXB 1D3TB 4XRNA 2ZEBA 4ZCNA 1BA8B 1QBVH 1TNLA 4MDSA 1CGIE 1NN6A 5DP3A 2GKVE 2Q1JA 3RLYH 3UUZA 4ACAA 4Q7YA 4JYUH 1TNKA 1OP8A 1C2LA 1S85A 2XC0A 1EZQA 3E0PB 1TNHA 2PKSB 3Q77A 3PRBA 2AERH 1P2QA 3OYPA 1ESAA 2J4IA 3SI4H 2LPRA 1UK4A 1PYTD 1QBOA 2V35A 1MZAA 1WSSH 1OX1A 4CR5A 2QYIA 1E37B 2G52A 1TQ7B 4X2WA 3KNXA 3I29A 5DP6A 1H1BA 1HLTH 4FUHA 1MQ5A 1NU9A 2TPIZ 5H4IB 2BY7X 1O3IA 5EXLA 1SHYA 1C9TA 1QJ7B 2TGTA 1D3PB 2BY8X 2J5UA 1MBQA 2XTTB 1J17T 3MH7A 3ZIAD 1GI3A 3KHVA 4KELA 1ZPCA 3EYDA 3DCLA 5T1VA 4I8JA 2BDGA 2ZA5A 4IBLH 2B9LA 1G2MA 1AY6H 1FV9A 2BM2A 4FOUC 1C2FA 1FY1A 2Z6BD 3FANA 3A87A 5SGAE 1EATA 4THNH 3EA8A 1DY8A 1SGFA 1C5WB 2JJ2D 5FPYA 1ZR0A 5GCHG 1GBBA 4R0IA 3RU4E 2XXLA 5HGGA 2FOEA 4AB9A 4DT4A 2HNTE 2VIWA 2XC4A 3RXCA 3VB4A 1SFIA 1L1JA 2BVRH 1PQ7A 3A82A 1ZPZA 1KTTB 1Y3WA 2QV1A 4MPUA 1GVLA 1V2NT 4ZAEA 3RXKA 1P3CA 2ZDVH 1KXFA 1BRUP 2BD8A 3SUFA 5DP7A 4FVBA 1Y3UA 1CT0E 1TRNA 2ZF0H 3PV2A 4DW2U 1WAYB 1Z8IB 1Z8RA 1SLVB 1V2WT 2AGEX 1AFQC 2VNTA 4RT0A 4XFQA 1TYNA 1YPHE 1W11U 1ETSH 1CT2E 2P8OB 2Y6TA 1BHXF 1TX6A 4NA7A 4AFQA 4B6FA 4HFPB 1PPFE 1YY3A 2BDIA 3GCNA 1NRQH 4IC6A 3VGCC 5LPFA 2WPJS 3K2UA 2BD9A 5J4SA 4AG1A 1O3BA 3S0NA 2DE9A 4X1PU 2A5IA 4M7GA 3MNSA 4INHA 1C1SA 2SGPE 1GHAG 5GPIB 4D76A 3PV5A 1DWEH 4A92A 1BBRE 1LHFH 3FOAA 4AOQA 1O2ZA 4RN6A 3ZYEA 1JWTA 1NT1A 2QGRA 5K7RA 2AMDA 2VVCA 1VJ9U 1XXFA 1WTGH 3RXSA 1EAUA 4ZXXH 3URDA 1ZSLA 1QL8A 5EQRA 4B1TA 1GI2A 1AVGH 5JBAS 3RXVA 1WQSA 2PUXB 1JBUH 1W0KD 3W95A 4BAQB 4TYDA 4TWWA 2KCAA 1LHGH 4CRCA 3AAVA 4IN1A 1N8OB 1BBRK 1GJ9B 1WOFA 3GY8A 4GHTA 1MKXH 3LKWA 2ZIQH 2BLQA 1EP6A 1Y8TA 1AVXA 2B8OH 1O5GH 1L4DA 1DWDH 1CBWB 4RI0A 1V2RT 3MH6A 1NPMA 5T6DA 1IQHA 3PWBA 2XRCA 1BRAA 2ZFPH 3MU0A 1DICA 5GIBA 5C5OA 2WZQA 2Z9LA 4K8BA 2JH5D 1VR1H 4BAHB 4RSPA 1O35A 1XVMA 1AHTH 3AASA 3SU6A 4D8NA 4P02A 3KN2A 3GCHB 1HNEE 2CF9H 1UCYE 5CHAC 2ESTE 1KXCA 4RT1A 1LPGB 4MVNA 1MTUA 4XD7D 2PGQB 1BDAA 1QHRB 1JIRA 1C1OA 4ZH8A 3VPKA 1COWD 2OBOA 1IQEA 1DM4B 1Y5BT 2GV6A 2TGDA 3STJA 3KQ5A 3H09A 5A8XA 5IYTA 1Q2WA 4TPYA 3NUMA 3BG8A 1V3XA 2F4LA 3B9FH 2RDEA 1LVBA 5DJ7A 1GMCF 3A7VA 3LC5A 5F8XA 3UOPA 1C5LH 1VGCB 1G3DA 1ZPBA 1GJDB 3AW0A 4WY3A 1KIGH 4I33A 1B0FA 3A7WA 1ZHRA 2HNTF 4ESTE 3BG4B 1A46H 2FLRH 1BRBE 4E05H 5K0HA 1UCYK 4I8GA 1T4UH 1QY6A 1LMWB 5LPRA 4ABBA 1P2MA 3DT0H 2VIVA 2ZGCA 2F9UA 2FX6A 3DFLA 4A1TA 1BTXA 3OE7D 2Y7ZA 1HYLA 3M61U 1C5UA 1ACBE 3ATWA 1NROH 4ASUD 3BTWE 1UHBA 4WMFA 1C4Y2 1QNJA 3F0OA 1BBRH 5DK1A 1FPCH 1S0QA 4F4OC 1T7CA 2FX4A 2J2UA 1V2KT 4YOGA 5EQSA 1SGYE 4YOJA 2HRVA 3HKJB 2ZHFH 1Z7KA 5C5NA 1O2SA 5BPEA 4A1VA 3ATIA 4DIIH 1SVPA 3SUDA 4GCHF 1HCGA 4CH8B 1YPHC 2FOFA 6CHAB 1O2PA 1SGFG 4Z6AH 2BX4A 5ESTE 3F9HA 1SPJA 4B6EA 3K65B 5LPEA 1TNGA 4NFEA 1SGEE 3E3TA 1GCTB 8ESTE 4ZHLU 5EIYA 3A85A 4X6PA 2YNAA 2PKSC 3KQDA 1OYTH 2B5TB 1SOZA 3AAUA 2Z9KA 1Z6JH 1ELAA 1P0SH 3T27A 5HKKD 5HM2A 2KX4A 5TJXA 2SNWA 4U2WA 1VJAU 2ZWLH 3F9GA 3ZVGA 3TJUA 1Z71A 5C1YA 1BB0B 2WPIS
chains in the Genus database with same CATH topology
2ZHEH 1GHBG 1MD8A 4I32A 1C4V2 4O3UA 1P12E 4J1YA 1EAXA 1O2LA 1ZHMA 5FCKA 1P2OA 2F9NA 3P8FA 3K9XB 1D6WA 1H4WA 2GZ9A 1CQQA 3QN7A 4B74A 1EKBB 4ABGA 3E16B 1CHOG 1UTPA 1A5HA 1P2JA 1TGNA 4D7GA 2UUYA 3F9EA 1O2JA 3ATKA 1CVWH 1QURH 3MO6A 4X2YA 1AWFH 3U8TH 3VXEH 1H9IE 1LCYA 1MBMA 1OP2A 1WU1A 4R8TB 4DJZB 2OXSA 2GCTB 3PMBB 2VJ1A 5B6OA 1RTFB 3QUMP 1GMDF 1OSSA 2CMYA 1SGTA 1XUHA 3EDXB 2AS9A 2WUCA 2PLXA 2TIOA 2FLBH 1MKWH 3MO3A 5C1UA 1IOEA 4O97A 1HJAB 2GGVB 1GCDA 2GDDA 3SV7A 2W5EA 3RXBA 3TGKE 4E06H 1MCTA 2C90B 2V3HH 3PV4A 5I25A 1TNJA 2P8OC 3Q3XA 1PPEE 1LO6A 1BT7A 4J2YB 2YNBA 1ZMNA 3B8JA 4IGDA 3BEFB 3NKKA 4ZKSU 1UTKA 3OTJE 6ESTA 3U1IB 4FU7A 1GBTA 3RM2H 4I8LA 1BTUA 1V2TT 2WPKS 2OUAA 2EI8A 3ZV8A 4X1NU 1AIXH 5HM9A 1ELVA 1BOQA 1SQOA 3SNAA 1FIWA 3A86A 2TGPZ 1FMGA 2ZU4A 4ABAA 1YP9A 4BXSA 1V2UT 4X6MA 1AZZA 2VH6A 3M7QA 1GDNA 5FCRA 1AMHA 1O3NA 1ZOMA 1PPZA 1BUIA 2WV4A 2FMJA 4MNVA 1N8OC 1TOCB 1QL7A 4BNRA 4X2VA 1F5LA 2UWPA 1WCZA 1DANH 1K1MA 1SHHB 3UQVA 2O8LA 4LZ4B 1E35B 1KLJH 7KMEH 1JMOH 1LVMA 1O33A 3TK6A 5EG4A 1AQ7A 1P03A 1O2MA 1RS0A 4LK4A 3A84A 2IPHA 4DURA 1ABIH 1UK3A 1O34A 1MU8B 1N1LA 2PTCE 5A2MH 2H2ZA 1ABJH 1C2JA 1HAIH 1EB2A 1ANBA 3SGBE 1CGJE 2SFAA 1W0YH 1VZQH 4IMQA 3U9AH 3GCHC 3SUGA 3RXPA 3ZVFA 3LGIA 4KTSA 2NWNA 1GMHF 3TH4H 4JYTA 2OCVB 1FUJA 3BTTE 3OSYA 3SV8A 2H5DA 2ZU2A 1C1MA 3EQ0H 2WINI 1QIXB 1C5VA 1CU1A 1C5NH 2CN0H 4I31A 1BITA 4H6SB 2XW9A 2PKAB 2UWOA 4UFDH 1GHWH 1TLDA 3ZYDA 1UK2A 1WUNH 1O3LA 5AVDA 1O3AA 1QQ4A 3SGAE 1TNIA 3ELAH 2VVUA 3RXJA 1Y3VA 1G36A 3MI4A 3LONA 3TH3H 1Z8JB 2NU0E 3AW1A 1P2NA 3UIRA 1IAUA 3GY4A 1EPTB 9ESTA 3SJ9A 1L1GA 1P2KA 2ZTXA 1OPHB 1LHEH 3SNCA 2CGAA 4MNWA 2VWOA 1TOMH 1TGTA 3RLWH 2H9TH 4Y8ZA 2AFQB 2AGIX 3UNSA 1P01A 1C5MD 1CO7E 1WQVH 1DS2E 3LGYA 3RXHA 1YPJH 2DE8A 3QK1A 1QGFA 3ATLA 1V2LT 4ISLA 1O2TA 1GWAA 4NSVA 4JYVH 2O9QA 3RC4A 3JZ2B 1NS3A 6CHAC 2GV7A 2TBSA 1QFKH 2VWNA 4KGAA 4NSYA 1BMNH 4BAMB 1MMJN 4H6TA 1GCTC 1C1PA 2ZU5A 2AYWA 3G01A 2Q6GA 5TCAA 1XUIA 3U69H 2ZQ2A 5A0CA 3A83A 2FZZA 1C2KA 2JETB 1C1TA 2ASUB 2FTMA 4IW4E 1HUTH 1H9LB 1AO5A 1FN8A 1C5OH 3BV9B 5EXNA 3A7YA 4UFEH 7GCHF 3S7KB 5DP8A 4FUJA 1TMTH 2KAIB 4INLA 1RIWC 2BVXH 3KF2A 4OS5A 3VXFH 1FZZA 1RJXB 1C1QA 1DE7H 1YPGH 3HKIB 2A5KA 2EI6A 3Q00A 1BMMH 3RXOA 4X1RU 2FP7B 1PQAA 1GJ8B 2F9BH 3SU2A 4UDWH 3LGWA 1A5GH 1GBHA 1ZYOA 1HPGA 7ESTE 3QX5H 1UJ1A 2OC8A 5FBEA 4OS1A 2FODA 1P04A 2QAAA 2W3KA 3GYMA 3I78A 2C4FH 2O8WA 3M5NA 3PMHB 2ZGBH 1O2QA 2OQ5A 1GBFA 3ENSB 3DD2H 4X8TH 3M7UA 3PYHA 4U01A 2P3FH 1KDQB 2UWLA 2FS9A 1TRMA 4MPXA 1O2RA 2GCTC 3CS7A 4GHQA 1C5YB 4Q7XA 2PUQH 3M37A 1BQYA 3QZQA 2ZC9H 4YO9A 1YF4A 2WUBA 1W2KH 2ODYB 1ZRBA 1NESE 1EB1H 1THPB 4OS4A 4UE7H 3GISB 2ZCHP 2R0LA 4B2CA 2ZO3H 1D6RA 1MH0A 3P95A 3T2NA 3TK9A 1PYTC 1DY9A 2P3UB 1M9UA 3A7XA 2BXUH 1GJ7B 1NM6A 1Z8GA 1ZJKA 2ANYA 1P3EA 4QT8C 2R2MB 1NRNH 3F6UH 1A1RA 2P95A 1C9PA 1HIAB 1P9UA 2A4OA 3RMOH 3SN8A 1KXBA 5FBIA 2QIQA 1ANCA 2OP9A 2ZFFH 5JPMH 1WBGB 1BCUH 4BOHA 3A7ZA 3OY6U 1TFXA 4Y6DA 4DVAU 1O3PB 2PFEA 3RXRA 1EOJA 3A8BA 4K1TA 4A7IB 3SNDA 2FOAA 3FP6E 3GDSA 1NFYA 1G3EA 3LGVA 4IMZA 4CREA 2O8MA 3KQBA 2LNCA 3M3TA 4CBOA 2BD4A 2W7UA 3PTBA 1UVTH 1L2EA 4Q2KA 3EE0B 1E0FD 1GHZA 1QB1A 1HXEH 4UONA 1C2MA 4H42U 5L2YH 4O9VA 3QGJA 4JZDH 1LVOA 3S7HB 1O3JA 2A31A 3V13A 3A7TA 1S0RA 1LHCH 1B5GH 3ZZ4A 3E91A 1Y5AT 5C1XA 1EASA 1GI5A 5DG6A 2EI7A 3ZZ9A 3D49H 2XBWA 1FNIA 1Y3YA 3K6YA 3SV2H 1AU8A 1E34B 1QB9A 3RXAA 1SFQB 3CS0A 1FAXA 4RKJB 3U98H 6GCHF 2OLGA 2R0KA 2ZQ1A 1W10U 1EZSC 2SGDE 3TGJE 4BANB 2ULLA 1GHBF 4Y8XA 4CRDA 1TE0A 3A8DA 3GY3A 2VINA 1LPZB 4Z0KA 1WV7H 2QXJA 5EW2H 4ZMAH 2VIOA 3ODDA 1CHOF 2C8XB 1SGPE 1MAYA 2AIQA 2EA3A 3UR9A 4OGXA 1EPTA 5JDUB 2VGCB 1O2HA 4WMDA 1IQFA 1TGCA 3VB7A 2JH6D 4Y79A 3ZZ5A 1RXPA 2ZHDA 3T62A 2OBQA 4NZLA 1YLCA 1ESBA 5FX5A 1NO9H 3S69A 1HAOH 1KXDA 2GCHF 1F0TA 1CGHA 4K1SA 3PMAB 2ILNA 2XWBI 4D7FA 3SZNA 4X1SU 1PPBH 3STIA 1GBMA 3FP7E 1HAVB 2OC0A 2XC5A 3GICB 1HAHH 4JZEH 5C3NA 1SLWB 1B7XB 4Y7BA 4XOJA 2BOKA 3T5FH 3U1JB 1IQNA 1HAYB 2C8YB 1XMNB 1XKAC 3V7TA 3UPEA 2Y7XA 2C93B 1VCWA 1GVZA 2BQ7B 4O03A 2PGBB 2Y80A 1MUEB 1S84A 4FUBA 5GJ4B 1GJ4H 3M3VA 1YPKH 1QA0A 1AB9B 3DHKH 3S9CA 2AH4X 1QCPA 2FYRA 1SQAA 1V2MT 4CHAB 3NCLA 1BJUA 4KTCA 1YKTA 3LH1A 1TGBA 2KAIA 3SV6A 3E8LA 1GGDB 2AIPA 1LVYA 3ZZAA 2P94A 1AN1E 1V2ST 2JETC 2W3IA 1O37A 5PTPA 3E6PH 1OWJA 4WMEA 1C1UH 1OXGA 1ZZZA 2QA9E 2FOCA 2WPMS 2WYJA 1LHDH 2J34A 1JRSA 1K1OA 2TGAA 4HZHA 8GCHF 1C1WH 1SC8U 3JZ1B 5DP9A 3RU4D 3EGKH 3LDXH 1YCPK 4U32A 2GVFA 2NU1E 2PHBA 1INCA 2BYAX 4NFFA 5AFYH 3OY5U 3MNCA 1A3EH 4ISHH 4AORA 2BD7A 3S9AA 2GT7A 2V0BA 2ZP0H 5T6GA 1KDQA 5IDKA 3ZVCA 1ORFA 3DFJA 1O2GH 3ATMA 1IQKA 1ID5H 1SQTA 2Z9IA 1K22H 2ZFSA 1MD7A 3F9FA 2WYGA 1AUJA 3PROA 1QR3E 4AFZA 3RXDA 1VITH 1O3HA 1P8VC 2SGFE 4B2BA 2Z9GA 1BIOA 1TMBH 2OC7A 1HAPH 3SJIA 1XXDA 3M35A 4LOYH 1ELDE 2ZTYA 1P09A 3BSQA 4X2XA 2IOTA 1EZUC 3TIUA 3RMMH 1GL1A 1UVOA 2BDHA 4B76A 4ABDA 1P11E 3MHWU 1DITH 3PO1B 1HIAA 1O5CB 1TBQH 5A0BA 1ZTKA 1XX9A 1GJAB 2J38A 2VIDA 5EPYA 5L30H 1VITF 1S6HA 3E0NB 3VEQB 4OS6A 1GHVH 3SJ8A 2R2WU 1B0EA 1IQIA 1G3CA 2STAE 4U30A 3PB1E 4AX9H 4SGBE 1UCYH 1GBAA 1FPHH 4D9QA 1WYKA 1UTQA 3UWJH 4OS2A 4CH2B 4LXBH 4E7RG 1UO6A 3SU3A 2XBYA 3SU5A 3M36A 1YC0A 1O2OA 2NU4E 2FYQA 5CE1A 4WWYA 1K9OE 2V3OH 2Z3CA 4X1QU 4NIWA 3SO3A 1QTFA 2OD3B 1NY22 1ARBA 3DA9B 1MTNB 1C5PA 1KYNA 1RTLA 2WV5A 4ZROA 2HOBA 3LH3A 2Y82A 3GOVB 3KIDU 4JK5A 4Y0YE 1YPLH 1SG8B 4NWKA 1YGCH 1H8DH 2R9PA 5DPAA 2CF8H 3GY6A 1P10A 1ZMLA 4ISOA 3ZVAA 1HJ9A 3KQCA 1GJCB 3UNRA 1TX8A 2F3CE 4AGKA 1ZSKA 2UUKB 2ANWA 1C5TA 1NTPA 3P17H 4XE4A 4D9RA 3LGTA 1FQ3A 4X8UH 3P8NA 3S9BA 4Y8YA 4UFGH 5I46H 3GYLB 2A5AA 1GI4A 1NZQH 5E0GA 3TH2H 1C5SA 1CE5A 1ZTLA 1MTVA 4ASHA 1E36B 1TA6A 3MU4A 1DFPA 1C2HA 1ELFA 3QWCH 1YBWA 5DKMA 2QCYA 3GY5A 3TPIZ 4NWLA 3RXLA 3SHCH 3NWUA 1QRZA 4ZHAA 1A2CH 1KY9A 2A1DB 1W7GH 5EGMA 1RRKA 1J16A 1O2UA 1XUKA 2Y5FA 3NK8A 5ETXA 3KL6A 1SGIB 3Q3KA 4LZ1H 1JIMA 2FM2A 4ZXYH 1EXFA 3QTOH 1O36A 1O3MA 4CRFA 1AWHB 3M3SA 2ZU1A 1TQ0B 1IQGA 3SGQE 2V6NA 1Y5UT 1MAXA 2HLCA 1KLIH 1IHSH 1FLEE 2I6QA 2TRMA 3DUXH 2VGCC 3P92A 4Y10E 1QRWA 3BTFE 1RTKA 3SI3H 4AYVB 4YT6H 1HAVA 3BTQE 4JZ1A 1GHYH 1ZGIA 3LC3A 2AMQA 3BEIB 3P6ZB 1TB6H 4AG2A 1K2I1 5AHGH 2J95A 2ZU3A 1K28D 2H1UA 3HK6B 2FI3E 3BTGE 3MU1A 1O2VA 1GDQA 2Z7FE 2XNIA 1CBWC 4K69A 2K1QA 1EX3A 4ZKOU 1TABE 1EP5A 3PMJA 3O8CA 2Z94A 2J9NA 3P8OA 3RM0H 2VH0A 1S83A 2A45B 3SORA 4B73A 3TVJB 2BQ6B 2XWAA 1H9HE 3CP7A 3RXQA 1MTWA 5E0HA 5G4BA 1D3DB 2FTLE 1XUJA 3VGCB 1F92A 3MFJA 1GI8B 4KTUA 4KKDA 1BHXB 1OWEA 1MCVA 1GJ6A 2BDCA 3SUEA 1AB9C 2OINA 2ZPSA 4FUFA 5GCHF 1ELCA 4GCHG 1UTNA 4NCYA 2BY6X 4CHAC 3FP8E 4ABEA 1DWBH 1T32A 1VGCC 2A7CA 1QJ6B 5JB9S 1AGJA 2ZDMA 4FU9A 1P2IA 1GBLA 4AYYB 1AKSB 5GXPA 1TPPA 2Z3EA 3BG4C 2BTCE 1CA0B 1W3CA 1C1NA 4B75A 1W14U 3SU1A 2ZZUH 1AE5A 4JMYA 3ZZ6A 3VFEA 3P8GA 1HXFH 2RCEA 1JRTA 3U8RH 1KXAA 1O5BB 3VB3A 4Y7AA 4NIXA 3T25A 1RFNA 4FXGH 3R3GB 3BF6H 1ELTA 4BTIB 2BY9X 3RP2A 1O30A 3VB6A 2XBVA 1BJVA 1TALA 1AUTC 1MQ6A 1O2KA 3ZZDA 2SGAA 1SGCA 4K2YA 1O3EA 1IQJA 1EOLA 4MNYA 1T8MA 1LKBA 1D4PB 3BTEE 2PW8H 1GHAF 4ISIH 4DT7B 1G30B 2RDLA 3PLPA 5HYOA 3NZIA 1UTOA 2F83A 1O3OA 4RKOB 2AEIH 1V6DA 1QA7A 4JCNA 1LKAA 1ELBA 3AVZA 5CHAB 4K5ZA 5EU8A 3A80A 1L0ZA 3GDUA 2ALPA 1PQ8A 1TA2A 2B0FA 2ZG0H 4MPVA 1C1RA 2C8WB 2D8WA 1E38B 1F5RA 2ANKH 1Q3XA 3EAJA 1KSNA 1PPHE 3B23B 2F91A 1O5DH 5E8EH 3PO1C 1GMDG 1OKXA 2ZFQH 1AE8H 4INKA 2BMGB 1C2IA 1YYY1 4FU8A 3GCTG 1F7ZA 2R3YA 4ZHMU 1O31A 1OS8A 1UTLM 3RXIA 1O2IA 4YLQH 5A8ZA 2ZPRA 1G2LA 2C8ZB 3KEEA 1K1NA 5JYIA 2J94A 2ZHQH 3L6PA 4MLFB 4GLYA 3QGNB 4NA9H 3TK5A 4JZFH 3UY9A 3SBKA 1FY5A 1PPGE 2VU8E 1GJ5H 1LQEA 4IC5A 2BDBA 1CT4E 3RC6A 2HWLB 4MQAA 1OWDA 6LPRA 2BVSH 1G32B 1K1IA 5L6NH 2VIPA 4WXVA 1O5AB 3A89A 1MTNC 2ZDKA 4O3TA 1BMAA 4GUXA 3CENA 4GPGA 5DP4A 1Y59T 1O3FA 3GY2A 4NZQA 1FONA 1SOTA 1DXPA 2FXRA 1GPZA 1F0UA 1FY8E 1W8BH 2Y5HA 4X8SH 1DWCH 1YLDA 4FUCA 2G4UA 1OP0A 3RXGA 1UHBB 3UFAA 2PSYA 3O8DA 4YM9A 1GJBB 2FWWA