1QLBC

Respiratory complex ii-like fumarate reductase from wolinella succinogenes
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
254
structure length
254
Chain Sequence
b'MTNESILESYSGVTPERKKSRMPAKLDWWQSATGLFLGLFMIGHMFFVSTILLGDNVMLWVTKKFELDFIFEGGKPIVVSFLAAFVFAVFIAHAFLAMRKFPINYRQYLTFKTHKDLMRHGDTTLWWIQAMTGFAMFFLGSVHLYIMMTQPQTIGPVSSSFRMVSEWMWPLYLVLLFAVELHGSVGLYRLAVKWGWFDGETPDKTRANLKKLKTLMSAFLIVLGLLTFGAYVKKGLEQTDPNIDYKYFDYKRTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT
publication title Structure of Fumarate Reductase from Wolinella Succinogenes at 2.2 Angstroms Resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 103
structure length 254
sequence length 254
chains with identical sequence F
ec nomenclature
pdb deposition date 1999-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 1qlbC00
3AE8C 3AEGD 1YQ3C 1KFYC 1ZOYD 3AEAC 3P4RD 2ACZC 5C2TC 4YSXD 3AE2D 2WU2D 3P4SD 2WS3C 4YSZC 3AEFC 3AE8D 1KF6D 2WDRD 1YQ3D 1NEND 3AE4C 3AECC 3AEDC 3P4PC 4YSYC 2BS4C 3AEBD 1ZP0D 3AE6D 3AE7C 1QLBC 1YQ4C 3AE1D 4YSZD 4YTMC 2WQYD 2H89C 3VR9C 3SFDD 3ABVD 4KX6D 2WP9D 3SFED 2WDVD 2WU5D 2H88C 3P4QD 3VRAD 4YTND 3CIRC 3AE9D 4YXDD 2BS2C 3VR9D 2B76C 1NEKC 1KFYD 4YT0C 3AEAD 2ACZD 1L0VC 5C2TD 2WS3D 2WDQC 3AEFD 3AEEC 3AECD 3AE4D 3AEDD 4YTPC 3P4PD 4YSYD 3VR8C 3AE5C 1L0VD 5C3JC 3AE7D 1YQ4D 1E7PC 3AE3C 4YTMD 2H89D 3AEGC 1ZOYC 3VR8D 3P4RC 4YSXC 3AE2C 2WU2C 3P4SC 2H88D 2WDRC 1KF6C 3CIRD 1NENC 2BS3C 2B76D 3AEBC 1ZP0C 1NEKD 3AE6C 4YT0D 3AE1C 3VRBC 2WQYC 2FBWC 2WDQD 3SFDC 3ABVC 3AEED 4KX6C 2WP9C 4YTPD 3SFEC 2WDVC 2WU5C 3AE5D 5C3JD 3P4QC 3VRAC 3VRBD 4YTNC 3AE9C 4YXDC 3AE3D 2FBWD
chains in the Genus database with same CATH superfamily
3AE8C 3AEGD 1YQ3C 1KFYC 1ZOYD 3AEAC 3P4RD 2ACZC 5C2TC 4YSXD 4DHJA 3AE2D 2WU2D 3P4SD 2WS3C 4YSZC 3AEFC 3AE8D 1KF6D 2WDRD 1YQ3D 1NEND 3AE4C 3AECC 3AEDC 3P4PC 4YSYC 2BS4C 3AEBD 4DHIB 4FJVA 1ZP0D 3AE6D 3AE7C 1QLBC 1YQ4C 3AE1D 4YSZD 4YTMC 2WQYD 2H89C 3VR9C 4DHZA 3SFDD 3ABVD 4KX6D 2WP9D 3SFED 2WDVD 2WU5D 2H88C 3P4QD 3VRAD 4YTND 3CIRC 3AE9D 4YXDD 2BS2C 3VR9D 2B76C 1NEKC 1KFYD 4DDGA 4YT0C 3AEAD 2ACZD 1L0VC 5C2TD 2WS3D 2WDQC 3AEFD 3AEEC 3AECD 3AE4D 3AEDD 4I6LA 3P4PD 4YSYD 4YTPC 3VR8C 3AE5C 1L0VD 5C3JC 4LDTA 3AE7D 1YQ4D 1E7PC 3AE3C 4YTMD 2H89D 3AEGC 1ZOYC 3VR8D 3P4RC 4YSXC 3AE2C 2WU2C 3P4SC 2H88D 2WDRC 1KF6C 3CIRD 1NENC 2BS3C 3VONA 2B76D 1TFFA 3AEBC 1ZP0C 1NEKD 3AE6C 4YT0D 4DDIA 3AE1C 3VRBC 2WQYC 2FBWC 2WDQD 3SFDC 3ABVC 3AEED 4KX6C 2WP9C 4YTPD 3SFEC 2WDVC 2WU5C 3AE5D 5C3JD 3P4QC 3VRAC 3VRBD 4YTNC 3AE9C 2ZFYA 4YXDC 3AE3D 2FBWD
chains in the Genus database with same CATH topology
3AE8C 3AEGD 1YQ3C 1KFYC 1ZOYD 3AEAC 3P4RD 2ACZC 5C2TC 4YSXD 3AE2D 2WU2D 3P4SD 2WS3C 4YSZC 3AEFC 3AE8D 1KF6D 2WDRD 1YQ3D 1NEND 3AE4C 3AECC 3AEDC 3P4PC 4YSYC 2BS4C 3AEBD 1ZP0D 3AE6D 3AE7C 1QLBC 1YQ4C 3AE1D 4YSZD 4YTMC 2WQYD 2H89C 3VR9C 3SFDD 3ABVD 4KX6D 2WP9D 3SFED 2WDVD 2WU5D 2H88C 3P4QD 3VRAD 4YTND 3CIRC 3AE9D 4YXDD 2BS2C 3VR9D 2B76C 1NEKC 1KFYD 4YT0C 3AEAD 2ACZD 1L0VC 5C2TD 2WS3D 2WDQC 3AEFD 3AEEC 3AECD 3AE4D 3AEDD 4YTPC 3P4PD 4YSYD 3VR8C 3AE5C 1L0VD 5C3JC 3AE7D 1YQ4D 1E7PC 3AE3C 4YTMD 2H89D 3AEGC 1ZOYC 3VR8D 3P4RC 4YSXC 3AE2C 2WU2C 3P4SC 2H88D 2WDRC 1KF6C 3CIRD 1NENC 2BS3C 2B76D 3AEBC 1ZP0C 1NEKD 3AE6C 4YT0D 3AE1C 3VRBC 2WQYC 2FBWC 2WDQD 3SFDC 3ABVC 3AEED 4KX6C 2WP9C 4YTPD 3SFEC 2WDVC 2WU5C 3AE5D 5C3JD 3P4QC 3VRAC 3VRBD 4YTNC 3AE9C 4YXDC 3AE3D 2FBWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE8 C;  3AEG D;  1YQ3 C;  1KFY C;  1ZOY D;  3AEA C;  3P4R D;  2ACZ C;  5C2T C;  4YSX D;  3AE2 D;  2WU2 D;  3P4S D;  2WS3 C;  4YSZ C;  3AEF C;  3AE8 D;  1KF6 D;  2WDR D;  1YQ3 D;  1NEN D;  3AE4 C;  3AEC C;  3AED C;  3P4P C;  4YSY C;  2BS4 C;  3AEB D;  1ZP0 D;  3AE6 D;  3AE7 C;  1QLB C;  1YQ4 C;  3AE1 D;  4YSZ D;  4YTM C;  2WQY D;  2H89 C;  3VR9 C;  3SFD D;  3ABV D;  4KX6 D;  2WP9 D;  3SFE D;  2WDV D;  2WU5 D;  2H88 C;  3P4Q D;  3VRA D;  4YTN D;  3CIR C;  3AE9 D;  4YXD D;  2BS2 C;  3VR9 D;  2B76 C;  1NEK C;  1KFY D;  4YT0 C;  3AEA D;  2ACZ D;  1L0V C;  5C2T D;  2WS3 D;  2WDQ C;  3AEF D;  3AEE C;  3AEC D;  3AE4 D;  3AED D;  4YTP C;  3P4P D;  4YSY D;  3VR8 C;  3AE5 C;  1L0V D;  5C3J C;  3AE7 D;  1YQ4 D;  1E7P C;  3AE3 C;  4YTM D;  2H89 D;  3AEG C;  1ZOY C;  3VR8 D;  3P4R C;  4YSX C;  3AE2 C;  2WU2 C;  3P4S C;  2H88 D;  2WDR C;  1KF6 C;  3CIR D;  1NEN C;  2BS3 C;  2B76 D;  3AEB C;  1ZP0 C;  1NEK D;  3AE6 C;  4YT0 D;  3AE1 C;  3VRB C;  2WQY C;  2FBW C;  2WDQ D;  3SFD C;  3ABV C;  3AEE D;  4KX6 C;  2WP9 C;  4YTP D;  3SFE C;  2WDV C;  2WU5 C;  3AE5 D;  5C3J D;  3P4Q C;  3VRA C;  3VRB D;  4YTN C;  3AE9 C;  4YXD C;  3AE3 D;  2FBW D; 
#chains in the Genus database with same CATH topology
 3AE8 C;  3AEG D;  1YQ3 C;  1KFY C;  1ZOY D;  3AEA C;  3P4R D;  2ACZ C;  5C2T C;  4YSX D;  4DHJ A;  3AE2 D;  2WU2 D;  3P4S D;  2WS3 C;  4YSZ C;  3AEF C;  3AE8 D;  1KF6 D;  2WDR D;  1YQ3 D;  1NEN D;  3AE4 C;  3AEC C;  3AED C;  3P4P C;  4YSY C;  2BS4 C;  3AEB D;  4DHI B;  4FJV A;  1ZP0 D;  3AE6 D;  3AE7 C;  1QLB C;  1YQ4 C;  3AE1 D;  4YSZ D;  4YTM C;  2WQY D;  2H89 C;  3VR9 C;  4DHZ A;  3SFD D;  3ABV D;  4KX6 D;  2WP9 D;  3SFE D;  2WDV D;  2WU5 D;  2H88 C;  3P4Q D;  3VRA D;  4YTN D;  3CIR C;  3AE9 D;  4YXD D;  2BS2 C;  3VR9 D;  2B76 C;  1NEK C;  1KFY D;  4DDG A;  4YT0 C;  3AEA D;  2ACZ D;  1L0V C;  5C2T D;  2WS3 D;  2WDQ C;  3AEF D;  3AEE C;  3AEC D;  3AE4 D;  3AED D;  4I6L A;  3P4P D;  4YSY D;  4YTP C;  3VR8 C;  3AE5 C;  1L0V D;  5C3J C;  4LDT A;  3AE7 D;  1YQ4 D;  1E7P C;  3AE3 C;  4YTM D;  2H89 D;  3AEG C;  1ZOY C;  3VR8 D;  3P4R C;  4YSX C;  3AE2 C;  2WU2 C;  3P4S C;  2H88 D;  2WDR C;  1KF6 C;  3CIR D;  1NEN C;  2BS3 C;  3VON A;  2B76 D;  1TFF A;  3AEB C;  1ZP0 C;  1NEK D;  3AE6 C;  4YT0 D;  4DDI A;  3AE1 C;  3VRB C;  2WQY C;  2FBW C;  2WDQ D;  3SFD C;  3ABV C;  3AEE D;  4KX6 C;  2WP9 C;  4YTP D;  3SFE C;  2WDV C;  2WU5 C;  3AE5 D;  5C3J D;  3P4Q C;  3VRA C;  3VRB D;  4YTN C;  3AE9 C;  2ZFY A;  4YXD C;  3AE3 D;  2FBW D; 
#chains in the Genus database with same CATH homology
 3AE8 C;  3AEG D;  1YQ3 C;  1KFY C;  1ZOY D;  3AEA C;  3P4R D;  2ACZ C;  5C2T C;  4YSX D;  3AE2 D;  2WU2 D;  3P4S D;  2WS3 C;  4YSZ C;  3AEF C;  3AE8 D;  1KF6 D;  2WDR D;  1YQ3 D;  1NEN D;  3AE4 C;  3AEC C;  3AED C;  3P4P C;  4YSY C;  2BS4 C;  3AEB D;  1ZP0 D;  3AE6 D;  3AE7 C;  1QLB C;  1YQ4 C;  3AE1 D;  4YSZ D;  4YTM C;  2WQY D;  2H89 C;  3VR9 C;  3SFD D;  3ABV D;  4KX6 D;  2WP9 D;  3SFE D;  2WDV D;  2WU5 D;  2H88 C;  3P4Q D;  3VRA D;  4YTN D;  3CIR C;  3AE9 D;  4YXD D;  2BS2 C;  3VR9 D;  2B76 C;  1NEK C;  1KFY D;  4YT0 C;  3AEA D;  2ACZ D;  1L0V C;  5C2T D;  2WS3 D;  2WDQ C;  3AEF D;  3AEE C;  3AEC D;  3AE4 D;  3AED D;  4YTP C;  3P4P D;  4YSY D;  3VR8 C;  3AE5 C;  1L0V D;  5C3J C;  3AE7 D;  1YQ4 D;  1E7P C;  3AE3 C;  4YTM D;  2H89 D;  3AEG C;  1ZOY C;  3VR8 D;  3P4R C;  4YSX C;  3AE2 C;  2WU2 C;  3P4S C;  2H88 D;  2WDR C;  1KF6 C;  3CIR D;  1NEN C;  2BS3 C;  2B76 D;  3AEB C;  1ZP0 C;  1NEK D;  3AE6 C;  4YT0 D;  3AE1 C;  3VRB C;  2WQY C;  2FBW C;  2WDQ D;  3SFD C;  3ABV C;  3AEE D;  4KX6 C;  2WP9 C;  4YTP D;  3SFE C;  2WDV C;  2WU5 C;  3AE5 D;  5C3J D;  3P4Q C;  3VRA C;  3VRB D;  4YTN C;  3AE9 C;  4YXD C;  3AE3 D;  2FBW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...