1QLBB

Respiratory complex ii-like fumarate reductase from wolinella succinogenes
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Fumarate Reductase from Wolinella Succinogenes at 2.2 Angstroms Resolution
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
total genus 61
structure length 239
sequence length 239
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 1999-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1qlbB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qlbB01
1XLNA 2L52A 3FAHA 1FXIA 1ZP0B 4YT0B 1JWAD 3EUB2 3LB8C 3W5UB 2Q5WD 3SFDB 1T3QA 3AN1A 3NVYA 1QT9A 1WWTA 3NVWA 4JWUC 1E10A 3P4PB 2HTME 2MJ3A 4WWMA 1RFKA 1R7SA 5EE3A 1E9MA 3CWIA 4YTMB 5AUIA 2PVOD 3AEAB 3P4RB 2DBYA 3W5VB 1RM6C 4KX6B 1J7BA 2LEKA 3NVVA 1XLOA 5H8YE 2WU5B 1J7CA 2M19A 4YSXB 4FXCA 3WCQA 1A70A 4P6VF 3HVZA 3BIID 5C2TB 3HUIA 3DWGC 3ZYYX 1QF6A 2KAJA 4ZHPA 3AEGB 1VDVA 4YTNB 1V8CA 1YQ3B 1N63A 3AB5A 1ZUD2 2M56B 3PO0A 2K22A 1FIQA 4HRSA 1TYGB 2MH7A 2WP9B 1N60A 4IDIA 1TJEA 5EE1A 5H92C 1QOBA 1WGKA 1XLPA 4USAA 2L83A 3AE5B 1QOAA 2BS3B 1PUTA 1SF0A 1YJIA 3KWLA 2WS3B 2AX5A 4JWSC 3SR6A 3W9CB 3VRBB 1FXAA 3AMZA 1B9RA 1FRDA 1JALA 1ROEA 1NI3A 3AE7B 2JX5A 1JROA 3FC4A 3AEEB 1N62A 4ZOHC 1L0VB 3AE2B 1NENB 1QLBB 1JWBD 1KFYB 3L4PA 2WQYB 1RYJA 3RPFC 2QJLA 1E7PB 1NVID 1FFVA 3AE6B 3VRAB 1N61A 1V97A 3B2FA 5G5HA 5EE0A 1H7XA 3AEDB 4YXDB 1ZXIA 1DOXA 4YTPB 2ACZB 2FBWB 1DGJA 2H89B 4YSZB 3VR9B 4ZHOA 1AYFA 1J7AA 1PDXA 3HRDD 3NVZA 3SFEB 1SB3C 2CU3A 1H7WA 1KRHA 1N5WA 4C80A 3ETRA 1QOGA 1SIJA 3AEFB 1JQ4A 5MPOA 3CF4A 1TKYA 1YQ4B 3P4SB 4C7ZA 1L6UA 1VLBA 2BS2B 2PVGC 2WU2B 1IUEA 1I7HA 2E3TA 1L6VA 1FFUA 2H88B 5G5GA 3AV8A 1NEKB 1NYQA 2Y5CA 4HROA 2EKIA 1ZOYB 1JW9D 2N0SB 3AE4B 4C7YA 5AUKA 1FM0D 2BT6A 1JRPA 3AE1B 4LTUA 3AM9A 4N59A 1OQQA 1FRRA 2PKOA 3AECB 1UWMA 2CJNA 1TKGA 3VR8B 3AE9B 2K5PA 2W3SA 1DOIA 2WLBA 1RWSA 3ABVB 1VJKA 2W55A 1WXQA 1GPXA 2CJOA 4WQMA 1FMAD 3NRZA 3P1MA 1AWDA 1GAQB 2MJEA 2WDVB 4ITKA 5EE9A 3P4QB 4US8A 1OQRA 1N5XA 2MJDA 3AE3B 2BS4B 2B76B 3AEBB 1CZPA 1WYGA 4JX1C 1DOYA 1GT8A 3CIRB 1PFDA 3DWMA 2OHFA 2WDRB 2JQRB 3LXFA 4N6EB 4US9A 1E6EB 3AE8B 3AH7A 1CJEA 5C3JB 1OFFA 2DWQA 1GTEA 1EWYC 2PIAA 4A9AA 1XO3A 1QOFA 1GTHA 3B2GA 1NYRA 1F0ZA 1FO4A 2WDQB 4YSYB 1KF6B 2QIEB 2W3RA 1XLQA 2KMMA 5GXGB 1E0ZA 3NS1A 1WRIA 3P63A 1YJJA 2G1EA 2W54A 1L5PA 2K9XA 4N58A 3B9JA 1TKEA
chains in the Genus database with same CATH superfamily
1ZP0B 3EUB2 3PHXB 1WWTA 1M94A 2CHXA 1R7SA 4MDKE 2J52A 4KKIA 2PVOD 2EKEC 3NS8A 3U7ZA 2LEKA 2WU5B 1YN3A 3JW0X 2KZRA 4RGOS 4EKUA 2KN4A 3VHTC 4P6VF 2J53A 3MC0B 2KO3A 1EUVB 1PUTA 4WURA 3ZVVA 3KQ4A 1EO6A 1XT9B 2L00B 1QLBB 4E71A 3NUHB 4II3B 3EFCA 3Q14C 1N61A 1RAXA 2GI9A 2MBBB 4WJOA 3H7PB 2KJ6A 2VRRB 1NI2A 2IGHA 1F2RC 4GU2A 3CF4A 4WH4A 2FIFA 1ISNA 2WU2B 1KLUD 2PJHA 1FEHA 2JWZA 3WAPA 3TMPB 1YQBA 2AQ3B 3C0RB 1WYWB 3VVWB 5HKHA 3M63B 3PSEB 4E74A 4ICUA 2JF5A 1PFDA 3CIRB 3ZTCA 1WJUA 4GXBA 4C4VA 2IGGA 2BBCA 1R4NB 3APDA 2RPQA 2R2QA 3MP9A 2M1MA 1PGBA 4K7WA 2D3GA 2RDBC 1TS4A 4LNFA 2MJ3A 3N1YC 5J17A 3ZJUA 4GMVA 2DBYA 1CMXB 3NG0A 2KTFA 4TUUA 1L0XB 1J7CA 2D11A 4MGKE 3DWGC 3W2DA 1N6ZA 3WALA 1LQBA 4BFRA 4ZRPA 3QCAA 1WGKA 2IO2B 3KWLA 3R2TA 1XCQL 3QARA 1R4MI 4K7SA 3ZKJC 5KHOA 1WJ4A 1I4HA 2WXRA 1LM8B 2KOXA 3VR9B 3H7PA 1E7VA 3SFEB 4WJNA 2DYMA 5HI1A 2Y3AA 3PPAA 2VH1A 2BS2B 3Q8BA 1IUEA 2MCNB 3RFZB 4DBGA 3D32A 2RD0A 2BT6A 4KIKB 3IBEA 2KC1A 3Q3NC 1RLFA 1FD6A 1NDDA 2NBVB 3P1MA 4YWGG 1YD8U 5HHDG 3DBHI 3AEBB 2BW2A 3IVFA 4I6LB 4KV2A 5CTRC 2LD9A 3UGBB 4AQ7A 1C77A 2DAJA 3B08A 3DHGC 5D6JB 5D2MB 1F77A 3L10B 3NZSA 3BVMA 2MWSB 3DPDA 2I1JA 4RF0A 1QT9A 1E10A 2G3QB 3NVWA 3DOWA 4GDKA 2PLPA 2C7MB 4G3XB 3AXCA 3QC8B 1D6EC 1ZKHA 1UELA 3ALBA 3AEGB 3MJWA 2JU6X 3Q3JA 4G0NB 1ZUD2 4HRSA 1VD2A 4AJWA 2WNMA 1YJIA 1WSPA 4BVUC 1D4BA 2G45B 1IPGA 4LDTB 2N7EA 1WR1A 2JX5A 4RH6A 1UGMA 4NJ6A 2KYWA 1ZDVA 3AEDB 3M3JA 2ZVOA 4NNJB 4TMAB 2YEPB 1KRHA 1QOGA 2QDFA 2BKRB 1R4MB 3FILB 2JT4B 2KDMA 2XBBC 1MG4A 2HD5B 2QILA 3RD2A 4DDID 3X23A 3KWVA 2HJ8A 2JRIB 1XF5L 2BYFA 1Q1OA 1WE7A 4DK5A 1E8XA 4GB9A 2J0KA 3A9KB 5EE9A 2QMTA 1E8WA 4TSSA 2J7QB 3QHTA 2DZJA 2JZPA 2WXJA 2PIAA 4BBNC 2KX0A 2UU7A 2KX3A 1XXGA 5CHFA 2JRHA 2N9PC 4W9FA 5E6NA 5JH5C 1WRIA 2BB6A 4KGSA 1L0YB 4H2AA 5BMGA 1VZ8A 4XC2A 3B1LX 1JWAD 2D5GA 3H6NA 1XD3B 3PS6A 3IAS1 3K9PB 1XLOA 5BYSA 2LRUA 2K8CA 1V6EA 4M00A 3H1UA 3ZTDA 3AU5A 4LCDE 1VDVA 4BBNF 3ZXRA 5IA7A 4FLHA 2I2YA 1ROEA 1UGJA 1JROA 2WGSA 4ZOHC 1AW7A 3MC8A 4LNKA 4IM2A 2GRIA 2LGIA 2QEJC 2PTLA 1K51A 1PGXA 4ZHOA 2V3PA 2SEBD 3QJZA 3GS2A 2KTRB 1KLVA 4A90A 4XWTA 1WMHB 1D5ZC 3T9LA 1VCBA 2LWPA 1YN4A 3QAQA 2GBMA 3KW5B 4ASWC 2WXHA 5TR5A 2RR9A 1L6VA 5IO9A 5G5GA 2KFKB 3DBHB 2HE7A 2YEPF 4AS1A 2PKOA 2AQ2B 1P7EA 3L0WB 2KLGA 4MJSB 4A3PA 4PYZA 1WRDB 2W55A 3I9V1 3U8ZA 1ACCA 2O6VA 2OEDA 3T3NA 2OHFA 1TS2A 2FCSA 5IOIA 3LXFA 2KJRA 1XO3A 2PMVA 3PRMB 5C1ZA 2KLCA 4AJYB 2QIEB 3NY5A 2W54A 4HDQA 4N58A 1UF0A 3LB8C 3AN1A 2NMQA 1PGAA 4JGHB 5IP4D 4L2YA 3JSVA 1V1OA 3OLMD 2IDYA 4YSXB 5FR3A 5C2TB 3R2IA 4LJPB 3VAWA 2Z8LA 3DQVA 4A20A 2M56B 3RNCC 3RNBC 1BXTA 1FPYA 1L4ZB 2A5UA 3A9JB 4EE2A 3BK2A 3A1QB 4NAWB 4P7IA 2IO1B 4PK1A 1WGGA 4EZJA 1FRDA 1I4XA 3TCAA 4W9HA 3RMKC 3NJTA 5BO4B 2MBHA 1WR6E 2JXTA 5DPRA 1SE4A 5AEKB 2DNFA 4DXGA 1PDXA 2NBUA 1H7WA 1MHXA 4C80A 2YVCA 1UUPA 3DVGY 1JWMD 4OZAA 5D7GA 2PVGC 4JE3B 1YX5B 3AV8A 1NEKB 1U4AA 3PLVA 5BYRA 1JW9D 4ZYNA 2KVRA 1JRPA 4F8CB 2W82A 2Z0DB 3AM9A 4MM3A 3V60A 4II2B 2LMCA 4GN1A 1WM3A 1ET6A 4ICVA 3WA0A 2CHWA 1I4PA 3V6CB 1GAQB 3P4QB 3N1ZC 4LDTD 2W9NA 3ZGZA 2HDEA 2KMAA 3N32A 4MSMB 4RGMA 3L08A 2WDRB 1SBBB 1C3TA 1LGRA 3AH7A 2Z0EB 3B2GA 5KHQA 1FO4A 1KF6B 4IUMB 3C8YA 3BWUD 1PQSA 3B9JA 4NJCA 4RGTA 5DCNA 1KOTA 1UWXA 2GBRA 2N9EB 1OEYA 3BYYB 4GDLB 3SU8X 5JHAA 4LNOA 2N1WA 1RM6C 1WIAA 2VH2A 3W5VB 4W9IA 3U4EG 4JQWC 1UBIA 1T5XD 3DBSA 3EECA 2SAKA 2J42A 1WXSA 3O13A 3PRZA 4J6IA 1E7UA 3PZ8A 4CO7A 1R4NI 2V9HA 3DVNU 2LXAA 2L83A 1P9DU 3TEXA 1BMLC 1NI3A 3AEEB 2WXGA 3TEYA 3A9KA 1JWBD 3N9YC 5BMIA 3VRAB 5G5HA 1QZEA 1TZ1A 5EE0A 2ON8A 1JWUD 4WIPA 3DBLB 4DHZB 2MA9B 1IBXA 4MT5A 1D5MC 3IAM1 2QCZA 1JQ4A 1V86A 3RCZA 2O2VB 3KUDB 1P7FA 2RPVA 3HHMA 3ONSA 4W9LA 3UQBA 4NZLB 3VFKA 4L1BA 3HIZA 3KH0A 2IJ0A 1WZ0A 4NJ7A 2CJOA 2IYDB 3Q2AC 1V80A 2DAFA 2N7JA 1WFYA 2CHZA 3N3KB 5LXHA 3PREA 4K81A 2V3NA 4A55A 3DCGA 1HZ5A 3RULA 1LXDA 1SE9A 3NS1A 2KANA 2KXJA 1C79A 1WF9A 2K9XA 5IKCM 2L52A 3W5UB 4YT0B 1H4RA 1K50A 2UYZB 1FNVA 2NTTA 2L32A 2RMMA 3HVZA 3ZJVA 1WX9A 3EFUA 4REZA 2MBEA 2OJWA 1HTOA 2RDGA 2DYBA 1V81A 3AE5B 3HM3A 2C60A 2WXPA 2KDFB 5L83A 3Q69A 2N4FA 4E3CA 1EWCA 2C7HA 4F1SA 1KH0A 1V97A 1HTQA 1XQQA 2CU1A 2XNAC 4IKGA 3EC8A 4W9CA 4IWQA 2LXCA 5FKAC 2BGFA 4KVGB 5G2NA 5DPTA 2D07B 1V49A 2REXA 2G4DB 2O2VA 5IN7A 1NYQA 4IOIE 4HROA 3CMMB 3U30A 3R3MA 2KC2A 2WXQA 4MACA 2FNJB 1ZPSA 1Z5SB 2ZEQA 2JZZA 3BYTB 1SE3A 1STEA 4PT5A 1VZ7A 3JSVB 3RYTA 2LZ6A 2D2QA 4GSWA 1AWDA 3I63C 4JX1C 3FKYA 2NBWB 1HQRD 2KFJA 3RNGC 3V61A 3AE8B 2ZJDA 3J9CA 3PZ7A 4B0EA 1GTEA 3A33B 4MGIE 5GMVA 1L7YA 1TY0A 3RUIB 5BMHA 3A4RA 3CF6E 1E0ZA 4R3DA 2WYQA 2ZW1A 1K53A 2MX2A 3ECIA 4IW0A 1C4AA 2XK5B 3P4RB 1J7BA 2WXFA 3R7RA 3DHHC 2LHDA 3KYCD 1A70A 3HUIA 5D94A 3RZFA 2ZPNA 4HJKA 2K6QA 1GJZA 2WXOA 4RM9A 3HM6X 4K7UA 1QOBA 4HPPA 1LO5D 3SDLC 4TQ0A 2LJ5A 1K52A 3VRBB 4WWNA 4BAXA 1B9RA 1WGYA 2PW9A 3AE7B 1I42A 2KK8A 2HJ1A 4LLGM 1WXAA 4EZKA 1GOZA 1MPEA 1T6BX 2D3BA 3KUCB 4CHKA 1NVID 1FFVA 1V1PB 1YN5A 1TGZB 3DVGX 3IT4B 1ZDXA 4DHJB 4ZRIA 4MEMA 4NAMA 5E6JA 2K25A 3P42A 2PPHA 2UWQA 3ZDTA 2D3CA 1ZOYB 2N0SB 2K0PA 5AUKA 3TBLD 3AE1B 5HFYA 3TJPA 2MLBA 3UQAA 2GOWA 1SE2A 5LLIA 3AE3B 2M0XA 2B76B 2EELA 4RMAA 4MJSA 2WXNA 3V6EB 4M8MA 3V05A 2GBKA 2AYOB 4KZCA 4OHJA 2FCQA 4KKJA 2WDQB 4YSYB 2L76A 4GGQA 2RDHA 2KQSA 2G1EA 1F2RI 1XLNA 3FAHA 3VXWA 1FXIA 2WHIA 3Q6BA 1ZXHA 1BT0A 1RFKA 2DHZA 3M62B 4RF1A 2IZVB 2K8BA 3NVVA 1JRUA 1RRBA 2ZCBA 1T0QC 2INCC 1QKZA 4ACFA 2KAJA 4LJOB 1SSNA 4XDDA 3MC9A 2K3UA 1FIQA 1TYGB 1Y8RC 5EE1A 5EDSA 2JSVX 2BTEA 1V9JA 1E90A 4USAA 1FXTB 1MFWA 1SF0A 4AUQC 4BOSC 1C4PA 1C4CA 3KYDD 5DPWA 4ZYSA 2N9LA 1RYJA 3A9JA 4ZDVA 3B2FA 4NAWA 1ZXIA 1V5OA 2K1FA 3TIXA 2KD0A 1AARA 3N1XC 4I6PA 2V3SA 1TS5A 3IHPC 2MBOA 2MP2B 4PS3A 2E6XA 3C19A 3V62A 3NZ3A 2LUEA 4N59A 5BYQA 1YOVB 3BINA 4X57B 3GOEA 3PLUA 3VQIA 4HWIB 4WJPA 2MJEA 1WYGA 3RNAC 2FE8A 1T0SC 1IGDA 1FNWA 1GC7A 3VUXA 3MJ5A 3UI3A 1C1YB 4QAYA 2V4LA 3W1SA 1NYRA 2OJRA 2A4ZA 2BWFA 2BF8B 2NCNA 2KDEB 3TEWA 4FJVB 2N7DA 2I1KA 2BPSA 1TKEA 1SXTA 3KUZA 3NHEB 4HK2A 4GDKB 3KVFB 2JWUA 2JPHA 5H8YE 2MP2A 4IM3A 2WX0A 4BZAA 4BKSA 2LUMA 1TBEA 3ZUNA 3ZYYX 4JIOU 2MEKA 3AB5A 2J0MA 2ZVNA 1UNSA 2Y5BB 4MGYE 2AL3A 5H92C 4CQNA 1J19A 3SR6A 4TQ1A 4M02A 3Q3FA 1WI0A 3FC4A 1FCCC 2KKCA 3ZIMA 3L4PA 1F1HA 1E7PB 4YXDB 2EMSA 2ACZB 1DGJA 2EMTA 4URKA 2M17A 1WGHA 1J7AA 3QQ8B 4FHKA 4P1BC 3T3OA 2G4SA 5LXIB 2FAZA 4A3OA 3UF8A 4K1RB 3HVDA 1IBXB 4AOFA 2EKIA 1C78A 3AE4B 2FCNA 1D3ZA 2XK5A 1TKGA 3U7DA 2LVPA 3R8BA 4XZ4A 1VJKA 2WXIA 4W9GA 4WQMA 2L7RA 1WXVA 2NTSA 2INDC 1DOYA 1CZPA 1SGHA 3RT3B 3ZRCA 1L2NA 2PEAA 2DWQA 1IYFA 2BWES 3S2AA 1V5TA 2KN5A 1SJED 1HA5A 1M4VA 4HLEA 1D5XC 2IO3B 2CKHB 2N9KA 1WE6A 1T0RC 4WWMA 4FBJB 2KNBA 4MM3B 3BY4B 2C9WB 2KACA 2JY6A 1UZXB 2DZKA 4KIKA 4HPLB 4FXCA 5E6PA 3MHSD 2D3AA 1N63A 1WY8A 2MHJA 1PYWD 3PV1A 1WX7A 3Q8EA 4XX5A 4LNNA 2BYTA 1ZGUB 4ZRJA 4C00A 3AE2B 1L4DB 2QHOA 3GP7A 3DBLI 5CHWA 2FBWB 4G50A 1EM7A 4D2KA 5CX3A 1AYFA 1SB3C 5AZFA 2ZCCA 1WMHA 4DXAB 3ZW3A 4DXFA 5MPOA 1TKYA 1WJNA 1EF1A 3BVGA 5JZEB 2NVUI 3W1SC 3PGEA 3AU4A 4FA6A 2DX5B 4WWOA 3ZNGC 3AECB 4XYCA 1HEZE 4ARIA 2LHEA 4KSLC 3ABVB 4A6QA 1FMAD 1WGRA 3H8HA 4OVZA 2MJDA 2L3ZA 4AWJA 2KWVB 2AWTA 4ANWA 4ZRQA 2K39A 3DBRB 3K9OB 1P1AA 1SJHD 4W9JA 1EWYC 1Y56A 1S3SG 5DPSA 4J3OD 4OZBA 4NY0A 3Q3OC 3UIOB 2AEHA 2JUOA 2L0TA 1MI0A 1WM2A 3P4PB 2HTME 3AULA 4TV3A 2KHWB 3N20C 3RNEC 3AEAB 2DZMA 5AZGA 4IM0A 2KDBA 1QF6A 2ONQA 3PVLA 1YQ3B 4KGRA 4OVUA 2O6VD 1E8ZA 1IP9A 1MG8A 4W9KA 1J0GA 1TJEA 4OZCA 1GNUA 3A1QA 4RGNA 3VTUA 2JYTA 2WS3B 4GOCA 1JALA 3ZLZA 1N62A 1TIFA 1TT5B 4RNAA 2WQYB 2IY0B 3AE6B 1X1MA 1H7XA 1DOXA 1YMHE 4KDLB 3NVZA 3HRDD 2QC8A 1WGDA 2D10A 4M0WB 2VZKB 2V1YA 1VLBA 4BKGA 1EF5A 3L54A 4W9EA 3AI5A 2JVCA 1ET9A 5TSSA 4I6NB 2M0AA 4KZ0A 3ZDMC 2ICIA 4HEA1 3WAOA 1OTRB 1T0YA 4US8A 1N5XA 3APFA 3DHIC 4B0MA 2G9HD 2L05A 4N6EB 4B9KA 4XWWA 4ARCA 2PE6B 4B6WA 4NQLB 1QOFA 3ENEA 1TS3A 4WWPA 4FHJA 4YL8A 3A4SC 2NR2A 4KDIC 3BVZA 2N1VA 1TZOA 4ZRKA 3NOBA 2Q5WD 3SFDB 3NVYA 3X0WA 2OOBB 3IFWB 2X38A 1RFAA 3HK0A 3CWIA 4YTMB 1QILA 4JL9A 3JVZX 5AZHA 4KX6B 3SHQA 1I4QA 3I5JC 2FUHB 2M19A 2V0GA 3GZNI 2WX1A 2BQQA 4HPMB 4ZHPA 2LASA 3L16A 5JXVA 3PO0A 1HZ6A 1ZW7A 3MFGA 4FULA 3WIMA 5I4DA 1QOAA 3MHZA 2BS3B 3VH4B 3AMZA 2IO0B 2RGFA 3EGRA 2KDIA 1ESFA 1L0VB 2LI5A 4F7ZA 3QWZB 3BZDB 5T8IA 1WZ3A 4YSZB 1CQVA 3IG3A 1WXMA 3GE8C 4DHZE 4XGAB 2LVQA 2KTRA 4NQKE 3TL5A 3AEFB 2K8HA 3VUWA 1GUAB 2KVZA 1L6UA 1FNUA 2BKFA 4GDLA 4OVVA 2E3TA 2BYVE 4HCNB 4MELA 1C76A 1SEBD 1Q5WB 2DZIA 2J0JA 1OQQA 3ZNZB 2CJNA 3I57A 3ZNID 1P3QU 4HKQA 2HTHA 1GPXA 3NRZA 1J8CA 3EHVA 2AQ1B 2KWUB 2LGXA 3U2SC 3OAWA 4C4VB 1UD7A 1GT8A 3DWMA 4EZLA 4US9A 4A9AA 4L23A 4JLCA 2NPTA 4B95A 3L17A 2WXLA 1XLQA 2M8SA 3VUYA 1I4RA 3P63A 4RFBA 1L5PA 1VR9A 3QA8A 4KGTA 3VH3B 3Q3MC 1OGWA 5D3IB 2AL6A 1T3QA 4ANXA 2I38A 1QQRA 3Q8AA 4JWUC 3V3XA 1KTKA 3N30A 2KQ7A 4GIVA 3WANA 5EE3A 1E9MA 1YJ1A 4P16A 3P2BA 1E8YA 3OWEB 1EU4A 2GBJA 4EEWA 4CYEA 3ZO5B 4A8XC 2K22A 1GB4A 4ANUA 5L95C 2ZNVC 4WAAA 2LVOA 2ZW0A 4N9F4 1A5RA 2AX5A 2NS5A 2Y5PA 5FR6A 2JZ3B 3VTWA 2NPTB 1P98A 2Z59B 4PYUA 2PE9A 3R66C 4S0RA 1IGCA 3T8MA 4MSQB 3W1YA 4YTPB 2ASQA 4S17A 1VZ6A 4BOZB 5C23A 1MHHE 1XEEA 2C5LC 1N5WA 3H7SA 3ETRA 2BYEA 2LGDA 4FADA 1TY2A 1AN8A 4HDOA 1ZE3D 2CS4A 3OJ3A 3DDCB 4BKSD 2H88B 1DYQA 3R7QA 4C7YA 2GLSA 2GMIC 4MH0E 4LTUA 3KLSX 4DWFA 1FRRA 1XCTL 3OJ4B 1OQYA 3VDZA 1WXQA 1WH3A 5CHVC 2IPKD 4ITKA 1OQRA 1Q10A 2RSUA 1S1QB 3GB1A 4HJGE 1CJEA 1OFFA 1JMLA 4HCPB 2KMCA 1GTHA 2MRPA 2QSDA 1F52A 1F9JA 5J18A 2KMMA 5GXGB 4RCOA 3ZXVA 2ZPYA 4DQOC 3GZNB 3E56A 1V2YA 4HKZE 2FCMA 1GG3A 2IBIB 2VZKD 3Q8CA 5AUIA 3RNFC 5G55A 4KSKC 3DVNV 3RN9C 4IG7B 3WCQA 2ZNVB 2X8XX 2MQJA 4YTNB 1KJTA 2GBNA 3LDZE 2R2OA 2LRWA 4PS7A 3UINB 3APCA 4TKNA 2MH7A 2WP9B 1VRAB 4IDIA 4EOYA 3OG5A 1XLPA 4FN2A 2C7NB 1HE8A 4OW0A 3W9CB 2WDTB 2MBQA 2JXXA 4M01A 2JYEA 1KFYB 1UH6A 3RPFC 3IXSA 2QJLA 3VTVA 2FIDA 4XDCA 2XN9C 3FILA 4WJQA 1MJDA 2XEWA 1LFDA 2CU3A 4K3CA 1GB1A 4IC7B 3RI7C 3O65B 1YQ4B 3P4SB 2BB5A 3ML9A 4K3BA 3UIPB 1I7HA 1FFUA 2TSSA 4UDUC 1FCLA 2Y5CA 1HXYD 1G6JA 2DLBA 1FM0D 1K8RB 4DDGD 4WQOB 1UWMA 3CSFA 3VR8B 5IAAC 2K5PA 4Q2JA 3PT2B 2WLBA 2LJIA 2ZZPB 3EA6A 2INPE 1GC6A 1OEYJ 3Q8FA 3URYA 2BS4B 1Q0WB 3M95A 3L13A 4JPSA 4BKTA 2L1AA 1E6EB 2W3RA 2IY1B 4XE0A 1NBFC 1UBQA 1YJJA 1V1PA 3ZQ4A 4FJZA 5FK9C 4NPNA 3QX1A 1JCKB 2N9XA 2CR5A 4LNIA 1Z2MA 3ZNHB 4HVBA 1E5WA 3MTNB 4MH8A 4GLSC 4AP4C 1BUIC 1YNTE 2KQ4X 5J2RA 1WX8A 3PRPB 1I35A 2L8JA 4IWPA 3ZRFA 2KWDA 4IWOA 1WJ6A 1MVKA 2M4NA 3BIID 3WAMA 5E6OA 4RM8A 1V8CA 2DENB 2GB1A 3E9SA 2MW5A 1YX6B 2KT7A 1N60A 1KLGD 3ML8A 4EUTA 3ZJTA 1H8CA 1EU3A 3U52E 2WXKA 3PHWB 3GE3C 4JWSC 3SD5A 1FXAA 2KWCA 2DYOA 1I4GA 4W9DA 2YLMA 1NENB 4M0WA 4HXDA 2LFIA 2KJHB 3BK1A 4O1NA 2WXMA 3IT6B 4MGZE 1P0RA 2H89B 3PZDA 4G11A 1CK1A 4C56C 2WWZA 3I3TB 5LNK1 1KM7A 1SIJA 3LJ3A 4C7ZA 3TEZA 3QIJA 1YIWA 4EFOA 1SIFA 2INNE 3JYUA 1ENFA 3SEBA 4PS8A 3AE9B 1B1ZA 2W3SA 1DOIA 2LGYA 4P1CC 1RWSA 2KFKA 3CSTA 2BVCA 2MSED 3NZUA 2WDVB 3PTFC 2K6DB 2L0FA 4ANVA 3DBRI 2B3AA 1TTNA 2IGDA 2R61A 5HG2A 2LGSA 2JQRB 3LYYA 3QK0A 3TUOA 1C9FA 5C3JB 4LK0M 4FJYA 3TSSA 2V4IB 3H9DA 4M8NA 1F0ZA 3RZWC 2O6VB 4DHJD 4WAFA 1JWSD 3B0AA 2FUG1 2J4XA 5D3DA 5JHBA
chains in the Genus database with same CATH topology
1XLNA 3FAHA 1FXIA 1ZP0B 3EUB2 3LB8C 2Q5WD 3SFDB 3AN1A 3NVYA 1WWTA 2NMQA 1PGAA 1ZXHA 1RFKA 1R7SA 2X38A 2J52A 4RF1A 3CWIA 4YTMB 1QILA 2PVOD 4KKIA 3U7ZA 4KX6B 2LEKA 3NVVA 4L2YA 2WU5B 1YN3A 1I4QA 1V1OA 2IDYA 2M19A 2V0GA 4YSXB 4RGOS 5FR3A 2KN4A 4P6VF 5C2TB 1QKZA 3R2IA 2KAJA 2J53A 4ZHPA 1SSNA 2Z8LA 3MC0B 4XDDA 2M56B 5JXVA 3PO0A 2K3UA 1FIQA 1HZ6A 1TYGB 1BXTA 3MFGA 5EE1A 2JSVX 2BTEA 1L4ZB 5I4DA 4USAA 1QOAA 3MHZA 2BS3B 1PUTA 1SF0A 4EE2A 3BK2A 4WURA 4NAWB 1C4PA 3AMZA 3KQ4A 1C4CA 1FRDA 1I4XA 3EGRA 4ZYSA 1ESFA 1L0VB 1QLBB 2N9LA 1RYJA 3NUHB 2JXTA 1N61A 3B2FA 2GI9A 3BZDB 1ZXIA 5T8IA 1SE4A 4YSZB 1CQVA 4DXGA 1PDXA 1H7WA 1MHXA 2IGHA 4C80A 1F2RC 3AEFB 1UUPA 3CF4A 1JWMD 4WH4A 4OZAA 1L6UA 1FNUA 5D7GA 2PVGC 2WU2B 2E3TA 1KLUD 4JE3B 1TS5A 3AV8A 1NEKB 5BYRA 1FEHA 1C76A 1JW9D 1SEBD 2E6XA 1JRPA 3NZ3A 2W82A 3AM9A 4N59A 5BYQA 1OQQA 2CJNA 2AQ3B 2LMCA 3I57A 3VQIA 4HKQA 1ET6A 1GPXA 3NRZA 1I4PA 1GAQB 2AQ1B 2MJEA 3P4QB 3U2SC 3ZGZA 2HDEA 1WYGA 1GT8A 3CIRB 1PFDA 2FE8A 3DWMA 4RGMA 2WDRB 1SBBB 1IGDA 4US9A 1FNWA 3AH7A 4A9AA 4L23A 3MJ5A 2WXLA 3UI3A 3B2GA 3W1SA 1NYRA 1FO4A 1KF6B 1XLQA 2BBCA 2IGGA 1I4RA 3TEWA 3P63A 4RFBA 1L5PA 3C8YA 3MP9A 1VR9A 3BWUD 3B9JA 4KGTA 4NJCA 1TKEA 1PGBA 1SXTA 4RGTA 5D3IB 1T3QA 1TS4A 1UWXA 2I38A 1QQRA 3Q8AA 4JWUC 2MJ3A 3V3XA 1KTKA 3BYYB 4GDKB 4GDLB 3ZJUA 2JWUA 5EE3A 1E9MA 2DBYA 3W5VB 1RM6C 4P16A 5H8YE 3U4EG 1L0XB 1J7CA 3OWEB 2LUMA 1EU4A 1T5XD 3DWGC 3W2DA 3ZYYX 2MEKA 2SAKA 2J42A 3AB5A 3O13A 1UNSA 4A8XC 2K22A 1GB4A 3PZ8A 4ZRPA 5H92C 1WGKA 4CQNA 2L83A 2ZW0A 3KWLA 3R2TA 1XCQL 2AX5A 3SR6A 3TEXA 2Y5PA 4TQ1A 1BMLC 1NI3A 3FC4A 1FCCC 3AEEB 2WXGA 1I4HA 2WXRA 3TEYA 1JWBD 3L4PA 1E7PB 3N9YC 5BMIA 3VRAB 5G5HA 1IGCA 5EE0A 2ON8A 1JWUD 4YXDB 4WIPA 4YTPB 2ACZB 1DGJA 3VR9B 1VZ6A 1J7AA 3SFEB 2DYMA 1MHHE 1XEEA 5HI1A 1N5WA 1IBXA 3T3OA 2Y3AA 3ETRA 4MT5A 1D5MC 3IAM1 1JQ4A 1TY2A 1AN8A 2BS2B 1ZE3D 3Q8BA 1IUEA 1P7FA 2RPVA 3HVDA 3RFZB 2H88B 1DYQA 1IBXB 2EKIA 1C78A 3AE4B 4C7YA 2BT6A 4LTUA 3KLSX 4NZLB 1FRRA 4L1BA 1XCTL 1TKGA 3R8BA 2IJ0A 1FD6A 1VJKA 1WXQA 2WXIA 2CJOA 4WQMA 3P1MA 4YWGG 2IPKD 4ITKA 5HHDG 2NTSA 1OQRA 1DOYA 3AEBB 1CZPA 1Q10A 2N7JA 2BW2A 3GB1A 4HJGE 1CJEA 2DWQA 1OFFA 1JMLA 4AQ7A 1C77A 2V3NA 4A55A 1GTHA 2QSDA 1HZ5A 1F77A 2KMMA 5GXGB 3NS1A 1SJED 1HA5A 1C79A 1M4VA 4RCOA 2K9XA 3BVMA 1D5XC 2L52A 2N9KA 4YT0B 3W5UB 4RF0A 4DQOC 1QT9A 1E10A 3NVWA 1K50A 3E56A 4WWMA 4HKZE 1FNVA 4MM3B 5AUIA 2VZKD 3Q8CA 2PLPA 2KACA 2NTTA 2L32A 2RMMA 1D6EC 4FXCA 3WCQA 3HVZA 3ZJVA 3AEGB 2JU6X 4YTNB 1N63A 1ZUD2 4REZA 1PYWD 4HRSA 2MH7A 2WP9B 1VRAB 4IDIA 3Q8EA 2WNMA 2RDGA 1XLPA 3AE5B 1YJIA 1WSPA 2BYTA 4OW0A 3W9CB 1D4BA 2WXPA 3Q69A 2JX5A 4RH6A 2JYEA 3AE2B 1EWCA 1KFYB 1ZDVA 3RPFC 3IXSA 1KH0A 2QJLA 1L4DB 1V97A 4XDCA 2XN9C 3GP7A 3AEDB 3FILA 2FBWB 2XNAC 1EM7A 4D2KA 4TMAB 1AYFA 4IKGA 1SB3C 2CU3A 2YEPB 1KRHA 1GB1A 5FKAC 1QOGA 4DXFA 5MPOA 1TKYA 2BB5A 1YQ4B 3P4SB 3FILB 3BVGA 1I7HA 2KDMA 1FFUA 1NYQA 2QILA 2TSSA 4IOIE 2Y5CA 4HROA 4UDUC 1FCLA 1HXYD 3KWVA 2DLBA 1FM0D 2WXQA 4MACA 3AECB 1UWMA 1HEZE 1XF5L 1ZPSA 3VR8B 3BYTB 2K5PA 4ARIA 1SE3A 1STEA 4Q2JA 4PT5A 1VZ7A 2WLBA 2LHEA 3ABVB 2LJIA 4A6QA 3EA6A 2INPE 1FMAD 3H8HA 1AWDA 5EE9A 4OVZA 3Q8FA 3URYA 2MJDA 2QMTA 2BS4B 4JX1C 4TSSA 4JPSA 2JZPA 1HQRD 4ZRQA 2L1AA 2WXJA 1E6EB 3AE8B 1SJHD 3J9CA 3PZ7A 4B0EA 1GTEA 1EWYC 1Y56A 2PIAA 4J3OD 1TY0A 1XXGA 4OZBA 2W3RA 5BMHA 1E0ZA 1WRIA 4XE0A 1YJJA 2BB6A 1V1PA 4KGSA 4R3DA 1L0YB 5FK9C 3ZQ4A 4H2AA 1JCKB 5BMGA 1VZ8A 1JWAD 2D5GA 1MI0A 4MH8A 4N58A 3P4PB 2HTME 2ZW1A 1K53A 3IAS1 1C4AA 4GLSC 1BUIC 1YNTE 3AEAB 3P4RB 2KQ4X 1J7BA 2WXFA 1XLOA 5BYSA 2LHDA 2KWDA 1MVKA 1A70A 3BIID 3HUIA 1QF6A 2ONQA 1VDVA 1V8CA 1YQ3B 4KGRA 2GB1A 3E9SA 1N60A 2WXOA 1TJEA 1KLGD 4OZCA 1QOBA 1LO5D 3ZJTA 4TQ0A 1EU3A 3U52E 4RGNA 2WXKA 2JYTA 2WS3B 1K52A 4JWSC 3VRBB 1FXAA 2I2YA 1B9RA 2PW9A 1JALA 1ROEA 3AE7B 1UGJA 2DYOA 1JROA 1I4GA 4LLGM 1GOZA 1N62A 4ZOHC 1MPEA 1AW7A 1NENB 1T6BX 4RNAA 2WQYB 4M0WA 1NVID 2LFIA 2GRIA 1FFVA 3AE6B 2LGIA 2PTLA 2QEJC 2WXMA 3BK1A 4O1NA 3IT6B 1H7XA 1K51A 1V1PB 1YN5A 1PGXA 1DOXA 4ZHOA 1YMHE 2H89B 2V3PA 2SEBD 3NVZA 1CK1A 3IT4B 3HRDD 1ZDXA 3GS2A 4C56C 5LNK1 4A90A 2VZKB 1SIJA 4XWTA 1D5ZC 4NAMA 5E6JA 4C7ZA 3TEZA 1VLBA 1YN4A 3P42A 2WXHA 1L6VA 5G5GA 1ZOYB 2INNE 2N0SB 2K0PA 5AUKA 1ET9A 3AE1B 5HFYA 5TSSA 2YEPF 4AS1A 1ENFA 2PKOA 2M0AA 2AQ2B 3SEBA 1P7EA 3AE9B 1B1ZA 2ICIA 2W3SA 4HEA1 1DOIA 1RWSA 2W55A 1SE2A 3I9V1 4US8A 2WDVB 1ACCA 1N5XA 3AE3B 4B0MA 2B76B 2EELA 2IGDA 2OEDA 2R61A 2OHFA 1TS2A 2WXNA 5HG2A 3T3NA 2JQRB 3LYYA 3TUOA 2G9HD 3LXFA 4N6EB 3V05A 4XWWA 1C9FA 5C3JB 4ARCA 4LK0M 1XO3A 1QOFA 2PMVA 3TSSA 2V4IB 4OHJA 1F0ZA 4KKJA 1TS3A 2WDQB 4YSYB 2QIEB 4WAFA 1JWSD 2RDHA 2G1EA 1F2RI 2W54A 2FUG1 2J4XA 3BVZA 5D3DA 1TZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLN A;  2L52 A;  3FAH A;  1FXI A;  1ZP0 B;  4YT0 B;  1JWA D;  3EUB 2;  3LB8 C;  3W5U B;  2Q5W D;  3SFD B;  1T3Q A;  3AN1 A;  3NVY A;  1QT9 A;  1WWT A;  3NVW A;  4JWU C;  1E10 A;  3P4P B;  2HTM E;  2MJ3 A;  4WWM A;  1RFK A;  1R7S A;  5EE3 A;  1E9M A;  3CWI A;  4YTM B;  5AUI A;  2PVO D;  3AEA B;  3P4R B;  2DBY A;  3W5V B;  1RM6 C;  4KX6 B;  1J7B A;  2LEK A;  3NVV A;  1XLO A;  5H8Y E;  2WU5 B;  1J7C A;  2M19 A;  4YSX B;  4FXC A;  3WCQ A;  1A70 A;  4P6V F;  3HVZ A;  3BII D;  5C2T B;  3HUI A;  3DWG C;  3ZYY X;  1QF6 A;  2KAJ A;  4ZHP A;  3AEG B;  1VDV A;  4YTN B;  1V8C A;  1YQ3 B;  1N63 A;  3AB5 A;  1ZUD 2;  2M56 B;  3PO0 A;  2K22 A;  1FIQ A;  4HRS A;  1TYG B;  2MH7 A;  2WP9 B;  1N60 A;  4IDI A;  1TJE A;  5EE1 A;  5H92 C;  1QOB A;  1WGK A;  1XLP A;  4USA A;  2L83 A;  3AE5 B;  1QOA A;  2BS3 B;  1PUT A;  1SF0 A;  1YJI A;  3KWL A;  2WS3 B;  2AX5 A;  4JWS C;  3SR6 A;  3W9C B;  3VRB B;  1FXA A;  3AMZ A;  1B9R A;  1FRD A;  1JAL A;  1ROE A;  1NI3 A;  3AE7 B;  2JX5 A;  1JRO A;  3FC4 A;  3AEE B;  1N62 A;  4ZOH C;  1L0V B;  3AE2 B;  1NEN B;  1QLB B;  1JWB D;  1KFY B;  3L4P A;  2WQY B;  1RYJ A;  3RPF C;  2QJL A;  1E7P B;  1NVI D;  1FFV A;  3AE6 B;  3VRA B;  1N61 A;  1V97 A;  3B2F A;  5G5H A;  5EE0 A;  1H7X A;  3AED B;  4YXD B;  1ZXI A;  1DOX A;  4YTP B;  2ACZ B;  2FBW B;  1DGJ A;  2H89 B;  4YSZ B;  3VR9 B;  4ZHO A;  1AYF A;  1J7A A;  1PDX A;  3HRD D;  3NVZ A;  3SFE B;  1SB3 C;  2CU3 A;  1H7W A;  1KRH A;  1N5W A;  4C80 A;  3ETR A;  1QOG A;  1SIJ A;  3AEF B;  1JQ4 A;  5MPO A;  3CF4 A;  1TKY A;  1YQ4 B;  3P4S B;  4C7Z A;  1L6U A;  1VLB A;  2BS2 B;  2PVG C;  2WU2 B;  1IUE A;  1I7H A;  2E3T A;  1L6V A;  1FFU A;  2H88 B;  5G5G A;  3AV8 A;  1NEK B;  1NYQ A;  2Y5C A;  4HRO A;  2EKI A;  1ZOY B;  1JW9 D;  2N0S B;  3AE4 B;  4C7Y A;  5AUK A;  1FM0 D;  2BT6 A;  1JRP A;  3AE1 B;  4LTU A;  3AM9 A;  4N59 A;  1OQQ A;  1FRR A;  2PKO A;  3AEC B;  1UWM A;  2CJN A;  1TKG A;  3VR8 B;  3AE9 B;  2K5P A;  2W3S A;  1DOI A;  2WLB A;  1RWS A;  3ABV B;  1VJK A;  2W55 A;  1WXQ A;  1GPX A;  2CJO A;  4WQM A;  1FMA D;  3NRZ A;  3P1M A;  1AWD A;  1GAQ B;  2MJE A;  2WDV B;  4ITK A;  5EE9 A;  3P4Q B;  4US8 A;  1OQR A;  1N5X A;  2MJD A;  3AE3 B;  2BS4 B;  2B76 B;  3AEB B;  1CZP A;  1WYG A;  4JX1 C;  1DOY A;  1GT8 A;  3CIR B;  1PFD A;  3DWM A;  2OHF A;  2WDR B;  2JQR B;  3LXF A;  4N6E B;  4US9 A;  1E6E B;  3AE8 B;  3AH7 A;  1CJE A;  5C3J B;  1OFF A;  2DWQ A;  1GTE A;  1EWY C;  2PIA A;  4A9A A;  1XO3 A;  1QOF A;  1GTH A;  3B2G A;  1NYR A;  1F0Z A;  1FO4 A;  2WDQ B;  4YSY B;  1KF6 B;  2QIE B;  2W3R A;  1XLQ A;  2KMM A;  5GXG B;  1E0Z A;  3NS1 A;  1WRI A;  3P63 A;  1YJJ A;  2G1E A;  2W54 A;  1L5P A;  2K9X A;  4N58 A;  3B9J A;  1TKE A; 
#chains in the Genus database with same CATH topology
 1ZP0 B;  3EUB 2;  3PHX B;  1WWT A;  1M94 A;  2CHX A;  1R7S A;  4MDK E;  2J52 A;  4KKI A;  2PVO D;  2EKE C;  3NS8 A;  3U7Z A;  2LEK A;  2WU5 B;  1YN3 A;  3JW0 X;  2KZR A;  4RGO S;  4EKU A;  2KN4 A;  3VHT C;  4P6V F;  2J53 A;  3MC0 B;  2KO3 A;  1EUV B;  1PUT A;  4WUR A;  3ZVV A;  3KQ4 A;  1EO6 A;  1XT9 B;  2L00 B;  1QLB B;  4E71 A;  3NUH B;  4II3 B;  3EFC A;  3Q14 C;  1N61 A;  1RAX A;  2GI9 A;  2MBB B;  4WJO A;  3H7P B;  2KJ6 A;  2VRR B;  1NI2 A;  2IGH A;  1F2R C;  4GU2 A;  3CF4 A;  4WH4 A;  2FIF A;  1ISN A;  2WU2 B;  1KLU D;  2PJH A;  1FEH A;  2JWZ A;  3WAP A;  3TMP B;  1YQB A;  2AQ3 B;  3C0R B;  1WYW B;  3VVW B;  5HKH A;  3M63 B;  3PSE B;  4E74 A;  4ICU A;  2JF5 A;  1PFD A;  3CIR B;  3ZTC A;  1WJU A;  4GXB A;  4C4V A;  2IGG A;  2BBC A;  1R4N B;  3APD A;  2RPQ A;  2R2Q A;  3MP9 A;  2M1M A;  1PGB A;  4K7W A;  2D3G A;  2RDB C;  1TS4 A;  4LNF A;  2MJ3 A;  3N1Y C;  5J17 A;  3ZJU A;  4GMV A;  2DBY A;  1CMX B;  3NG0 A;  2KTF A;  4TUU A;  1L0X B;  1J7C A;  2D11 A;  4MGK E;  3DWG C;  3W2D A;  1N6Z A;  3WAL A;  1LQB A;  4BFR A;  4ZRP A;  3QCA A;  1WGK A;  2IO2 B;  3KWL A;  3R2T A;  1XCQ L;  3QAR A;  1R4M I;  4K7S A;  3ZKJ C;  5KHO A;  1WJ4 A;  1I4H A;  2WXR A;  1LM8 B;  2KOX A;  3VR9 B;  3H7P A;  1E7V A;  3SFE B;  4WJN A;  2DYM A;  5HI1 A;  2Y3A A;  3PPA A;  2VH1 A;  2BS2 B;  3Q8B A;  1IUE A;  2MCN B;  3RFZ B;  4DBG A;  3D32 A;  2RD0 A;  2BT6 A;  4KIK B;  3IBE A;  2KC1 A;  3Q3N C;  1RLF A;  1FD6 A;  1NDD A;  2NBV B;  3P1M A;  4YWG G;  1YD8 U;  5HHD G;  3DBH I;  3AEB B;  2BW2 A;  3IVF A;  4I6L B;  4KV2 A;  5CTR C;  2LD9 A;  3UGB B;  4AQ7 A;  1C77 A;  2DAJ A;  3B08 A;  3DHG C;  5D6J B;  5D2M B;  1F77 A;  3L10 B;  3NZS A;  3BVM A;  2MWS B;  3DPD A;  2I1J A;  4RF0 A;  1QT9 A;  1E10 A;  2G3Q B;  3NVW A;  3DOW A;  4GDK A;  2PLP A;  2C7M B;  4G3X B;  3AXC A;  3QC8 B;  1D6E C;  1ZKH A;  1UEL A;  3ALB A;  3AEG B;  3MJW A;  2JU6 X;  3Q3J A;  4G0N B;  1ZUD 2;  4HRS A;  1VD2 A;  4AJW A;  2WNM A;  1YJI A;  1WSP A;  4BVU C;  1D4B A;  2G45 B;  1IPG A;  4LDT B;  2N7E A;  1WR1 A;  2JX5 A;  4RH6 A;  1UGM A;  4NJ6 A;  2KYW A;  1ZDV A;  3AED B;  3M3J A;  2ZVO A;  4NNJ B;  4TMA B;  2YEP B;  1KRH A;  1QOG A;  2QDF A;  2BKR B;  1R4M B;  3FIL B;  2JT4 B;  2KDM A;  2XBB C;  1MG4 A;  2HD5 B;  2QIL A;  3RD2 A;  4DDI D;  3X23 A;  3KWV A;  2HJ8 A;  2JRI B;  1XF5 L;  2BYF A;  1Q1O A;  1WE7 A;  4DK5 A;  1E8X A;  4GB9 A;  2J0K A;  3A9K B;  5EE9 A;  2QMT A;  1E8W A;  4TSS A;  2J7Q B;  3QHT A;  2DZJ A;  2JZP A;  2WXJ A;  2PIA A;  4BBN C;  2KX0 A;  2UU7 A;  2KX3 A;  1XXG A;  5CHF A;  2JRH A;  2N9P C;  4W9F A;  5E6N A;  5JH5 C;  1WRI A;  2BB6 A;  4KGS A;  1L0Y B;  4H2A A;  5BMG A;  1VZ8 A;  4XC2 A;  3B1L X;  1JWA D;  2D5G A;  3H6N A;  1XD3 B;  3PS6 A;  3IAS 1;  3K9P B;  1XLO A;  5BYS A;  2LRU A;  2K8C A;  1V6E A;  4M00 A;  3H1U A;  3ZTD A;  3AU5 A;  4LCD E;  1VDV A;  4BBN F;  3ZXR A;  5IA7 A;  4FLH A;  2I2Y A;  1ROE A;  1UGJ A;  1JRO A;  2WGS A;  4ZOH C;  1AW7 A;  3MC8 A;  4LNK A;  4IM2 A;  2GRI A;  2LGI A;  2QEJ C;  2PTL A;  1K51 A;  1PGX A;  4ZHO A;  2V3P A;  2SEB D;  3QJZ A;  3GS2 A;  2KTR B;  1KLV A;  4A90 A;  4XWT A;  1WMH B;  1D5Z C;  3T9L A;  1VCB A;  2LWP A;  1YN4 A;  3QAQ A;  2GBM A;  3KW5 B;  4ASW C;  2WXH A;  5TR5 A;  2RR9 A;  1L6V A;  5IO9 A;  5G5G A;  2KFK B;  3DBH B;  2HE7 A;  2YEP F;  4AS1 A;  2PKO A;  2AQ2 B;  1P7E A;  3L0W B;  2KLG A;  4MJS B;  4A3P A;  4PYZ A;  1WRD B;  2W55 A;  3I9V 1;  3U8Z A;  1ACC A;  2O6V A;  2OED A;  3T3N A;  2OHF A;  1TS2 A;  2FCS A;  5IOI A;  3LXF A;  2KJR A;  1XO3 A;  2PMV A;  3PRM B;  5C1Z A;  2KLC A;  4AJY B;  2QIE B;  3NY5 A;  2W54 A;  4HDQ A;  4N58 A;  1UF0 A;  3LB8 C;  3AN1 A;  2NMQ A;  1PGA A;  4JGH B;  5IP4 D;  4L2Y A;  3JSV A;  1V1O A;  3OLM D;  2IDY A;  4YSX B;  5FR3 A;  5C2T B;  3R2I A;  4LJP B;  3VAW A;  2Z8L A;  3DQV A;  4A20 A;  2M56 B;  3RNC C;  3RNB C;  1BXT A;  1FPY A;  1L4Z B;  2A5U A;  3A9J B;  4EE2 A;  3BK2 A;  3A1Q B;  4NAW B;  4P7I A;  2IO1 B;  4PK1 A;  1WGG A;  4EZJ A;  1FRD A;  1I4X A;  3TCA A;  4W9H A;  3RMK C;  3NJT A;  5BO4 B;  2MBH A;  1WR6 E;  2JXT A;  5DPR A;  1SE4 A;  5AEK B;  2DNF A;  4DXG A;  1PDX A;  2NBU A;  1H7W A;  1MHX A;  4C80 A;  2YVC A;  1UUP A;  3DVG Y;  1JWM D;  4OZA A;  5D7G A;  2PVG C;  4JE3 B;  1YX5 B;  3AV8 A;  1NEK B;  1U4A A;  3PLV A;  5BYR A;  1JW9 D;  4ZYN A;  2KVR A;  1JRP A;  4F8C B;  2W82 A;  2Z0D B;  3AM9 A;  4MM3 A;  3V60 A;  4II2 B;  2LMC A;  4GN1 A;  1WM3 A;  1ET6 A;  4ICV A;  3WA0 A;  2CHW A;  1I4P A;  3V6C B;  1GAQ B;  3P4Q B;  3N1Z C;  4LDT D;  2W9N A;  3ZGZ A;  2HDE A;  2KMA A;  3N32 A;  4MSM B;  4RGM A;  3L08 A;  2WDR B;  1SBB B;  1C3T A;  1LGR A;  3AH7 A;  2Z0E B;  3B2G A;  5KHQ A;  1FO4 A;  1KF6 B;  4IUM B;  3C8Y A;  3BWU D;  1PQS A;  3B9J A;  4NJC A;  4RGT A;  5DCN A;  1KOT A;  1UWX A;  2GBR A;  2N9E B;  1OEY A;  3BYY B;  4GDL B;  3SU8 X;  5JHA A;  4LNO A;  2N1W A;  1RM6 C;  1WIA A;  2VH2 A;  3W5V B;  4W9I A;  3U4E G;  4JQW C;  1UBI A;  1T5X D;  3DBS A;  3EEC A;  2SAK A;  2J42 A;  1WXS A;  3O13 A;  3PRZ A;  4J6I A;  1E7U A;  3PZ8 A;  4CO7 A;  1R4N I;  2V9H A;  3DVN U;  2LXA A;  2L83 A;  1P9D U;  3TEX A;  1BML C;  1NI3 A;  3AEE B;  2WXG A;  3TEY A;  3A9K A;  1JWB D;  3N9Y C;  5BMI A;  3VRA B;  5G5H A;  1QZE A;  1TZ1 A;  5EE0 A;  2ON8 A;  1JWU D;  4WIP A;  3DBL B;  4DHZ B;  2MA9 B;  1IBX A;  4MT5 A;  1D5M C;  3IAM 1;  2QCZ A;  1JQ4 A;  1V86 A;  3RCZ A;  2O2V B;  3KUD B;  1P7F A;  2RPV A;  3HHM A;  3ONS A;  4W9L A;  3UQB A;  4NZL B;  3VFK A;  4L1B A;  3HIZ A;  3KH0 A;  2IJ0 A;  1WZ0 A;  4NJ7 A;  2CJO A;  2IYD B;  3Q2A C;  1V80 A;  2DAF A;  2N7J A;  1WFY A;  2CHZ A;  3N3K B;  5LXH A;  3PRE A;  4K81 A;  2V3N A;  4A55 A;  3DCG A;  1HZ5 A;  3RUL A;  1LXD A;  1SE9 A;  3NS1 A;  2KAN A;  2KXJ A;  1C79 A;  1WF9 A;  2K9X A;  5IKC M;  2L52 A;  3W5U B;  4YT0 B;  1H4R A;  1K50 A;  2UYZ B;  1FNV A;  2NTT A;  2L32 A;  2RMM A;  3HVZ A;  3ZJV A;  1WX9 A;  3EFU A;  4REZ A;  2MBE A;  2OJW A;  1HTO A;  2RDG A;  2DYB A;  1V81 A;  3AE5 B;  3HM3 A;  2C60 A;  2WXP A;  2KDF B;  5L83 A;  3Q69 A;  2N4F A;  4E3C A;  1EWC A;  2C7H A;  4F1S A;  1KH0 A;  1V97 A;  1HTQ A;  1XQQ A;  2CU1 A;  2XNA C;  4IKG A;  3EC8 A;  4W9C A;  4IWQ A;  2LXC A;  5FKA C;  2BGF A;  4KVG B;  5G2N A;  5DPT A;  2D07 B;  1V49 A;  2REX A;  2G4D B;  2O2V A;  5IN7 A;  1NYQ A;  4IOI E;  4HRO A;  3CMM B;  3U30 A;  3R3M A;  2KC2 A;  2WXQ A;  4MAC A;  2FNJ B;  1ZPS A;  1Z5S B;  2ZEQ A;  2JZZ A;  3BYT B;  1SE3 A;  1STE A;  4PT5 A;  1VZ7 A;  3JSV B;  3RYT A;  2LZ6 A;  2D2Q A;  4GSW A;  1AWD A;  3I63 C;  4JX1 C;  3FKY A;  2NBW B;  1HQR D;  2KFJ A;  3RNG C;  3V61 A;  3AE8 B;  2ZJD A;  3J9C A;  3PZ7 A;  4B0E A;  1GTE A;  3A33 B;  4MGI E;  5GMV A;  1L7Y A;  1TY0 A;  3RUI B;  5BMH A;  3A4R A;  3CF6 E;  1E0Z A;  4R3D A;  2WYQ A;  2ZW1 A;  1K53 A;  2MX2 A;  3ECI A;  4IW0 A;  1C4A A;  2XK5 B;  3P4R B;  1J7B A;  2WXF A;  3R7R A;  3DHH C;  2LHD A;  3KYC D;  1A70 A;  3HUI A;  5D94 A;  3RZF A;  2ZPN A;  4HJK A;  2K6Q A;  1GJZ A;  2WXO A;  4RM9 A;  3HM6 X;  4K7U A;  1QOB A;  4HPP A;  1LO5 D;  3SDL C;  4TQ0 A;  2LJ5 A;  1K52 A;  3VRB B;  4WWN A;  4BAX A;  1B9R A;  1WGY A;  2PW9 A;  3AE7 B;  1I42 A;  2KK8 A;  2HJ1 A;  4LLG M;  1WXA A;  4EZK A;  1GOZ A;  1MPE A;  1T6B X;  2D3B A;  3KUC B;  4CHK A;  1NVI D;  1FFV A;  1V1P B;  1YN5 A;  1TGZ B;  3DVG X;  3IT4 B;  1ZDX A;  4DHJ B;  4ZRI A;  4MEM A;  4NAM A;  5E6J A;  2K25 A;  3P42 A;  2PPH A;  2UWQ A;  3ZDT A;  2D3C A;  1ZOY B;  2N0S B;  2K0P A;  5AUK A;  3TBL D;  3AE1 B;  5HFY A;  3TJP A;  2MLB A;  3UQA A;  2GOW A;  1SE2 A;  5LLI A;  3AE3 B;  2M0X A;  2B76 B;  2EEL A;  4RMA A;  4MJS A;  2WXN A;  3V6E B;  4M8M A;  3V05 A;  2GBK A;  2AYO B;  4KZC A;  4OHJ A;  2FCQ A;  4KKJ A;  2WDQ B;  4YSY B;  2L76 A;  4GGQ A;  2RDH A;  2KQS A;  2G1E A;  1F2R I;  1XLN A;  3FAH A;  3VXW A;  1FXI A;  2WHI A;  3Q6B A;  1ZXH A;  1BT0 A;  1RFK A;  2DHZ A;  3M62 B;  4RF1 A;  2IZV B;  2K8B A;  3NVV A;  1JRU A;  1RRB A;  2ZCB A;  1T0Q C;  2INC C;  1QKZ A;  4ACF A;  2KAJ A;  4LJO B;  1SSN A;  4XDD A;  3MC9 A;  2K3U A;  1FIQ A;  1TYG B;  1Y8R C;  5EE1 A;  5EDS A;  2JSV X;  2BTE A;  1V9J A;  1E90 A;  4USA A;  1FXT B;  1MFW A;  1SF0 A;  4AUQ C;  4BOS C;  1C4P A;  1C4C A;  3KYD D;  5DPW A;  4ZYS A;  2N9L A;  1RYJ A;  3A9J A;  4ZDV A;  3B2F A;  4NAW A;  1ZXI A;  1V5O A;  2K1F A;  3TIX A;  2KD0 A;  1AAR A;  3N1X C;  4I6P A;  2V3S A;  1TS5 A;  3IHP C;  2MBO A;  2MP2 B;  4PS3 A;  2E6X A;  3C19 A;  3V62 A;  3NZ3 A;  2LUE A;  4N59 A;  5BYQ A;  1YOV B;  3BIN A;  4X57 B;  3GOE A;  3PLU A;  3VQI A;  4HWI B;  4WJP A;  2MJE A;  1WYG A;  3RNA C;  2FE8 A;  1T0S C;  1IGD A;  1FNW A;  1GC7 A;  3VUX A;  3MJ5 A;  3UI3 A;  1C1Y B;  4QAY A;  2V4L A;  3W1S A;  1NYR A;  2OJR A;  2A4Z A;  2BWF A;  2BF8 B;  2NCN A;  2KDE B;  3TEW A;  4FJV B;  2N7D A;  2I1K A;  2BPS A;  1TKE A;  1SXT A;  3KUZ A;  3NHE B;  4HK2 A;  4GDK B;  3KVF B;  2JWU A;  2JPH A;  5H8Y E;  2MP2 A;  4IM3 A;  2WX0 A;  4BZA A;  4BKS A;  2LUM A;  1TBE A;  3ZUN A;  3ZYY X;  4JIO U;  2MEK A;  3AB5 A;  2J0M A;  2ZVN A;  1UNS A;  2Y5B B;  4MGY E;  2AL3 A;  5H92 C;  4CQN A;  1J19 A;  3SR6 A;  4TQ1 A;  4M02 A;  3Q3F A;  1WI0 A;  3FC4 A;  1FCC C;  2KKC A;  3ZIM A;  3L4P A;  1F1H A;  1E7P B;  4YXD B;  2EMS A;  2ACZ B;  1DGJ A;  2EMT A;  4URK A;  2M17 A;  1WGH A;  1J7A A;  3QQ8 B;  4FHK A;  4P1B C;  3T3O A;  2G4S A;  5LXI B;  2FAZ A;  4A3O A;  3UF8 A;  4K1R B;  3HVD A;  1IBX B;  4AOF A;  2EKI A;  1C78 A;  3AE4 B;  2FCN A;  1D3Z A;  2XK5 A;  1TKG A;  3U7D A;  2LVP A;  3R8B A;  4XZ4 A;  1VJK A;  2WXI A;  4W9G A;  4WQM A;  2L7R A;  1WXV A;  2NTS A;  2IND C;  1DOY A;  1CZP A;  1SGH A;  3RT3 B;  3ZRC A;  1L2N A;  2PEA A;  2DWQ A;  1IYF A;  2BWE S;  3S2A A;  1V5T A;  2KN5 A;  1SJE D;  1HA5 A;  1M4V A;  4HLE A;  1D5X C;  2IO3 B;  2CKH B;  2N9K A;  1WE6 A;  1T0R C;  4WWM A;  4FBJ B;  2KNB A;  4MM3 B;  3BY4 B;  2C9W B;  2KAC A;  2JY6 A;  1UZX B;  2DZK A;  4KIK A;  4HPL B;  4FXC A;  5E6P A;  3MHS D;  2D3A A;  1N63 A;  1WY8 A;  2MHJ A;  1PYW D;  3PV1 A;  1WX7 A;  3Q8E A;  4XX5 A;  4LNN A;  2BYT A;  1ZGU B;  4ZRJ A;  4C00 A;  3AE2 B;  1L4D B;  2QHO A;  3GP7 A;  3DBL I;  5CHW A;  2FBW B;  4G50 A;  1EM7 A;  4D2K A;  5CX3 A;  1AYF A;  1SB3 C;  5AZF A;  2ZCC A;  1WMH A;  4DXA B;  3ZW3 A;  4DXF A;  5MPO A;  1TKY A;  1WJN A;  1EF1 A;  3BVG A;  5JZE B;  2NVU I;  3W1S C;  3PGE A;  3AU4 A;  4FA6 A;  2DX5 B;  4WWO A;  3ZNG C;  3AEC B;  4XYC A;  1HEZ E;  4ARI A;  2LHE A;  4KSL C;  3ABV B;  4A6Q A;  1FMA D;  1WGR A;  3H8H A;  4OVZ A;  2MJD A;  2L3Z A;  4AWJ A;  2KWV B;  2AWT A;  4ANW A;  4ZRQ A;  2K39 A;  3DBR B;  3K9O B;  1P1A A;  1SJH D;  4W9J A;  1EWY C;  1Y56 A;  1S3S G;  5DPS A;  4J3O D;  4OZB A;  4NY0 A;  3Q3O C;  3UIO B;  2AEH A;  2JUO A;  2L0T A;  1MI0 A;  1WM2 A;  3P4P B;  2HTM E;  3AUL A;  4TV3 A;  2KHW B;  3N20 C;  3RNE C;  3AEA B;  2DZM A;  5AZG A;  4IM0 A;  2KDB A;  1QF6 A;  2ONQ A;  3PVL A;  1YQ3 B;  4KGR A;  4OVU A;  2O6V D;  1E8Z A;  1IP9 A;  1MG8 A;  4W9K A;  1J0G A;  1TJE A;  4OZC A;  1GNU A;  3A1Q A;  4RGN A;  3VTU A;  2JYT A;  2WS3 B;  4GOC A;  1JAL A;  3ZLZ A;  1N62 A;  1TIF A;  1TT5 B;  4RNA A;  2WQY B;  2IY0 B;  3AE6 B;  1X1M A;  1H7X A;  1DOX A;  1YMH E;  4KDL B;  3NVZ A;  3HRD D;  2QC8 A;  1WGD A;  2D10 A;  4M0W B;  2VZK B;  2V1Y A;  1VLB A;  4BKG A;  1EF5 A;  3L54 A;  4W9E A;  3AI5 A;  2JVC A;  1ET9 A;  5TSS A;  4I6N B;  2M0A A;  4KZ0 A;  3ZDM C;  2ICI A;  4HEA 1;  3WAO A;  1OTR B;  1T0Y A;  4US8 A;  1N5X A;  3APF A;  3DHI C;  4B0M A;  2G9H D;  2L05 A;  4N6E B;  4B9K A;  4XWW A;  4ARC A;  2PE6 B;  4B6W A;  4NQL B;  1QOF A;  3ENE A;  1TS3 A;  4WWP A;  4FHJ A;  4YL8 A;  3A4S C;  2NR2 A;  4KDI C;  3BVZ A;  2N1V A;  1TZO A;  4ZRK A;  3NOB A;  2Q5W D;  3SFD B;  3NVY A;  3X0W A;  2OOB B;  3IFW B;  2X38 A;  1RFA A;  3HK0 A;  3CWI A;  4YTM B;  1QIL A;  4JL9 A;  3JVZ X;  5AZH A;  4KX6 B;  3SHQ A;  1I4Q A;  3I5J C;  2FUH B;  2M19 A;  2V0G A;  3GZN I;  2WX1 A;  2BQQ A;  4HPM B;  4ZHP A;  2LAS A;  3L16 A;  5JXV A;  3PO0 A;  1HZ6 A;  1ZW7 A;  3MFG A;  4FUL A;  3WIM A;  5I4D A;  1QOA A;  3MHZ A;  2BS3 B;  3VH4 B;  3AMZ A;  2IO0 B;  2RGF A;  3EGR A;  2KDI A;  1ESF A;  1L0V B;  2LI5 A;  4F7Z A;  3QWZ B;  3BZD B;  5T8I A;  1WZ3 A;  4YSZ B;  1CQV A;  3IG3 A;  1WXM A;  3GE8 C;  4DHZ E;  4XGA B;  2LVQ A;  2KTR A;  4NQK E;  3TL5 A;  3AEF B;  2K8H A;  3VUW A;  1GUA B;  2KVZ A;  1L6U A;  1FNU A;  2BKF A;  4GDL A;  4OVV A;  2E3T A;  2BYV E;  4HCN B;  4MEL A;  1C76 A;  1SEB D;  1Q5W B;  2DZI A;  2J0J A;  1OQQ A;  3ZNZ B;  2CJN A;  3I57 A;  3ZNI D;  1P3Q U;  4HKQ A;  2HTH A;  1GPX A;  3NRZ A;  1J8C A;  3EHV A;  2AQ1 B;  2KWU B;  2LGX A;  3U2S C;  3OAW A;  4C4V B;  1UD7 A;  1GT8 A;  3DWM A;  4EZL A;  4US9 A;  4A9A A;  4L23 A;  4JLC A;  2NPT A;  4B95 A;  3L17 A;  2WXL A;  1XLQ A;  2M8S A;  3VUY A;  1I4R A;  3P63 A;  4RFB A;  1L5P A;  1VR9 A;  3QA8 A;  4KGT A;  3VH3 B;  3Q3M C;  1OGW A;  5D3I B;  2AL6 A;  1T3Q A;  4ANX A;  2I38 A;  1QQR A;  3Q8A A;  4JWU C;  3V3X A;  1KTK A;  3N30 A;  2KQ7 A;  4GIV A;  3WAN A;  5EE3 A;  1E9M A;  1YJ1 A;  4P16 A;  3P2B A;  1E8Y A;  3OWE B;  1EU4 A;  2GBJ A;  4EEW A;  4CYE A;  3ZO5 B;  4A8X C;  2K22 A;  1GB4 A;  4ANU A;  5L95 C;  2ZNV C;  4WAA A;  2LVO A;  2ZW0 A;  4N9F 4;  1A5R A;  2AX5 A;  2NS5 A;  2Y5P A;  5FR6 A;  2JZ3 B;  3VTW A;  2NPT B;  1P98 A;  2Z59 B;  4PYU A;  2PE9 A;  3R66 C;  4S0R A;  1IGC A;  3T8M A;  4MSQ B;  3W1Y A;  4YTP B;  2ASQ A;  4S17 A;  1VZ6 A;  4BOZ B;  5C23 A;  1MHH E;  1XEE A;  2C5L C;  1N5W A;  3H7S A;  3ETR A;  2BYE A;  2LGD A;  4FAD A;  1TY2 A;  1AN8 A;  4HDO A;  1ZE3 D;  2CS4 A;  3OJ3 A;  3DDC B;  4BKS D;  2H88 B;  1DYQ A;  3R7Q A;  4C7Y A;  2GLS A;  2GMI C;  4MH0 E;  4LTU A;  3KLS X;  4DWF A;  1FRR A;  1XCT L;  3OJ4 B;  1OQY A;  3VDZ A;  1WXQ A;  1WH3 A;  5CHV C;  2IPK D;  4ITK A;  1OQR A;  1Q10 A;  2RSU A;  1S1Q B;  3GB1 A;  4HJG E;  1CJE A;  1OFF A;  1JML A;  4HCP B;  2KMC A;  1GTH A;  2MRP A;  2QSD A;  1F52 A;  1F9J A;  5J18 A;  2KMM A;  5GXG B;  4RCO A;  3ZXV A;  2ZPY A;  4DQO C;  3GZN B;  3E56 A;  1V2Y A;  4HKZ E;  2FCM A;  1GG3 A;  2IBI B;  2VZK D;  3Q8C A;  5AUI A;  3RNF C;  5G55 A;  4KSK C;  3DVN V;  3RN9 C;  4IG7 B;  3WCQ A;  2ZNV B;  2X8X X;  2MQJ A;  4YTN B;  1KJT A;  2GBN A;  3LDZ E;  2R2O A;  2LRW A;  4PS7 A;  3UIN B;  3APC A;  4TKN A;  2MH7 A;  2WP9 B;  1VRA B;  4IDI A;  4EOY A;  3OG5 A;  1XLP A;  4FN2 A;  2C7N B;  1HE8 A;  4OW0 A;  3W9C B;  2WDT B;  2MBQ A;  2JXX A;  4M01 A;  2JYE A;  1KFY B;  1UH6 A;  3RPF C;  3IXS A;  2QJL A;  3VTV A;  2FID A;  4XDC A;  2XN9 C;  3FIL A;  4WJQ A;  1MJD A;  2XEW A;  1LFD A;  2CU3 A;  4K3C A;  1GB1 A;  4IC7 B;  3RI7 C;  3O65 B;  1YQ4 B;  3P4S B;  2BB5 A;  3ML9 A;  4K3B A;  3UIP B;  1I7H A;  1FFU A;  2TSS A;  4UDU C;  1FCL A;  2Y5C A;  1HXY D;  1G6J A;  2DLB A;  1FM0 D;  1K8R B;  4DDG D;  4WQO B;  1UWM A;  3CSF A;  3VR8 B;  5IAA C;  2K5P A;  4Q2J A;  3PT2 B;  2WLB A;  2LJI A;  2ZZP B;  3EA6 A;  2INP E;  1GC6 A;  1OEY J;  3Q8F A;  3URY A;  2BS4 B;  1Q0W B;  3M95 A;  3L13 A;  4JPS A;  4BKT A;  2L1A A;  1E6E B;  2W3R A;  2IY1 B;  4XE0 A;  1NBF C;  1UBQ A;  1YJJ A;  1V1P A;  3ZQ4 A;  4FJZ A;  5FK9 C;  4NPN A;  3QX1 A;  1JCK B;  2N9X A;  2CR5 A;  4LNI A;  1Z2M A;  3ZNH B;  4HVB A;  1E5W A;  3MTN B;  4MH8 A;  4GLS C;  4AP4 C;  1BUI C;  1YNT E;  2KQ4 X;  5J2R A;  1WX8 A;  3PRP B;  1I35 A;  2L8J A;  4IWP A;  3ZRF A;  2KWD A;  4IWO A;  1WJ6 A;  1MVK A;  2M4N A;  3BII D;  3WAM A;  5E6O A;  4RM8 A;  1V8C A;  2DEN B;  2GB1 A;  3E9S A;  2MW5 A;  1YX6 B;  2KT7 A;  1N60 A;  1KLG D;  3ML8 A;  4EUT A;  3ZJT A;  1H8C A;  1EU3 A;  3U52 E;  2WXK A;  3PHW B;  3GE3 C;  4JWS C;  3SD5 A;  1FXA A;  2KWC A;  2DYO A;  1I4G A;  4W9D A;  2YLM A;  1NEN B;  4M0W A;  4HXD A;  2LFI A;  2KJH B;  3BK1 A;  4O1N A;  2WXM A;  3IT6 B;  4MGZ E;  1P0R A;  2H89 B;  3PZD A;  4G11 A;  1CK1 A;  4C56 C;  2WWZ A;  3I3T B;  5LNK 1;  1KM7 A;  1SIJ A;  3LJ3 A;  4C7Z A;  3TEZ A;  3QIJ A;  1YIW A;  4EFO A;  1SIF A;  2INN E;  3JYU A;  1ENF A;  3SEB A;  4PS8 A;  3AE9 B;  1B1Z A;  2W3S A;  1DOI A;  2LGY A;  4P1C C;  1RWS A;  2KFK A;  3CST A;  2BVC A;  2MSE D;  3NZU A;  2WDV B;  3PTF C;  2K6D B;  2L0F A;  4ANV A;  3DBR I;  2B3A A;  1TTN A;  2IGD A;  2R61 A;  5HG2 A;  2LGS A;  2JQR B;  3LYY A;  3QK0 A;  3TUO A;  1C9F A;  5C3J B;  4LK0 M;  4FJY A;  3TSS A;  2V4I B;  3H9D A;  4M8N A;  1F0Z A;  3RZW C;  2O6V B;  4DHJ D;  4WAF A;  1JWS D;  3B0A A;  2FUG 1;  2J4X A;  5D3D A;  5JHB A; 
#chains in the Genus database with same CATH homology
 1XLN A;  3FAH A;  1FXI A;  1ZP0 B;  3EUB 2;  3LB8 C;  2Q5W D;  3SFD B;  3AN1 A;  3NVY A;  1WWT A;  2NMQ A;  1PGA A;  1ZXH A;  1RFK A;  1R7S A;  2X38 A;  2J52 A;  4RF1 A;  3CWI A;  4YTM B;  1QIL A;  2PVO D;  4KKI A;  3U7Z A;  4KX6 B;  2LEK A;  3NVV A;  4L2Y A;  2WU5 B;  1YN3 A;  1I4Q A;  1V1O A;  2IDY A;  2M19 A;  2V0G A;  4YSX B;  4RGO S;  5FR3 A;  2KN4 A;  4P6V F;  5C2T B;  1QKZ A;  3R2I A;  2KAJ A;  2J53 A;  4ZHP A;  1SSN A;  2Z8L A;  3MC0 B;  4XDD A;  2M56 B;  5JXV A;  3PO0 A;  2K3U A;  1FIQ A;  1HZ6 A;  1TYG B;  1BXT A;  3MFG A;  5EE1 A;  2JSV X;  2BTE A;  1L4Z B;  5I4D A;  4USA A;  1QOA A;  3MHZ A;  2BS3 B;  1PUT A;  1SF0 A;  4EE2 A;  3BK2 A;  4WUR A;  4NAW B;  1C4P A;  3AMZ A;  3KQ4 A;  1C4C A;  1FRD A;  1I4X A;  3EGR A;  4ZYS A;  1ESF A;  1L0V B;  1QLB B;  2N9L A;  1RYJ A;  3NUH B;  2JXT A;  1N61 A;  3B2F A;  2GI9 A;  3BZD B;  1ZXI A;  5T8I A;  1SE4 A;  4YSZ B;  1CQV A;  4DXG A;  1PDX A;  1H7W A;  1MHX A;  2IGH A;  4C80 A;  1F2R C;  3AEF B;  1UUP A;  3CF4 A;  1JWM D;  4WH4 A;  4OZA A;  1L6U A;  1FNU A;  5D7G A;  2PVG C;  2WU2 B;  2E3T A;  1KLU D;  4JE3 B;  1TS5 A;  3AV8 A;  1NEK B;  5BYR A;  1FEH A;  1C76 A;  1JW9 D;  1SEB D;  2E6X A;  1JRP A;  3NZ3 A;  2W82 A;  3AM9 A;  4N59 A;  5BYQ A;  1OQQ A;  2CJN A;  2AQ3 B;  2LMC A;  3I57 A;  3VQI A;  4HKQ A;  1ET6 A;  1GPX A;  3NRZ A;  1I4P A;  1GAQ B;  2AQ1 B;  2MJE A;  3P4Q B;  3U2S C;  3ZGZ A;  2HDE A;  1WYG A;  1GT8 A;  3CIR B;  1PFD A;  2FE8 A;  3DWM A;  4RGM A;  2WDR B;  1SBB B;  1IGD A;  4US9 A;  1FNW A;  3AH7 A;  4A9A A;  4L23 A;  3MJ5 A;  2WXL A;  3UI3 A;  3B2G A;  3W1S A;  1NYR A;  1FO4 A;  1KF6 B;  1XLQ A;  2BBC A;  2IGG A;  1I4R A;  3TEW A;  3P63 A;  4RFB A;  1L5P A;  3C8Y A;  3MP9 A;  1VR9 A;  3BWU D;  3B9J A;  4KGT A;  4NJC A;  1TKE A;  1PGB A;  1SXT A;  4RGT A;  5D3I B;  1T3Q A;  1TS4 A;  1UWX A;  2I38 A;  1QQR A;  3Q8A A;  4JWU C;  2MJ3 A;  3V3X A;  1KTK A;  3BYY B;  4GDK B;  4GDL B;  3ZJU A;  2JWU A;  5EE3 A;  1E9M A;  2DBY A;  3W5V B;  1RM6 C;  4P16 A;  5H8Y E;  3U4E G;  1L0X B;  1J7C A;  3OWE B;  2LUM A;  1EU4 A;  1T5X D;  3DWG C;  3W2D A;  3ZYY X;  2MEK A;  2SAK A;  2J42 A;  3AB5 A;  3O13 A;  1UNS A;  4A8X C;  2K22 A;  1GB4 A;  3PZ8 A;  4ZRP A;  5H92 C;  1WGK A;  4CQN A;  2L83 A;  2ZW0 A;  3KWL A;  3R2T A;  1XCQ L;  2AX5 A;  3SR6 A;  3TEX A;  2Y5P A;  4TQ1 A;  1BML C;  1NI3 A;  3FC4 A;  1FCC C;  3AEE B;  2WXG A;  1I4H A;  2WXR A;  3TEY A;  1JWB D;  3L4P A;  1E7P B;  3N9Y C;  5BMI A;  3VRA B;  5G5H A;  1IGC A;  5EE0 A;  2ON8 A;  1JWU D;  4YXD B;  4WIP A;  4YTP B;  2ACZ B;  1DGJ A;  3VR9 B;  1VZ6 A;  1J7A A;  3SFE B;  2DYM A;  1MHH E;  1XEE A;  5HI1 A;  1N5W A;  1IBX A;  3T3O A;  2Y3A A;  3ETR A;  4MT5 A;  1D5M C;  3IAM 1;  1JQ4 A;  1TY2 A;  1AN8 A;  2BS2 B;  1ZE3 D;  3Q8B A;  1IUE A;  1P7F A;  2RPV A;  3HVD A;  3RFZ B;  2H88 B;  1DYQ A;  1IBX B;  2EKI A;  1C78 A;  3AE4 B;  4C7Y A;  2BT6 A;  4LTU A;  3KLS X;  4NZL B;  1FRR A;  4L1B A;  1XCT L;  1TKG A;  3R8B A;  2IJ0 A;  1FD6 A;  1VJK A;  1WXQ A;  2WXI A;  2CJO A;  4WQM A;  3P1M A;  4YWG G;  2IPK D;  4ITK A;  5HHD G;  2NTS A;  1OQR A;  1DOY A;  3AEB B;  1CZP A;  1Q10 A;  2N7J A;  2BW2 A;  3GB1 A;  4HJG E;  1CJE A;  2DWQ A;  1OFF A;  1JML A;  4AQ7 A;  1C77 A;  2V3N A;  4A55 A;  1GTH A;  2QSD A;  1HZ5 A;  1F77 A;  2KMM A;  5GXG B;  3NS1 A;  1SJE D;  1HA5 A;  1C79 A;  1M4V A;  4RCO A;  2K9X A;  3BVM A;  1D5X C;  2L52 A;  2N9K A;  4YT0 B;  3W5U B;  4RF0 A;  4DQO C;  1QT9 A;  1E10 A;  3NVW A;  1K50 A;  3E56 A;  4WWM A;  4HKZ E;  1FNV A;  4MM3 B;  5AUI A;  2VZK D;  3Q8C A;  2PLP A;  2KAC A;  2NTT A;  2L32 A;  2RMM A;  1D6E C;  4FXC A;  3WCQ A;  3HVZ A;  3ZJV A;  3AEG B;  2JU6 X;  4YTN B;  1N63 A;  1ZUD 2;  4REZ A;  1PYW D;  4HRS A;  2MH7 A;  2WP9 B;  1VRA B;  4IDI A;  3Q8E A;  2WNM A;  2RDG A;  1XLP A;  3AE5 B;  1YJI A;  1WSP A;  2BYT A;  4OW0 A;  3W9C B;  1D4B A;  2WXP A;  3Q69 A;  2JX5 A;  4RH6 A;  2JYE A;  3AE2 B;  1EWC A;  1KFY B;  1ZDV A;  3RPF C;  3IXS A;  1KH0 A;  2QJL A;  1L4D B;  1V97 A;  4XDC A;  2XN9 C;  3GP7 A;  3AED B;  3FIL A;  2FBW B;  2XNA C;  1EM7 A;  4D2K A;  4TMA B;  1AYF A;  4IKG A;  1SB3 C;  2CU3 A;  2YEP B;  1KRH A;  1GB1 A;  5FKA C;  1QOG A;  4DXF A;  5MPO A;  1TKY A;  2BB5 A;  1YQ4 B;  3P4S B;  3FIL B;  3BVG A;  1I7H A;  2KDM A;  1FFU A;  1NYQ A;  2QIL A;  2TSS A;  4IOI E;  2Y5C A;  4HRO A;  4UDU C;  1FCL A;  1HXY D;  3KWV A;  2DLB A;  1FM0 D;  2WXQ A;  4MAC A;  3AEC B;  1UWM A;  1HEZ E;  1XF5 L;  1ZPS A;  3VR8 B;  3BYT B;  2K5P A;  4ARI A;  1SE3 A;  1STE A;  4Q2J A;  4PT5 A;  1VZ7 A;  2WLB A;  2LHE A;  3ABV B;  2LJI A;  4A6Q A;  3EA6 A;  2INP E;  1FMA D;  3H8H A;  1AWD A;  5EE9 A;  4OVZ A;  3Q8F A;  3URY A;  2MJD A;  2QMT A;  2BS4 B;  4JX1 C;  4TSS A;  4JPS A;  2JZP A;  1HQR D;  4ZRQ A;  2L1A A;  2WXJ A;  1E6E B;  3AE8 B;  1SJH D;  3J9C A;  3PZ7 A;  4B0E A;  1GTE A;  1EWY C;  1Y56 A;  2PIA A;  4J3O D;  1TY0 A;  1XXG A;  4OZB A;  2W3R A;  5BMH A;  1E0Z A;  1WRI A;  4XE0 A;  1YJJ A;  2BB6 A;  1V1P A;  4KGS A;  4R3D A;  1L0Y B;  5FK9 C;  3ZQ4 A;  4H2A A;  1JCK B;  5BMG A;  1VZ8 A;  1JWA D;  2D5G A;  1MI0 A;  4MH8 A;  4N58 A;  3P4P B;  2HTM E;  2ZW1 A;  1K53 A;  3IAS 1;  1C4A A;  4GLS C;  1BUI C;  1YNT E;  3AEA B;  3P4R B;  2KQ4 X;  1J7B A;  2WXF A;  1XLO A;  5BYS A;  2LHD A;  2KWD A;  1MVK A;  1A70 A;  3BII D;  3HUI A;  1QF6 A;  2ONQ A;  1VDV A;  1V8C A;  1YQ3 B;  4KGR A;  2GB1 A;  3E9S A;  1N60 A;  2WXO A;  1TJE A;  1KLG D;  4OZC A;  1QOB A;  1LO5 D;  3ZJT A;  4TQ0 A;  1EU3 A;  3U52 E;  4RGN A;  2WXK A;  2JYT A;  2WS3 B;  1K52 A;  4JWS C;  3VRB B;  1FXA A;  2I2Y A;  1B9R A;  2PW9 A;  1JAL A;  1ROE A;  3AE7 B;  1UGJ A;  2DYO A;  1JRO A;  1I4G A;  4LLG M;  1GOZ A;  1N62 A;  4ZOH C;  1MPE A;  1AW7 A;  1NEN B;  1T6B X;  4RNA A;  2WQY B;  4M0W A;  1NVI D;  2LFI A;  2GRI A;  1FFV A;  3AE6 B;  2LGI A;  2PTL A;  2QEJ C;  2WXM A;  3BK1 A;  4O1N A;  3IT6 B;  1H7X A;  1K51 A;  1V1P B;  1YN5 A;  1PGX A;  1DOX A;  4ZHO A;  1YMH E;  2H89 B;  2V3P A;  2SEB D;  3NVZ A;  1CK1 A;  3IT4 B;  3HRD D;  1ZDX A;  3GS2 A;  4C56 C;  5LNK 1;  4A90 A;  2VZK B;  1SIJ A;  4XWT A;  1D5Z C;  4NAM A;  5E6J A;  4C7Z A;  3TEZ A;  1VLB A;  1YN4 A;  3P42 A;  2WXH A;  1L6V A;  5G5G A;  1ZOY B;  2INN E;  2N0S B;  2K0P A;  5AUK A;  1ET9 A;  3AE1 B;  5HFY A;  5TSS A;  2YEP F;  4AS1 A;  1ENF A;  2PKO A;  2M0A A;  2AQ2 B;  3SEB A;  1P7E A;  3AE9 B;  1B1Z A;  2ICI A;  2W3S A;  4HEA 1;  1DOI A;  1RWS A;  2W55 A;  1SE2 A;  3I9V 1;  4US8 A;  2WDV B;  1ACC A;  1N5X A;  3AE3 B;  4B0M A;  2B76 B;  2EEL A;  2IGD A;  2OED A;  2R61 A;  2OHF A;  1TS2 A;  2WXN A;  5HG2 A;  3T3N A;  2JQR B;  3LYY A;  3TUO A;  2G9H D;  3LXF A;  4N6E B;  3V05 A;  4XWW A;  1C9F A;  5C3J B;  4ARC A;  4LK0 M;  1XO3 A;  1QOF A;  2PMV A;  3TSS A;  2V4I B;  4OHJ A;  1F0Z A;  4KKJ A;  1TS3 A;  2WDQ B;  4YSY B;  2QIE B;  4WAF A;  1JWS D;  2RDH A;  2G1E A;  1F2R I;  2W54 A;  2FUG 1;  2J4X A;  3BVZ A;  5D3D A;  1TZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...