1QLEB

Cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
252
structure length
252
Chain Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Cytochrome C Oxidase from Paracoccus Denitrificans Does not Change the Metal Center Ligation Upon Reduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/immune system
molecule keywords CYTOCHROME C OXIDASE POLYPEPTIDE I-BETA
total genus 61
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 1999-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qleB02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1qleB01
3BQVA 1KBWA 4WKXA 2UX6A 5TK4A 3FPYA 2P80A 1R1CA 1RCYA 1GS6X 1A65A 2DWTA 3N55A 1BEXA 4A2EA 3PXLA 5B1JA 1JZJA 2GHZA 2IDQA 2ZOOA 1GS7A 3FSZA 4M3HA 2QPEB 1A4AA 2GB2A 3UABA 4AI7A 5LDUA 1KCWA 1J5CA 1PAZA 2BW5A 3ZX1A 1OCCB 1AZNA 3DKHA 1GS8A 4YVUA 1OV8A 1E5YA 2IDTA 1JXDA 5I6KA 1V54B 1AAJA 3EH5B 4NAJA 2J55A 2XV3A 3IN2A 3QPKA 1JXFA 4E9SA 2UXTA 3FU9A 1AR1B 3GXUB 2GSMB 3H56A 2DYRB 3FQ1A 1RKRA 1J9SA 2B3IA 1AS8A 3RYMA 1A3ZA 5AZUA 1NDTA 4E9RA 3IN0A 1GY2A 1M9WA 2PPEA 4DP8X 4X4KA 2RACA 2CCWA 2LLNA 2XWZA 2IDUA 2YXVA 1WA1X 2AFNA 2QDWA 4HCGA 1N70A 3CVBA 1ZPUA 2GC7C 1XB3A 3DIVA 5I6MA 2YAQA 4G7QB 1AIZA 6PCYA 4UAHA 1NIEA 2FQGA 4AKQA 1MZZA 1NPJA 3SBQA 5ANHA 4BWUA 3ASNB 3T6ZA 4RH4A 5B7EA 1SFDA 3WIAA 4E9QA 2YAHA 3NJGA 5D4JA 3FU7A 5PAZA 2J5WA 1ZV2A 2FQFA 1WAEA 8PAZA 4QLWA 1E30A 1OCRB 2EIKB 3AZUA 1A8ZA 2I85A 3S3BB 3OMIB 3FU7B 3NJMA 1HAUA 1MG3C 2HXAA 1KBVA 1GW0A 1XMEB 3C75A 1HFUA 1BYPA 4GP5B 1W6LA 4HHWA 4E9WA 5B1BB 3WI9A 7PAZA 2XX1A 3NJJA 1ET8A 4A2GA 2HRGA 3EHBB 2XX0A 2BW4A 1AS7A 1DYZA 1PZCA 4AKOA 1KV7A 4YSDA 4KO6A 4YSEA 3NJHA 1HAWA 2VSKB 4F2EA 3TU6A 3OMAB 1AG0A 4Q8BA 4JKNA 4EF3A 1NIDA 1ILSA 2J56A 4HAKA 3ABMB 4W1TA 1PF3A 3EF4A 3CG8A 4FAAB 1JXGA 1IBZA 4HCIA 5D4IA 1B3IA 2PP8A 1KDJA 5AFAA 1GY1A 3IE9A 1BAWA 2P80D 1FWXA 4DP5X 1CYXA 1PZBA 1V10A 2VW4A 2TSBA 3PAUA 4YSRA 2AZUA 1TU2A 5FC9A 1JZGA 3X1GA 3S8FB 2Y69B 2J57A 1T5KA 2GIMA 2EIJB 2MTAA 1BXAA 4L0PB 2VSMB 4BWWA 2FQDA 2FJSA 5I5JA 2YAFA 5B3SB 3FU8A 4DP1X 1SDDA 2XLLA 2N0MA 4UANA 2IDSA 2QT6A 4WTQA 1JZIA 2HLEB 2YQBA 1BYOA 5I6LA 1J9RA 1JOIA 2AZAA 1IC0A 3WNIA 1IBYA 3U25A 3WKPA 1NIFA 4AKPA 3H4HA 4CSPA 1PMYA 4NERA 1OE2A 2DV6A 3FPXA 2VW6A 1JERA 3QJTB 4N8UA 2UXVA 3TBCA 1WA2X 1BQRA 3G5WA 1L9QA 5I6OA 1PY0A 3FQ2A 1ZIAA 4GY4A 1ET7A 2CUAA 2BP0A 1OCZB 2W8CA 1URIA 3OQRA 3T6VA 4YSUA 3ABGA 1FA4A 3WNJA 3JT2A 4BXSV 1SHWA 3OMNB 2IH8A 3NJFA 1RZQA 1ZIBA 2W88A 3PAVA 2UX7A 5AKRA 1KCBA 3FYEB 2VM4A 1SDDB 2BWIA 2PP9A 1BQKA 2UXGA 3KW7A 1QLEB 4HIPA 4KO7A 2Q9OA 1AS6A 1SNRA 2FT7A 2OV0A 2R7EB 1E65A 2Q5BA 4K9JA 4YSTA 3SBRA 2HX7A 1F56A 1AACA 2QPDB 1ADWA 4F2FA 4DP4X 2Y1AA 2FWLB 1JZHA 1AZBA 1CURA 5D4HA 1I53A 2IH9A 3BVDB 3X1BA 4JHUA 1ETJA 3CDZA 2BP0B 2AVFA 2YAPA 2YXWA 3X1FA 2PPCA 1L9SA 2PLTA 2ZONA 2ZWNA 2JKWA 4DPBX 4KO9A 4E9XA 1TEGA 1J9QA 1VLXA 6PAZA 1MDAA 3QQXA 4YSOA 3NP3A 2X87A 1SJMA 3QJQB 4GP8B 4DP0X 2WO3B 3S3DB 3FSAA 3KW8A 5B1AB 1WS7A 1PZAA 2PPAA 3NJNA 5EHFA 5I6PA 1OCOB 5F7BA 3NJLA 3CVCA 1DZ0A 3L45A 4YSSA 1ZDQA 3FS9A 4KNUA 2VN3A 1NTDA 3T9WA 3X1EA 3NSYA 1WS8A 4KNSA 4DP9X 5A7EA 3NJIA 1ET5A 2BO0A 4KO5A 3FSWA 1W6WA 2IWFA 1OOWA 4CSZA 2GBAA 1NPNA 1NWOA 2CAKA 2YEVB 1MZYA 3ZBMA 4G7SB 3AG1B 3X1NA 2EINB 2BHFA 1W8EA 1KGYE 3QJSB 2BZCA 2CALA 1AZUA 3GYRA 3MX0B 4GP4B 1WA0X 1NWPA 1EHKB 2R7EA 4ZK8A 3AG4B 3H4FA 4G7RB 3OD3A 3FT0A 1JVLA 1M56B 3SQRA 2DY2A 3S3CB 4JHVA 3T71A 2XV2A 2H5UA 2PPDA 2PP7A 4M4RB 2QDVA 3PAZA 4A68A 3CDZB 4N4YB 2XYBA 2H3XC 2NRDA 2PCYA 3AY2A 3TA4D 4YSAA 3UGEA 4A66A 2H47C 1ILUA 1J5DA 2VMJA 2XXFA 3ABLB 1SHXA 4HALA 3AG3B 1AZRA 1PLBA 5B1JC 3OM3B 5I28A 4BK5C 2EIMB 4AX3A 4DP7X 3UACA 1J9TA 3ZDWA 1SF5A 3FSVA 4A67A 1UATA 1OE3A 3GDCA 3D12B 1PCSA 3IEAA 2EILB 2BWDA 1NICA 1ASQA 4PCYA 2GC4C 4YVNA 4W9ZA 2DYSB 3AG2B 1KYAA 3NSDA 4A2HA 3UADA 4DPAX 3HEIB 3X2QB 3MBWB 1NIBA 4YSPA 3PLYA 2UXFA 3NJKA 3DTUB 3QJVB 4BDVA 4G72B 4HCFA 4BWTA 4TXVB 5I6NA 4KNTA 1MG2C 2IWEA 2YARA 2B08A 3TASA 1L9RA 2XU9A 1QHQA 3NP4A 3NYKA 3PCYA 4A2FA 1PNCA 4P5SA 7PCYA 4NB7A 3ASOB 1EZLA 1AG6A 2HX8A 1AANA 1CC3A 1JVOA 1OE1A 2A3TA 5B7FA 3V9EA 2HZHA 3AW5A 4MFHA 2FTAA 2AANA 1A4CA 3V9CA 4YL4A 3NSFA 4DP6X 5B7MA 3SBPA 1BXUA 4E9YA 1V55B 1E5ZA 3WKQA 4PAZA 4GYBA 1L9TA 2IDFA 3JTBA 3EH4B 3ABKB 1M57B 3WG7B 2HRHA 4YSQA 2I7OA 3S8GB 5I26A 1NIAA 2OJ1A 2WO2B 2YAEA 5IY5B 2BP8A 1YLBB 4P5RA 2X88A 2GI0A 4AZUA 4GXFA 2IWKA 3FYIB 1SF3A 2IAAC 1GSKA 3T6XA 4DP2X 3CZUB 3TBBA 2PCFA 4ENZA 5B1KA 4HHGA 3PPSA 4G71B 1GR7A 2BP8B 1CUOA 1RZPA 1X9UA 1AOZA 5PCYA 2ZXWB 2FT6A 2YAMA 2VM3A 1BQ5A 3IBOA 5I5MA 4YSCA 1N68A 2XXGA 3HB3B 4E9VA 3NT0A 4G70B 1AQ8A 2FT8A 2VW7A 4Q89A 3T6WA 4QKTA 1L9OA 3ERXA 1XB6A 1BXVA 3ZIYA 3QJUB 2I7SA 1X9RA 1OF0A 5E9NA 3UAEA 5F7AA 4KOCA 2JXMA 1CYWA 5TK2A 1FFTB 5I5IA 4BDVB 1KDIA 1NZRA 1PLAA 9PCYA 2TSAA 1TKWA 1AZCA 3CVDA 1ID2A 1PLCA 3N2JA 1JZFA 2CBPA 1IUZA 2XVBA 1PNDA 1ASOA 2YAOA 2JFCA 1IKOP 1JZEA 3EH3B 3QJRB 2CJ3A 1ZDSA 2HX9A 4UF7C 1XB8A 3UAAA 1SFHA 4DPCX 2DWSA 1L9PA 2BZ7A 1QNIA 4FA7B 1GYCA 2XUWA 3FQYA 1ASPA 2PPFA 4F7KA 1TEFA 4BXVA 3NSCA 4KOBA 2MRYA 1E67A 1A4BA 2WSDA 1NINA 2FNWA 2OCCB 4HZ1A 4A2DA 4E9TA 2XV0A 2E86A 2FQEA
chains in the Genus database with same CATH superfamily
2LR4A 4OVVA 3UYPB 3UJTL 1A6AB 5D70L 5E2UL 1J1XH 2DWTA 3MOQA 5AEAA 4FG2A 3MLSL 2Q7GA 1S9YB 1OSEA 2VC2B 4X66B 4NC1C 4LQFL 3K5MA 3OTOO 1SY6L 4JPQA 3F05A 2C1OB 5C0BE 3WXVH 5FFOA 4JZ2A 3F6IA 4F1ZA 3FQUA 3SE8H 2ATPB 4F24A 3ZSSA 3VXRE 4OI7A 4UBDC 3FSZA 4YE0A 5DQ9B 1RFDH 3L17A 2P3YA 4MCZB 1JWMA 4K3HA 1QW9A 3V7AE 1A7QL 2WYIA 1CFNB 4JCLA 4M6AA 4X4XA 3SDCA 5DJYA 3SGJC 3TBTB 4AI7A 3KR3H 1MCDA 3FBQA 1HK6A 3OLDA 3KLQA 3HMXH 1QSFD 1ROWA 5HJ3B 1XBDA 4QAWA 4Z78B 5LN4A 3DDFA 2IDTA 2ADIA 4I88A 4YK4B 4FS0A 1YJDH 5C2BH 4R4BA 8CGTA 1M3JA 3EH5B 4JO2L 3VI3F 2OL3B 1EK3A 3IDXH 1R19A 4LFBO 5EUOF 4JDZA 5T1KA 5MENB 4O2AB 4OF5A 1H3WM 3QUKA 4H1LH 4IEFB 4PWEA 4ANKA 3VVVA 2GBUA 5JW4M 4QO1A 3E9UA 5AWNH 3MRQB 3RYMA 4BFFA 3Q1EA 3RVUD 3MO1B 3QXUA 4UNVA 4XMWA 5IQ9A 3MRCB 4KK9D 4E9RA 2XT9A 4JY5L 4U05A 4GCZA 1YNTA 1YMMA 3EJPA 1VEOA 2MWCA 2QKSA 2OXGB 2X3BA 3ZDZE 1VEWA 2JNZA 1R46A 4IOIA 2FR4A 4E2LA 5TFSL 1RPRA 1YJDL 2XXMB 5EOQL 1OK0A 2CM6A 3N50A 3Q43A 3EFDL 3ZHTA 4NQDE 4OI9A 5D4QA 3VU1A 4XP1L 4GW1A 4ZMWA 1L9NA 5D7HA 1TQWA 6PCYA 5IJ9B 1INEL 3GO1L 4UAHA 5DMGD 3CFNA 1JYVA 4YPGB 1TYJA 4JK0D 1KIQA 2NSMA 5L8KB 4FQQA 4X99A 5JJJB 1U8JB 3C5ZA 3QFDB 4S1SH 3RZWA 5JVDA 1K8IA 2WLNA 2HWZL 1W91A 4AGQA 1E3FA 3N2GB 3T2QA 3QUMB 2OR7A 2IBZH 1AXSA 4F37K 1PQZA 4IMLA 1I7UB 4W9EC 3S3XA 1GA2A 3FU7B 5T1MB 1C5BH 3TBWA 1TQBB 3K71A 1FZOB 1I3UA 1K7DA 4X4YB 1Q1JH 3PQYB 4UV9A 1XF2B 1IBMB 3KWWB 1IQWH 2XETA 5DUMH 4G80B 4XXDA 4G27B 2B0SH 3Q6GH 3UO1H 4A2GA 2Q67A 5AQ0A 1KJVB 5C0BB 5F3BB 3LS5H 3O4LB 4GFXA 3ZQWA 1NCHA 4RDQG 5JA8B 4H13B 3BGMB 1KIUB 2VSKB 2A9HA 2HKFL 1IDSA 5J2UA 1KLUB 1DQVA 1K3ZA 1NFIB 1JN6B 4X80H 1OP5H 3SPVB 2JIXB 4E41B 4Z7NF 1ZVSA 2XQBH 2ZIDA 5F9JA 5SWSA 1MCOH 3U7YL 5HYSB 1KLGA 4XXCA 3V4VH 3R06A 3CMGA 4FAAB 1ZXQA 1MHCB 1QFUL 3GBEA 1S72V 3QORB 2YN3A 2ESVA 1GY1A 4CVZB 1SPDA 3HUJF 2BMKA 3V5HB 3VFGH 1GHFH 1IFRA 1K9TA 1MJUL 4YY3O 4DP5X 3DYMA 3N41B 3NG5A 4HLZH 2NZIA 1S5HB 3EGDB 2WB1A 3PUCA 4OIIH 3WIIL 5HTSA 5SX4I 2D8KA 1GL4B 3PAUA 4NIKB 4U7KA 4ZTPL 5CEZE 1ED3A 5DD0L 2X4TB 2JEUA 2HVJC 3HBPA 4N8VA 4AQAB 3GD1C 2A9BA 4M8RA 4MA1B 3V6BR 1OV9A 3SE4C 2ADIB 4HF5H 1DN0A 3MRPB 3QFJD 2VSMB 2X05A 5DJCA 3B6SB 4Z78A 2OQJB 3OF6D 3TEWA 2FJSA 2OP4L 2VLKD 2HTKC 4N23A 2Z7ZA 4Z7VB 1D5BB 3ARBA 3KE0A 2Z93A 3U4AA 3MLWL 5KW9H 5DD0H 5KOVC 3T1FB 5KVMC 2ZXDA 3TA3B 4I0PA 3H4HA 3LKRB 1XL6A 4PA7A 3TA3A 4XNMB 3VQ1C 2MCPL 4DR2B 2IBGA 1GGBH 3QJTB 2HVJB 4B9ZA 2CH8A 1H2MA 4AQEB 4DUVA 5EC2C 4N8PA 5FWQA 1M1KW 1G7LB 4WNSA 2ARJB 2YUWA 4M03A 1GK9A 3WL9A 4X5XA 4G7VH 4U2YA 4W9CC 1I1CA 4U31A 2Y7SA 3BWAB 1XR9B 2VRZA 3QJFA 1QKZL 1B6UA 3QEHA 4LHUG 5E99H 2P46B 2CHNA 5E2VL 5I2IB 2XA8H 5J12B 1SYVB 3FCUB 3FU5A 4Y5VC 4V1DA 5CP7A 4EI6B 1TTUA 3G5XB 1BF5A 1FF5A 2PP9A 1K97A 5L2KE 2APFA 2JWYA 4KJWD 3MHHC 5DMJB 2FT7A 5BOJA 5EG6C 1S7SA 2E8YA 5EUOB 2YA1A 4CADB 2B77A 2QVTA 2ZNJA 3A6OA 1U96A 4Y5YC 4D0DA 3B40A 2GY5A 3GS7A 3OTFA 2AJVH 4O02A 3WJJC 3CBKB 1UWGL 2PWEA 5DVMA 5GRZA 3G5ZA 2AITA 5EBMA 5FYKD 3U9PH 2BNQB 3WLWD 3WUWB 5SWQB 2BIIA 3BRDA 4I9QA 1BQZA 2BNUB 1AGCB 3DTXB 4LSPL 1P4LA 3E1ZA 3LKPB 1A6WL 1UM4H 3P3RA 2BNRB 3L3KA 3U4BH 4Y5XB 1K4DA 2VXVL 4X98A 3K6DA 4G9DA 4RMRA 3PAYA 4NWTL 2XG4B 4ENEC 3LRHA 1AQMA 3UO3A 1GMGA 2FGZA 4PQXA 4C56D 6PAZA 3POCA 4MLSA 2FO1A 1S5IH 1KV3A 3HNTL 4RQQB 3QJQB 2VDLH 1PV0A 1RZ7H 4XNDA 3W56A 4GG6F 2PPAA 4L3AA 2ZOKA 2NT1A 3CZKA 3SHSA 4C4UA 3CVCA 2LFRA 5T1JA 5AKTA 3FOLA 5C09A 5L4JA 1TFPA 4LOEA 5I82A 3QR2A 3VFSA 2CJSA 4PJEA 1G1OA 4AYDC 2G38A 2NUPA 3ATAA 2FYVA 4QRTA 4PJCA 1XHXA 5A7EA 4LLDA 4BW5A 1MXGA 3G6DL 3FSWA 4W9KC 2ZXGA 4WWID 5KUKA 2AZ2A 3C5ZD 5GISH 1B9KA 3VI4F 2G5BB 3ZL4L 3MGOA 3S36L 1T5XA 2VDRH 1BMFG 1LO5B 4HPOL 4Y5YB 4G7YH 2P5WE 4JG5A 4JQIA 1AY1H 2BHFA 3FCGA 2AEOA 3GLDA 2NW3A 4IGBA 3EFFK 1FYTA 1IXBA 3Q01A 1ZHLA 4LPXA 3GKZA 2Y4UA 3GLZA 4R7XA 4G6JL 1XCQB 4H0LC 4L4VD 5JHDE 2W0LA 2A9NH 4KHTH 2B9BA 2E9JA 3SQRA 3ENEA 1TDQA 3R65A 2P9RA 4MJ5B 3VXNA 5F1NB 5CP3A 1VKXA 1TQCC 3SKMB 4M5TA 1G94A 1HNXB 1JL8A 3SGDH 3ZDZB 2P28B 4OCMC 1ILUA 4F15C 5IJCC 2BIMA 2XWRA 2Z8SA 3PWPE 3MRHA 4Y88A 3Q06A 3L3OA 2HLAA 3AG3B 1QI3A 4OLWH 4KC3B 4NX0A 1R5WA 2NPLX 5B1JC 4PN6A 4X98B 4P5KA 2ATAA 1A6UL 4O4JA 1WA8B 3GDCA 3ESPA 4NUJA 5IHUH 4GSDH 3QEUB 2FH6A 4DGWC 3TESA 5EZJB 1WN7A 1OAJA 4FCAA 3SDDD 1OF2A 2BWDA 5BZXA 1OGPA 2EO7A 2APWA 5TPWL 3MN8A 4IRJC 3V4PH 3IS0X 3NABH 5JQHC 3LXAA 1Y67A 3MROA 4Q56A 4N0UA 5EUOA 1X5GA 1DF4A 3EOTL 1FKAO 1DCLA 4YSPA 5LBSL 2WBJB 4CA4A 3L3GA 4H5SA 1TLKA 4YN3A 5JIMA 2X89D 3CFDB 5HXMA 4G82A 5KANI 3JZYA 1VQPV 4RIRA 4ENED 4K8RD 4WNJA 5JW4R 3VMNA 2WBWB 4OZIF 2J25A 2WXLA 3GSOA 3H9HB 4A7GF 3WTVA 2D3NA 1MHPH 2Q3AA 2WJ5A 3ALXA 4AMWA 3WIFA 3EG9A 1T0PB 5CF3A 1SY6A 5TH2B 4KKAC 1ZSHA 4WFBV 4NRYB 4OF6A 2QM7A 4EXPX 3T2MA 1DUYB 5TDOB 4F8TA 4XMPH 2Q9LA 1MVUB 2H6UA 4CSTA 1TZIA 5IGXH 4X0KB 3BSZA 5D1QE 4GSXA 2L35A 3BE1H 2F6AA 3IDUA 4JFPB 5JHLA 4R7CA 1Q0XH 4FFWD 5I15L 1BOGA 2Q3XA 1BFSA 3QG6B 3HG0A 1TG8A 4M62L 4Y9GA 4HBCL 5DUBB 4BCYA 4WWOA 1FYTD 5IJVA 3MOAH 3L7FB 1SM3L 4PRHA 3JATB 3CZFA 3K7UA 5IB3A 1KGJA 4M7LL 3HE7C 4BA8A 1C1EL 2ZSWB 3RWDA 1I7UA 2FEEL 3OC8A 4N9GB 4U3FH 1AXSB 4U1GB 2YAMA 3GSNB 5CBEA 2BCKB 5E95B 4I18B 4JO2H 5F9WB 3D9AH 2OI9C 3D4ZA 3F7RA 4YDVB 4MB3A 1F11B 1SBBA 4GRMA 4EPSA 4ZJ9A 4BSVA 2FYYA 4YBQC 4NC0B 1DVFC 3OAZH 2H94A 4AEEA 4NQCB 1VAHA 1WF5A 3PWPB 1BA9A 4WF7A 3DO7B 1HL4A 2VDMH 3VXNB 2JXMA 4U3JB 5TE4H 5TK2A 3RHWF 3M1BA 4H1LG 4G9FA 5EK0A 1FO0H 1KIRA 1NGWB 4EB6A 1TKWA 4KKNA 4E41A 3IJEB 5E1HB 4B3VA 4D9LH 1KPUB 1WIPA 2Z35B 4TOIA 3SDAB 3P30A 3EYVA 4WK0B 1RUKL 3MJ7B 4DKFH 4NQQA 1IFHL 5EH1A 2JSFA 5CWSA 3RWJA 2ENSA 1M1SA 3LMJH 4G6AC 3MV9E 5ESQB 2NNAA 3IFPA 1BD2A 4ZNEE 5DC0A 3NRPA 3LIUA 4NAQA 3VWKA 4DIXA 2LT9A 3M8OL 4UBDD 4YUEL 1IM3D 1N19A 5FX3A 4XMLH 4PRPB 1W0WB 5C6TL 3W7SA 1UA7A 2CGZA 1A6TB 1CIUA 3S37H 1HH6A 1SVBA 1W16A 2WSDA 3I3EA 4CC4A 4PV8A 3DXAD 4N0RA 2G75B 4YDLB 1E5UI 5TE6L 2BCCH 2BSSB 2P5WB 5DMKB 4B95C 5L88H 2YPVL 1S7WB 2CJUH 3NCEB 3WS6C 5JOPE 5DO2C 1WBYB 1DVFB 1S9XA 3F3HA 3L5WA 2ZTBA 3MU3A 2ZOWA 1GYUA 2IG2H 1BJ1J 4MA8H 1Z5WA 3CP1A 4FKEA 3U9UA 1SJVA 3AWGA 3ECQA 4E42B 3KYMA 4F15B 1D5RA 3PXLA 1WK0A 4QRQA 4WHTA 3AY4C 2P45B 2R0KL 2JQAA 4N2OA 4XP4L 5BRQA 3ULVL 3LY6A 4IRSB 4AQ8A 5LGJB 2BNRE 3K72B 3UTTE 1Q1PA 2R51A 2RQEA 4XBMA 1KCWA 1EBPA 4DTGL 1AP6A 1XR8A 3GM8A 4HC1L 4I0PD 1T1ZB 5ID1A 5DLML 4BE6A 1NGPH 1KB5L 3FUDA 1URFA 3BZ5A 1CTOA 5IT9N 3ROOB 3ZKSD 1CP9A 1DLFH 4PP1D 1H3UA 4S11A 2DBJA 5DUBA 3G08A 4XCFH 4UINH 3RWIA 3DSNB 4QRPA 3PP4H 5L2KB 1OSPL 4BFBD 2CGOA 3FU9A 3LKSB 3HZ3A 4NFCA 2CU9A 4QJ5B 4QHNA 3EGDA 1A3RH 2A7WA 4NNYA 1TTFA 3OKDA 3IAYA 1NC2A 5AZUA 3GI8H 3BHBB 3QUGA 3LNMB 1FE8H 2APTA 4YBHA 1DBAL 4XNYH 5ANMA 3M7MX 2Z0BA 5FKAB 1OARL 3K5SA 2XUMA 4PRIB 5FECA 1F4YL 3PV6A 5IBLD 3OHXA 4DV2O 4KHPB 1FV1A 2H1XA 3FQXA 1OAUH 1GO3F 1CD0A 3FQ4A 3H9HA 3IBEA 2ZJSL 3KJ6H 4WUUE 1CBVL 1DBJL 1MAML 5C0JA 2C1OA 3AQZA 2V9QA 2DTML 4IBQA 5KVGE 3NZSA 1GKEA 2C3XA 4LNUB 3P3TA 4NXMB 4PLOB 3KLHD 3KPSD 4PUBH 4FJYA 3KCWA 3AXLB 1JGVL 1BLNB 1A1NA 1JFQH 1KYOJ 2YD3A 2ZICA 1MLCA 3SJVA 3PGDA 3DX3A 3ASNB 4HWUA 1GW6A 4KH2A 1RU9L 2BXYA 4HWEH 3G04B 1KN2H 3QP3A 4AEIL 4KTDH 4E9QA 1INDH 2QQNL 4JQVC 5T3ZH 4GMSL 2YD2A 1UOVA 1PEWA 2HJFB 2NX5E 4G8AC 3C6LD 4PBXA 1AI6A 3K1DA 1YHQV 2VKXA 4PGEA 3AMKA 1X3DA 4GUPB 4RMTA 3S3BB 4B7LA 3DX6B 4Y4KC 3N27A 3F7PC 1M42A 3EJUA 4LGPB 5D7IB 3RJDA 1LP9E 2QPSA 4FLWA 1A2YA 3VI3A 3Q4HA 3BP4B 2VMFA 32C2A 4O02L 5J1AB 1RZKL 5IJKA 4E9WA 1TPXC 5BZBA 2JJSC 5CLTA 5DO2D 4MJIE 4JPVL 1NC4B 3P0YL 2HG5C 1ET8A 1BHAA 3MLRH 2EDOA 1WFOA 2XX0A 1OCCC 4LBEA 3LKNB 1K4CA 4JPIB 5KVGL 3JWNG 1CS6A 1NM4A 3TYFB 3IJ8A 4I8DA 4WKZA 2O57A 3BABA 1YEJL 3DX7B 3KPSE 3BAAA 4ZI8A 4JKNA 4KUZL 4TSBL 4K4KA 1U8NB 1EANA 4PP2A 5IK3B 1LNUB 5CJ8A 3UTZA 5E24E 3G6JE 3FFCB 2YQ2A 1IAIH 4X6DE 1WEJH 3EO9L 4ZW8A 5K5YA 2N04A 2GT9A 2J20A 3STZC 4RQFA 3UTQB 2X38A 1A9BB 4QRBA 4QXGL 5IWAO 4LPVA 1RY7B 2YD7A 4BSJA 1P5VB 1PU0A 1UXMA 2Z1PA 4Y5XC 1G5GA 5FO7A 4DR7B 2Z1KA 3U7WH 4AMKL 1T5KA 4PJBA 2VERN 2Z35A 3OGCB 3QE5A 5I18L 4OGYL 3GSXB 3BP4A 3CV5A 1IQDA 4MB4A 1NKGA 1MKFA 2P26A 4P4KA 4CMHC 1B0GB 1PL3A 3WBDA 4YPGA 2ICEA 4IIJB 3CHRA 4NQUA 1UYWL 3ZU8A 3Q2VA 4AZ8A 4NKMB 3AT8A 2G60L 3WFEH 3WIHL 3MYJB 1J5EO 1J8HB 3EFFB 4HHAB 3WNIA 2AQTA 1U8MB 3ZGHA 4ZOLB 1O9ZA 4G6KL 4HS6B 4E0RA 4P4RA 4WWKC 4UCVA 3FB6A 4NERA 1OE2A 5TDNB 3FPXA 4YDKH 3SGDI 1U8CA 2QPUA 4PJAF 5E5MB 5JUEL 5IVXB 2ZYSA 5C97A 3CFMA 3BWUF 4Q14A 1OZTG 1YNTB 3MTRA 3SYAA 1MW1A 1FYJA 1P4LB 1ERNA 1ET7A 4DERA 5IQOA 3VXRD 1IBGL 4O5LH 1J18A 5JMRA 2D73A 2C8NA 4HCRH 4U6HA 5JR1L 4UT6L 1VIWA 4NJAL 3QCUH 4X5WB 3NEEA 4FLQA 2I07A 3EH2A 4XC3L 1THCA 4NSKB 4WF9V 4JW3A 1B06A 5AOIA 2BX5A 3P4MA 2GG1A 3K74B 4PY8J 2JJWA 4Z77B 4IJ3B 1TUEB 2D7TH 4JHWH 4WWKB 3R18A 3T1YB 43C9B 4MS6A 3IMWA 1OP5K 1HCZA 4TNVK 5DFVC 2PF6A 4YXLL 3T3PE 3H1ZA 3CMAV 3F8UB 5ISZE 2CIIA 5J3HD 2PWFA 4LSQH 4GG6A 4CH4A 4BFEA 2GHWB 2EZOA 3I5DA 3CDYA 2ESVE 3FT1A 3MBXL 1LEGB 3IETB 4OB5H 3RU8L 7FABH 1XCTB 4DR3B 3TBTA 2BP3A 3EYOB 2ZAIA 3QJFB 4UOW1 2IO5A 3S37X 2Y7QB 4J4PA 3MQIA 2O61A 2B3RA 3Q2NA 1H3PL 4PRPD 4LF5O 2QSTA 3CRMA 3ZTDC 4M5YH 2DYPA 1QHOA 1HNGA 2NY3B 1BJ8A 3DX9A 4PJFA 1RK1B 3HI1B 1KOAA 4QHLA 3A22A 3W9DB 3ZIMA 5DURD 5HI4C 3N9GL 4R4FH 4IBVA 1G6UA 4P9MH 1XAKA 5CSGA 3JSLA 1UA6L 3OAUL 5C2UB 1XNQB 1FORH 1K8AW 2A5UA 3HPLC 3V95A 3NP3A 5TDNA 5HVFB 2GUOA 2DMHA 2IALA 3T1FA 1CE6B 4X8JB 5JQGA 3WY3A 3IFXA 2Z93B 1XEDA 4G6ML 1ANUA 4KUZH 3PV6B 2OWOA 1WAAA 5EB9A 1US6A 5E8OA 3BSZL 2DJSA 3GIZH 3BFRA 3VXSD 2QV2A 5C92A 4O2EB 1KEGH 4LIQH 3QWQB 3F7LA 2CRZA 3DARA 1UT9A 2C3GA 2E27L 3SSGA 1KTLB 3RWFA 2OXHA 4YHNB 5I1DA 1WA8A 1KYOF 3PIQA 3V5KB 4FF9A 2ATKB 3N04A 4LF7B 3UJJL 1BPLB 3GB7A 1TZHB 2XZZA 3T0XA 3V7AG 4KJQD 1S5HA 4JY6B 2MCG1 4PTUB 2OCHA 5EU6E 5SX4H 3PFQA 4R4NC 1V55C 1NWPA 1IJNA 5AOKA 4GKNA 4F7TB 3PY9A 4ZOAA 3VD4A 1JRHI 4L29B 4L48A 4ZUUA 3CFBB 5BZDA 2FB4H 4F3FB 4JM2D 4HWEL 2QR0A 1N26A 2BVOA 4YOKA 3ATFA 4HU2A 1EGJL 3L3DB 1UQSB 3AGWA 3MJ9A 4K7PL 4M4RB 4BFNA 3MKKA 1VP7A 1MPAL 4KWUA 3CDFA 3W7XA 4O9HH 2HN7A 4RGNE 4ZFGL 2A73B 3OB0K 4R3SB 1SLXA 2Z7YA 2XJKA 5KVDE 5HFMA 3AUWB 3I2CL 1J5DA 3TVMA 5I24A 3IGAB 1SHXA 4NQCE 3RNQB 3KVDD 4MMYA 3UPCA 1CL7I 3M8AA 1KIRB 1NGWA 3D3VA 4XC1L 3V0FA 2YLKA 3NA9H 3TYFA 4LF4O 4QPKA 1T1WB 1JFFA 4G80A 2E4FA 4U1GC 1KBHA 1JI2A 1NOFA 3K58A 4K8RC 2VXQL 4S1RH 4NQCA 1E1RG 3BVNA 4DQOH 5B38G 5DRWB 2W0KA 4X0NA 1TFHA 1XGZA 4PJGE 1FHNA 1ZV5A 3VI4B 5CEZD 4DV4O 1NICA 2P5ED 4RFEA 1GPOH 4Z77A 2JKXA 3QXWA 2OMXB 3P4MB 1SMAA 2I60H 4RETB 3VXMD 4PMEA 4I7ZB 5H9CA 2OTWA 5F1KC 4DV3O 2DWEB 4P2OB 4PJ8A 4ZTEA 1F00I 4J1UA 4OT1L 4TUOB 5FR3A 3HNSH 4LEBA 2P24A 3B8YA 4HH9B 4PRHB 2BIPA 3NJKA 1U2YA 2CA3A 5AYTA 1T03L 4Z5RB 2Y7NA 4GQPH 1U92B 5E8NA 3S88L 1NANH 1O9VA 3I6SA 5F7MC 2YPVA 2EDQA 4ZMAT 4ZUSB 2YGQA 1FP5A 3NPZB 1PNCA 2G2PA 2YD6A 4LOVA 4DJMA 2HX8A 4UZSA 4EI0A 3V9EA 4PV1B 3RGVD 1MIML 3UGUA 3CXDH 3C3SA 4NKMA 2B1AH 5HHOE 2X3AA 1BVZA 1HL8A 1KENH 3NSFA 3L72H 4LLQA 5JHDA 3W11C 3ZL2A 1L3NA 3MVSA 4DV2B 4LP5A 4EKXA 1S7TA 3FFCE 5MEOA 1XF5B 2WUCL 3HNVH 4HC1A 1XBRA 5E6ZA 4ZD3L 2ZCZA 5SX5K 2OK0L 5GJTL 3NCJL 3FONB 5JW4N 2IH3C 4KKCD 1G9NC 1KFAH 3TEXA 5GQBA 2QHRL 4HZAA 2OMVA 3KXFB 5JCOA 1AP2A 1HWYA 4XWGL 5KX5A 1FGVH 2DMXA 2CNZA 3HHMA 4NNPL 5C0EB 4U1HB 4OCXH 1NEZB 3LCYA 2Y24A 4N2IA 4L4VB 2PCFA 4X1YA 2GABA 5DEFA 4P3DA 3VFWB 3PE9A 4M5SA 3ULVD 2Q5ZA 1T1ZA 4LVNC 1RZPA 1XF3B 2CBOA 2MMXA 2YA2A 3OX8A 5FOJA 1BEYL 3MV8B 4QNHB 1KCUL 2FBJL 3KL5A 5D7IE 2UXDB 2NY3D 3I3DA 1DJSA 2L04A 3OUFA 4ZPVB 2Y0IA 1AFVH 3FOMB 3FT4A 3HI5L 1EM1A 2ETNA 4LRIC 1IFHH 3OKMB 3ZYOA 3ZIYA 4C47A 3F7YA 1FV1B 3D85A 4PS3A 4FMTA 4GKZB 4WK4B 3WNPA 3F7YC 5CNHA 5D7LA 2GTZA 3VB9A 1BVKA 1UC6A 3ICXA 4WWKD 4FQCL 4K9EH 5DD3H 2KKWA 3PDOA 3ATBA 3SZKC 4KHXH 1VQ9V 2G60H 2A6DB 3BEVB 3WFEL 1OGAA 3CAFA 1OHQA 4E5XG 3QO1B 4PU2A 5AALA 1OT1A 1EAQA 1WB7A 4DPCX 2VDPH 1CIDA 3LYRA 5EOTA 1MFAH 5IY5C 3WB1A 3DOSB 1S4IA 3QYCA 4JGJA 1QLRB 4IKLA 1RSFA 1UT1A 2Q2LA 5IFAH 2PPFA 4RGOL 4B0MB 1TYEB 3FRPA 1R3LC 2TAAA 1A1NB 4NJ9H 1K34A 5C7XL 3IF1B 1HOEA 1KTDB 2E9IA 1U91A 4JGSA 4KDVA 5DJZA 1F90L 2ZQMA 1GXEA 5JIQA 1UACH 1CLVA 1T2JA 2NY2C 4HJIA 4K3JH 3H2PA 2IPUG 3QQDA 4OLZL 2PI4A 1F5WA 4D0BB 4YFLI 5HHPA 2NY0D 4JLRA 1CWVA 2LGQA 4WKXA 1EN4A 1IAIL 2CUGA 2FX8H 2GBTA 2YOCA 5CJQH 3F84A 1T83C 1M2VA 3TPUB 4N6QA 1HKLL 2HRPH 4N2HA 1J0IA 4MHHI 2FATL 2Z9TA 1WJZA 2E47A 3QUXD 4PR5B 3KPMA 4RRPG 5FFLA 1N8ZB 4UQ9A 1N8ZA 1YEJH 1BZEA 1FFNB 1PG7W 4TPRL 3GXFA 4WI3A 12E8H 4PRBB 5E00B 3HLAB 3POHA 3LB6C 1QOKA 2VWEE 5EBGA 1FJ1B 4A6YB 2XVLA 4NRXB 2NXZB 3L3KB 2XXCB 3IPBA 4OD2A 5F1IA 1X5MA 5FO8B 2R9HD 1WJ3A 5ADPL 2GPZA 4P9PA 4PJ6A 1OZ0A 1VF6C 4QI3A 1UUSA 5IT2L 4OGAD 3O6ML 3FT3A 2ZR3A 1MFCH 2UYLA 4NAJA 2J55A 4J3TA 2XV3A 2OMUB 2E46A 4GMSH 2LP7A 3N5AA 2DTMH 4JJ5B 3HKBA 3KKYA 1KN2L 1BJ1H 4H25A 4JHBA 4AIOA 3Q6FB 3RVZA 2BZDA 5IFHL 2CDEA 3WIHA 5J13C 1JGDB 2ZCEA 4PJCB 3RVVC 3NQIA 5HGGS 4OM1L 4WO0A 3WE6B 1ZAUA 4B7KA 3C6LC 4LLMA 1KTBA 3D36A 3ASOC 1SYVA 3NIGB 5BS0D 5L4FA 3GI8L 5C0CE 5KMGA 5JW5A 1T03H 2JDIG 1W72A 1BZOA 3VCLA 2VLLB 4QGTA 2JTDA 3QFJE 1QNZL 2D31B 2X2JA 1F11A 3ISYA 4AIZA 4FYQA 1U58B 3TCXA 5A16A 2IEPA 4NHUA 5K9KB 4HIJA 4PRAB 5D7LB 5SWZE 5MENA 4LAQL 4K35A 2G3XA 2H4EA 2WQAA 1T04A 3S9DB 4YQXL 3AU0A 1SLUA 3L1GA 2F08A 3RIFF 5MI0C 2QGNA 1JTOA 5I1GL 35C8L 2WD0A 4RH4A 5CGBA 4XN7A 1K5SA 4JL2A 3WUWA 4QOKD 1WG3A 3PXJA 2QELA 1E2ZA 2IANB 4X65O 2VO5A 3LH2L 2WLKA 1HINH 1M71B 1ZV2A 4NTYA 5GGSB 2EE0A 2Y69C 1N7MH 1MRFH 3B7RL 4QRAA 2WZ5A 5GGSA 3NA9L 4LL1A 2J2ZB 2VQ4A 3T2LA 1FO0A 1Z3GL 3FQUB 2PCFB 2JJSA 5IQMA 2BWQA 5EIBD 5AOJA 1F8TH 3FT2B 5GGTL 3TOPA 2I26N 4ZFGH 3V4PA 5EZYB 5EEWA 1U3JA 4N20A 3KZ8A 2XKNA 5MI0B 4B96A 2XV6B 2L6LA 1EAPA 1QBLH 5DVLA 2N56A 3O3EA 4LSUL 4UV7H 3TH4T 1T1XA 1MUJB 4KROD 1KV7A 5TF1H 4HLEA 4JFEA 4LWSA 4CRPA 3GBLA 2OJZL 2YXMA 5GPRA 4DUZB 2WXKA 5C0GB 4OLEA 4BA0A 4OFIA 4A2MA 5IEKB 3S98A 4ODVL 3ABMB 4N3TA 1AJPA 3A47A 1LJMA 3FCTB 4MXWH 4LLQB 4LU5L 3E35A 2RTTA 3TPUA 3HMWH 2CIKA 5D7LD 1A3QA 3IE9A 3TGXA 1NFIA 4N0YH 3SPVA 4JZGA 3JWDL 4I0PB 3QIUD 4WW2C 1ZHLB 1JAEA 1NOAA 4QLRA 1MF2L 5EOCJ 4CU6A 5AB0A 4DGYL 5IHZB 2TSBA 3ZZQA 2YC1B 2K1MA 4Z7VF 2G4EA 3ZHSA 3MV9D 5DEJA 2AHZA 1D5BA 4TNGA 3PFUA 1BZQK 3S8FB 2QWNB 3Q8AA 1CU4H 1UD2A 1IBLO 2DYSC 1M3IA 2VDQH 1AXTH 4Z23A 2GHYA 1U6AH 1EHLL 1T20B 5JIKA 5KAQF 3IMRA 1YYCA 1BT8A 2HFFB 1NFDA 3LZFH 4DV5O 3QXDA 1F13A 2XQYA 4KX7A 5FCSH 4OXSA 1U8QB 1ED3B 2HLEB 2MQ3A 4TRPH 3SJVE 2OZ4H 2X4RA 4DKFL 3GMQB 5L9DL 4ZFOB 1HQRB 1GZPB 4NBZB 2P4VA 3U25A 5DM6V 2VXSH 1D5MB 2AJSH 1IFGA 2DQIL 3MJ9L 4ETQB 3TTSA 5ABAA 5E2VH 1F3DJ 3LRGA 1JERA 1QSFB 3L8QA 3DBXA 2ZKHL 5CZXC 4KAQH 3ECWA 3D48R 3EYFB 3FUKA 2WQVA 3KNBA 3BRCA 1BIHA 2CUIA 2Y3AA 4JFQA 2B39A 5KVFL 2HPTA 1GYWA 1G9HA 1CGVA 4XP6H 1YYLH 2C3HA 2W60A 2ZWLT 2PETA 5FM5M 1H19A 1HZKA 3K0YA 1H5BC 3SBWC 4YEFA 1YEEH 3D9AL 4GS7B 2VXQA 3BXNA 3NJFA 5INCB 2EYSB 4U1KA 1HJCA 3MRLB 5ITBL 1HNXO 1BQHB 3L9DA 3QUXB 2G3ZA 2HLFC 3RIKA 3WGUB 3T2OA 4YK4C 2DI8A 3S6CA 2OSWA 4NZUH 2KG7B 3TJPA 3JBG7 1VPOL 2F7PA 1OEZW 4ABUA 3KPOA 1RUQL 1NCIA 1G7JA 3ARZA 3DXAB 5E56A 3CK0L 2F1EA 2D03H 2DQDH 4O5LL 4F2FA 1MRDH 4KK5C 5LJYH 1NBVH 4HWBA 2F74A 3FOLB 2NY5H 1KB9F 4H8QA 4ERSH 3MJ7A 3U10A 3U0PB 3ZDYF 3VI4A 3EDFA 2DM3A 5CEXA 2MOQA 4JYAO 1XR9A 1U30A 2C9RA 2IH9A 4DR2O 3IDYC 4RQQA 2VLRA 3PWNB 4TVPE 2B1IA 4DUWA 4RGNC 1FLTX 4LLMB 3QDJE 4X7FC 4TVUA 4RDQF 5AL8A 3VYPA 5GS0H 5EORH 3LHPH 4PY8I 2KHAA 2V7NA 1GGTA 3F7YB 3J7HA 2X0UA 4KVCH 3OKMA 4Z8FL 2BNUA 2AEQL 4Y16C 4HZ3A 4DK5A 2DEYX 2HPOA 5DEGB 1CFTB 3EJJX 3IDMA 3NIDB 2N05A 3VU2A 4F8QA 5F7BA 3NJLA 2AEPL 1FNGB 3BY6A 5I1JL 2NLJB 4Y5YA 4JL1A 4N9GA 4DV1O 1OPGL 1OTTC 4TV9A 3PL6C 1W0JG 2FSDA 3FMGL 4FERA 3BP5B 4KU1A 4WZ9A 3ZMRA 1YSOA 4GSDL 4GQZA 2X1XR 2ZG1A 1U8IB 3L70H 4NRXA 4P46B 2IGLA 2XY2A 4M43L 3HFMH 4J3XA 1Q9LB 3ILEA 2I5YH 2WUBH 3DOIA 3QK0A 4NRZA 2EINB 1EAJA 4P5TC 3HN8A 1DL7L 2B14A 1RVFH 4P5TA 1GKFA 4I5BA 3SDDC 2EZPA 1EHKB 2B59A 4MJID 4WI2A 4DQAA 4KVNH 3VWJC 5IHUL 4KQ4H 4N1HB 3TNMB 5FYJU 1F18A 2Y07H 3FQRA 3OAYH 4K94L 4UFZA 4NOBA 2NY3C 2AAAA 3PS6A 4JHVA 5J4MA 5B1NA 2XV2A 3HC2A 1T0NB 2GIXA 1MHCA 4GAFB 3S34L 4QHUA 5C8YB 1HWWA 2WC7A 4UQ3A 1MVYA 5HHMB 2ZP9A 2X2HA 5CUSL 4JPVH 2RNBA 1KY7A 4RO2A 5C6WH 3LDDA 4MAUH 5I75C 2XIIA 5IEHB 3ZUCA 1EFXB 4ADJA 4GKJO 1B0RA 2F4VB 1E8YA 2E74C 2VJ8A 3MSPA 3FU6A 5KWYC 3SDDB 3R66A 1SZNA 2YPKB 1PD6A 3BKMH 2OSXA 3QDMB 4L29A 3T8VA 4ACPA 4ZG1A 1RK1A 3HI1A 3BYYA 3EO0A 4G6JH 5T3ZL 2KLTA 4X4YA 3HC0A 3RHWK 4APQA 5CEYB 2K9PA 5SWZB 4UTCA 4Y7MA 4ZQTA 3GSNH 4KZDL 4ALAC 2AXHA 2R8SH 4PDLA 4A04A 2R0ZH 2V2WA 3U0TB 4TVPH 1K5WA 1Y7VA 6FABH 5D1ZI 3FO2B 4RFEB 2DQCH 4FLXA 4IBLT 1PLGH 2HVBA 4XVOA 1NC4D 3OT7A 3WKML 4D9QD 2Q6AA 1YUKB 2K78A 1YY8B 4DZBA 2Y36L 4UV4L 1NIBA 3H55A 4FULA 2NXYB 4OAWA 3OGCA 1DE4A 2NNCA 1G1XB 3BKJH 4ZX6A 3EJZC 3RYFA 4BKLB 1MG2C 1KY6A 1LP9B 2NT0A 1YYLL 2B08A 3P2TA 4YHLL 4PJDB 4MVBC 1V7NL 3UBHA 3MNZB 3NP4A 2ICWI 3PCYA 2FZ3B 4OSUH 2WLIA 1ZLVH 3REVA 4ZYKA 2VABB 1DDTA 1ORSA 2LGNA 1LE5B 1RIHL 2HUEA 1AG6A 4FNLH 5FUCE 5MEPB 2CAZC 2D0FA 4L8BB 4AGMA 2CKBA 4UB8Z 3K2UL 3WS3A 4MFHA 2C2AA 1H3XA 1L0QA 3LN5B 3TBSA 5AAPA 3UYRL 5GIRB 3RWRD 3UPAA 1UHVA 2JQMA 5DHMC 1UXLA 4FI7A 4J23A 1CU4L 4NNXA 1T7WA 5IVZB 1KGUA 4U3SA 2B2XH 3PQYA 3MLSH 4CN4A 3SDAC 3ZRSA 3OJDB 5D7JC 1F3JB 5TGBA 1BZ9B 4QPJA 3RDTA 3KPQB 4JRXA 3WG7B 5JOPD 3ETSA 3OXRA 3U2SA 4DUXA 1HHHB 1HIMH 1K9MW 4NO0D 2O72A 3WFDL 1SQMA 1DFXA 3B5GA 2AV7A 3OB0H 5E99L 1E8XA 3IU3A 3CCSV 2HH0H 5T3XD 3O65A 3K2UH 1LEIB 5BO1L 3V55A 4AZUA 1Z9SA 3P73B 3JUZA 4YDJB 1AJQA 2W81C 4GQ9L 3QFGA 3VD2A 2OW6A 4OSUL 2R27A 3OXSA 5JHDB 2FJFA 4G71B 3QZWA 4HWZB 1R47A 5CS7A 1GZQB 3FTYA 3CCVV 3BAKA 1YJWV 1YN7A 5FA4A 1D9KC 5A2KH 3JZ7A 3VQLA 5B39A 5FCUH 3KYNA 5IMMB 3TV8A 2MCPH 4OZFB 3UCQA 2DD8L 3IJYA 5DQJB 1GCYA 3JARB 4HKZB 1I85C 4LVEA 4PI2A 1NS1A 1FZMB 3I9AA 4HJJH 4OJYA 3H9SD 1I85A 3LRMA 4TVPL 5AVWB 4X7DC 3UROR 2X4OA 3DIDA 4LCWB 4JAMA 1XREA 1W72L 3ESMA 1U95A 2NUTA 4W4OC 5EC1B 1I1AC 5CM1A 1Y18B 4UQAA 1HW7A 2QR0B 4JFFB 3A3YB 3LEYL 3CFBA 3FUMA 2DI7A 1FC2D 5BZDB 5DRXB 2FJGA 2F54A 1AZCA 5E08L 4NZRH 5DHVA 5GRVL 1ID2A 4GAJH 3UDWA 4YR6B 4JO5A 1IUZA 2NYYC 5T1LB 1JZDC 3QNYA 4IOSA 4QAMB 4OCWH 2O61B 1UWXK 5D71H 1UPGA 3OAWA 3VXSE 3A23A 1Z0MA 2WXHA 4HIXL 4PRIA 1A6ZB 4Y2OA 5B3JF 1OAYH 4WJ5A 4OKVA 4DZ8B 4XDLA 4B3TO 1IL1A 1G7IB 1NCGA 2QQKL 3WSQH 1WZMA 4P46C 1R3LA 4UNTA 5BV7L 1HWHB 2AABH 4BXVA 1E28B 2X41A 3NSCA 4ZZKA 1PZUB 1FO0L 1H6FA 2CDGA 2XOTA 3HAEB 5LBSA 2ZDIA 5EPMA 5CAYB 3BWAA 3C08L 2D2OA 2KUTA 1UJ3A 2UV3A 4LAQH 4OVUA 5GGRB 4NXNB 2VLMD 3SJVB 4BWAA 2UX6A 4WU7B 5EWIH 1ACCA 3GXTA 1H8NA 3VGAB 3ZL1A 2V17H 3O2DA 3DV6A 1R4XA 3V0EA 4GQ9H 1FQ9C 3SB3A 2X7RB 3ULUD 2DIAA 4JI0B 3N55A 4QRRB 1B0WA 1RHFA 1VZGA 1XF4B 2H7WA 3AWFA 3ETBF 2XTAA 3GHEL 3UMNA 5MEPA 2C1PA 5I5RA 3NBNA 3ZUNC 3VXQA 4G42B 4MAYA 4HS6A 1MHHA 3Q2LA 1WP6A 3SYPA 1T22A 4L8SB 5A1AA 1JWUB 2CO2A 3GI9H 4Q6KA 5C8YA 4UT7H 4EZMA 1O9GA 5B38A 4RZKA 1N12A 4F5CE 3B9KD 1CB4A 1IQWL 2YDEA 1PY9A 1E5AA 2EKSB 2OQJA 1RK7A 3LZLA 1G7QB 4KJPD 4X6FB 1Y76B 1OP3H 2Q68A 4NNYB 4X6FA 1M7DA 1O7DC 1CTMA 1CICB 3MJWA 3PHQB 4FM0A 3QORD 4XAWH 3TV3H 3TCLB 3AG2C 3EXLA 2A6IA 1PKXA 1OCRC 2VDOB 3P0VH 3QPKA 4QXWA 4D3CL 1TQTA 4R5VA 4NO2A 2A2QT 3BD5A 3KJ4C 1HN1A 2GSMB 1P4UA 3EFDH 4WEBL 1DSFH 4ASUG 5I0VA 1AS8A 4LF6O 3CFKB 1V27A 4F58H 1E6OH 1XMQB 3AABA 4XZUB 4DN3L 4QOKA 2FECL 4XCEB 4DUYB 3IDYB 4F6RB 4XX1G 2Y2TA 1EZJA 5C9KA 3RZCD 1ZE3C 3KPNB 5D1QA 4L37A 2XWZA 2IDUA 2JIXA 3ARBD 5GGVL 1X5LA 2R0ZL 3AACA 1YIJV 4XPHL 5FLUA 5DF0A 5A3ID 1FZMA 3B56A 2OMTA 5IW1B 4OPAA 4KY2A 4JNXA 5HD8C 1WPCA 3AK3A 1BVLA 1QSFE 4K3AA 2WP3O 3NOIA 4K0KB 4LZKA 5F6HI 3WKNA 4RNRA 1RLWA 4GUQA 4S1DD 4OLYL 5LG6A 4LBEB 3FFCD 5C7ZA 1E9PA 5EA0H 2EICA 5LMUB 2R1YA 2Z92A 3DC5A 1S7WA 3MLZH 3OKDB 4J42A 3BISA 1I7TB 3NCXA 1WT5C 5DT1H 4CVUA 4PJ7F 4QCIB 3NJGA 1F4MA 1YMMD 5AUMA 1CFQB 5CJOH 3IC7A 1IAMA 3ZR5A 4I18A 4PGZA 8PAZA 2VISA 5J11C 3GMLB 2VAAA 3D3QA 1U8OA 3BW9B 3BPNB 4TLSA 2Q86B 1OD9A 4YO0A 3NJMA 1LO2H 4O4HA 1LQSR 3OJDA 4HWBL 2KERA 3EYSH 4L9LB 5EN3A 3S34H 5HSFA 2OL3L 4TSAH 2F5BH 7PAZA 1JNLH 2EACA 1NU1H 1GTOA 1FZKB 3ZE1E 2PZSA 4IIQC 3T2NL 3WNMA 3LZFL 5H35B 4KGLA 1GN6A 2NYZA 4TTGA 1CDIA 1MI5D 3QQ4B 4YSDA 4R9HA 2RN9A 3L2NA 5D71L 2CKBB 4F2EA 1AE6L 4JAUA 3CRAA 2RCSL 2EIZB 3Q1SH 5CU9A 1ML0A 1S3RA 1ZHNB 2VZ1A 4PYHA 4LBAA 1DEDA 2Q8BH 3OJMB 3PJNA 4OZGF 3JALB 3RN4A 4K0KO 3L9YA 2OM5A 4ZT1A 3MA9H 5DRNA 1SA0B 1NAKL 2WZAA 2E3VA 3M45A 1Z32X 3CG8A 4ODSL 4XBFA 1IBZA 3UJTH 4NNPH 1VFBA 1XILA 2EE3A 4HIHA 3MC0A 2W38A 4OZGA 4UQ2A 3PWNA 2JE8A 3NIFB 2W0XA 2VN6A 4MQXC 3S36H 3TLRA 4L9DA 2VYRE 2XRAH 2P80D 4GEJA 5I71C 3DUHA 4AM0A 1WBXB 1C5CH 4NKIL 1KB5A 4PWGA 5CBEB 3FCBA 5FM8A 2XYCA 4YSRA 4RGNB 2ARWA 3HKCA 3RVTD 4B9FA 2YEVA 4EKJA 4PRID 4KZEL 5LA6A 4G5ZH 1Y0LA 3C5JA 4OU3A 1MFEH 4TUJA 2HJDA 1F3JA 5TGBB 2MTAA 4GXVL 4IK6A 2GJ6E 4QJ4B 1JTPA 5TF1L 1S7UB 1RP3B 4UDTA 1QBLL 4WTQA 1T1YB 2IDSA 3AXLA 1LILA 4DFIA 1AR1D 4F33A 5F7UA 4JN2B 4XCYB 1ZS2A 5AZEH 1HIML 3WFDH 4MASA 4DKAA 2QTSA 4JFOA 1NIFA 1KPUA 3ME0A 3DMMB 3VD5A 4KK6C 5M7QA 5DXWA 2YPLA 2NDFA 4JFEE 2X6MA 4JFDE 2R39A 3SKNB 1AQDA 3OJVC 1KECA 1GGCL 1BMGA 4D94A 5CR1A 1TJGL 1C8PA 1HNWO 3ARQA 1OTSC 5ICZA 4KXRA 1O5PA 3ESVF 3F7KA 3FCTA 3IMSA 5T3ZE 3OQRA 3MDSA 2F58L 1IBKO 3FQRB 1JHKH 2JQZA 2KLSA 5EU4B 1VFOA 3S88H 2BSKA 1TUPA 2R2EA 1IGIL 4LWSB 2GSGA 3CCHB 1HQRA 4IJTA 5TQ2H 1MUJA 4LK4A 4MRCA 4PV8B 1P7GA 5EU3B 2OX5A 3O9WA 1K5NB 2UX7A 3PAVA 3UTSB 3O3AA 4EUPB 2VQFO 4MA3B 4UXNA 4F9PA 1ZJBA 3L3GB 4Q0XH 1X5YA 1Z3RA 3E1F1 3N42B 5CSZB 1AS6A 4OBRA 5DJ0B 2V8LA 1TXKA 4I87A 2R29A 1JV2A 2YO3A 1OO2A 1KJ2A 2Q20A 2Y1AA 4GXUM 1MCCA 3CXCU 2B7DT 3PN1A 2DQIH 2APBA 2K9UA 4CC5A 2EEDA 5FDWA 1A6VH 4FXGB 2XPZA 2X70A 2GIYA 3P69A 2OFQA 3UZVB 3R4RA 2AK4D 3OKLB 3UT5A 3K72A 3RVXC 3AY4A 4QIWF 2NQCA 1CLYL 2OMZA 2W9LA 2HFGH 1JXKA 3QG7L 4NUJB 3FUHA 2VL5B 1TO5A 2J71A 4XNUH 1BX2A 5BS0E 5I66B 4F7CB 1L9SA 3NCMA 2CKBL 3DX8A 1DFBL 2WTPA 1G9MH 1WFUA 1U93B 3MHZA 4FQ2H 2CHWA 1XIWD 4QPEA 2BVPA 2G9KA 4LVOC 4Y9FA 4DGVL 4ELKB 4B27A 3CZJA 1I1RA 4FQIH 1XMWA 2OS7A 3C6SA 3CU1A 3KW8A 3EO1B 3HPJA 5BRPA 5M94B 1YQVH 4K3DH 4HEPG 4QRPB 3SJBC 2N74A 1MSWD 4HBNA 2JRIA 5GSRA 4Y5VB 2LE9A 4FJ6A 3WGVB 1YF2A 2ZXCA 4JM4H 3KVQA 3NJIA 4XPFL 3CSTA 3H9SA 3TO4A 1TOXA 2KSDA 3W7TA 4H2AA 3WEXB 1O5DT 4Y4FD 2BSCA 2IWFA 1FPTL 4KQ3L 3C60C 2BNQA 4NN6B 1ND0B 4NUMA 4CSZA 3JTTB 4CW1A 3RWCA 2YKLH 4YLCA 5KSAB 3AS0A 4BZ2L 1PZ5A 3BXNB 4K55A 3TYGH 4MNQB 1W8EA 1SRYA 3K04A 3WFHA 5DZOA 1FIEA 4ZK8A 3DOSA 2W0FC 1DFBH 2DH2A 3OUSA 5AVTB 1C12A 4IRJD 5C08B 2H5UA 5ITZB 3EW3B 4FNSA 4J9ZB 4PJXF 3PAZA 3FUJA 4N4YB 3MV9B 2H3XC 3L5HA 4JJOA 2NRDA 5ALCL 3SY0B 3TA4D 5D2LF 4Y1AD 3K9SA 3P9MA 1D6EA 1F4WH 3G67A 1HINL 2EP6A 4XTRC 1NBQA 5KBKA 1PLBA 3K08A 4RRPA 1CD9B 1MABG 2QKCA 1OT2A 4UT6A 5GJSH 3UAJC 1MH5A 3MRKB 3CXHF 1M2VB 4NYLA 3ARFA 4YXLH 4EE2A 5D6DA 4JPRA 2VQUA 4H5SB 3MCKB 4MWFB 3HAEG 5K69A 1KB9K 5DK2B 1GRJA 1HEZB 3T09A 3F83A 4W9GC 2BE3A 3IE4A 4U6XA 5IJ0B 1PCXA 3FUNA 5TQ2L 2VIRA 1L3WA 3IU4H 3AG2B 4M8VA 1ZLUH 1I8MB 1INEH 2M6YA 1J11A 2XTJC 3NTCL 5AKVA 4LSSH 4XP1H 4A2HA 4ZHQA 2W94A 4EAEA 3TBVB 1J5IA 1PG7X 4RBPH 4EB6B 2D3VA 2IU0A 3ISWA 4PBDA 4HX1A 4BWTA 5LYJA 4MNGB 3FCSB 5JR1H 1OGAB 1BSMA 4P07A 1Q5OA 1S9VB 3QUZA 3ARRA 2Y6SC 1A4JA 1TQCB 2IH3B 2HLAB 3IU4L 4NB7A 1N6VA 3O2DL 4NM8L 1WPBA 4Y89A 3B7SA 3QQ9D 1H2SB 3WL9B 4LEXH 5D7SL 4CVZA 5L8JB 3BLBA 5HFLA 3V9CA 2WO4A 3OQ3B 1BXXA 4FQ1H 4DW1A 4LCIL 4LLYB 2P8LA 1KLGB 5EZYA 1R3KA 2OTUA 3HNVL 4GXVH 3CX5J 1KBPA 4IYIA 4QTIH 3CSXA 1OQXA 4GPVA 2G5RA 4JLRB 4M3KB 3ZVVA 3BZFB 5I1CH 1J88A 1DBML 1UZ8A 2OSLA 5C07B 3X13A 1RURH 3MROB 4KI5D 3E7JA 4YSQA 1BD2E 2J8UB 2M83A 3AWEA 4TPRH 5L9DH 4IYHA 2J8UA 4G8GD 3SDXA 1DQMH 1KJVA 1S78C 1ZS8A 3E6HB 1DEEA 5L8LB 5LDSA 1LO5A 1F6AB 2O6PA 4YHYC 4WNQA 1JNJA 1WCQA 4EO5A 4M4PA 1XIWB 1GSKA 5EO9B 3GRBA 4B60A 1IBHA 1FZJB 2P4KA 5PCYA 2CBMA 2ZSVB 4WSGA 3EO9H 4B3SB 5I5MA 2QGBA 3CC1A 5C0DA 2GJZA 3CHXA 2Q8BL 2PO6B 2VR3A 4BZ2H 3IJSA 5KAIZ 4FXKB 4Q89A 4BKSC 1EGJA 3LQMA 3CJHB 4JFDD 1I7FA 5KYWA 5DJ6B 5LXVA 4B5EA 4QWWC 2DTSA 3GSVA 4UQBA 1G84A 2DM4A 4K7PX 1OF0A 4RGOH 1TCRB 4P4KD 3K2IA 1YEDA 5DWUL 1J0HA 4DV0O 2DWEC 3QZOA 4BDVB 2DJUA 2DMKA 1N5AB 2LAGB 3MLXH 4KI5E 2YXLA 4LCCB 5DFTA 5BMFL 3G6BA 1T4KA 1MFVA 2BC4A 1JZFA 4HKBB 1WFJA 1KCSL 4IHJA 1DUZA 1IO4C 4AK2A 4ZODA 1Z5VA 3M7FB 1AI1L 1HVXA 3CVHA 4N1CA 3UTSD 3F6JA 3UPRB 5EU6A 1E6JL 1UTDA 4N2FA 4J3OF 3SE9H 3TO4C 4LLAA 4K8ZA 4GIPD 1JZ4A 3MJ6A 1B2YA 1PG7H 1THAA 5DJ2A 2PN5A 3BJLA 5L3FA 1L9PA 2EEBA 4ZX3A 4AT6A 1C16A 4YPJA 4JKPL 2XBTA 4D0CB 3COOA 4HJSA 4KL1A 1Y6MR 1I8UA 2Q76B 4OD1L 3MR9A 4QO1B 4XNUL 1WZLA 5EA0L 5ERWB 4U1MA 1P1ZA 4ZI7B 4HA1A 3RPIB 4RFNC 1E4JA 1A4BA 2J6EH 1D9KB 2J21A 4ZW3A 2LTQC 4RSYA 2WIIB 1RIUL 2QV4A 4Q2ZB 4DETA 5IHWA 5IYZA 3P11H 4BYHA 5EU6D 4B9YA 2NDGA 1WH0A 2ITDC 4UVAA 2NNFA 2GBOA 1RCYA 1I75A 2EC9U 1FFOB 3R8BB 5JDJA 2JKJA 3M17B 3V79C 4KV5E 4AQEA 1U8HB 4DXWA 1WUNT 2EE6A 4GO9A 5C0FB 2E27H 1BCCH 1OSPH 3H8NA 1OARH 4YE4L 1P53A 4I4TB 1RJCA 4UQCA 3NCJH 1R3HA 3D2UD 4RGND 2GB2A 1L0LH 2VAJA 1WWWX 4OGQB 43CAB 2GYSA 4L37B 3CJJA 5INDA 3LPWA 4LOFA 2BW5A 4PRNB 2EO9A 4LARH 3TNNA 3DGCR 1KSRA 3QUYA 3QHZH 1CD1A 4DVBB 3NCBB 1AR2A 3BEHA 4WO4B 4M1DH 1JGUH 5JLZA 4B3SO 3TCUA 4WTXA 1FZOA 3SKJH 4WBNA 5JHAA 4QE9A 4X4ME 3MRPA 1VGKB 3STLA 3ZEDA 1DCEA 1DVZA 1DVYA 5CMAB 5CZVH 5GSRB 2CO6B 1S76D 1MH5B 3DJSA 2UUDH 4W6WB 4J3OC 5GS3A 3D0LB 4O2FB 2IIJA 2ZX7A 4XGZA 3VI3E 1MNGA 1Z0NA 5AUMB 2D4FA 4X7TB 1MFCL 3RX7A 1CT8B 1NGXA 5E9DE 4ODUA 5JIDA 1W15A 2C5DC 1FL5B 4N85A 3VQXA 3GHBH 3K6IA 3CZSA 1TTCA 3O41B 3EBIA 2V2XB 4YE4H 4GT1A 4X4KA 3UAJD 3HRPA 2LLNA 2YXYA 1DBBH 2BOCB 5KBMA 4JRYB 2FX9L 1AQHA 3QIUA 2OMZB 2PTMA 2VR6A 1V54C 1QSEB 3LNEA 4RAVB 3ZGIA 5J6HB 2KB1A 2ZPKH 4MTGA 4MVSA 3Q8EA 3LZPA 1RERA 3VQMA 4Z7OB 4QEGA 5EIBC 3HPLA 4MA7H 5IB1B 1U91B 4HSQA 5CLXA 2LO1A 3ILPB 4ZSOB 3HI6H 3JWOL 2YD0A 3BLPX 3SBQA 2FX8L 2HT2D 4X6EA 2CCLA 5HHOD 2Q4PA 3C2AH 5E8DL 4X1YB 4QE7A 3INOA 5DJCB 1RMFL 2YUXA 4DSYA 1CDCA 4P2YA 3QPXH 3VXOB 1J8HA 1NDMB 2FQFA 3EFFA 4HHAA 5E9AA 4F57H 1A3LH 4NN6C 4WCYH 5FGBC 1T3FA 5C3TA 4KK9C 3DVFA 4GAGH 2JK5A 2R29L 3CN2A 3DPBA 3RBSA 2GSGB 4Q6YA 4P2ZA 4AV5A 3VXME 5DA4A 4L8CB 3H1IH 3KM2A 4PRHD 5BR8B 4DRXA 1I1YB 2VR4A 4HHWA 4LHUD 3O8XD 1KTCA 2XX1A 4L3ED 4MXVF 3Q48A 1CI3M 4NFDA 4FTVE 4CBPA 4YMPA 4HWBH 5HGAB 2AEWA 2YD8A 4RGMC 4R6ZA 2VZVA 4P0DA 1SF9A 4KHPO 5JQ6H 4MDJA 5E2WL 1BPVA 1KULA 4ODBD 3Q3GA 4WDIA 5JQGB 2CG9X 2ENPA 4GQRA 4LDLB 4KHXL 4XWOD 5GRJL 1SJXA 2GUOB 2IALB 1IX2A 1HCVA 4R2GC 5IWLC 5CJOL 3PJSB 1ILSA 5JXED 2J56A 3EDKA 2CO4A 4TTDC 5F71A 4Q0XL 2AHIA 5I0WA 1X5ZA 3LV3B 5FYKL 5F1OB 5J7CC 4RMUA 2UUCO 2H6PB 5LBQA 1ZA3A 5E4AA 3T4AB 2C3VA 1TR7A 2J1KA 2ZUXA 1KDJA 5DEFB 2Y6SD 3F5WC 1JHLH 2R4RH 4R7DB 5DHYB 5CEZH 3AADB 5C0AA 1QD0A 4EI5B 2X6UA 1TCMA 4AQZA 3ASNC 2Y7QA 2UXBB 3FTUA 1KJ2H 1AGDA 2H8PC 3PWVB 2F9BT 3H1LH 3BMWA 3HZVB 4JRYD 2C9PA 5HI5C 3CZGA 5H37A 1U21A 1SGKA 5TJWK 1G1YA 4X62B 4JM2B 1VHPA 3GINA 3ZKQD 5LUMA 5CMUA 4GUNA 3BPLC 3RWHB 1JCHA 4BZ2A 4R97C 3WLWC 4WENB 5CGTA 3PABA 4NEHB 1P6WA 1FGVL 4PJ8C 4V11A 2FGWL 1URZA 1QRNA 5HDOA 1J9RA 1JOIA 3D4GA 4FQJH 4JCWA 4QTIL 1MCWW 1VENA 5LMNO 4YFLF 1G5AA 3RNQA 3QIWC 4Z3IA 2AS5M 1U2CA 3PPEA 5I1LB 3TVMB 2IJHA 5A9GA 1REIA 2XWXA 1AVMA 3BP7A 3HHSB 4NTXA 1BBJB 4DR1B 2KQMA 1MLCB 2QZ5A 5B5EZ 2KH2B 1ES0A 3G5WA 4LSQL 1MCNA 5I6OA 1ES0B 2UVEA 3VG0H 1IGTB 4F6RA 1XTMA 4WHYH 1A6PA 1S7UA 2X0WA 2X2IA 2ZKMX 3V6ZA 1CG9B 3L71H 2QTVA 4NO5B 2WK2A 4TULH 3OMNB 5ABDE 1K3IA 4F92B 5I0ZA 1IC4H 4PJDF 1CQKA 1OHZA 4JY6A 5F0MB 3B5TA 4NJAH 1BQUA 4DR5B 3DSFL 2Q8VA 3BGFB 3PV7A 5DJ8B 4PLKC 1BQKA 1Q90D 4JVUA 4HIPA 5E1AB 2VQEB 4FYRA 3CCUV 2R83A 5IZ7A 1UGKA 4OCSH 3TWCL 4S10A 5FPIA 1Q3EA 5GZNC 4RUFA 4GXUN 1BFOA 2DWDC 3QAZB 2LHAA 3DVIA 5E8PA 3MMEB 1D9KD 1QBZA 1JZHA 3OXRB 3QJHB 2COVD 4OX9O 3U2SB 4ALAH 3X11A 2BIOA 2EEXA 4WW2B 5DD1L 4M9OA 4XPAH 4JGNA 3C60A 5FHAH 4ANWA 1DQJA 3B5HA 1XMOB 5GJSL 1KZYA 3BVDB 4WFHE 3A6CH 5IB5B 3CCEV 5I17B 1ETJA 4Y4FA 1LL1A 2OXGA 3N40F 3WSQL 2ZCKH 1ZJAA 4RISH 3S8WA 2Y06H 2ZDIC 1N6QH 2YBRB 1TEGA 2GJPA 4XBPA 4PELA 1MWAH 3PJSA 2XN9D 2NSXA 3V10A 1RVFL 4OZHE 1DL7H 3JYBA 4PTUA 3JAKB 3ML0A 4O9HL 1AP5A 5D2LE 3PDGA 4HUXA 2VDKB 2X9XA 3KYOB 5T5FA 4DAGL 5CJXA 3I9GH 4WY7H 2P8MB 3Q5OA 2KYIA 3VQVA 1AGEB 4OQTA 4NQSA 4Z0XB 4DNLA 2FB4L 3WFBL 4JQVA 1EWHA 1LO3H 4JTAB 1YPZB 5CINH 3E2HB 5B21A 4G7YL 2JLPA 2WTRA 4BHUI 2Z92B 1W6WA 4OCNC 4P2AA 4XPHH 4F7MA 5C8JB 3H6AA 3T4ZA 5EC2B 1XXDC 5DTFB 4E2OA 2KDGA 3ZTNH 1MZYA 2K6YA 2CDFA 3AG1B 1A6TA 3X1NA 3QH3B 1JWUA 4PJ7E 3W39A 4L5FL 5BVPL 3IGUA 1KPRB 4DN3H 4ZFFA 3VFOB 2CKNA 3FC8A 4IT5A 1IZKA 3K4ZA 1OCOC 1UG9A 1Q94A 1ULVA 2VITB 2R7EA 2VXVH 3II3A 3MX0B 1FSKC 1FNLA 4JI8O 4XZUA 2YD9A 1KEGL 1VGEL 4ZO8A 1MI5E 1KELH 3RVWC 3TJHC 4H2CA 3CNKA 3ZMNA 5TF0A 2AGJH 2NXYD 1LK3H 3HHSA 1DQJB 4YS4A 3A4DA 4HV8A 2EVIA 1G9NL 5B8CB 3JSNA 3VRLE 4DP7X 1N4CA 2EIMB 1J9TA 4WFGA 5SWZD 3ZOAA 1DR9A 1DQKA 1OE3A 1KCKA 2MEJB 1L7TL 3O4OC 3RZCA 1PKOA 2WXQA 3CRQA 5D7JB 5MHSE 2F8OA 1A66A 2V1DA 3UYRH 2ZX5A 3G5VB 4I2XE 1AVAA 4YFDB 4DHLA 4JB9H 4R5TA 2YWZA 2VZOA 3H9SE 1GAFH 3K5RA 1EFRG 2AXGB 3ULUF 1OSYA 4ZO7A 3G08B 1ZTXH 4GX2A 5DZAA 5JQIB 2R23A 2ZJSH 2VMEA 1AJ7L 5ERWA 1N2RB 2FEJA 3MUGB 3T6QC 4LCCC 5T1LA 1Z5LA 2C1PB 3BAJA 5DHVB 1TVBA 3N2KB 5JW3H 1G7PB 5FUZL 3APQA 4G72B 3VXUB 1I5YA 3DURB 4CVXB 2H32A 4QDGA 2WZ6A 1LHZA 4OLXH 2NY6B 5EFIB 3S0PA 3SDXF 2WLZA 2WN2A 3V0JA 1F1GA 4GBXB 2H3NA 2XZCH 1EZLA 3C60B 4QTFA 5I1IL 4KZDH 1SM3H 3H0TB 4LKCB 4P3CH 4X6DA 5KHHA 5JORB 4X50A 5LB1A 3DO7A 2K6WA 4N21A 2W1NA 4X6DF 4E9YA 4XMKL 3VAEA 2R1WA 1U6AL 1EHLH 5IQLA 3JTSB 2IDFA 2EDXA 3OGIB 3AVEA 4YDJA 3GC3A 5FYKU 4WI6A 4ECNA 2PYEA 4GAJL 1GMEA 1JCKA 5JXEC 2V7HA 3LZNA 1NCOA 3VGEA 4BGDA 4QTHB 5I1AB 5H6QA 1Y4MA 1ACYH 1CFVL 4A6YH 1MF2H 1W72H 2RGSA 3ULUE 5D8JH 2OZ4A 4I7ZC 2VZ3A 3FYIB 2AJ3A 4ZUVB 2P47B 2BVQA 2DEXX 3A2FA 4MA8L 1Q0EA 1F3DH 2EH8H 4ODHH 1AZZC 4TQDA 3LZQA 1F6AA 3PPSA 4HUUA 1E2VA 4QUOA 2NUTB 1RK0A 2EYTB 5L2KD 1BQ5A 4FQPA 2NY6C 2APXA 1IIKA 4FHBD 1ORQA 2AJXL 4FD0A 3X13B 1EPFA 1FAKT 4QXGH 5K59E 3HZMB 3DX0A 4HK3N 4NC1E 5JYMA 4NKIH 1MCOL 1SLVA 1EJFA 3U7YH 3JD0A 1SXZA 3B8SA 1LE9A 5BO1H 1O75A 2BOCA 1QLFA 2HH0L 2JXMB 4NENB 3FMGH 4KOCA 3N6YA 1HS6A 1CYWA 1IEBA 3VDBA 4M6ML 4H4NA 4G3YL 5TQ0H 4JPSA 4FFYH 4OCYL 5SWSE 1QFHA 2MTPA 5CJXC 3UGXA 1YY8A 3T2NH 2K7QA 2F66C 1B2WH 3A4FA 4EKWA 1AQKL 1DP0A 2YN5A 1F2XK 1P7KA 1Z5HA 5BXZA 5FYLH 4TQEL 3TN0D 3CIQA 4NRZB 1S7RA 3LZOA 3ETTA 3Q1SL 4URKA 3VM7A 3VQWA 4UF7C 4V2BA 5DZLA 3UAAA 2V3EA 2BRRH 3LNFA 4UZUA 4BD4A 3L4ZA 1B88A 3FT2A 4WI8A 5ADOH 1W0KG 2WGNB 4B9JA 3WMSA 1CICC 2VDML 1NFKA 8FABB 3FQTA 3JWOC 4ALAL 1WV7T 2X7LA 3SGJA 4L18A 2P5WD 4IOFD 3MLYH 4IKIA 2VRQA 2QFPA 5ECGA 1YY9D 1UUNA 1OWRM 5GIRA 2H32H 4IS6B 4CJ1A 3W0WB 3GJFK 4MJ6A 5KAFZ 5CD3B 4GX0A 1QG3A 1R3IH 2X1QA 3F7VA 3MLTA 4PLKD 4U6XB 2R70A 1SJEB 2CQVA 1KGWA 3CWGA 1WC7B 4JRWA 2K4AA 2QKIC 3WNNA 1YEIH 2CIKB 4MTOA 1A1MB 1GS6X 5DVOA 1X7SA 3HG1D 2Q7YA 4OFVA 3TN0B 2QSAA 5ITBH 4P23A 3S35X 3RLSA 3JCZA 4GLRI 1G7MB 4OFKA 2GJZB 1A4AA 1A4JB 4ONOA 2P44B 1DDHA 3TH3T 1C5DB 1HILA 2A0LC 4FQHA 4EUPH 3IAGC 4BJLA 3ARDA 1JJOA 1JMKC 2J1YA 3HZKA 2VGLM 4Q52A 1I31A 4HSCX 4LEOB 1HZHH 2VDNH 5JO5B 4N3UA 3UERA 3D52A 1G7JB 3ESNA 3PWPD 4P2CG 1USQA 3STLC 1RH8A 1UXSB 3SOBH 3BC9A 2MW2B 4HD9A 1D6VH 1IM9A 2JS3A 1P4RA 4H25B 3FRPG 1N33O 1FFRA 4ZSOA 2ERJC 3U1QA 2AXJA 2N01B 3RW0A 2ENQA 3SE8L 3EXJA 2CE6A 1GAXA 1I9RL 2UXTA 4XAKE 5IJ0A 3CE1A 3CH1B 2MH4A 2OSLB 1AR1B 4LMQI 4NQXA 4X5RA 5C07A 1R3JC 1SLWA 2EXWD 2D3OW 2VS0A 4H0HB 4ZSOE 2ILLA 5E2TL 3QEQA 2PI5A 1BF2A 3GI9L 4UT7L 2OTJV 1E90A 3FTGB 2BOBA 1QPXA 5DLMH 2HVKC 5LBSH 3G9VA 4HC1H 4F7PB 3EOTH 3LB6D 1ZL8A 3WTYA 4RVBA 3ZDXF 2J5LB 4KXZH 1IBDA 4PRBA 5E00A 1KGCD 2GKIA 4PIBA 3B4SA 3QWOB 1PKQB 2AFNA 3W81A 4XPBL 5L7XL 2OAAA 1PKQA 3KPRB 2WZPD 4L1SA 1NTKH 1JV5B 4XDKA 4HUVB 2ADFL 3ULAB 1JF6A 4OIAA 2PABA 5I6MA 1R0AL 1D7FA 2Y9RT 4X1IB 3F64A 3MNWA 5G4MA 5CFAA 3A67L 5JWPA 2FQGA 4HX1B 2ZAHA 2XT1B 2QJ1A 1GRWA 1QEWB 1WO2A 4PA3A 2DQUL 5IF0A 1IM3A 4QKXB 5D1XE 5BNXD 2E7DA 2NQ3A 3A4AA 3PL6B 4DV4B 4ZRGA 3WIAA 4ANXA 3LQZA 4F37F 3QZNA 3BQUC 1TZGL 2GAZB 3RTQA 3JSSA 4LSDA 5CILL 5AVUB 3T8XA 3TT1L 5HPMB 3JD4A 3OR7A 3CVHB 4AYEC 3DYPA 3UPRA 5BVJB 4H7VA 2EDBA 1NLDL 1KLFB 1HAUA 2MHAA 2HXAA 5EZIL 1EN5A 1HFUA 1MWAA 1ZT4B 4OGQC 1R5IB 3NIDE 5AYUL 3J80N 5J0BA 1RIVH 1MFDL 2A6KA 5BV7H 4M3JA 3MRRB 5D7EA 4M93B 3O3AB 3BSGA 4G6FD 4AEHL 1DYZA 3VFRA 3V7MA 4HOXA 4DK1A 3OPUA 4WAFA 1YCSA 5FKPA 3O3BB 3CFIC 4BSVB 1HHGB 3GSUB 2XVGA 1AG0A 3LIZA 4M7KH 4Q2ZA 5FNVA 4EF3A 2GEQA 2W95A 2E5EA 4TSCL 1AGBB 4JQIH 4KKBD 4W1TA 4AE0A 3A8TA 2D9QB 1E0OB 4AH2B 3VQYA 1BAFH 1C12B 3FCSA 3KL0A 4CJ0A 4UTAA 5FB8B 2E7HA 2J1WA 4NKGB 1H6TA 1MCLA 2PTTB 4LFBB 3LPFA 5I6XB 2DLFL 1KGXA 3LRKA 2I9TA 4Q9BA 4JGUA 3PDDA 4UMSA 2FHCA 3TT1H 5IFJB 1A8JH 3ME0B 4XVJH 4FXLA 4EIZC 1TZGH 2ZG2A 1DBBL 4FLOA 3H9YA 4OQTL 1MQ8A 1WHPA 3BAWA 2Q0ZX 1DANT 1J05B 2F18A 1MLBA 5CBHA 1X9QA 3UG3A 4XO5A 3ZMTA 1ZD6A 1YVWA 1S7XA 2Y69B 1UGNA 1XGPB 4WEMB 5ICYA 2KPWA 1WCBB 3O2WH 4F7MB 2EIJB 1EO7A 3NDYE 5CR8A 1AD9A 3A67H 3WKYA 3SE4A 3GSWA 3ES6B 3SDCD 1QI4A 5DGQA 3H1JH 4DP1X 5IB4A 2F43G 4N86A 3G5XA 4NQSB 4Z0XA 4ZFZB 5I8OH 1N33B 5DYOA 2OX5B 3QS3A 4EUPA 4TQFA 3EYQD 4N8VG 3IKKA 4X6BA 1TO4A 2JJ1G 4GZRB 2CTRA 1T7VA 1HE8A 1U58A 1YNKL 2LABA 4IDLA 4RGMB 4UB0L 4MQTB 1Q90A 4YHKL 4Y2NA 2OT5A 3QHZL 4UNUA 5D7LE 5D1ZA 2FB5A 7TAAA 4KY1H 1IEBB 3SKMA 1QR1B 3ETQA 1OIOA 4LCYA 4A7SA 3B9KB 2B2XL 3D85B 4AOFA 5BJTB 3KL3A 5F9JB 4WHDA 1TQVA 4DGYH 2UZYB 2XQYK 5H4ZA 2A77L 5I76A 3ECBB 4HNAB 4WEEA 4XMUA 3OWRA 5GRUH 2LW1A 2E76B 4Y1SA 1VDGA 4FP8H 3QHFL 2Y4TA 2BY2A 5I73B 1OAQH 4OLUL 4F33B 1MLBB 2Y48A 1KCBA 1HDMB 2HHHO 2RBLA 3WKMH 4XMXA 3O9WC 4R0LA 2D3LA 3TBYB 3WAJA 3GMOB 4ZS7H 3RBZA 2BNRD 2VQFB 2RB8A 2Q9OA 3MACL 4KJQC 1HKLH 4FNPA 4IBWA 2ICWJ 2EIJC 3AMLA 4B3MO 5CJQL 3WEAA 5IKCA 1HHJA 1KP3A 5GRXG 4QRTB 2MQ0A 4FN0A 5D5MA 2QGCA 2XFGB 3VFSB 4CN6A 4CKQA 3D05A 5E9DD 2OL3A 4DCQB 3DMMD 3MLUL 1CTNA 2BSTA 2BSKB 5CLWA 5KJRH 1I53A 3U1SL 4YAQB 3NJXA 2HP4A 2ZAGA 2R9AA 2WNWA 3OKEA 1L6XA 1TZ8A 3BFWA 4G8EA 4J6RL 4FNTA 5FV1L 1JUFA 4QWWD 4AYFA 1Z1WA 1CXHA 2AQ3A 3ARFD 3MRRA 2HKAA 3F01A 2MPAL 2ZF9A 5LGTA 1DO6A 2VRKA 4PGJA 4PREB 3H9VA 2CCVA 2B9AA 1XCQA 3R19A 5A2FA 3UZEA 3N43B 3MV01 2QR4A 4KJWC 3LPGA 5I8KH 5EEUA 3W2DL 2UWEB 4N2GA 1N64H 4JN2A 3CPLA 4KQ4L 3EYUH 3TJHD 5KSAA 3RKDC 4KNUA 1K73W 3U46B 4JFFD 3U6RA 2ZWKA 1A6AA 1XD1A 1K72A 4L1TA 5IE9A 4XHQA 3PL6A 2DH3A 2BO0A 1VZHA 2XPYA 1CXEA 1QO3A 1XH1A 1GGUA 1NPNA 1TTAA 5C86A 4RMSA 3GVMA 1CFSB 3CDCA 5JNYA 2AQNA 3M86A 4LRNL 4POUB 3IKCA 2OMXA 2Q87A 5D1QC 1AGFB 3ALPA 1S5JA 1IBLB 4E36A 5AVVB 1GM9A 1OP9A 3RWGB 4HGMA 4L3EE 4JZNB 4KV5F 5DD5L 4QGPA 5IYDO 3G6DH 3PUUA 1N0LB 3B43A 3X3FH 4BH8A 4IHOA 3TFKC 2X3CA 2K8MA 3T4YB 3U6XA 4P59H 3VTTA 4X7SL 1H38A 4NO0B 4FADA 2X6AA 1MHHB 1EHAA 2CLRB 1P69B 4WUKL 1B4LA 5HHNB 4PJ5E 4UUJA 4EI5D 3EGXB 2WANA 2Y1ZA 2QKAA 3CU7A 1IU1A 5EOCL 3CIAA 2V3FA 4HT1L 4IU3A 4WTZG 1YMMB 4B3RO 4LCYB 4A67A 2P48B 3T3MB 3ZKXB 3FN3A 2PNDA 2LQTA 1AO7E 4XOAA 1N5YL 5C0ND 3MNVB 3OBAA 3G6JB 4X42A 5I9QB 1QLRA 3AJ7A 3HB3C 5C0EA 2JIXD 3N44F 4PI0A 1HYRC 4GKKO 4KH9A 4KPHL 4LEOA 3ZKMD 1RZ8A 5EIIA 5EPMB 3ARDB 5LCVA 4YNYA 5ID0B 4BH7B 3FB8C 2OMBA 3P3PA 4JDVB 1G87A 2P7TC 4B9CA 2P67A 2MOVA 5F7EL 5GZOC 1JA8A 1P49A 1KJ2L 2W92A 3H3PL 4NUPA 4XCCH 3EJYD 1KC5H 1KQSU 3GBNL 2V9TA 5CBGA 3RZCB 3QZWG 4XZ4A 3QJVB 1M9SA 1ZWIB 1LK2A 2MFNA 4DKEH 2HJLA 4PJCE 4YC2B 5I1IH 3IDGB 4KKBC 1ETB1 4UVBA 4NUGL 4X4XB 5TE7H 4W6XB 3AK1A 4NZJA 3ABZA 5DZJA 3U4EB 1JNNL 4M7ZB 4PB9L 1SVCP 2I60L 5DQDL 3KZIZ 1F4XH 3BP6B 4ZPVA 4AJWA 1G1KA 4YHYB 1AO7D 2EDDA 2PW2A 4KJPC