1QLBB

Respiratory complex ii-like fumarate reductase from wolinella succinogenes
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
MGRMLTIRVFKYDPQSAVSKPHFQEYKIEEAPSMTIFIVLNMIRETYDPDLNFDFVCRAGICGSCGMMINGRPSLACRTLTKDFEDGVITLLPLPAFKLIKDLSVDTGNWFNGMSQRVESWIHAQKEHDISKLEERIEPEVAQEVFELDRCIECGCCIAACGTKIMREDFVGAAGLNRVVRFMIDPHDERTDEDYYELIGDDDGVFGCMTLLACHDVCPKNLPLQSKIAYLRRKMVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
publication title Structure of Fumarate Reductase from Wolinella Succinogenes at 2.2 Angstroms Resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 61
structure length 239
sequence length 239
chains with identical sequence E
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 1999-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1qlbB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qlbB01
3NVYA 3CF4A 1QOFA 4YXDB 4KX6B 1OQQA 1TJEA 1UWMA 4C7ZA 3VRBB 1CJEA 5AUIA 1JQ4A 2N0SB 1FM0D 1JRPA 2OHFA 4ZHPA 1AYFA 1RWSA 1XLNA 3DWMA 5MPOA 2WU5B 1GT8A 1YQ4B 2WDVB 1RM6C 1YJJA 3AE4B 3L4PA 4YSYB 3P63A 1L6UA 2CU3A 2KMMA 3VRAB 3AMZA 1TKGA 3AEDB 1FRRA 1JW9D 5AUKA 1N60A 3RPFC 1TKYA 2WS3B 4C7YA 1L6VA 1FFVA 3HVZA 4ZOHC 1JWAD 2LEKA 4YTPB 1N62A 1WYGA 1TYGB 2QJLA 3AE2B 2WDRB 1J7CA 1DOXA 3HUIA 1E6EB 1KF6B 4YTMB 2M56B 2PVGC 2W55A 3AE7B 1H7WA 3KWLA 5EE3A 2PIAA 3BIID 3AE3B 1KRHA 1L0VB 2WP9B 4JWUC 3AECB 1A70A 3AN1A 1GTHA 1PUTA 4JX1C 4WWMA 4YTNB 1DOYA 1DOIA 1NYQA 1FMAD 3P1MA 5EE9A 1NI3A 3P4SB 3W5VB 1QT9A 4ITKA 3FC4A 1GPXA 5C3JB 2L83A 3ABVB 1FRDA 2Y5CA 4FXCA 3B2FA 3AEBB 1QF6A 4USAA 2WQYB 1TKEA 1WXQA 2BT6A 2EKIA 1NYRA 1PDXA 1IUEA 1XLQA 2M19A 2DWQA 2BS2B 2B76B 3EUB2 1FFUA 3NVZA 3P4PB 1OFFA 2PKOA 3B9JA 3NRZA 2MJEA 3AE5B 4YSZB 3NS1A 1N5WA 1GAQB 1JWBD 1N63A 2K5PA 3WCQA 1V8CA 3P4QB 1F0ZA 2ACZB 1GTEA 2WU2B 2KAJA 1RYJA 3AH7A 1QLBB 1JROA 2MH7A 1SIJA 3W5UB 3AE9B 5C2TB 1YQ3B 1N5XA 4ZHOA 1ZP0B 1VDVA 4N59A 1JALA 2CJOA 5H8YE 3NVVA 4N58A 4HROA 4WQMA 5G5GA 3VR9B 5H92C 3LB8C 3LXFA 1OQRA 1NVID 3FAHA 3AV8A 2BS4B 3AEFB 5G5HA 4YSXB 2JQRB 3SFDB 1I7HA 1L5PA 2CJNA 2W54A 1WGKA 1E10A 1SB3C 2W3RA 4C80A 3VR8B 4JWSC 1ROEA 3CIRB 1AWDA 3PO0A 3AB5A 4HRSA 1J7BA 3ZYYX 2QIEB 1FO4A 1RFKA 1J7AA 3AM9A 2PVOD 1N61A 2MJ3A 3P4RB 2MJDA 3NVWA 1NENB 2HTME 1DGJA 1E0ZA 1T3QA 2DBYA 3AE1B 5EE0A 4N6EB 1PFDA 1WWTA 1V97A 4IDIA 1EWYC 1ZUD2 3AEGB 1YJIA 2AX5A 1R7SA 1XLPA 1QOGA 1FIQA 1ZXIA 1E7PB 2G1EA 3SR6A 3CWIA 1E9MA 3W9CB 2H88B 2BS3B 3AEEB 2JX5A 1FXIA 1H7XA 1KFYB 1NEKB 2K22A 4US8A 2H89B 4YT0B 3B2GA 1XLOA 1XO3A 1QOBA 3ETRA 4P6VF 1CZPA 1QOAA 2W3SA 4A9AA 1B9RA 3AE6B 2K9XA 4LTUA 1VJKA 4US9A 2E3TA 3HRDD 1SF0A 1FXAA 3DWGC 3SFEB 2Q5WD 3AEAB 2WDQB 1WRIA 5GXGB 2WLBA 1ZOYB 1VLBA 2FBWB 5EE1A 2L52A 3AE8B
chains in the Genus database with same CATH superfamily
2X38A 3CF4A 5AZFA 3PPAA 4YXDB 3IXSA 3GS2A 4W9CA 2HE7A 1V49A 4BOZB 2BWES 3VDZA 4ZHPA 3Q6BA 4ZYNA 3P63A 3VUXA 2LGYA 2SAKA 3TEWA 3RPFC 3RCZA 2REXA 2IO0B 2L7RA 3V05A 2MQJA 4S17A 2WP9B 1RLFA 3PZ7A 1QT9A 1GPXA 3R8BA 3IFWB 4GU2A 5DPTA 2K1FA 1CK1A 2A5UA 4BZAA 1LXDA 1M4VA 4II3B 2B76B 5IAAC 3BVGA 4NQKE 5DPSA 3GZNB 3UF8A 2LRWA 3NS1A 3QK0A 2INNE 1SIJA 2DNFA 4F8CB 2RDBC 3Q8EA 3IBEA 4N58A 4OZAA 1STEA 3IG3A 4DHZE 5HG2A 1WZ3A 2WXFA 4W9JA 3V60A 4LJPB 2IO1B 1L5PA 2IBIB 2YEPF 1PYWD 2QIEB 3PLUA 1RFKA 4RCOA 2LFIA 1V5TA 2WXGA 4DHZB 5BYQA 3R3MA 4EFOA 3O65B 1FIQA 3WIMA 3BY4B 3ZNZB 5E6PA 2JX5A 1FXIA 5CTRC 2H89B 1XO3A 1QOBA 2R61A 1WH3A 3MC9A 4OVUA 4AP4C 1WGRA 2CHZA 2ZCBA 1C1YB 3DBLI 2FUG1 3SFEB 1IYFA 2QMTA 4G50A 1D5XC 1QOFA 4I6LB 5FKAC 4G0NB 1JRPA 2AQ3B 3U8ZA 5IOIA 4K3CA 1UBIA 2PTLA 3PHXB 2KO3A 2R2QA 2CU3A 4K7UA 3KYCD 1HQRD 1WX7A 3GP7A 3QHTA 2NBWB 4HPPA 3EA6A 4IG7B 2JZ3B 3AULA 2IGHA 1KF6B 1H7WA 3RNCC 3ZVVA 2R2OA 1WRDB 3LYYA 1V9JA 3VFKA 3P1MA 3AU4A 3L13A 4M8NA 4ITKA 1UH6A 3V62A 1EU3A 2DHZA 1TS5A 1TY2A 2NTSA 3QJZA 2LRUA 1ISNA 2GLSA 2LGSA 4B9KA 3D32A 1AN8A 2RMMA 3TIXA 4IM0A 2WXPA 1MPEA 2LXAA 3P4QB 4JPSA 3PV1A 2WU2B 1MHHE 5C2TB 1HEZE 1JWUD 1WF9A 3AU5A 3PSEB 3ECIA 2K0PA 4NJ6A 4W9KA 1VR9A 4MSMB 1J7BA 3ZYYX 1WZ0A 4M0WB 3RYTA 1T3QA 4CHKA 2N1WA 2W82A 3TEYA 2LMCA 2JVCA 3DBHB 3ZNID 3CWIA 2RPQA 2O6VB 2ZEQA 1XLOA 2D2QA 1L4ZB 2DYMA 1V81A 2J52A 2C7MB 2K9XA 2L00B 4US9A 4CQNA 3HRDD 3QAQA 4IOIE 1JWSD 5J17A 1UBQA 1RWSA 3RZWC 2C5LC 5LXIB 1SXTA 4FJVB 1YJJA 2ZNVC 3TUOA 2G4DB 4H2AA 2RD0A 3ZLZA 3ZUNA 2LGIA 1FRRA 2MWSB 4FJYA 1N60A 1MHXA 4G11A 3ALBA 5L83A 1F52A 2KD0A 2PMVA 4KIKB 1YJ1A 4B95A 1WXSA 4MM3B 1EM7A 1VCBA 1AARA 1GNUA 1VD2A 3H9DA 2JSVX 2KQ7A 1E8ZA 4WWPA 4NAWB 1IUEA 3EECA 3T3NA 4A8XC 2GBKA 3UINB 3WCQA 4WJOA 4BKTA 5LXHA 3AE9B 4A3OA 4ZHOA 3NZ3A 1ZP0B 1Q1OA 3WA0A 4W9IA 3KVFB 1KLVA 2MLBA 4F7ZA 5JZEB 2WXRA 5JHAA 1L0XB 2GBRA 3H8HA 1WE6A 1VZ8A 2MBHA 4C4VA 4JIOU 4OZBA 3TSSA 1LM8B 2LZ6A 4EOYA 1IGDA 1Q5WB 4KDIC 3DBSA 2MP2A 2PE9A 4PYUA 2BW2A 2DYBA 1ENFA 4YT0B 3ZJUA 4P6VF 2BPSA 1B9RA 2KX3A 2VRRB 5D7GA 2KFKA 1Q0WB 4DXAB 5BYRA 3DDCB 1VRAB 4IKGA 2Q5WD 1WRIA 2GB1A 1VLBA 3NG0A 1PGXA 3R7QA 4MDKE 2FIDA 2XN9C 4K7WA 1UWMA 3DOWA 3DVGX 3VRBB 1V1PA 1XLNA 4WJQA 2WU5B 2D3AA 2K6QA 4YSYB 1IGCA 3VXWA 1GOZA 2LGDA 4RGMA 1CQVA 4MEMA 4YTPB 2J7QB 3BZDB 3U2SC 2LUMA 4KGSA 3CF6E 2M56B 1Q10A 3DHHC 4HVBA 2TSSA 2JUOA 1WJUA 2Y5PA 3FC4A 3R7RA 3TL5A 3QX1A 2L83A 4FXCA 4XX5A 3OJ3A 4B6WA 3U52E 3VH3B 1UZXB 2KVZA 4EZJA 4B0EA 1LQBA 2IGDA 5L95C 4K3BA 3ZTCA 4RMAA 4KGRA 4IWOA 1F0ZA 2PW9A 4RM9A 3NZSA 3JSVA 1QZEA 1MFWA 2N7JA 1Z5SB 1TS2A 3DBRI 2KJHB 2MBEA 1T6BX 3ZXRA 3LXFA 4BVUC 1TY0A 1GC6A 2CJNA 1P98A 1WMHA 1SB3C 1SE4A 2V3NA 4EZKA 2PVOD 4RM8A 3KH0A 1E8WA 3ZKJC 3MHSD 2N9EB 3N3KB 2IZVB 2FE8A 1NEKB 4IUMB 3B2GA 2INPE 3N1XC 1XEEA 3MC0B 4ASWC 2QEJC 4LJOB 1FXAA 1JRUA 2KN5A 1TGZB 2K3UA 3CSTA 4C7ZA 1JQ4A 3PRPB 4ICVA 4D2KA 2DZIA 2NR2A 2JPHA 4P16A 4C7YA 3EFCA 1L6VA 1JWAD 2NBVB 1ZKHA 2W55A 2V4LA 1ZDXA 3FILA 1KRHA 3Q8BA 4XWWA 4ACFA 2KTFA 4GDLB 4A3PA 3W5VB 2DZMA 2L05A 2XBBC 3B2FA 1R4MI 2ZPYA 3CSFA 2BB5A 2M0AA 4RGTA 2XNAC 3NVZA 2PKOA 2VZKB 3NRZA 4GN1A 1GAQB 1C78A 4KSKC 2EMSA 3BINA 1I42A 2ACZB 2FIFA 1QLBB 4HPMB 1YQ3B 4QAYA 2KKCA 2WXLA 3B0AA 4LDTB 1AW7A 2MBBB 2YLMA 3A9KB 3BK2A 5IO9A 2HJ1A 2JQRB 2KDEB 3B1LX 2WX0A 2WXMA 4NY0A 3VAWA 1F2RI 4MGIE 1J7AA 1HE8A 3P4RB 5HHDG 1FNVA 3TJPA 4F1SA 1R7SA 2QSDA 4HLEA 2PEAA 4GOCA 1ZGUB 1F9JA 2RGFA 4M00A 3AE6B 1EU4A 2QCZA 4WQOB 4IW0A 3RN9C 1D3ZA 2J0JA 3I3TB 2KC1A 3DWGC 3Q3JA 1ZOYB 4URKA 3M3JA 2K39A 1E8YA 3TBLD 2N4FA 2D3CA 3N20C 4MACA 3WAPA 1Y56A 4UDUC 3OWEB 3PHWB 1R4NI 3M62B 2WWZA 5C23A 3TMPB 2JYEA 2NPTB 4LNNA 5TR5A 1UF0A 1WFYA 2CR5A 2KXJA 1NI3A 1PGAA 2V0GA 1NI2A 3PREA 5BYSA 2KDBA 2O2VB 3P4PB 2QC8A 1OFFA 3B9JA 3IAS1 4ANVA 3VVWB 4GLSC 1N5WA 3BVMA 4BBNF 2HTHA 2MBQA 1VDVA 5G5GA 4WJNA 2KLGA 5CX3A 3VR9B 1FEHA 2BKFA 2WXHA 4K81A 3PGEA 5J2RA 1XCQL 4WWNA 2LHDA 4GMVA 4I6PA 3QIJA 1KOTA 2W3RA 2KLCA 3H7PA 4GSWA 2GI9A 2MJ3A 2MJDA 1WX9A 4GXBA 3ZRCA 4LNIA 3KW5B 4N6EB 1PFDA 4WIPA 3AEGB 1YJIA 4AJYB 3Q3NC 4ZRQA 4E3CA 4NAMA 1L2NA 4C00A 2INDC 4PS3A 5E6JA 2FNJB 2A4ZA 2N7EA 3B08A 1V1OA 5IP4D 2NVUI 1IBXA 1EWCA 1H4RA 2B3AA 3MJWA 2BQQA 1FM0D 2IDYA 1TTNA 2KDIA 4XGAB 1WXVA 2JXXA 2WXQA 5BMIA 4TQ1A 1WYGA 1ESFA 1J7CA 3I5JC 1YN4A 1F77A 2UWQA 1T0SC 3PRZA 2PIAA 3Q3OC 1A70A 3DBRB 1F2RC 4HKQA 1UD7A 2D11A 2RDHA 3HK0A 1VZ6A 3IT6B 3ENEA 1XLQA 3L16A 3Q3MC 4AUQC 2MHJA 2OJWA 1ZW7A 3AE5B 1N63A 3CMMB 3PLVA 4RFBA 2KAJA 1RYJA 1KJTA 2GBMA 1OEYJ 1SJHD 1YD8U 4N59A 4XWTA 5E6OA 2GRIA 5LNK1 3U4EG 1E5WA 4WAFA 2KX0A 1FCCC 3Q2AC 1WGHA 1T5XD 5E6NA 2JT4B 3EGRA 4IM3A 1NENB 2D07B 1DGJA 2NBUA 1EUVB 3W2DA 1EWYC 1T0QC 2KANA 5D6JB 4DK5A 3AEEB 2WXNA 4II2B 1MJDA 2LJ5A 1LGRA 3UIOB 1WR6E 1D6EC 2BF8B 3C19A 4HJKA 4M0WA 2O6VD 4KSLC 2KQ4X 3BYTB 3LJ3A 4IM2A 2AQ1B 1SF0A 2WDQB 4REZA 2D3BA 4BFRA 1KTKA 2FBWB 1H8CA 5EE1A 3NVYA 2ON8A 2O6VA 4KX6B 3A9JA 4HCPB 3L08A 4KZ0A 1CJEA 1HTOA 2N0SB 2WXIA 3HIZA 1AYFA 1OGWA 2JWZA 3DWMA 5G55A 1A5RA 2V1YA 2XK5B 4MGZE 2WS3B 2G9HD 4YWGG 2OOBB 1NBFC 3URYA 4BKSD 1C77A 4FHKA 4JWUC 4FLHA 3AN1A 4TKNA 4PK1A 3AEBB 1QF6A 5JH5C 2L1AA 2BYTA 2Z59B 2M1MA 2V9HA 4HK2A 4XDCA 4MM3A 2K5PA 1QQRA 1WJNA 2KTRB 4RNAA 4W9EA 4ARIA 1YNTE 3ZGZA 4HROA 4NAWA 3Q8CA 1T0RC 1WGKA 1Z2MA 4MJSB 4C80A 3BK1A 4OZCA 4HRSA 2ICIA 1GG3A 3PVLA 5HKHA 5EE0A 3TEZA 3RI7C 4TUUA 1ZUD2 2BYFA 2QILA 1K50A 5DPWA 1ZXIA 3QCAA 3RNBC 5JXVA 3R66C 1H7XA 4GDKA 2D3GA 4US8A 2Y5BB 4R3DA 1WR1A 3I9V1 1D4BA 3A1QA 5DCNA 2KDMA 1C4CA 2LHEA 3W1SC 3Q69A 1T0YA 1V80A 1HA5A 2KWVB 2KN4A 3OAWA 2V4IB 1KM7A 1WY8A 3KQ4A 4ZRIA 3AMZA 5IKCM 5AUKA 1TKYA 4KKJA 3HVZA 1OEYA 2WXJA 1DOXA 2WX1A 2PVGC 3T8MA 4XDDA 3KWLA 3WAOA 1L0VB 2KMAA 3AECB 4WWMA 1FMAD 5FK9C 4DXFA 1FNWA 1TS4A 2AQ2B 4RF1A 1HZ5A 1I4QA 3RNGC 2N9KA 2MJEA 4LNOA 1ZPSA 1JMLA 1WYWB 4ANUA 4EUTA 2ZNVB 4J3OD 2WXKA 3W5UB 3MHZA 1N5XA 4ARCA 4MH8A 2CJOA 3R2IA 4HWIB 4E71A 2ZPNA 3N1YC 4MSQB 4M01A 2QHOA 3FAHA 4YSXB 4CYEA 1I7HA 2N9LA 3OLMD 4YL8A 4DDID 1KLGD 4HCNB 3NVWA 3RNEC 1LO5D 1LFDA 4LK0M 4I6NB 1WE7A 2I38A 3W1SA 1YX6B 4BBNC 2JXTA 2H88B 2BS3B 4OHJA 3MC8A 2DYOA 2K22A 4GGQA 1QOAA 3L54A 3N30A 4FULA 3T3OA 3P2BA 1UWXA 1ZDVA 3DBLB 1GB1A 1C4AA 2IO3B 1HZ6A 1WGGA 5AUIA 2MSED 3DVGY 1ZXHA 5T8IA 4WH4A 2LD9A 2Z8LA 2KMMA 1GUAB 4FADA 1E7VA 1FFVA 2JY6A 3QA8A 4MT5A 1N62A 1XD3B 1TYGB 2QJLA 4ZRKA 3HUIA 3AI5A 1FXTB 3AE7B 4CO7A 2NMQA 2BYEA 1EF1A 1FPYA 1FCLA 3ZNGC 4W9DA 3H7SA 1DOYA 5J18A 3ZQ4A 4PT5A 2JZPA 3ABVB 1L0YB 1UNSA 2BT6A 2BS2B 3J9CA 4MELA 3VQIA 2RSUA 2LGXA 2ZW1A 1C79A 3APFA 2G45B 3I63C 2RPVA 4M8MA 3ZO5B 2GBNA 2MH7A 4DHJD 1UUPA 1C4PA 2VZKD 2IPKD 4FBJB 2ONQA 3X23A 3N9YC 3TEXA 5I4DA 1OQRA 2EELA 4ZDVA 1I4PA 2OEDA 4LDTD 1WGYA 4RGOS 4DHJB 1SBBB 1JCKB 4P1BC 2HTME 4OVZA 5JHBA 5FR6A 2LWPA 1UGJA 5DPRA 1QOGA 3FILB 3A9KA 3APDA 3RMKC 1E9MA 5C1ZA 2CU1A 3L17A 1N6ZA 1HTQA 1KFYB 4LNKA 3NY5A 3DHGC 3BVZA 3RNAC 2BVCA 5BO4B 2G4SA 1P1AA 1QKZA 2BKRB 2EKEC 2KNBA 2CHXA 1L4DB 1TJEA 3K9PB 4AOFA 4ZYSA 1BXTA 5D3DA 2JZZA 3IT4B 3N32A 2KDFB 3DPDA 3BYYB 4ZOHC 2JYTA 4FA6A 3Q3FA 4DWFA 3ZDTA 2M17A 2ZW0A 1UELA 3AE3B 2KACA 1NYQA 2KZRA 4NNJB 2Z0DB 1FD6A 5C3JB 1RAXA 4KV2A 2L8JA 2EKIA 2YEPB 4ZRJA 3EFUA 2DWQA 5IN7A 2BGFA 2MW5A 1IPGA 1V8CA 5IA7A 1XF5L 1I4RA 3NVVA 1TS3A 4B0MA 2MA9B 3VTUA 3E9SA 1XT9B 4HKZE 1E7UA 3IAM1 5G5HA 4DXGA 2AL3A 1J0GA 1V6EA 2NS5A 3V3XA 2L3ZA 4KVGB 2MX2A 2BBCA 2Z0EB 1V97A 2ZCCA 3VH4B 4P7IA 1P7FA 3GE3C 1ET9A 1F1HA 4EEWA 1CZPA 2W3SA 3ZNHB 4MGKE 4EKUA 1YN5A 2I1KA 3ZDMC 3K9OB 2INCC 5CHVC 3GE8C 2KQSA 2LXCA 2L52A 3AE8B 2V3SA 2EMTA 4WJPA 2J42A 2KK8A 2WXOA 1GT8A 3W1YA 3UIPB 3P42A 2ZZPB 3SD5A 1JW9D 5AEKB 2W9NA 1HXYD 2YVCA 1MG8A 2MCNB 2IY0B 2WDRB 3V61A 1WSPA 2MEKA 3H7PB 3M95A 3UQAA 2IO2B 1YX5B 2DZJA 1C9FA 1GTHA 3MFGA 4YTNB 3R2TA 1SJED 5EE9A 3P4SB 4M02A 2IY1B 2KWUB 3MP9A 1PDXA 2CHWA 3DCGA 4K1RB 2M19A 3UI3A 2M0XA 1E90A 2GOWA 1K51A 1SE2A 1IBXB 1GTEA 1WIAA 2PLPA 3IVFA 2X8XX 2BB6A 3NUHB 4WQMA 3DHIC 5D2MB 5HI1A 2LVQA 4NJ7A 5BMHA 2N9PC 1FO4A 3JVZX 3RUIB 3QWZB 3VUWA 4P1CC 4NQLB 2AX5A 1M94A 2G1EA 2E6XA 4XZ4A 3VTVA 4TQ0A 5HFYA 2FCSA 5G2NA 4PS8A 3QQ8B 3APCA 4XE0A 3OG5A 3ZJVA 5BMGA 4LTUA 5D94A 4IC7B 1WGDA 3FKYA 1WJ4A 3AEAB 1B1ZA 4USAA 4FHJA 1SIFA 2D5GA 2N1VA 2C60A 3QC8B 1ACCA 2C9WB 5MPOA 2FCNA 2WDVB 1RM6C 4AQ7A 3AE4B 3L4PA 4NZLB 2IYDB 4OVVA 1S3SG 3VRAB 1WXMA 1OQYA 3HM3A 3KUDB 1QILA 2G3QB 3A4RA 3BWUD 2KVRA 4JGHB 3WAMA 5AZGA 5EDSA 3DVNV 4HXDA 4WAAA 1FNUA 2LVPA 1WM3A 3DVNU 1DOIA 2XK5A 2FCQA 1SEBD 4O1NA 2V3PA 3RD2A 1TBEA 5CHFA 2PPHA 1WXQA 3VTWA 2D10A 2M8SA 2K8CA 1R4MB 4MH0E 4TSSA 2NTTA 4Q2JA 4J6IA 1L7YA 3Q8FA 4EE2A 3KYDD 2BTEA 3C0RB 3NHEB 1YIWA 3X0WA 4GB9A 2LASA 2LUEA 1OTRB 3AH7A 3HVDA 4HDOA 4WURA 1J19A 3ZXVA 1DYQA 2WGSA 2KFJA 3A9JB 3RFZB 2LJIA 4RGNA 4BKSA 2SEBD 4JL9A 3AV8A 2BS4B 4A20A 1I35A 3SFDB 4DDGD 4KKIA 2ZJDA 4KIKA 3CIRB 1AWDA 2QDFA 2J0KA 3AB5A 3PO0A 4S0RA 4ANWA 3OJ4B 2KTRA 3PTFC 2I2YA 1TIFA 1E0ZA 4K7SA 2DBYA 1WWTA 4IDIA 3WALA 4ICUA 1WM2A 3U7ZA 3SR6A 3VUYA 4AWJA 2FUHB 3DQVA 4BOSC 3KWVA 4MJSA 3T9LA 2BYVE 2PE6B 3O13A 3L10B 3RULA 1VJKA 1ET6A 4W9LA 3ZTDA 2IGGA 1I4GA 2J0MA 1OQQA 1I4HA 2CS4A 2KYWA 2L32A 2OHFA 4C56C 4FN2A 3LDZE 4HDQA 1C76A 4MGYE 4HEA1 1PQSA 2LEKA 3NOBA 3E56A 1K52A 1R4NB 3AE2B 3PT2B 1E6EB 2KHWB 1MG4A 3BIID 4W9HA 1PUTA 4JX1C 4XYCA 3AXCA 4KGTA 3Q14C 1V86A 1NDDA 5TSSA 4DQOC 3U7DA 2WQYB 4GIVA 4GDKB 2C7NB 3A4SC 1V5OA 3Q8AA 3EUB2 1FFUA 1TZOA 1Y8RC 4OW0A 4KDLB 5GMVA 1D5MC 4JLCA 4YSZB 2K8HA 3A1QB 4AJWA 3ZRFA 3SDLC 1XCTL 2WHIA 1JROA 3KUCB 2FAZA 4C4VB 3PRMB 5CHWA 2AWTA 4A55A 1K8RB 3ONSA 1GC7A 2K6DB 3LB8C 1JWMD 3A33B 3MTNB 2MP2B 1RFAA 1MVKA 3GZNI 1C3TA 1SSNA 2JF5A 3MJ5A 3AM9A 2KFKB 2VH1A 1VZ7A 2N7DA 5KHOA 1XLPA 2KT7A 1MI0A 2OJRA 3H1UA 1E7PB 1U4AA 1D5ZC 2MBOA 4NPNA 4TMAB 4BAXA 2DLBA 5LLIA 1V1PB 2C7HA 3ETRA 1WI0A 4A9AA 1I4XA 3L0WB 2ZVOA 1X1MA 2ZVNA 2WNMA 2E3TA 2GMIC 4ZRPA 3ZIMA 3M63B 2BWFA 2DAFA 3GOEA 1GB4A 3JYUA 2XEWA 2JRHA 4JE3B 1SGHA 2M4NA 4DBGA 2JU6X 4TV3A 1TKGA 3SEBA 2L0TA 4L2YA 1GJZA 1P3QU 3PZDA 4HJGE 2KWCA 2CKHB 1WX8A 1TT5B 4LCDE 5AZHA 1J8CA 1P0RA 2KC2A 4G3XB 2I1JA 2DAJA 1P7EA 3U30A 3S2AA 4NJCA 3UGBB 4L1BA 3JSVB 1FRDA 2Y5CA 3NZUA 4RF0A 1KLUD 4W9FA 2WYQA 2K25A 1SE3A 2KJRA 4JQWC 3NJTA 2KJ6A 2ASQA 1BUIC 1V2YA 2UYZB 1WMHB 4EZLA 3SHQA 5H8YE 1JALA 4A6QA 1NVID 2NCNA 3AEFB 4KZCA 2W54A 1TZ1A 1YQBA 1E10A 2HDEA 1KH0A 2RR9A 4BKGA 2RDGA 3V6EB 2HJ8A 1N61A 2JWUA 4IWPA 3ML9A 2KOXA 4GDLA 2MRPA 1G6JA 1XQQA 3AE1B 3N1ZC 2DX5B 3ZW3A 4ANXA 2GBJA 3W9CB 2AL6A 3C8YA 5KHQA 1P9DU 1K53A 2WDTB 5GXGB 2WLBA 3TCAA 3DBHI 1EO6A 4IWQA 1CMXB 3ZJTA 4FJZA 4PS7A 1RRBA 3QARA 1YQ4B 1SE9A 2L0FA 4RH6A 1L6UA 1UGMA 3AEDB 1PGBA 1IP9A 4L23A 2LVOA 4A90A 1BMLC 3EHVA 2HD5B 1YN3A 4YTMB 2PJHA 3EC8A 3VHTC 2JRIB 5EE3A 2K8BA 3GB1A 1YOVB 1ZE3D 3KUZA 2N9XA 2AEHA 2L76A 3ML8A 3KLSX 1TKEA 3RT3B 4LLGM 1S1QB 1NYRA 2Y3AA 2LI5A 3HHMA 4X57B 2VH2A 3PS6A 1JWBD 4XC2A 3SU8X 4LNFA 1WXAA 5FR3A 3HM6X 3RNFC 2AYOB 2FCMA 1WJ6A 3NS8A 3RZFA 5H92C 4E74A 4WWOA 4HPLB 3I57A 2KMCA 1YMHE 3JW0X 3H6NA 1BT0A 3VR8B 4JWSC 1ROEA 4AS1A 1E8XA 2NPTA 1XXGA 4N9F4 2UU7A 1EF5A 3WANA 2O2VA 3PZ8A 2KWDA 4PYZA 4W9GA 2J53A 3UQBA 2DZKA 3IHPC 2IJ0A 5D3IB 2J4XA 3V6CB 2DENB
chains in the Genus database with same CATH topology
2X38A 3CF4A 2KN4A 4YXDB 3IXSA 2D5GA 3GS2A 4C7ZA 1JQ4A 4ZHPA 1ACCA 2V4IB 4D2KA 5MPOA 2WDVB 1RM6C 4AQ7A 3AE4B 3KQ4A 3L4PA 4NZLB 3P63A 2SAKA 3TEWA 3VRAB 3AMZA 3RPFC 5AUKA 4P16A 1QILA 1TKYA 4C7YA 1L6VA 4KKJA 3BWUD 3HVZA 1JWAD 2WXJA 3V05A 1DOXA 2W55A 2PVGC 4XDDA 3KWLA 1ZDXA 3FILA 1KRHA 1L0VB 2WP9B 1FNUA 3Q8BA 3AECB 4XWWA 4WWMA 4GDLB 3PZ7A 1DOIA 1FMAD 3W5VB 1QT9A 5FK9C 1SEBD 4DXFA 1GPXA 3R8BA 1FNWA 2V3PA 4O1NA 3B2FA 1CK1A 4USAA 1WXQA 1TS4A 2AQ2B 4RF1A 1HZ5A 4TSSA 2BB5A 1I4QA 1M4VA 2NTTA 4Q2JA 3Q8FA 2B76B 2M0AA 3BVGA 2XNAC 3NVZA 4RGTA 4EE2A 2BTEA 2PKOA 2N9KA 2VZKB 3NRZA 2MJEA 3NS1A 1GAQB 1ZPSA 1C78A 1JMLA 4J3OD 2WXKA 2ACZB 3AH7A 1QLBB 3W5UB 2INNE 1SIJA 3HVDA 1N5XA 3MHZA 1YQ3B 2WXLA 3Q8EA 4MH8A 2CJOA 3R2IA 4WURA 4ARCA 1AW7A 1DYQA 4N58A 4OZAA 1STEA 3RFZB 5HG2A 2LJIA 4RGNA 2WXFA 2SEBD 3FAHA 3AV8A 3BK2A 2BS4B 4YSXB 2JQRB 3SFDB 1I7HA 1L5PA 2N9LA 4KKIA 2WXMA 2YEPF 1KLGD 3CIRB 1AWDA 3PO0A 1PYWD 3AB5A 1F2RI 2QIEB 1RFKA 4RCOA 1J7AA 2LFIA 2WXGA 3P4RB 3NVWA 2I2YA 5HHDG 1FNVA 1E0ZA 5BYQA 2DBYA 1LO5D 1WWTA 4IDIA 4LK0M 1R7SA 2QSDA 1FIQA 3U7ZA 3SR6A 2I38A 3W1SA 2JXTA 2H88B 2BS3B 4OHJA 2JX5A 1FXIA 2DYOA 2K22A 3KWVA 2H89B 1XO3A 1QOBA 2R61A 1QOAA 3AE6B 1EU4A 3O13A 3T3OA 1VJKA 1UWXA 1ET6A 2FUG1 1ZDVA 3DWGC 3SFEB 1GB1A 1ZOYB 1C4AA 2QMTA 1HZ6A 1D5XC 1I4GA 1QOFA 2IGGA 1OQQA 1I4HA 5FKAC 5AUIA 1JRPA 2L32A 2OHFA 4C56C 1ZXHA 2AQ3B 5T8IA 4WH4A 2PTLA 2Z8LA 2CU3A 2KMMA 4MACA 1C76A 1Y56A 1HQRD 4UDUC 3GP7A 3OWEB 1FFVA 4HEA1 2LEKA 3E56A 3EA6A 4MT5A 1N62A 1TYGB 1K52A 2QJLA 3AE2B 3HUIA 1E6EB 1KF6B 2IGHA 3AE7B 1H7WA 2NMQA 2JYEA 3BIID 1FCLA 3LYYA 1PUTA 4JX1C 1DOYA 3P1MA 4KGTA 1NI3A 3ZQ4A 4ITKA 1PGAA 4PT5A 2JZPA 5TSSA 3ABVB 1L0YB 1EU3A 2NTSA 1TS5A 1TY2A 4DQOC 2V0GA 1UNSA 2WQYB 2BT6A 4GDKB 3Q8AA 5BYSA 3EUB2 2BS2B 1FFUA 1TZOA 3P4PB 3J9CA 3VQIA 1AN8A 1OFFA 2RMMA 4OW0A 3B9JA 3IAS1 2ZW1A 1C79A 1D5MC 4YSZB 2WXPA 4GLSC 1N5WA 1MPEA 2RPVA 3BVMA 4JPSA 3P4QB 2WU2B 1XCTL 1MHHE 1JROA 2MH7A 1UUPA 5C2TB 1C4PA 2VZKD 2IPKD 1VDVA 1HEZE 2ONQA 4A55A 1JWUD 5G5GA 3VR9B 1FEHA 2WXHA 3N9YC 3TEXA 5I4DA 3LB8C 1XCQL 1OQRA 1JWMD 2EELA 1I4PA 2LHDA 2OEDA 4RGOS 2K0PA 1MVKA 2W3RA 1VR9A 1SSNA 1J7BA 3ZYYX 2GI9A 1SBBB 3MJ5A 1JCKB 3AM9A 2MJ3A 2MJDA 2HTME 4OVZA 1VZ7A 1T3QA 4N6EB 1PFDA 1UGJA 2W82A 4WIPA 3TEYA 3AEGB 1YJIA 2LMCA 1XLPA 1QOGA 1MI0A 3FILB 1E7PB 1D5ZC 3CWIA 4TMAB 4ZRQA 1E9MA 2DLBA 4NAMA 1KFYB 5E6JA 1V1PB 1XLOA 3ETRA 4A9AA 1L4ZB 3BVZA 2DYMA 1I4XA 1V1OA 2J52A 2K9XA 1QKZA 4US9A 2WNMA 4CQNA 2E3TA 3HRDD 1IBXA 1EWCA 4ZRPA 4IOIE 1GB4A 1JWSD 4ZYSA 1L4DB 1TJEA 4JE3B 1BXTA 1FM0D 5D3DA 1RWSA 2IDYA 3IT4B 1SXTA 1YJJA 3TUOA 2JU6X 4H2AA 2LGIA 1TKGA 1FRRA 3SEBA 1N60A 4L2YA 2WXQA 3BYYB 5BMIA 4ZOHC 4HJGE 2JYTA 4TQ1A 1MHXA 1WYGA 1ESFA 1J7CA 1YN4A 1F77A 2PMVA 2ZW0A 2PIAA 3AE3B 1A70A 2KACA 4MM3B 1EM7A 1P7EA 4NJCA 1NYQA 4L1BA 1FD6A 5C3JB 1F2RC 1FRDA 2JSVX 2Y5CA 4HKQA 4RF0A 2RDHA 1KLUD 1VZ6A 3IT6B 1SE3A 2EKIA 2YEPB 4NAWB 1IUEA 1XLQA 2DWQA 3T3NA 4A8XC 3AE5B 1BUIC 1N63A 3WCQA 1V8CA 1XF5L 4RFBA 2KAJA 1RYJA 3AE9B 4ZHOA 3NZ3A 1SJHD 1ZP0B 4N59A 5H8YE 1JALA 4XWTA 1I4RA 3NVVA 1TS3A 4B0MA 2GRIA 4A6QA 5LNK1 3E9SA 3U4EG 4HKZE 4WAFA 2WXRA 1NVID 1FCCC 3AEFB 1L0XB 3IAM1 5G5HA 4DXGA 1T5XD 3H8HA 2W54A 1E10A 2HDEA 1VZ8A 1KH0A 3EGRA 3V3XA 2RDGA 1N61A 2JWUA 1NENB 1DGJA 4OZBA 3TSSA 2BBCA 3W2DA 3AE1B 1V97A 1EWYC 1IGDA 1P7FA 3W9CB 3AEEB 1ET9A 2WXNA 2BW2A 1ENFA 4YT0B 3ZJUA 4P6VF 3C8YA 1CZPA 2W3SA 1B9RA 1D6EC 4M0WA 5D7GA 2KQ4X 1YN5A 3BYTB 5BYRA 1VRAB 4IKGA 1K53A 2AQ1B 1SF0A 2Q5WD 5GXGB 2WDQB 1WRIA 4REZA 2WLBA 2GB1A 1VLBA 1KTKA 1PGXA 2FBWB 5EE1A 2L52A 3AE8B 3NVYA 2ON8A 2XN9C 4KX6B 1UWMA 3VRBB 1CJEA 2N0SB 2J42A 3ZJTA 1V1PA 2WXIA 1AYFA 1XLNA 2WXOA 3DWMA 2WU5B 1GT8A 1YQ4B 4RH6A 4YSYB 3P42A 1L6UA 1IGCA 3AEDB 1JW9D 1PGBA 2WS3B 1GOZA 2G9HD 4YWGG 4RGMA 1HXYD 4L23A 1CQVA 4A90A 4YTPB 3BZDB 1BMLC 3U2SC 2LUMA 2WDRB 4KGSA 3URYA 2M56B 1WSPA 4YTMB 1YN3A 1Q10A 1C77A 2MEKA 3GB1A 5EE3A 4JWUC 1ZE3D 1C9FA 3AN1A 1GTHA 3MFGA 2TSSA 4YTNB 3R2TA 1SJED 5EE9A 3P4SB 2Y5PA 3FC4A 2L83A 4FXCA 3AEBB 3KLSX 1QF6A 1TKEA 4LLGM 3U52E 2L1AA 2BYTA 1NYRA 3MP9A 1PDXA 2IGDA 4B0EA 3UI3A 2M19A 2Y3AA 4XDCA 1JWBD 2K5PA 1QQRA 5FR3A 1K51A 1SE2A 4KGRA 1IBXB 1F0ZA 1GTEA 2PW9A 2PLPA 4RNAA 2BB6A 3NUHB 2N7JA 1YNTE 4ARIA 3ZGZA 1TS2A 4HROA 4WQMA 5HI1A 5H92C 1T6BX 3LXFA 3I57A 1TY0A 1YMHE 3Q8CA 2CJNA 1WGKA 5BMHA 1SB3C 1SE4A 4C80A 3VR8B 4JWSC 1ROEA 3BK1A 4OZCA 2V3NA 4HRSA 4AS1A 1FO4A 2PVOD 1XXGA 2ICIA 5EE0A 3TEZA 1ZUD2 2AX5A 2QILA 1K50A 1ZXIA 2G1EA 2E6XA 5JXVA 2FE8A 1H7XA 4TQ0A 1NEKB 5HFYA 4US8A 3B2GA 2INPE 3PZ8A 4R3DA 2KWDA 2J53A 1XEEA 4XE0A 3I9V1 3MC0B 3ZJVA 1D4BA 5BMGA 2QEJC 4LTUA 2KDMA 1C4CA 2IJ0A 2LHEA 5D3IB 2J4XA 3Q69A 1FXAA 3AEAB 1B1ZA 1HA5A 2K3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVY A;  3CF4 A;  1QOF A;  4YXD B;  4KX6 B;  1OQQ A;  1TJE A;  1UWM A;  4C7Z A;  3VRB B;  1CJE A;  5AUI A;  1JQ4 A;  2N0S B;  1FM0 D;  1JRP A;  2OHF A;  4ZHP A;  1AYF A;  1RWS A;  1XLN A;  3DWM A;  5MPO A;  2WU5 B;  1GT8 A;  1YQ4 B;  2WDV B;  1RM6 C;  1YJJ A;  3AE4 B;  3L4P A;  4YSY B;  3P63 A;  1L6U A;  2CU3 A;  2KMM A;  3VRA B;  3AMZ A;  1TKG A;  3AED B;  1FRR A;  1JW9 D;  5AUK A;  1N60 A;  3RPF C;  1TKY A;  2WS3 B;  4C7Y A;  1L6V A;  1FFV A;  3HVZ A;  4ZOH C;  1JWA D;  2LEK A;  4YTP B;  1N62 A;  1WYG A;  1TYG B;  2QJL A;  3AE2 B;  2WDR B;  1J7C A;  1DOX A;  3HUI A;  1E6E B;  1KF6 B;  4YTM B;  2M56 B;  2PVG C;  2W55 A;  3AE7 B;  1H7W A;  3KWL A;  5EE3 A;  2PIA A;  3BII D;  3AE3 B;  1KRH A;  1L0V B;  2WP9 B;  4JWU C;  3AEC B;  1A70 A;  3AN1 A;  1GTH A;  1PUT A;  4JX1 C;  4WWM A;  4YTN B;  1DOY A;  1DOI A;  1NYQ A;  1FMA D;  3P1M A;  5EE9 A;  1NI3 A;  3P4S B;  3W5V B;  1QT9 A;  4ITK A;  3FC4 A;  1GPX A;  5C3J B;  2L83 A;  3ABV B;  1FRD A;  2Y5C A;  4FXC A;  3B2F A;  3AEB B;  1QF6 A;  4USA A;  2WQY B;  1TKE A;  1WXQ A;  2BT6 A;  2EKI A;  1NYR A;  1PDX A;  1IUE A;  1XLQ A;  2M19 A;  2DWQ A;  2BS2 B;  2B76 B;  3EUB 2;  1FFU A;  3NVZ A;  3P4P B;  1OFF A;  2PKO A;  3B9J A;  3NRZ A;  2MJE A;  3AE5 B;  4YSZ B;  3NS1 A;  1N5W A;  1GAQ B;  1JWB D;  1N63 A;  2K5P A;  3WCQ A;  1V8C A;  3P4Q B;  1F0Z A;  2ACZ B;  1GTE A;  2WU2 B;  2KAJ A;  1RYJ A;  3AH7 A;  1QLB B;  1JRO A;  2MH7 A;  1SIJ A;  3W5U B;  3AE9 B;  5C2T B;  1YQ3 B;  1N5X A;  4ZHO A;  1ZP0 B;  1VDV A;  4N59 A;  1JAL A;  2CJO A;  5H8Y E;  3NVV A;  4N58 A;  4HRO A;  4WQM A;  5G5G A;  3VR9 B;  5H92 C;  3LB8 C;  3LXF A;  1OQR A;  1NVI D;  3FAH A;  3AV8 A;  2BS4 B;  3AEF B;  5G5H A;  4YSX B;  2JQR B;  3SFD B;  1I7H A;  1L5P A;  2CJN A;  2W54 A;  1WGK A;  1E10 A;  1SB3 C;  2W3R A;  4C80 A;  3VR8 B;  4JWS C;  1ROE A;  3CIR B;  1AWD A;  3PO0 A;  3AB5 A;  4HRS A;  1J7B A;  3ZYY X;  2QIE B;  1FO4 A;  1RFK A;  1J7A A;  3AM9 A;  2PVO D;  1N61 A;  2MJ3 A;  3P4R B;  2MJD A;  3NVW A;  1NEN B;  2HTM E;  1DGJ A;  1E0Z A;  1T3Q A;  2DBY A;  3AE1 B;  5EE0 A;  4N6E B;  1PFD A;  1WWT A;  1V97 A;  4IDI A;  1EWY C;  1ZUD 2;  3AEG B;  1YJI A;  2AX5 A;  1R7S A;  1XLP A;  1QOG A;  1FIQ A;  1ZXI A;  1E7P B;  2G1E A;  3SR6 A;  3CWI A;  1E9M A;  3W9C B;  2H88 B;  2BS3 B;  3AEE B;  2JX5 A;  1FXI A;  1H7X A;  1KFY B;  1NEK B;  2K22 A;  4US8 A;  2H89 B;  4YT0 B;  3B2G A;  1XLO A;  1XO3 A;  1QOB A;  3ETR A;  4P6V F;  1CZP A;  1QOA A;  2W3S A;  4A9A A;  1B9R A;  3AE6 B;  2K9X A;  4LTU A;  1VJK A;  4US9 A;  2E3T A;  3HRD D;  1SF0 A;  1FXA A;  3DWG C;  3SFE B;  2Q5W D;  3AEA B;  2WDQ B;  1WRI A;  5GXG B;  2WLB A;  1ZOY B;  1VLB A;  2FBW B;  5EE1 A;  2L52 A;  3AE8 B; 
#chains in the Genus database with same CATH topology
 2X38 A;  3CF4 A;  5AZF A;  3PPA A;  4YXD B;  3IXS A;  3GS2 A;  4W9C A;  2HE7 A;  1V49 A;  4BOZ B;  2BWE S;  3VDZ A;  4ZHP A;  3Q6B A;  4ZYN A;  3P63 A;  3VUX A;  2LGY A;  2SAK A;  3TEW A;  3RPF C;  3RCZ A;  2REX A;  2IO0 B;  2L7R A;  3V05 A;  2MQJ A;  4S17 A;  2WP9 B;  1RLF A;  3PZ7 A;  1QT9 A;  1GPX A;  3R8B A;  3IFW B;  4GU2 A;  5DPT A;  2K1F A;  1CK1 A;  2A5U A;  4BZA A;  1LXD A;  1M4V A;  4II3 B;  2B76 B;  5IAA C;  3BVG A;  4NQK E;  5DPS A;  3GZN B;  3UF8 A;  2LRW A;  3NS1 A;  3QK0 A;  2INN E;  1SIJ A;  2DNF A;  4F8C B;  2RDB C;  3Q8E A;  3IBE A;  4N58 A;  4OZA A;  1STE A;  3IG3 A;  4DHZ E;  5HG2 A;  1WZ3 A;  2WXF A;  4W9J A;  3V60 A;  4LJP B;  2IO1 B;  1L5P A;  2IBI B;  2YEP F;  1PYW D;  2QIE B;  3PLU A;  1RFK A;  4RCO A;  2LFI A;  1V5T A;  2WXG A;  4DHZ B;  5BYQ A;  3R3M A;  4EFO A;  3O65 B;  1FIQ A;  3WIM A;  3BY4 B;  3ZNZ B;  5E6P A;  2JX5 A;  1FXI A;  5CTR C;  2H89 B;  1XO3 A;  1QOB A;  2R61 A;  1WH3 A;  3MC9 A;  4OVU A;  4AP4 C;  1WGR A;  2CHZ A;  2ZCB A;  1C1Y B;  3DBL I;  2FUG 1;  3SFE B;  1IYF A;  2QMT A;  4G50 A;  1D5X C;  1QOF A;  4I6L B;  5FKA C;  4G0N B;  1JRP A;  2AQ3 B;  3U8Z A;  5IOI A;  4K3C A;  1UBI A;  2PTL A;  3PHX B;  2KO3 A;  2R2Q A;  2CU3 A;  4K7U A;  3KYC D;  1HQR D;  1WX7 A;  3GP7 A;  3QHT A;  2NBW B;  4HPP A;  3EA6 A;  4IG7 B;  2JZ3 B;  3AUL A;  2IGH A;  1KF6 B;  1H7W A;  3RNC C;  3ZVV A;  2R2O A;  1WRD B;  3LYY A;  1V9J A;  3VFK A;  3P1M A;  3AU4 A;  3L13 A;  4M8N A;  4ITK A;  1UH6 A;  3V62 A;  1EU3 A;  2DHZ A;  1TS5 A;  1TY2 A;  2NTS A;  3QJZ A;  2LRU A;  1ISN A;  2GLS A;  2LGS A;  4B9K A;  3D32 A;  1AN8 A;  2RMM A;  3TIX A;  4IM0 A;  2WXP A;  1MPE A;  2LXA A;  3P4Q B;  4JPS A;  3PV1 A;  2WU2 B;  1MHH E;  5C2T B;  1HEZ E;  1JWU D;  1WF9 A;  3AU5 A;  3PSE B;  3ECI A;  2K0P A;  4NJ6 A;  4W9K A;  1VR9 A;  4MSM B;  1J7B A;  3ZYY X;  1WZ0 A;  4M0W B;  3RYT A;  1T3Q A;  4CHK A;  2N1W A;  2W82 A;  3TEY A;  2LMC A;  2JVC A;  3DBH B;  3ZNI D;  3CWI A;  2RPQ A;  2O6V B;  2ZEQ A;  1XLO A;  2D2Q A;  1L4Z B;  2DYM A;  1V81 A;  2J52 A;  2C7M B;  2K9X A;  2L00 B;  4US9 A;  4CQN A;  3HRD D;  3QAQ A;  4IOI E;  1JWS D;  5J17 A;  1UBQ A;  1RWS A;  3RZW C;  2C5L C;  5LXI B;  1SXT A;  4FJV B;  1YJJ A;  2ZNV C;  3TUO A;  2G4D B;  4H2A A;  2RD0 A;  3ZLZ A;  3ZUN A;  2LGI A;  1FRR A;  2MWS B;  4FJY A;  1N60 A;  1MHX A;  4G11 A;  3ALB A;  5L83 A;  1F52 A;  2KD0 A;  2PMV A;  4KIK B;  1YJ1 A;  4B95 A;  1WXS A;  4MM3 B;  1EM7 A;  1VCB A;  1AAR A;  1GNU A;  1VD2 A;  3H9D A;  2JSV X;  2KQ7 A;  1E8Z A;  4WWP A;  4NAW B;  1IUE A;  3EEC A;  3T3N A;  4A8X C;  2GBK A;  3UIN B;  3WCQ A;  4WJO A;  4BKT A;  5LXH A;  3AE9 B;  4A3O A;  4ZHO A;  3NZ3 A;  1ZP0 B;  1Q1O A;  3WA0 A;  4W9I A;  3KVF B;  1KLV A;  2MLB A;  4F7Z A;  5JZE B;  2WXR A;  5JHA A;  1L0X B;  2GBR A;  3H8H A;  1WE6 A;  1VZ8 A;  2MBH A;  4C4V A;  4JIO U;  4OZB A;  3TSS A;  1LM8 B;  2LZ6 A;  4EOY A;  1IGD A;  1Q5W B;  4KDI C;  3DBS A;  2MP2 A;  2PE9 A;  4PYU A;  2BW2 A;  2DYB A;  1ENF A;  4YT0 B;  3ZJU A;  4P6V F;  2BPS A;  1B9R A;  2KX3 A;  2VRR B;  5D7G A;  2KFK A;  1Q0W B;  4DXA B;  5BYR A;  3DDC B;  1VRA B;  4IKG A;  2Q5W D;  1WRI A;  2GB1 A;  1VLB A;  3NG0 A;  1PGX A;  3R7Q A;  4MDK E;  2FID A;  2XN9 C;  4K7W A;  1UWM A;  3DOW A;  3DVG X;  3VRB B;  1V1P A;  1XLN A;  4WJQ A;  2WU5 B;  2D3A A;  2K6Q A;  4YSY B;  1IGC A;  3VXW A;  1GOZ A;  2LGD A;  4RGM A;  1CQV A;  4MEM A;  4YTP B;  2J7Q B;  3BZD B;  3U2S C;  2LUM A;  4KGS A;  3CF6 E;  2M56 B;  1Q10 A;  3DHH C;  4HVB A;  2TSS A;  2JUO A;  1WJU A;  2Y5P A;  3FC4 A;  3R7R A;  3TL5 A;  3QX1 A;  2L83 A;  4FXC A;  4XX5 A;  3OJ3 A;  4B6W A;  3U52 E;  3VH3 B;  1UZX B;  2KVZ A;  4EZJ A;  4B0E A;  1LQB A;  2IGD A;  5L95 C;  4K3B A;  3ZTC A;  4RMA A;  4KGR A;  4IWO A;  1F0Z A;  2PW9 A;  4RM9 A;  3NZS A;  3JSV A;  1QZE A;  1MFW A;  2N7J A;  1Z5S B;  1TS2 A;  3DBR I;  2KJH B;  2MBE A;  1T6B X;  3ZXR A;  3LXF A;  4BVU C;  1TY0 A;  1GC6 A;  2CJN A;  1P98 A;  1WMH A;  1SB3 C;  1SE4 A;  2V3N A;  4EZK A;  2PVO D;  4RM8 A;  3KH0 A;  1E8W A;  3ZKJ C;  3MHS D;  2N9E B;  3N3K B;  2IZV B;  2FE8 A;  1NEK B;  4IUM B;  3B2G A;  2INP E;  3N1X C;  1XEE A;  3MC0 B;  4ASW C;  2QEJ C;  4LJO B;  1FXA A;  1JRU A;  2KN5 A;  1TGZ B;  2K3U A;  3CST A;  4C7Z A;  1JQ4 A;  3PRP B;  4ICV A;  4D2K A;  2DZI A;  2NR2 A;  2JPH A;  4P16 A;  4C7Y A;  3EFC A;  1L6V A;  1JWA D;  2NBV B;  1ZKH A;  2W55 A;  2V4L A;  1ZDX A;  3FIL A;  1KRH A;  3Q8B A;  4XWW A;  4ACF A;  2KTF A;  4GDL B;  4A3P A;  3W5V B;  2DZM A;  2L05 A;  2XBB C;  3B2F A;  1R4M I;  2ZPY A;  3CSF A;  2BB5 A;  2M0A A;  4RGT A;  2XNA C;  3NVZ A;  2PKO A;  2VZK B;  3NRZ A;  4GN1 A;  1GAQ B;  1C78 A;  4KSK C;  2EMS A;  3BIN A;  1I42 A;  2ACZ B;  2FIF A;  1QLB B;  4HPM B;  1YQ3 B;  4QAY A;  2KKC A;  2WXL A;  3B0A A;  4LDT B;  1AW7 A;  2MBB B;  2YLM A;  3A9K B;  3BK2 A;  5IO9 A;  2HJ1 A;  2JQR B;  2KDE B;  3B1L X;  2WX0 A;  2WXM A;  4NY0 A;  3VAW A;  1F2R I;  4MGI E;  1J7A A;  1HE8 A;  3P4R B;  5HHD G;  1FNV A;  3TJP A;  4F1S A;  1R7S A;  2QSD A;  4HLE A;  2PEA A;  4GOC A;  1ZGU B;  1F9J A;  2RGF A;  4M00 A;  3AE6 B;  1EU4 A;  2QCZ A;  4WQO B;  4IW0 A;  3RN9 C;  1D3Z A;  2J0J A;  3I3T B;  2KC1 A;  3DWG C;  3Q3J A;  1ZOY B;  4URK A;  3M3J A;  2K39 A;  1E8Y A;  3TBL D;  2N4F A;  2D3C A;  3N20 C;  4MAC A;  3WAP A;  1Y56 A;  4UDU C;  3OWE B;  3PHW B;  1R4N I;  3M62 B;  2WWZ A;  5C23 A;  3TMP B;  2JYE A;  2NPT B;  4LNN A;  5TR5 A;  1UF0 A;  1WFY A;  2CR5 A;  2KXJ A;  1NI3 A;  1PGA A;  2V0G A;  1NI2 A;  3PRE A;  5BYS A;  2KDB A;  2O2V B;  3P4P B;  2QC8 A;  1OFF A;  3B9J A;  3IAS 1;  4ANV A;  3VVW B;  4GLS C;  1N5W A;  3BVM A;  4BBN F;  2HTH A;  2MBQ A;  1VDV A;  5G5G A;  4WJN A;  2KLG A;  5CX3 A;  3VR9 B;  1FEH A;  2BKF A;  2WXH A;  4K81 A;  3PGE A;  5J2R A;  1XCQ L;  4WWN A;  2LHD A;  4GMV A;  4I6P A;  3QIJ A;  1KOT A;  2W3R A;  2KLC A;  3H7P A;  4GSW A;  2GI9 A;  2MJ3 A;  2MJD A;  1WX9 A;  4GXB A;  3ZRC A;  4LNI A;  3KW5 B;  4N6E B;  1PFD A;  4WIP A;  3AEG B;  1YJI A;  4AJY B;  3Q3N C;  4ZRQ A;  4E3C A;  4NAM A;  1L2N A;  4C00 A;  2IND C;  4PS3 A;  5E6J A;  2FNJ B;  2A4Z A;  2N7E A;  3B08 A;  1V1O A;  5IP4 D;  2NVU I;  1IBX A;  1EWC A;  1H4R A;  2B3A A;  3MJW A;  2BQQ A;  1FM0 D;  2IDY A;  1TTN A;  2KDI A;  4XGA B;  1WXV A;  2JXX A;  2WXQ A;  5BMI A;  4TQ1 A;  1WYG A;  1ESF A;  1J7C A;  3I5J C;  1YN4 A;  1F77 A;  2UWQ A;  1T0S C;  3PRZ A;  2PIA A;  3Q3O C;  1A70 A;  3DBR B;  1F2R C;  4HKQ A;  1UD7 A;  2D11 A;  2RDH A;  3HK0 A;  1VZ6 A;  3IT6 B;  3ENE A;  1XLQ A;  3L16 A;  3Q3M C;  4AUQ C;  2MHJ A;  2OJW A;  1ZW7 A;  3AE5 B;  1N63 A;  3CMM B;  3PLV A;  4RFB A;  2KAJ A;  1RYJ A;  1KJT A;  2GBM A;  1OEY J;  1SJH D;  1YD8 U;  4N59 A;  4XWT A;  5E6O A;  2GRI A;  5LNK 1;  3U4E G;  1E5W A;  4WAF A;  2KX0 A;  1FCC C;  3Q2A C;  1WGH A;  1T5X D;  5E6N A;  2JT4 B;  3EGR A;  4IM3 A;  1NEN B;  2D07 B;  1DGJ A;  2NBU A;  1EUV B;  3W2D A;  1EWY C;  1T0Q C;  2KAN A;  5D6J B;  4DK5 A;  3AEE B;  2WXN A;  4II2 B;  1MJD A;  2LJ5 A;  1LGR A;  3UIO B;  1WR6 E;  1D6E C;  2BF8 B;  3C19 A;  4HJK A;  4M0W A;  2O6V D;  4KSL C;  2KQ4 X;  3BYT B;  3LJ3 A;  4IM2 A;  2AQ1 B;  1SF0 A;  2WDQ B;  4REZ A;  2D3B A;  4BFR A;  1KTK A;  2FBW B;  1H8C A;  5EE1 A;  3NVY A;  2ON8 A;  2O6V A;  4KX6 B;  3A9J A;  4HCP B;  3L08 A;  4KZ0 A;  1CJE A;  1HTO A;  2N0S B;  2WXI A;  3HIZ A;  1AYF A;  1OGW A;  2JWZ A;  3DWM A;  5G55 A;  1A5R A;  2V1Y A;  2XK5 B;  4MGZ E;  2WS3 B;  2G9H D;  4YWG G;  2OOB B;  1NBF C;  3URY A;  4BKS D;  1C77 A;  4FHK A;  4JWU C;  4FLH A;  3AN1 A;  4TKN A;  4PK1 A;  3AEB B;  1QF6 A;  5JH5 C;  2L1A A;  2BYT A;  2Z59 B;  2M1M A;  2V9H A;  4HK2 A;  4XDC A;  4MM3 A;  2K5P A;  1QQR A;  1WJN A;  2KTR B;  4RNA A;  4W9E A;  4ARI A;  1YNT E;  3ZGZ A;  4HRO A;  4NAW A;  3Q8C A;  1T0R C;  1WGK A;  1Z2M A;  4MJS B;  4C80 A;  3BK1 A;  4OZC A;  4HRS A;  2ICI A;  1GG3 A;  3PVL A;  5HKH A;  5EE0 A;  3TEZ A;  3RI7 C;  4TUU A;  1ZUD 2;  2BYF A;  2QIL A;  1K50 A;  5DPW A;  1ZXI A;  3QCA A;  3RNB C;  5JXV A;  3R66 C;  1H7X A;  4GDK A;  2D3G A;  4US8 A;  2Y5B B;  4R3D A;  1WR1 A;  3I9V 1;  1D4B A;  3A1Q A;  5DCN A;  2KDM A;  1C4C A;  2LHE A;  3W1S C;  3Q69 A;  1T0Y A;  1V80 A;  1HA5 A;  2KWV B;  2KN4 A;  3OAW A;  2V4I B;  1KM7 A;  1WY8 A;  3KQ4 A;  4ZRI A;  3AMZ A;  5IKC M;  5AUK A;  1TKY A;  4KKJ A;  3HVZ A;  1OEY A;  2WXJ A;  1DOX A;  2WX1 A;  2PVG C;  3T8M A;  4XDD A;  3KWL A;  3WAO A;  1L0V B;  2KMA A;  3AEC B;  4WWM A;  1FMA D;  5FK9 C;  4DXF A;  1FNW A;  1TS4 A;  2AQ2 B;  4RF1 A;  1HZ5 A;  1I4Q A;  3RNG C;  2N9K A;  2MJE A;  4LNO A;  1ZPS A;  1JML A;  1WYW B;  4ANU A;  4EUT A;  2ZNV B;  4J3O D;  2WXK A;  3W5U B;  3MHZ A;  1N5X A;  4ARC A;  4MH8 A;  2CJO A;  3R2I A;  4HWI B;  4E71 A;  2ZPN A;  3N1Y C;  4MSQ B;  4M01 A;  2QHO A;  3FAH A;  4YSX B;  4CYE A;  1I7H A;  2N9L A;  3OLM D;  4YL8 A;  4DDI D;  1KLG D;  4HCN B;  3NVW A;  3RNE C;  1LO5 D;  1LFD A;  4LK0 M;  4I6N B;  1WE7 A;  2I38 A;  3W1S A;  1YX6 B;  4BBN C;  2JXT A;  2H88 B;  2BS3 B;  4OHJ A;  3MC8 A;  2DYO A;  2K22 A;  4GGQ A;  1QOA A;  3L54 A;  3N30 A;  4FUL A;  3T3O A;  3P2B A;  1UWX A;  1ZDV A;  3DBL B;  1GB1 A;  1C4A A;  2IO3 B;  1HZ6 A;  1WGG A;  5AUI A;  2MSE D;  3DVG Y;  1ZXH A;  5T8I A;  4WH4 A;  2LD9 A;  2Z8L A;  2KMM A;  1GUA B;  4FAD A;  1E7V A;  1FFV A;  2JY6 A;  3QA8 A;  4MT5 A;  1N62 A;  1XD3 B;  1TYG B;  2QJL A;  4ZRK A;  3HUI A;  3AI5 A;  1FXT B;  3AE7 B;  4CO7 A;  2NMQ A;  2BYE A;  1EF1 A;  1FPY A;  1FCL A;  3ZNG C;  4W9D A;  3H7S A;  1DOY A;  5J18 A;  3ZQ4 A;  4PT5 A;  2JZP A;  3ABV B;  1L0Y B;  1UNS A;  2BT6 A;  2BS2 B;  3J9C A;  4MEL A;  3VQI A;  2RSU A;  2LGX A;  2ZW1 A;  1C79 A;  3APF A;  2G45 B;  3I63 C;  2RPV A;  4M8M A;  3ZO5 B;  2GBN A;  2MH7 A;  4DHJ D;  1UUP A;  1C4P A;  2VZK D;  2IPK D;  4FBJ B;  2ONQ A;  3X23 A;  3N9Y C;  3TEX A;  5I4D A;  1OQR A;  2EEL A;  4ZDV A;  1I4P A;  2OED A;  4LDT D;  1WGY A;  4RGO S;  4DHJ B;  1SBB B;  1JCK B;  4P1B C;  2HTM E;  4OVZ A;  5JHB A;  5FR6 A;  2LWP A;  1UGJ A;  5DPR A;  1QOG A;  3FIL B;  3A9K A;  3APD A;  3RMK C;  1E9M A;  5C1Z A;  2CU1 A;  3L17 A;  1N6Z A;  1HTQ A;  1KFY B;  4LNK A;  3NY5 A;  3DHG C;  3BVZ A;  3RNA C;  2BVC A;  5BO4 B;  2G4S A;  1P1A A;  1QKZ A;  2BKR B;  2EKE C;  2KNB A;  2CHX A;  1L4D B;  1TJE A;  3K9P B;  4AOF A;  4ZYS A;  1BXT A;  5D3D A;  2JZZ A;  3IT4 B;  3N32 A;  2KDF B;  3DPD A;  3BYY B;  4ZOH C;  2JYT A;  4FA6 A;  3Q3F A;  4DWF A;  3ZDT A;  2M17 A;  2ZW0 A;  1UEL A;  3AE3 B;  2KAC A;  1NYQ A;  2KZR A;  4NNJ B;  2Z0D B;  1FD6 A;  5C3J B;  1RAX A;  4KV2 A;  2L8J A;  2EKI A;  2YEP B;  4ZRJ A;  3EFU A;  2DWQ A;  5IN7 A;  2BGF A;  2MW5 A;  1IPG A;  1V8C A;  5IA7 A;  1XF5 L;  1I4R A;  3NVV A;  1TS3 A;  4B0M A;  2MA9 B;  3VTU A;  3E9S A;  1XT9 B;  4HKZ E;  1E7U A;  3IAM 1;  5G5H A;  4DXG A;  2AL3 A;  1J0G A;  1V6E A;  2NS5 A;  3V3X A;  2L3Z A;  4KVG B;  2MX2 A;  2BBC A;  2Z0E B;  1V97 A;  2ZCC A;  3VH4 B;  4P7I A;  1P7F A;  3GE3 C;  1ET9 A;  1F1H A;  4EEW A;  1CZP A;  2W3S A;  3ZNH B;  4MGK E;  4EKU A;  1YN5 A;  2I1K A;  3ZDM C;  3K9O B;  2INC C;  5CHV C;  3GE8 C;  2KQS A;  2LXC A;  2L52 A;  3AE8 B;  2V3S A;  2EMT A;  4WJP A;  2J42 A;  2KK8 A;  2WXO A;  1GT8 A;  3W1Y A;  3UIP B;  3P42 A;  2ZZP B;  3SD5 A;  1JW9 D;  5AEK B;  2W9N A;  1HXY D;  2YVC A;  1MG8 A;  2MCN B;  2IY0 B;  2WDR B;  3V61 A;  1WSP A;  2MEK A;  3H7P B;  3M95 A;  3UQA A;  2IO2 B;  1YX5 B;  2DZJ A;  1C9F A;  1GTH A;  3MFG A;  4YTN B;  3R2T A;  1SJE D;  5EE9 A;  3P4S B;  4M02 A;  2IY1 B;  2KWU B;  3MP9 A;  1PDX A;  2CHW A;  3DCG A;  4K1R B;  2M19 A;  3UI3 A;  2M0X A;  1E90 A;  2GOW A;  1K51 A;  1SE2 A;  1IBX B;  1GTE A;  1WIA A;  2PLP A;  3IVF A;  2X8X X;  2BB6 A;  3NUH B;  4WQM A;  3DHI C;  5D2M B;  5HI1 A;  2LVQ A;  4NJ7 A;  5BMH A;  2N9P C;  1FO4 A;  3JVZ X;  3RUI B;  3QWZ B;  3VUW A;  4P1C C;  4NQL B;  2AX5 A;  1M94 A;  2G1E A;  2E6X A;  4XZ4 A;  3VTV A;  4TQ0 A;  5HFY A;  2FCS A;  5G2N A;  4PS8 A;  3QQ8 B;  3APC A;  4XE0 A;  3OG5 A;  3ZJV A;  5BMG A;  4LTU A;  5D94 A;  4IC7 B;  1WGD A;  3FKY A;  1WJ4 A;  3AEA B;  1B1Z A;  4USA A;  4FHJ A;  1SIF A;  2D5G A;  2N1V A;  2C60 A;  3QC8 B;  1ACC A;  2C9W B;  5MPO A;  2FCN A;  2WDV B;  1RM6 C;  4AQ7 A;  3AE4 B;  3L4P A;  4NZL B;  2IYD B;  4OVV A;  1S3S G;  3VRA B;  1WXM A;  1OQY A;  3HM3 A;  3KUD B;  1QIL A;  2G3Q B;  3A4R A;  3BWU D;  2KVR A;  4JGH B;  3WAM A;  5AZG A;  5EDS A;  3DVN V;  4HXD A;  4WAA A;  1FNU A;  2LVP A;  1WM3 A;  3DVN U;  1DOI A;  2XK5 A;  2FCQ A;  1SEB D;  4O1N A;  2V3P A;  3RD2 A;  1TBE A;  5CHF A;  2PPH A;  1WXQ A;  3VTW A;  2D10 A;  2M8S A;  2K8C A;  1R4M B;  4MH0 E;  4TSS A;  2NTT A;  4Q2J A;  4J6I A;  1L7Y A;  3Q8F A;  4EE2 A;  3KYD D;  2BTE A;  3C0R B;  3NHE B;  1YIW A;  3X0W A;  4GB9 A;  2LAS A;  2LUE A;  1OTR B;  3AH7 A;  3HVD A;  4HDO A;  4WUR A;  1J19 A;  3ZXV A;  1DYQ A;  2WGS A;  2KFJ A;  3A9J B;  3RFZ B;  2LJI A;  4RGN A;  4BKS A;  2SEB D;  4JL9 A;  3AV8 A;  2BS4 B;  4A20 A;  1I35 A;  3SFD B;  4DDG D;  4KKI A;  2ZJD A;  4KIK A;  3CIR B;  1AWD A;  2QDF A;  2J0K A;  3AB5 A;  3PO0 A;  4S0R A;  4ANW A;  3OJ4 B;  2KTR A;  3PTF C;  2I2Y A;  1TIF A;  1E0Z A;  4K7S A;  2DBY A;  1WWT A;  4IDI A;  3WAL A;  4ICU A;  1WM2 A;  3U7Z A;  3SR6 A;  3VUY A;  4AWJ A;  2FUH B;  3DQV A;  4BOS C;  3KWV A;  4MJS A;  3T9L A;  2BYV E;  2PE6 B;  3O13 A;  3L10 B;  3RUL A;  1VJK A;  1ET6 A;  4W9L A;  3ZTD A;  2IGG A;  1I4G A;  2J0M A;  1OQQ A;  1I4H A;  2CS4 A;  2KYW A;  2L32 A;  2OHF A;  4C56 C;  4FN2 A;  3LDZ E;  4HDQ A;  1C76 A;  4MGY E;  4HEA 1;  1PQS A;  2LEK A;  3NOB A;  3E56 A;  1K52 A;  1R4N B;  3AE2 B;  3PT2 B;  1E6E B;  2KHW B;  1MG4 A;  3BII D;  4W9H A;  1PUT A;  4JX1 C;  4XYC A;  3AXC A;  4KGT A;  3Q14 C;  1V86 A;  1NDD A;  5TSS A;  4DQO C;  3U7D A;  2WQY B;  4GIV A;  4GDK B;  2C7N B;  3A4S C;  1V5O A;  3Q8A A;  3EUB 2;  1FFU A;  1TZO A;  1Y8R C;  4OW0 A;  4KDL B;  5GMV A;  1D5M C;  4JLC A;  4YSZ B;  2K8H A;  3A1Q B;  4AJW A;  3ZRF A;  3SDL C;  1XCT L;  2WHI A;  1JRO A;  3KUC B;  2FAZ A;  4C4V B;  3PRM B;  5CHW A;  2AWT A;  4A55 A;  1K8R B;  3ONS A;  1GC7 A;  2K6D B;  3LB8 C;  1JWM D;  3A33 B;  3MTN B;  2MP2 B;  1RFA A;  1MVK A;  3GZN I;  1C3T A;  1SSN A;  2JF5 A;  3MJ5 A;  3AM9 A;  2KFK B;  2VH1 A;  1VZ7 A;  2N7D A;  5KHO A;  1XLP A;  2KT7 A;  1MI0 A;  2OJR A;  3H1U A;  1E7P B;  1U4A A;  1D5Z C;  2MBO A;  4NPN A;  4TMA B;  4BAX A;  2DLB A;  5LLI A;  1V1P B;  2C7H A;  3ETR A;  1WI0 A;  4A9A A;  1I4X A;  3L0W B;  2ZVO A;  1X1M A;  2ZVN A;  2WNM A;  2E3T A;  2GMI C;  4ZRP A;  3ZIM A;  3M63 B;  2BWF A;  2DAF A;  3GOE A;  1GB4 A;  3JYU A;  2XEW A;  2JRH A;  4JE3 B;  1SGH A;  2M4N A;  4DBG A;  2JU6 X;  4TV3 A;  1TKG A;  3SEB A;  2L0T A;  4L2Y A;  1GJZ A;  1P3Q U;  3PZD A;  4HJG E;  2KWC A;  2CKH B;  1WX8 A;  1TT5 B;  4LCD E;  5AZH A;  1J8C A;  1P0R A;  2KC2 A;  4G3X B;  2I1J A;  2DAJ A;  1P7E A;  3U30 A;  3S2A A;  4NJC A;  3UGB B;  4L1B A;  3JSV B;  1FRD A;  2Y5C A;  3NZU A;  4RF0 A;  1KLU D;  4W9F A;  2WYQ A;  2K25 A;  1SE3 A;  2KJR A;  4JQW C;  3NJT A;  2KJ6 A;  2ASQ A;  1BUI C;  1V2Y A;  2UYZ B;  1WMH B;  4EZL A;  3SHQ A;  5H8Y E;  1JAL A;  4A6Q A;  1NVI D;  2NCN A;  3AEF B;  4KZC A;  2W54 A;  1TZ1 A;  1YQB A;  1E10 A;  2HDE A;  1KH0 A;  2RR9 A;  4BKG A;  2RDG A;  3V6E B;  2HJ8 A;  1N61 A;  2JWU A;  4IWP A;  3ML9 A;  2KOX A;  4GDL A;  2MRP A;  1G6J A;  1XQQ A;  3AE1 B;  3N1Z C;  2DX5 B;  3ZW3 A;  4ANX A;  2GBJ A;  3W9C B;  2AL6 A;  3C8Y A;  5KHQ A;  1P9D U;  1K53 A;  2WDT B;  5GXG B;  2WLB A;  3TCA A;  3DBH I;  1EO6 A;  4IWQ A;  1CMX B;  3ZJT A;  4FJZ A;  4PS7 A;  1RRB A;  3QAR A;  1YQ4 B;  1SE9 A;  2L0F A;  4RH6 A;  1L6U A;  1UGM A;  3AED B;  1PGB A;  1IP9 A;  4L23 A;  2LVO A;  4A90 A;  1BML C;  3EHV A;  2HD5 B;  1YN3 A;  4YTM B;  2PJH A;  3EC8 A;  3VHT C;  2JRI B;  5EE3 A;  2K8B A;  3GB1 A;  1YOV B;  1ZE3 D;  3KUZ A;  2N9X A;  2AEH A;  2L76 A;  3ML8 A;  3KLS X;  1TKE A;  3RT3 B;  4LLG M;  1S1Q B;  1NYR A;  2Y3A A;  2LI5 A;  3HHM A;  4X57 B;  2VH2 A;  3PS6 A;  1JWB D;  4XC2 A;  3SU8 X;  4LNF A;  1WXA A;  5FR3 A;  3HM6 X;  3RNF C;  2AYO B;  2FCM A;  1WJ6 A;  3NS8 A;  3RZF A;  5H92 C;  4E74 A;  4WWO A;  4HPL B;  3I57 A;  2KMC A;  1YMH E;  3JW0 X;  3H6N A;  1BT0 A;  3VR8 B;  4JWS C;  1ROE A;  4AS1 A;  1E8X A;  2NPT A;  1XXG A;  4N9F 4;  2UU7 A;  1EF5 A;  3WAN A;  2O2V A;  3PZ8 A;  2KWD A;  4PYZ A;  4W9G A;  2J53 A;  3UQB A;  2DZK A;  3IHP C;  2IJ0 A;  5D3I B;  2J4X A;  3V6C B;  2DEN B; 
#chains in the Genus database with same CATH homology
 2X38 A;  3CF4 A;  2KN4 A;  4YXD B;  3IXS A;  2D5G A;  3GS2 A;  4C7Z A;  1JQ4 A;  4ZHP A;  1ACC A;  2V4I B;  4D2K A;  5MPO A;  2WDV B;  1RM6 C;  4AQ7 A;  3AE4 B;  3KQ4 A;  3L4P A;  4NZL B;  3P63 A;  2SAK A;  3TEW A;  3VRA B;  3AMZ A;  3RPF C;  5AUK A;  4P16 A;  1QIL A;  1TKY A;  4C7Y A;  1L6V A;  4KKJ A;  3BWU D;  3HVZ A;  1JWA D;  2WXJ A;  3V05 A;  1DOX A;  2W55 A;  2PVG C;  4XDD A;  3KWL A;  1ZDX A;  3FIL A;  1KRH A;  1L0V B;  2WP9 B;  1FNU A;  3Q8B A;  3AEC B;  4XWW A;  4WWM A;  4GDL B;  3PZ7 A;  1DOI A;  1FMA D;  3W5V B;  1QT9 A;  5FK9 C;  1SEB D;  4DXF A;  1GPX A;  3R8B A;  1FNW A;  2V3P A;  4O1N A;  3B2F A;  1CK1 A;  4USA A;  1WXQ A;  1TS4 A;  2AQ2 B;  4RF1 A;  1HZ5 A;  4TSS A;  2BB5 A;  1I4Q A;  1M4V A;  2NTT A;  4Q2J A;  3Q8F A;  2B76 B;  2M0A A;  3BVG A;  2XNA C;  3NVZ A;  4RGT A;  4EE2 A;  2BTE A;  2PKO A;  2N9K A;  2VZK B;  3NRZ A;  2MJE A;  3NS1 A;  1GAQ B;  1ZPS A;  1C78 A;  1JML A;  4J3O D;  2WXK A;  2ACZ B;  3AH7 A;  1QLB B;  3W5U B;  2INN E;  1SIJ A;  3HVD A;  1N5X A;  3MHZ A;  1YQ3 B;  2WXL A;  3Q8E A;  4MH8 A;  2CJO A;  3R2I A;  4WUR A;  4ARC A;  1AW7 A;  1DYQ A;  4N58 A;  4OZA A;  1STE A;  3RFZ B;  5HG2 A;  2LJI A;  4RGN A;  2WXF A;  2SEB D;  3FAH A;  3AV8 A;  3BK2 A;  2BS4 B;  4YSX B;  2JQR B;  3SFD B;  1I7H A;  1L5P A;  2N9L A;  4KKI A;  2WXM A;  2YEP F;  1KLG D;  3CIR B;  1AWD A;  3PO0 A;  1PYW D;  3AB5 A;  1F2R I;  2QIE B;  1RFK A;  4RCO A;  1J7A A;  2LFI A;  2WXG A;  3P4R B;  3NVW A;  2I2Y A;  5HHD G;  1FNV A;  1E0Z A;  5BYQ A;  2DBY A;  1LO5 D;  1WWT A;  4IDI A;  4LK0 M;  1R7S A;  2QSD A;  1FIQ A;  3U7Z A;  3SR6 A;  2I38 A;  3W1S A;  2JXT A;  2H88 B;  2BS3 B;  4OHJ A;  2JX5 A;  1FXI A;  2DYO A;  2K22 A;  3KWV A;  2H89 B;  1XO3 A;  1QOB A;  2R61 A;  1QOA A;  3AE6 B;  1EU4 A;  3O13 A;  3T3O A;  1VJK A;  1UWX A;  1ET6 A;  2FUG 1;  1ZDV A;  3DWG C;  3SFE B;  1GB1 A;  1ZOY B;  1C4A A;  2QMT A;  1HZ6 A;  1D5X C;  1I4G A;  1QOF A;  2IGG A;  1OQQ A;  1I4H A;  5FKA C;  5AUI A;  1JRP A;  2L32 A;  2OHF A;  4C56 C;  1ZXH A;  2AQ3 B;  5T8I A;  4WH4 A;  2PTL A;  2Z8L A;  2CU3 A;  2KMM A;  4MAC A;  1C76 A;  1Y56 A;  1HQR D;  4UDU C;  3GP7 A;  3OWE B;  1FFV A;  4HEA 1;  2LEK A;  3E56 A;  3EA6 A;  4MT5 A;  1N62 A;  1TYG B;  1K52 A;  2QJL A;  3AE2 B;  3HUI A;  1E6E B;  1KF6 B;  2IGH A;  3AE7 B;  1H7W A;  2NMQ A;  2JYE A;  3BII D;  1FCL A;  3LYY A;  1PUT A;  4JX1 C;  1DOY A;  3P1M A;  4KGT A;  1NI3 A;  3ZQ4 A;  4ITK A;  1PGA A;  4PT5 A;  2JZP A;  5TSS A;  3ABV B;  1L0Y B;  1EU3 A;  2NTS A;  1TS5 A;  1TY2 A;  4DQO C;  2V0G A;  1UNS A;  2WQY B;  2BT6 A;  4GDK B;  3Q8A A;  5BYS A;  3EUB 2;  2BS2 B;  1FFU A;  1TZO A;  3P4P B;  3J9C A;  3VQI A;  1AN8 A;  1OFF A;  2RMM A;  4OW0 A;  3B9J A;  3IAS 1;  2ZW1 A;  1C79 A;  1D5M C;  4YSZ B;  2WXP A;  4GLS C;  1N5W A;  1MPE A;  2RPV A;  3BVM A;  4JPS A;  3P4Q B;  2WU2 B;  1XCT L;  1MHH E;  1JRO A;  2MH7 A;  1UUP A;  5C2T B;  1C4P A;  2VZK D;  2IPK D;  1VDV A;  1HEZ E;  2ONQ A;  4A55 A;  1JWU D;  5G5G A;  3VR9 B;  1FEH A;  2WXH A;  3N9Y C;  3TEX A;  5I4D A;  3LB8 C;  1XCQ L;  1OQR A;  1JWM D;  2EEL A;  1I4P A;  2LHD A;  2OED A;  4RGO S;  2K0P A;  1MVK A;  2W3R A;  1VR9 A;  1SSN A;  1J7B A;  3ZYY X;  2GI9 A;  1SBB B;  3MJ5 A;  1JCK B;  3AM9 A;  2MJ3 A;  2MJD A;  2HTM E;  4OVZ A;  1VZ7 A;  1T3Q A;  4N6E B;  1PFD A;  1UGJ A;  2W82 A;  4WIP A;  3TEY A;  3AEG B;  1YJI A;  2LMC A;  1XLP A;  1QOG A;  1MI0 A;  3FIL B;  1E7P B;  1D5Z C;  3CWI A;  4TMA B;  4ZRQ A;  1E9M A;  2DLB A;  4NAM A;  1KFY B;  5E6J A;  1V1P B;  1XLO A;  3ETR A;  4A9A A;  1L4Z B;  3BVZ A;  2DYM A;  1I4X A;  1V1O A;  2J52 A;  2K9X A;  1QKZ A;  4US9 A;  2WNM A;  4CQN A;  2E3T A;  3HRD D;  1IBX A;  1EWC A;  4ZRP A;  4IOI E;  1GB4 A;  1JWS D;  4ZYS A;  1L4D B;  1TJE A;  4JE3 B;  1BXT A;  1FM0 D;  5D3D A;  1RWS A;  2IDY A;  3IT4 B;  1SXT A;  1YJJ A;  3TUO A;  2JU6 X;  4H2A A;  2LGI A;  1TKG A;  1FRR A;  3SEB A;  1N60 A;  4L2Y A;  2WXQ A;  3BYY B;  5BMI A;  4ZOH C;  4HJG E;  2JYT A;  4TQ1 A;  1MHX A;  1WYG A;  1ESF A;  1J7C A;  1YN4 A;  1F77 A;  2PMV A;  2ZW0 A;  2PIA A;  3AE3 B;  1A70 A;  2KAC A;  4MM3 B;  1EM7 A;  1P7E A;  4NJC A;  1NYQ A;  4L1B A;  1FD6 A;  5C3J B;  1F2R C;  1FRD A;  2JSV X;  2Y5C A;  4HKQ A;  4RF0 A;  2RDH A;  1KLU D;  1VZ6 A;  3IT6 B;  1SE3 A;  2EKI A;  2YEP B;  4NAW B;  1IUE A;  1XLQ A;  2DWQ A;  3T3N A;  4A8X C;  3AE5 B;  1BUI C;  1N63 A;  3WCQ A;  1V8C A;  1XF5 L;  4RFB A;  2KAJ A;  1RYJ A;  3AE9 B;  4ZHO A;  3NZ3 A;  1SJH D;  1ZP0 B;  4N59 A;  5H8Y E;  1JAL A;  4XWT A;  1I4R A;  3NVV A;  1TS3 A;  4B0M A;  2GRI A;  4A6Q A;  5LNK 1;  3E9S A;  3U4E G;  4HKZ E;  4WAF A;  2WXR A;  1NVI D;  1FCC C;  3AEF B;  1L0X B;  3IAM 1;  5G5H A;  4DXG A;  1T5X D;  3H8H A;  2W54 A;  1E10 A;  2HDE A;  1VZ8 A;  1KH0 A;  3EGR A;  3V3X A;  2RDG A;  1N61 A;  2JWU A;  1NEN B;  1DGJ A;  4OZB A;  3TSS A;  2BBC A;  3W2D A;  3AE1 B;  1V97 A;  1EWY C;  1IGD A;  1P7F A;  3W9C B;  3AEE B;  1ET9 A;  2WXN A;  2BW2 A;  1ENF A;  4YT0 B;  3ZJU A;  4P6V F;  3C8Y A;  1CZP A;  2W3S A;  1B9R A;  1D6E C;  4M0W A;  5D7G A;  2KQ4 X;  1YN5 A;  3BYT B;  5BYR A;  1VRA B;  4IKG A;  1K53 A;  2AQ1 B;  1SF0 A;  2Q5W D;  5GXG B;  2WDQ B;  1WRI A;  4REZ A;  2WLB A;  2GB1 A;  1VLB A;  1KTK A;  1PGX A;  2FBW B;  5EE1 A;  2L52 A;  3AE8 B;  3NVY A;  2ON8 A;  2XN9 C;  4KX6 B;  1UWM A;  3VRB B;  1CJE A;  2N0S B;  2J42 A;  3ZJT A;  1V1P A;  2WXI A;  1AYF A;  1XLN A;  2WXO A;  3DWM A;  2WU5 B;  1GT8 A;  1YQ4 B;  4RH6 A;  4YSY B;  3P42 A;  1L6U A;  1IGC A;  3AED B;  1JW9 D;  1PGB A;  2WS3 B;  1GOZ A;  2G9H D;  4YWG G;  4RGM A;  1HXY D;  4L23 A;  1CQV A;  4A90 A;  4YTP B;  3BZD B;  1BML C;  3U2S C;  2LUM A;  2WDR B;  4KGS A;  3URY A;  2M56 B;  1WSP A;  4YTM B;  1YN3 A;  1Q10 A;  1C77 A;  2MEK A;  3GB1 A;  5EE3 A;  4JWU C;  1ZE3 D;  1C9F A;  3AN1 A;  1GTH A;  3MFG A;  2TSS A;  4YTN B;  3R2T A;  1SJE D;  5EE9 A;  3P4S B;  2Y5P A;  3FC4 A;  2L83 A;  4FXC A;  3AEB B;  3KLS X;  1QF6 A;  1TKE A;  4LLG M;  3U52 E;  2L1A A;  2BYT A;  1NYR A;  3MP9 A;  1PDX A;  2IGD A;  4B0E A;  3UI3 A;  2M19 A;  2Y3A A;  4XDC A;  1JWB D;  2K5P A;  1QQR A;  5FR3 A;  1K51 A;  1SE2 A;  4KGR A;  1IBX B;  1F0Z A;  1GTE A;  2PW9 A;  2PLP A;  4RNA A;  2BB6 A;  3NUH B;  2N7J A;  1YNT E;  4ARI A;  3ZGZ A;  1TS2 A;  4HRO A;  4WQM A;  5HI1 A;  5H92 C;  1T6B X;  3LXF A;  3I57 A;  1TY0 A;  1YMH E;  3Q8C A;  2CJN A;  1WGK A;  5BMH A;  1SB3 C;  1SE4 A;  4C80 A;  3VR8 B;  4JWS C;  1ROE A;  3BK1 A;  4OZC A;  2V3N A;  4HRS A;  4AS1 A;  1FO4 A;  2PVO D;  1XXG A;  2ICI A;  5EE0 A;  3TEZ A;  1ZUD 2;  2AX5 A;  2QIL A;  1K50 A;  1ZXI A;  2G1E A;  2E6X A;  5JXV A;  2FE8 A;  1H7X A;  4TQ0 A;  1NEK B;  5HFY A;  4US8 A;  3B2G A;  2INP E;  3PZ8 A;  4R3D A;  2KWD A;  2J53 A;  1XEE A;  4XE0 A;  3I9V 1;  3MC0 B;  3ZJV A;  1D4B A;  5BMG A;  2QEJ C;  4LTU A;  2KDM A;  1C4C A;  2IJ0 A;  2LHE A;  5D3I B;  2J4X A;  3Q69 A;  1FXA A;  3AEA B;  1B1Z A;  1HA5 A;  2K3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...