1QLEB

Cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
252
structure length
252
Chain Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE POLYPEPTIDE I-BETA
publication title The Cytochrome C Oxidase from Paracoccus Denitrificans Does not Change the Metal Center Ligation Upon Reduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/immune system
total genus 61
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 1999-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qleB02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1qleB01
2YAPA 3NJNA 3EH3B 2WO2B 2IWFA 2EIJB 1BAWA 1BYOA 1PZCA 1W6WA 3FQ1A 4HIPA 3T71A 3QJQB 1ZIAA 1WA2X 2H3XC 4E9RA 4E9TA 5ANHA 4FA7B 1W8EA 3MBWB 2UXGA 4KO9A 3X1BA 3QJSB 3GYRA 2IWKA 1VLXA 1BXUA 4KO5A 4E9SA 1PF3A 2J5WA 3FYIB 1EHKB 1GS7A 1X9RA 2CBPA 1AR1B 1BXVA 1V10A 2FT7A 2DYSB 1JZJA 2IDSA 1NINA 1ETJA 4G70B 3AG1B 5D4JA 3SBQA 4HCGA 3FSZA 2XXFA 4DP7X 1KCWA 1PNCA 1KV7A 2DV6A 5I5JA 3IEAA 3AW5A 4BDVA 1E5YA 1SFDA 3FT0A 5TK2A 4M4RB 3WKPA 1PAZA 1GR7A 2VMJA 1AZUA 2AANA 2I7SA 1XMEB 2IH8A 1PLAA 3EH5B 4PAZA 2VM3A 3ZDWA 2FQGA 3TASA 1IBZA 2ZXWB 1RKRA 4KNUA 1JZEA 1L9TA 1WA0X 1BEXA 3NJHA 3T6ZA 3T9WA 2BHFA 4HHWA 3FU7B 3PPSA 2Q9OA 1ZIBA 3FS9A 4AKQA 1RCYA 1MZYA 2JXMA 3ZIYA 1KGYE 4QKTA 2UXVA 2DY2A 1F56A 2HX7A 1JZIA 3FSVA 2N0MA 3UAEA 1ASQA 4AZUA 3OM3B 1KCBA 4YSAA 2XYBA 1GW0A 2EINB 5B1BB 4TXVB 1CYXA 5I5IA 3IN2A 3ASNB 4YSUA 4CSPA 4A67A 3AZUA 5B1KA 1V55B 1SDDB 2IDUA 1NIAA 2QPEB 1ZPUA 1SF3A 9PCYA 3KW7A 1NWOA 1JVLA 2OJ1A 4JHVA 2AVFA 3UGEA 3SQRA 2IAAC 1KBWA 2PP9A 1A8ZA 1R1CA 3DTUB 1GY2A 2PPEA 4KNTA 4E9QA 3UADA 2YXWA 3RYMA 4E9WA 3FPYA 1AS6A 2ZWNA 3PCYA 3WIAA 2AZUA 2BP0B 1XB3A 2XV0A 3PAZA 4A2GA 2LLNA 3U25A 2VN3A 5E9NA 3N55A 7PCYA 5I6LA 5I6MA 4KOBA 1KDJA 4AKPA 1GS8A 1NICA 1J9RA 1XB6A 2BWIA 2IDFA 3FU8A 2CCWA 3FU7A 5B1JC 4HAKA 1FA4A 1AZRA 2B3IA 3UAAA 5AFAA 4YSEA 3PAUA 2IWEA 3UACA 3X2QB 4DP4X 2BW4A 4UANA 2YAOA 1L9RA 3T6VA 1DYZA 5FC9A 2FQFA 2XU9A 4NAJA 4G7QB 1OCCB 1J9TA 4BXSV 2RACA 2TSAA 1NIDA 3N2JA 3NJLA 1TEGA 1DZ0A 2XLLA 1E65A 6PAZA 1AZNA 3AY2A 4UAHA 1X9UA 1HAWA 3MX0B 4EF3A 2WO3B 1SDDA 2MRYA 2QDVA 4DP6X 4HCFA 3H56A 4BWTA 1IKOP 1TEFA 2FT6A 5I26A 1SNRA 1MDAA 2GHZA 1BQ5A 1FWXA 1RZQA 4W9ZA 3EHBB 2Y69B 1BYPA 2YAHA 2YARA 3CDZB 1MZZA 2PP7A 4GYBA 1OCRB 2GC7C 6PCYA 4NERA 1MG3C 4GP8B 4ZK8A 3JTBA 1AS7A 3NSDA 4DP2X 4MFHA 2BP0A 5I28A 1JZGA 4DP5X 1AOZA 2BZ7A 3S3CB 1JXFA 5I6NA 2PCYA 4GY4A 3FYEB 1PNDA 1E5ZA 2W88A 3NJIA 4E9VA 5B1AB 1WS7A 2AFNA 1CC3A 3TBCA 1BQKA 2XUWA 1N70A 2PCFA 1CYWA 4N4YB 1SF5A 1ILSA 3ABMB 3T6WA 4G7SB 2CUAA 2NRDA 3OMNB 3CVDA 1HAUA 1J9SA 2IH9A 4P5SA 4AI7A 3H4HA 3CVBA 4DP9X 1QHQA 4WKXA 3NJJA 5F7BA 3ASOB 1BXAA 2GBAA 2YXVA 4A2EA 2DWSA 4YVNA 1ZV2A 2W8CA 2PPDA 1CURA 4BWWA 2PPCA 1CUOA 4CSZA 5I5MA 2VM4A 1NPNA 1JVOA 5IY5B 2QDWA 4FAAB 4DPBX 2FJSA 2PPFA 1PLBA 2BZCA 4ENZA 2H47C 2VSKB 4PCYA 3FU9A 3H4FA 1A65A 5TK4A 4DP1X 2GSMB 3ZX1A 4P5RA 3CG8A 3CDZA 2GIMA 1OE3A 4YSSA 2FTAA 1AS8A 2UX7A 3CVCA 4G71B 4E9YA 2HX9A 3NJKA 1A4AA 4F2FA 4GXFA 1AQ8A 5I6KA 4X4KA 3NSYA 2EIKB 5AZUA 1WAEA 1OE1A 1WA1X 1AACA 1PZBA 4DP8X 2FQEA 1PLCA 2EIMB 4DP0X 3OMIB 1OV8A 1ET8A 1J9QA 3ERXA 3AG2B 4GP4B 2HRHA 1KBVA 4L0PB 3L45A 4M3HA 2J56A 2OCCB 1NPJA 1V54B 2DWTA 2VW4A 3X1EA 4G7RB 1KDIA 1GS6X 2A3TA 4YSPA 4YVUA 5PCYA 1URIA 3IE9A 1ADWA 2E86A 3OMAB 1OOWA 1ET7A 3TBBA 1QNIA 3AG3B 1AZCA 1PZAA 4F2EA 1JXGA 2XX1A 4YSOA 3TU6A 7PAZA 2BP8B 4JHUA 2PPAA 3S8GB 4F7KA 1JERA 2ZOOA 1A4BA 2QPDB 2XWZA 3X1FA 5B3SB 3WNJA 1JZHA 3S3DB 2HZHA 2H5UA 2GB2A 3TA4D 1B3IA 1PCSA 1GYCA 3OD3A 4A2FA 4HZ1A 2XV2A 1OE2A 5F7AA 4A66A 4Q89A 1JXDA 3FQ2A 1SHXA 3QQXA 1IBYA 4RH4A 2UXTA 1AG0A 3ABGA 3QJTB 2CAKA 2FWLB 1ILUA 1M9WA 2PLTA 3NT0A 3NJGA 3OQRA 3WNIA 4YSTA 4E9XA 2J55A 2YQBA 1NZRA 5EHFA 2FQDA 3QJUB 4G72B 4YSQA 1BQRA 2VSMB 5B7FA 1UATA 2Y1AA 2R7EB 3NJFA 1AAJA 3BVDB 1IC0A 3ABKB 3CZUB 4KNSA 3IBOA 1SFHA 2CALA 2I7OA 3FPXA 4BK5C 1J5DA 3AG4B 2J57A 3QJRB 2YEVB 4DPAX 1J5CA 1NDTA 4N8UA 5B1JA 3WI9A 1MG2C 3BQVA 1M56B 3WG7B 5I6PA 1TKWA 2AZAA 2HXAA 2P80D 4KO7A 5B7MA 3QJVB 1A4CA 2BP8A 4YSDA 3DIVA 2VW7A 3NYKA 1XB8A 3UABA 3V9CA 1HFUA 4W1TA 4QLWA 2UXFA 1OCOB 1SHWA 1NWPA 3C75A 1NIFA 3IN0A 3PAVA 5LDUA 1PY0A 3X1GA 3JT2A 1TU2A 4UF7C 5D4HA 3WKQA 1IUZA 2IDTA 4AKOA 1AZBA 4GP5B 4K9JA 1PMYA 1W6LA 4BXVA 3S8FB 3DKHA 2BWDA 1E67A 2MTAA 2QT6A 1L9SA 2XVBA 5AKRA 4YSCA 2X87A 1NIBA 3S3BB 1I53A 2BW5A 2CJ3A 2OV0A 3G5WA 3GXUB 1A3ZA 1N68A 2YAMA 2VW6A 1ID2A 3FSAA 1AG6A 2GI0A 1YLBB 3T6XA 4A2DA 2FNWA 2WSDA 4WTQA 1ASPA 2R7EA 1OF0A 4A68A 4HCIA 2P80A 4BWUA 2XV3A 3NSFA 2X88A 4AX3A 1EZLA 4NB7A 3NJMA 2PP8A 2IDQA 5I6OA 1QLEB 5A7EA 1SJMA 2XX0A 5PAZA 2HLEB 1OCZB 3HB3B 3ABLB 2JKWA 1ZDSA 3SBPA 3FQYA 3KW8A 3V9EA 4JKNA 2YAFA 1L9QA 1GSKA 2GC4C 2Q5BA 4A2HA 2EILB 4YSRA 3EH4B 4KOCA 2TSBA 3X1NA 8PAZA 1ET5A 4KO6A 1WS8A 2FT8A 3PXLA 3SBRA 2XXGA 3GDCA 2HRGA 4HALA 3EF4A 2ZONA 3NP4A 2JFCA 3NSCA 2B08A 5D4IA 1AIZA 3PLYA 4BDVB 1JOIA 1ASOA 1E30A 1NIEA 3QPKA 1GY1A 3FSWA 4HHGA 1KYAA 1L9OA 4Q8BA 1ZDQA 3D12B 1L9PA 2BO0A 4YL4A 1AANA 1T5KA 1RZPA 1JZFA 1FFTB 2YAQA 5B7EA 4DPCX 1M57B 2I85A 2YAEA 3NP3A 1NTDA 3ZBMA 2UX6A 2DYRB 3HEIB 2HX8A
chains in the Genus database with same CATH superfamily
3HNSH 3VXRB 3F7RA 4QRTB 5FW6A 4HW6A 2EO7A 2PY5A 2UU9B 4JRYA 1R17A 4N2HA 1CVRA 2VDQB 2A4EA 1BXUA 5GRVK 4XCFH 3QO7A 1FYJA 5BV7B 3KXFE 2KG7B 3C60A 1JDCA 4ZPTA 3L3GB 1KN2H 5A2JH 2XY1A 4W4LA 3CCSV 2DQFB 3FQ4A 3TO2A 2A6IB 1XH2A 2QMJA 3QORA 1J95A 4R4BA 2Y69C 3SPGA 1JIBA 1GGUA 5D4JA 1PKQE 2P67A 1N6UA 3BVUA 5CWSA 3SE9L 4EUPA 3V6ZB 4GSXA 5B1NA 3W7WA 1PNMA 5DJ0A 1CD0A 3U4BL 5EO1B 4XR8C 3LS4H 4P49A 4E68A 1ETA1 4BDVA 1Z7JA 4M6MH 5L2KE 2XN9B 3WKPA 1X4YA 4U3JA 2JQZA 4CJ1A 3SEPA 5SX5H 2CTPA 1CPUA 1AQMA 2Z7YA 3ARGA 4ASUG 2R59A 3D06A 5ESAA 5TGBB 3AXHA 4YGVB 3I6LD 4JFDD 5DO2C 4NRZB 1JNHB 1DJGA 5C0AA 1CT8B 1MVUB 2FSEA 1WIUA 1TJGH 4P3WA 1WTLA 3T6ZA 1I1AD 2N74A 4K3EH 4ZYKA 4JN2A 1BLNB 4S0TD 3WLBB 4JPWH 2J8HA 1MN4A 1VADB 2EDWA 3O6FC 2J71A 1Q86W 3AXLB 3IJHA 4JRXA 1RP8A 3II2A 3A22A 3ZO9A 1OP9A 4GKJB 1QATA 4AZUA 4JKPH 3TT1L 2BIHA 1Q9KA 1X5XA 1G6RH 3R7RA 3DHMA 4P2OA 1TUPA 5BRZE 3FO2B 5HHME 1HZKA 4CS2A 1OPOA 2YD6A 3DV4A 4ZO9A 4K73A 2HN7B 5CB4A 3ZZLA 5I5IA 4U6XA 5TE6H 2DOCA 1W72B 2BXYA 2C1PA 3ULUL 3SY0B 3RGVD 1E4KC 2JIXA 4YX2H 4C83B 1WZMA 3II1A 1H2GA 3IYLW 2Y23A 4LFAO 3U46B 2AJVH 5KSAD 5FWQA 3VG9C 2DI9A 1IGYB 1EXGA 1SYSB 1MOFA 3EYSL 3H9VA 1FZOA 4W9IC 3X12B 2Q3AA 4GO8A 3ZYZA 4JO8A 3J07A 2X1OA 4TQHA 1I8KB 2PXYC 1R1CA 2ETWA 2CRYA 5EULV 3U7WL 3H1JH 3ULVC 1NI8A 4OZ4A 4AOFA 3PDOA 4U2ZA 4JPSA 5A16A 2HJKA 3CX5J 5I1CL 5SWZB 1FGVH 1MWAA 4DV6O 1J48A 2FWUA 3PAZA 3D3VD 2OXGA 2FHBA 4JM2A 2OMYB 5CU9A 4H8WL 2WTRA 3QG5A 1WIOA 4FC3E 5KYUB 5HHVL 4QHUA 1I9JL 2NZ9C 3LH8A 2QVTA 2WN2A 1DGSA 4POZD 3HBPA 3IK2A 3Q2WA 1WZ1H 1RIUH 3LDBB 4OU3A 5CLXA 1FA4A 5B39G 4DR1O 1ADQL 1OCWL 4DEPB 1LEGB 4K2UL 1KGUA 1BJMA 3SE4C 4M48L 3UJJL 1FSKB 1FZMA 1ZE3H 4MX7A 3ARDC 1I9RL 1ZAUA 2DQHL 3L3OA 1DYZA 1SLVA 3IDJB 2ATKC 1SHMA 4F3FB 4JVWA 4PA3A 1L0YA 4XBPB 3QJOA 4X6CA 4LLVA 4XO8A 3NPZB 4ZFOL 1FI8C 1O9HA 5JHDA 5J9PC 2HTKD 3F58L 3REWB 2GK2A 1ZTMA 3BVNB 4A7UA 3TTSA 5I1AB 4ES9A 3V9FA 4HWBA 4X9IA 4LCWD 5LXGH 1BJ8A 2ZUUA 5A2KH 4OZGB 2CKBA 3VH8A 4A2LA 4XMWA 5CD3A 4GG6E 2F43G 2ZNJA 2Y4SA 4BWTA 3IDNA 4O2CB 4M5ZH 3I6KA 2Z5UA 4FJCC 3D39B 4PJAF 4RZCB 3FQUB 3MV9B 3QZNA 1WLEA 1BYPA 3EBGA 1ZLEA 4GRWE 5IT2H 4NFCA 5J3HC 1EEUA 3ZE1F 3K6OA 1OCRB 4A6YH 1QEWB 2C4XA 1IX2A 4NERA 3BUTA 4QLRA 3T1FA 2DM2A 2V5YA 3BP7A 5JPNB 4QRPE 3D33A 3JTBA 1MNUH 4Y4HB 2AW9A 3NTCL 2BP0A 4RMVA 1C5BL 4ZAKC 4JDVB 4AC2A 1BQZA 4K55A 4XX5A 2AXWA 4XN7A 5CGYC 4HUWA 5CEXA 2IAND 2ARWA 2ZF9A 2ZJSL 3P4NB 4YJ3B 4Y5XC 4K9EH 5C9JA 1TO5A 1IBGL 3RU8L 2NY0D 2PCYA 3V52H 2GV9A 3QDMD 3VVWA 2EKJA 4KUZH 5TE7H 1C8PA 3EW3B 5B1AB 3UTQB 1FVCB 4W70A 2BHUA 2A77L 1ACYL 2NXYC 5KA6A 1BHBA 1BZ8A 3BEWA 3GHEH 4PG2A 4Z7OE 4E2LA 4QRUA 5EU4B 3CZNA 2NRDA 3K0WA 1WZAA 2RTTA 5IYBO 1IEAB 1CU4L 3RWHA 2EYRA 2O6EA 4F37F 4YZFF 2IH9A 4AI7A 2IOMA 3IMTA 1WFMA 3OZLA 3KPQB 3VFPB 4DP9X 4GKSB 4HYTB 1NOFA 5BJTB 5DUJA 1KB5A 1MUJB 4ECNA 4V2CB 1LO4H 3G67A 5F7NC 1FZKB 2EXWD 1QP1A 3HCVA 1KD1W 4NDMB 4Z3EA 1T5XB 2ZCKL 2P52A 3IRCA 1ONQA 1MHPH 3GEWB 4ICWA 2JK5A 3T3ME 2EDDA 1LQSR 4NUGH 1E9PA 2P28B 4ZOAA 3RUGA 3C87A 3IPBA 5AKTA 2AGJL 1TZAA 4PJAB 3RTQD 4UNIA 1CL7I 1KTLB 2WXJA 3CFKA 1GRJA 4IMLA 3O4OC 5JW4R 4LNRB 4JI5O 2V5RA 4ZSOE 3ZE1B 5A2LH 4PJFE 4JASA 4AILC 1MI5B 3LPOA 4FYRA 3D0VB 2IPTL 4ATTA 5FYJU 1AS8A 3PWVB 2OI9C 4JY6A 1X7QA 1BZ7A 3FQTB 1OV9A 1QPKA 4OGQC 4WK4B 5EOQL 1LP9A 1UB6B 1P7KA 1UH2A 4WW2F 4NM4H 3C08L 2HLAA 3I75A 4FLSA 4N0UA 2QKCA 4TVPL 3IETB 2QGCA 4HK3N 2L7QA 3ZRFC 5EZJA 1Q1JL 2P8PA 2Z31B 4GBXB 5C07B 2BNUA 1QI4A 4PJEF 5IVZB 5KTEL 4PGBA 2NQDA 3TH2T 1WPXA 3NFPA 3IC9A 2E56A 4F6RB 1EFXB 4WHYH 4IRSA 4F2MB 2GJZA 3LPPA 4YVUA 5F2VO 1EO8L 1EUTA 4MQSB 4XP4H 1L8DA 5DR5H 2QADB 3H9HA 5K1JA 5KX5B 1ITCA 2KMWA 2XFGB 1P6FA 1ZS8B 3MA9H 1J86A 1DQLH 2FEEL 2J2ZB 3MZGB 5DQDL 3VFUA 3HZKB 1DBAL 1DN0A 3RNQB 4XXDA 3QQ9C 4YSOA 1JERA 5E00B 2P24B 4X7SH 5DHVA 5T1DL 2YXHA 4DTGL 3QPQD 2NY4D 2V5MA 2WXRA 2VZVA 2ZM6O 4KY2A 4CH3A 3E7JA 4LFBO 4D94A 3ZPDA 5I1JH 3MU3A 3JD2A 3P02A 4CU8A 2O57A 4L18A 4MA7H 3BSZL 4QTHA 4KZDL 3CC1A 5IB3A 1G7MB 3QQ3B 4A66A 4MDJA 5F7UA 1T89A 4LSRH 4HPOL 3QQXA 1AI7A 5EBMB 3UX9B 1DF4A 25C8H 2HJFC 4DGIL 4FQJL 4LFCB 3Q01A 3VFSB 4HGMA 5C0AE 1AY1L 2WQVA 5I30L 1ZGLP 1MW3A 4RZKA 3NT0A 4WW2B 3OQRA 3WNIA 4GRMA 1KJ2B 4LCUC 1C7SA 2VLJB 3L5JA 4LBAA 4UYPA 2ADFL 4HA1A 3WHXA 3BCCH 2DQGH 2QBWA 2QTEA 1I94B 2FLMA 1GL4B 4JRXE 2XTLA 4DKAA 1MRFL 4W9DC 4APQA 4XPAH 5C0JA 3S48A 2NR6C 1IC0A 4PJEB 1TNNA 3SYAA 5TFSL 4P9MH 4KXRA 3MJ7A 1J05B 3TJTA 5IOKA 5GS0H 5E2WL 2NW2A 5LP6A 4RGNC 4F91B 3CK0L 4ZW8A 5A6LA 2AEOA 5TD4A 5FAAA 3RVUC 1NT2B 3CC4V 3P3RA 3GF8A 1NDTA 4XBEH 4BA0A 5K1VA 2WUBL 3R66A 3UCSC 3B37A 3CPLA 4GKKB 1YVWA 1RM1C 2MPAH 4YIQA 4AM0B 3B2UD 2QL1A 4L2YA 4JX0A 3O0RL 1Y7VA 2P1YA 2PO6B 3C5ZD 4PJGF 4F7TA 5LA6B 4PA9A 2A6JA 1XB8A 1YQVH 1NQTA 3UABA 1E79G 4X4XA 3GMRA 1PTZA 5L3BA 1NAMB 1QUNA 3ATEA 4LLDB 1XBDA 1UT9A 4GUPA 5GJTH 4NO3A 1OAXL 1BVNT 3IN0A 4GLXA 3I9IA 1G94A 3OHMB 4PGEA 3CFIC 2HFEA 2XT1B 2E47A 1U3YA 4B3RB 3SGKC 3VNYA 2ZNIA 4X6FA 4B7EA 5LG1A 1RFDH 4R84A 5JORA 3WB0A 4OCSH 3K81A 1XGTA 3KHOA 4PSRA 4MVSA 5JXAH 3B77A 2OXHA 2K9PA 2BVQA 4MAYD 2R1WA 3RX8A 4J7JA 3GC3A 4MVOA 3HNSL 3T09A 4F7EA 3R65A 1SXSA 3P30L 5EC1B 4KDTC 4JTDB 2I9TA 4HFUL 3RY5A 1UJ3C 2OSLA 4JFXA 1GGBH 5A43C 4N2LA 4F57H 1KTCA 4N20A 2YEZB 3T3PF 1ZHBB 2JB6B 4X6CE 1M1XB 3OUFA 2KDYA 2ZYHA 3HPLB 1SJMA 5HY9A 4CH6A 5JHDE 4B3VA 3KGUA 4WHYG 4EI6A 1MHEB 2YPVA 3SDYL 1IJNA 3UTTB 4MHHI 3U6RA 3ABLB 2X4TB 1PY9A 3HVNA 1G9MH 3HA0A 4PEEA 2WLKA 2EJ7A 4QUOA 1BM7A 1K4DC 1MSPA 2I26N 4G6KL 5EK0A 1F8TH 4LEOA 1D6EA 1GRWA 4KY1L 4XTRC 1H15B 3MLPA 3VXPB 5MEND 2BOCB 4N24A 2ZE8A 4PJGB 3OKDB 5CMAB 4YHNB 3UM7A 3EFFA 3PV6B 4U7SA 3U36B 1QRNA 1MNGA 2YBGA 2ADIB 2UUAO 3TK1A 3FQRA 3HUJA 4M6ML 1LTXA 1KGWA 3LIZA 2XXGA 5DD3L 4WFED 2B59B 2CD0A 4LLQA 3VFWB 4R96A 5DWPA 4X1KA 2AQRA 4OLZH 2JLPA 5JW4Q 1FV1B 5LXVA 2KQMA 1ZOXA 1VAHA 4AE1A 3QEGL 3SPIA 2XHBA 2Y7MA 2BSRB 1Y1DA 2CH7B 2TAAA 3LPWA 4G7VH 4KQ0A 3E86A 3BPNB 4OCNC 4DVRL 1M9NA 1XEUA 4JLRB 5MEPB 4Q9QL 1T5KA 2QMKA 3QUGA 1IU1A 2R70A 1OW0A 5CKAA 4UVBA 1NDGA 1FKAO 4JI6O 1ZKAA 1YTFD 3SGEI 3OTOO 1LDSA 3QHZH 3ETEA 4FG6C 4DV3B 1FJGB 2COVD 3NIGE 1OB0A 1SYVA 4WFFA 3T3PB 2GTZB 3NJNA 2UXDO 1G6RL 3SCMC 4DJMA 1W2BU 1SEQH 3HKBA 4OKDA 2EDHA 3DIDA 4WAFA 3KPMB 1NCJA 2OW7A 2VLKD 2H3XC 3QWOB 4E9RA 5FPIA 2Y0PA 1MG1A 4WEBH 1ZHKA 3JVGC 2Q7HA 1PPIA 2IWKA 1UWXH 4I87A 2WV3A 1NCUA 3SKMA 4E9SA 2QVFB 3PJNA 2NY2B 3BP5B 3EGDA 3RUGE 5KYXB 5T3ZH 3N44F 4KK9C 4M6NH 4LPUA 2FT7A 4P3DA 3VUAA 4X6BB 4AIEA 4WWKB 2H2SD 4ODVH 2C8NA 1WBZB 1GO3F 1CBJA 2IXQB 3NIDF 5L6YH 3LKSA 2KYIA 3KPSB 4RFNB 2QFRA 3PJSA 1GIGH 5KN5B 2DN7A 3ULSA 3CJHA 2IPKA 5JZ7C 3O41B 3UPRA 4NRYB 2XPZA 4EIBA 5AVVB 3FTSA 1QR9A 3IGUA 4Y4FC 2QQQA 4KKQA 4Q56A 1JRHH 2MK3A 4N0UE 2PTMA 4NHUA 1UPGA 4I9WA 4IIZA 3TXAA 2VMJA 4PG9B 4Y4KA 1NCTA 3VI4F 4PGJA 5HYJD 2DWEC 4R7DB 4WI0A 2VM3A 1U41A 4H4NA 3ZDWA 1WZ1L 2CJUH 2A3QA 4K3DH 1P6WA 3SODB 3ZO0A 1KY6A 2ID5A 3V8CA 3BQUC 2Z6FA 5GGSA 1OK8A 1ZK9A 4PMEA 2I69A 3T9WA 4XB3A 1D2PA 2GY5A 4XRCA 5I8EB 2F54A 3BGFB 4GKZB 4HJ1A 3MUGB 1E0OB 4YC2C 1X7SA 3RWEA 3BLPX 5LNEA 2DI8A 2N0MA 2XWRA 4F7MB 1RZIA 2PW1B 4NQXB 5DHXB 3RX7A 5TDPA 4UCUA 1JF1B 3UKMA 4FKEA 5LXGL 4RIRA 2FGWL 5K9QG 3D9AL 4CC1A 1PL3A 3N44B 1WGOA 3IFXA 3AREA 4AXWA 2KI6A 1AQHA 4I0XB 2D8KA 3DVGA 1H0DA 3PS6A 4GKLA 4MSWA 2BM3A 4YE4L 1W2KT 4MXWH 3UTSE 3NIDB 2EAEA 2P7TB 3QUMA 2EDJA 3K1DA 3MYJB 5IT2L 4NTWA 1NANI 3BVVA 2MOGA 9PCYA 3KZ8A 1NWOA 4XI5D 5E7FA 5BXFB 1M42A 2I5YH 4I7ZB 3KPPA 2JIZG 4N0YL 1VGEL 1R5VA 2AHIA 2PP9A 7FABL 3WN6A 4TQ8A 2ZCLH 4KNTA 4WO4C 3QP3A 3VI4B 1ZLUH 3RYMA 2ZKHL 1TMQA 3FPYA 4M8QB 3DX9A 2JB5H 4XVUD 5I0DA 3HKEA 1F1DA 3G5XB 2I32A 4KUZL 4PJHE 3CP1A 2MQGA 1EDQA 4HSAC 1JV2B 3KDPB 1IC7L 5C0DA 2YI9A 1K9MW 2QKSA 4BH7A 1JF6A 5F89A 5F1NB 1U3HA 5ISZA 5L0QB 4PRAB 5DFVD 2C1OA 1BPLB 2BVPB 1E8XA 3LXBA 4JFOA 4FQXD 4M9OA 3ZMEA 4BQCA 1VSCA 4I2XA 2IU3A 5HHOD 1WUZA 3GSWA 3AS2A 3TBVA 1Z9OA 3TNMB 2PCFB 3MLZH 1NMBH 2DWDA 2RIKA 1DP0A 1W72H 1F3RB 3V0WL 2VDOL 2BP3A 3QAQA 4Z7UF 2K78A 4AH2B 4HULB 2OYLA 1SGKA 1S8DB 1K2DA 2WQXA 3DX7B 4QOKD 4J1UA 2XU9A 1IKFH 1A7QH 3DXAD 3ZT6A 5AYQA 4OZFB 1S2EA 4D9RE 1FVDA 1FYTB 4PJDA 4Q6GA 1Q9WA 4AKOA 5HHNB 2O5XH 4HWEH 5D93C 4NI3A 1SA0B 4O58H 1JVMA 1XCQA 4PRID 1AZNA 2XWJA 3AU0A 4MJIA 4BQ9A 2X1XR 4X65O 2DL9A 4Q9RH 1XMQO 4LHQB 5ECGA 1TEFA 5FCUL 5JW3H 1T22B 12E8H 2NUPB 3ML9A 2Y69B 1MFAH 1I85A 3FQWA 4RMWA 4W6YB 4NM4L 5L8KB 3HI1A 3BH9B 5FUCC 3AQYA 4AQAA 3CCEV 1L9MA 3FMGL 3ZIMA 4DF9A 2HKAA 4C47A 5EZLB 1KP2A 1GC1H 2FX8H 3NDYE 5E23A 2Y4UA 1VIWA 1QZ1A 3ZKND 3T4AA 3V4UH 2P8LB 2Z34A 5DK0A 4CN1A 3KXFD 1LWHA 3CXDH 5LXTA 3ILQD 3ZJZA 3IDUA 3QR0A 4D7BA 4FLWA 1SQGA 1M05B 1NGQL 1WAAA 3HN3A 4H8VA 5FKAA 1RZGA 3LNIA 1E5ZA 5FFOA 2RN9A 3RL1A 2K3HA 3BN9D 4OVUA 3IBEA 3QO5A 4OIFA 4AITA 4E2OA 5DMKB 4ZMVA 4KNQA 2XUWA 2EX3A 1DQLL 5G4MA 1CYWA 2R9RB 3ABMB 4Z7UB 3TIEA 4IU3A 1TQSA 1KTDA 4WHTA 4OAWA 1CGXA 1XR9A 4X88A 4R7XA 3RVVC 3A2FA 5C8YB 4ZQKA 1QRNE 3TJHD 4Q9CA 3UBXA 4K94L 3L5IA 1JTOA 1WWBX 3HUJE 3O6FB 1OSPH 5AYUL 2VUYA 2FUTA 2XWBA 1ESOA 2RR3A 4X64B 3O0LA 5ITBL 4FK5C 1UXWB 1F5WA 3EYQD 3PGCA 5GGRA 4F4LA 3QIWD 3NAAL 3LXUX 3NPSB 4JFHE 3CSXA 4K8XA 4FZ8H 1GTFA 4GW4A 5FB8A 2JEUA 1YN7B 1V8HA 5HDLA 4NQCA 4G1MA 2N7SA 1XZWA 5IMMA 3B3IA 3LEVH 5ICZA 5D7EA 3ICXA 1JGDB 3CQPA 3H1LH 2Z1KA 1ITBB 4WU5B 2FGZA 5LVEA 3C6SB 2DQGL 3T4YA 3QCUL 3RI5K 4WTZG 2DQ0A 4XPAL 5BRZD 5HHMD 3WKMH 3S5ZA 1TZHA 2ZX6A 4WFFE 2V2WA 4QPEA 4UMGA 1AZZC 2PXYB 4Z7VA 2UUBB 2BK8A 4G6FB 3TN0A 3K04A 3BAWA 3RIAK 5GS0L 2YPLA 5D8JL 3HKFA 1G9EA 3DTDA 4RDBA 4DP0X 3SYCA 5INCA 1XDCA 4CC5A 4ZW3A 3QQNA 4GW5A 4U3XA 3OJDA 3AQZA 4ZD3H 4LRNH 1BHAA 4W68A 3PHOA 4FNLH 4OGYH 4HMEA 1OAQL 3GM8A 3SOTA 1SEBB 3V7AG 2LFGA 3MFGB 5JYLA 1WD9A 3AAZB 5H8DA 2OZ4H 5SWQA 1LE9A 2F19L 1YPZF 1KJVB 1TZIB 4U3SB 4NTYA 4JHAH 1JK9B 3HFMH 3IXTB 5GGUA 1AZCA 5D1ZI 3ZK0A 4W9JC 4WFAV 3FFCA 2XX1A 1L7IL 3ARDB 1FRGH 4ZMOA 2VQ1B 4JI2O 5E6IC 5GJTL 2LFEA 1HESA 2XG5A 4RFEB 4C56A 3WNJA 4ELMA 1JZHA 3HS0A 4W9CC 1F3DH 3BZFA 5J9PB 4G9DB 3VYNA 1K4CA 4I9WE 1U8IA 3ES6B 4GAFB 4KFMA 3JV5A 2HH0L 1MAML 4KBPA 5D5MA 5E0QA 3HR6A 3L81A 1JL8A 5JXAL 1W9XA 4R97C 4LFCO 1N4XH 2EEXA 5T1LB 1K92A 3ZR5A 4TOYL 2CAKA 1P6AB 1YO4A 1TTRA 3KBEA 3PXHA 5H2BB 4K5LA 4X7TA 5L9DL 1GW6A 1EDHA 1PYWA 1QO3B 2F54E 2FQDA 3FTUA 4N8VA 4OF7A 5FWRA 1GGBL 2PYEB 2QV2A 5E4EB 5DSCB 1U8MB 1T66D 2KC0A 3ESNA 3T1HB 4J4PD 4XCNB 4O2EB 4GW1A 3QULB 4UTBL 3TETA 5AYTA 3TO4A 3VFRA 4JGSA 3QWQB 2EYSA 2XZQL 1I4FA 4I85A 4RA3A 1M71A 2IQ9H 4L4VA 2MW2B 3OUSA 4FLOA 4HHAA 3CLEL 2HVKC 3STLC 4LVNB 1CFQA 1WH0A 3HE6B 1VFBB 4OV6F 1CTMA 2NY5L 3LKRB 1YPZB 4L5FE 2VQFO 2WAQA 1DJZA 4O5LL 5T5NF 4R50A 3FJTA 3ZE0E 4DAGH 1N0LB 4H13C 2NXYB 5A6IA 2V7HB 3OWEA 2B1IA 3ARFB 3IAYA 2X6AA 1TKWA 3NZ8B 1XGYL 2VL5A 4FYQA 4ZS7H 1KG0B 4PP1D 5I5RA 1A4CA 3CXCU 1JGUH 1K8IA 1QSFD 1PX4A 3VSVA 5CD5D 3T65A 3K7UA 3OZKA 1NH2B 2ICEA 5SV4A 4HNAB 1IAMA 5KYWB 3BO8A 1NDMA 3NACL 1I1AC 4M6OH 3QNZA 5I17A 4X20B 1QFWI 3W7SA 2O6CA 4ZRGA 3K71A 5JDJA 3WAKA 1KJ2H 5LNGA 4HJGA 3QXWA 3MNVB 5DEZA 2QM4A 5IUCA 4XC1H 2RJZA 3E6FB 1ZGLB 1TZ8A 2VR8A 1A32A 2Y4TA 1X5ZA 2ESVA 1AZBA 5E2UL 3MJ8A 5DRXB 5FYKU 4ZMQA 1AQKH 1KPVB 3MRGB 4BXVA 4X1IB 4XOBA 5DRNB 3ARYA 4WEMB 3PHSA 5SWSB 1JPEA 5C6TH 1R6TA 1C16A 1KUMA 3O4OB 5EUOF 2OJEB 2CJ3A 1J1OL 4ZODA 1LNQA 1FXKA 1JX9A 2OIGA 4U3CA 5TQ0L 4GZRB 5D2NA 1I1YB 3SPVB 2E7LC 1XF5A 4WCYH 2R7EA 4U7NA 4X5WB 1OAUL 2QHRL 3RGVC 5CA1A 3E22B 5DM6V 1NCWL 3CZFB 3O81A 2FWOB 4Z18A 5GONB 5KSAC 1RUML 2FJHA 5I8CB 1JF5A 2JV6A 1K3IA 1XOUA 4NZ8A 1KYOK 3BRDA 2C7FA 1Y6XA 2WBJA 3HR5A 5CIPB 1T1ZB 4PJDE 3HRZB 2CZNA 5GJSH 1H5BC 4K8ZA 5CZVH 4DV5O 5FLUA 4HAMA 4LBEB 1UM4L 1ZANL 4M6NL 1ZDSA 2WLMA 4XDLA 1QVOA 4X2UA 4PY8J 3ZJAA 3CCQV 1NAMH 3MOQA 5LBSH 4C54A 4HIIA 4ZPVB 4Z7QF 4WEEA 1MPAH 1GIGL 1OGPA 1S9YB 4GMTH 3HMXL 3WMSA 5HGBA 2YIHA 3NESA 2EO1A 1GAFL 1UT2A 2K9FB 2P9RA 2WIIB 1ZUQA 3R06B 5DJCB 4U31A 4YSRA 4XNXL 3MCLH 3ETBJ 4LCYB 4POZC 3HB3D 3WENA 2WB7A 1JRHL 4JMNA 3GJFB 5I1DB 2UUCB 1KXHA 4FI6A 3MLXH 5FF6A 3NN8B 5DMIH 3WEOA 4O2FB 2JRIA 3I5DA 3POHA 1GY1A 3T77B 4NVPA 2ZTBA 1G0XA 1FN4A 3CBRA 1ORSB 4IOIB 4YGVA 1WAAE 4UVCA 3MUZ1 4J9ZB 2V37A 1CT8A 1A1NB 3QORD 2GBVA 1P1ZA 5EUOB 3CDYA 1YEDB 3IJ7A 4DVBB 1I5XA 1HXYB 2VDQL 1PG7L 4PJ7A 2Q0ZX 2HTKC 1UQSB 5F1IA 1FFTB 3WLBA 5BV7L 1WB8A 2GUYA 3B7YA 4Y5YC 3VRIB 4JO1H 4LKCB 4OCRL 4JZJC 4BGLA 3L48A 2V7NB 3AXLA 4HVBA 2H26B 4PV8A 4QJFB 4LCUB 3OR7A 2WLIB 2ITCB 3HEIB 2Z91A 1YJNV 5MP6H 4NJ9H 2F58H 2WO2B 3SDXF 2EIJB 5A2BA 3VW3L 5D1QE 3SGDI 1PZCA 3NZHH 3FTVA 5LBVA 5IQMA 3DX8B 2ZPKH 4BJLA 2ZWKA 2APFA 4ETQB 1WA2X 5JCOC 4N68A 1AMXA 3NEEA 4XNYL 5HXMA 1UUNA 4YQXH 5GRJL 2G9HA 4CGUB 1ZGLM 3V4PL 1YMMA 3L7FA 4DR5O 3C6LC 5C0AD 3GBLA 3U46A 1WISA 4Z7QB 1LR1A 2VOTA 4OJFH 1GMIA 1IL1B 4X62B 1V10A 2X4RB 1AJQA 3QG6A 4RGMB 4NQCE 3X12A 4IGBB 1XIWA 4YHZH 4JRXD 4MQTB 1T1YB 4OFYD 1S7SB 2WMPB 2ZCLL 3SDAA 3RIKA 4QO1A 4XN2A 2EQDA 1ECYA 1NBVL 4MB5A 2DJVA 4P2OD 5BNXD 1FXVA 2AK4A 1S7RB 1FPOA 3I50L 3RGHA 4K71C 4NZRH 5IB1B 4QHLB 2YPLE 3WKYA 3ABTA 1QHTA 5AZ2L 4JFTA 1RPUA 3TWCH 2WZ6A 2JIXD 3TZVC 5IB5B 4ATWA 4NLAA 4LR3A 5B3NA 1OARH 1CFSA 3P4MB 3GSUB 4JFEA 3DRQB 1RJYB 2EXWC 3B34A 4PJ8A 1N5YH 1LEGA 1ZEAH 1NMBL 2BZDA 5F6HI 2ZOWA 1U3JA 1H8LA 3SKNA 3SDXB 4H33A 3N2KA 3W0WB 4K7PY 5A40E 3RTQC 3VXMB 1FJ1B 2IVFC 2R4RH 1IKFL 2L8AA 2KERA 4OCXH 3MLYH 4N9OB 3ZIYA 5KHKA 1OCOC 1MLBB 3FFCE 4HS6B 4Y2DA 3W37A 1F56A 3ASOC 1TXKA 2ZOLB 1IV8A 1MFBL 2WB1A 3ARWA 3FSVA 5F0PB 4C56E 4F7CA 1W0KG 3LXCA 4NYLB 4QHNB 4YSAA 5A2QN 1FQ9C 4ELME 2R1YA 4JM2D 3FCTB 2VJXA 4OZGA 3NXSA 5DS1A 4XODA 3WU2Z 3E3QC 1JZ6A 1ZK5A 4WI5A 1RSFA 2COQA 4IHJB 4PJXA 3I02A 1CXZB 4EFBA 2H6PB 4Q9RL 1UD3A 4HBCL 2NLJC 3GK8H 5CLZA 5BQDA 5F1KC 2HT2D 3I55V 1K4DB 4RZCA 2B3RA 4CSPA 5D5ME 2WQSA 3BIKB 4H5SA 3ZYJA 2LGNA 3DV6B 2V9TA 1V55B 3BAEH 4RWHA 3S36H 1RK7A 4B60A 2G2NA 1U8KA 3DOSA 2YMOA 4ZO6A 3UT5B 1F1AA 1QFUL 2GJ6E 1Q0YL 1SY6H 3FCSB 3V4UL 1INEH 1WWAX 1S5JA 4JPRA 3S35X 3V0FA 2ZSWA 5KVFL 4QGTA 2QWQB 1IM3B 4NS0A 3VE0B 3WN5A 4BKLB 2BSBA 4WDIA 4NBXB 4KRPC 2P5WA 4FHBD 5EU6D 5DJXA 3CFBA 5GISL 1NAKH 4L4VE 1T0MA 4F20A 2PUQT 4UOZA 4UQ2B 2VXTH 1SJEB 1MJJB 2X41A 2ZE6A 4MA8H 2OJZL 3O6KH 1L5GA 1WO2A 2IG2L 3QPQC 2NY4C 4FABL 1XVSA 3IMVA 4DKEL 5EU4A 4FLUA 3ZN6A 2B4CH 4A5UB 4WBNB 5IJBC 4HJJL 2OM5A 1XHXA 4JTCB 3HZVA 3PP3K 1JUFB 3VFPA 3KJ6H 3KPQA 3OAZH 4M62H 4PTTB 3APDA 3EOTH 2GDSA 1IM9A 2VXVL 3GMQA 4LCCB 4UT7H 3VFOB 4Z3JA 2LTQC 4DZ8B 5T3ZE 1FVEB 2APBA 5I19L 1T5XA 5D5QA 3SCMB 5IK3B 5KBNC 4JI8B 2X42A 3RVYA 4I1PA 4U6TA 3CS5A 3PG2A 4J39A 1EVUA 4UM9B 4FFYL 3ULAB 3Q9QA 5E8PB 4C8XA 5FYJH 5MEQA 4H26A 1HAWA 2K8MA 4JPVL 2ESVE 5E6ZA 2HFGH 3D51A 4FJ6A 3C90A 3DOIA 2ZP9A 1VEMA 4X9YA 5DQ9A 1N3NB 3MRBA 3QUXB 2P43B 3VGFA 1OM9A 2BIOA 4W9ZA 1F7YA 3CLFH 5F9DC 4F15C 3HKCB 4X5LA 1JHTA 4AVKA 4Z1MG 1RULH 5D2NE 1DVUA 5CCKH 4MJ6B 3REVA 5JW4N 5D6DA 1PG7W 3IETA 4NJAH 4RCAA 2VH5H 3P1VA 3RNKA 4CS4A 4LASH 4MMXA 4WFHE 2AI0L 3MNWB 4Y4FB 1QBML 3C5ZC 4ODHL 2ZSVA 1XZ0B 2A6DB 2XPGA 4LRNL 4XH2A 3LHAA 4CC4C 2LJ2A 2BFGA 3VFTB 1IIIA 3O6ML 2WQAA 2C9QA 3O3BA 1G84A 1KIUA 4YPJA 2OZ4L 1S5IL 1CC3A 5IB4B 4OZFH 5JHAA 1ZV5A 3BESR 1HIML 3HFML 3BQUB 3BZ5A 3RNQA 3MRRA 4TNWK 3ZRCC 4DNLA 4AQYO 5KVDL 5HGHB 1SDYA 4LP5A 1FRGL 1Y18B 2J5LC 3G4SV 5L88L 4HLJA 2WLLA 1PG7X 2AXFB 3BFOA 4K7FA 5CJQL 4HOXA 4UTAL 3CB2A 1DSWA 2XN9E 4PW3A 4YC2B 5JHLL 1H3TA 4QIWF 5C0IA 3L1OL 2GBAA 3CRRA 3RYFB 1BFVL 4MAYC 1BPVA 3DXRB 3B7UX 1W0WA 3VVVA 3TOPA 4MD0A 3SE6A 2OT5A 3EFFK 1VIBA 4IRSD 2GJPA 3TIDB 4PREB 2XHNA 4NGHL 3CN2A 5DHYB 3CMAV 3VFSA 3HZMB 3U4AA 4LF9O 3ZL4H 4TL5A 2FJSA 3ZEDA 4H25A 4P8QA 3W9DB 1EHAA 4PWGA 1ES0B 1NBZB 3FHEA 5GRWA 1KJ2A 1PLGL 1IEBA 2BSKB 2CRZA 3G71V 4O4IA 4WTXA 3AROA 2B5IC 4NC1E 4OI8A 4O2BB 1KGIA 3P0VL 4PBDA 2HX9A 4ONGH 2BNRA 4U1NA 5I1HH 1CYGA 1DO6A 3C09C 1T5EA 3FONB 3P9LB 4X4KA 3CRAA 1AQ8A 3U1PA 4KKZA 1T83A 3LN9A 3FAXA 3BD3A 1RERA 2GHWB 4UZSA 2XFXB 5FNVB 3LB6D 4D0CB 3O9WA 2FX7L 2QSCL 3H3PL 4ICGA 3TFKD 1Q94B 3UTSD 4GI8A 1DVYA 4M1DL 1JWMB 1OP3K 1AO7A 5BPPA 4DAGL 1JS4A 2LVEA 4ANKA 3ZCCA 4FI7A 4TLUA 5JIHA 3U82B 1QYGH 2JI1A 1C1EH 1MCBA 1W91A 2X9YA 3KL5A 4G42B 2X7LB 1URIA 3EYFB 4RFOL 3QDJB 5FKPA 1A9BB 1U8CB 4NP4H 4TUOB 1I3RB 1F4YL 4KKBD 1SQVH 1JG9A 3JYBA 5F7FA 1DE4B 2E74C 2EILC 5LBSA 5JDSB 4Y2OB 3HLKA 4M6OL 2BOBC 1AJ7H 5ESVB 5E8EB 5SWZE 1XF2B 1FFPB 3L1GA 4ADGA 1TTUA 3ZN1A 4MMYB 2ZE0A 5DRZB 1KXQA 1TUBA 1Z2KA 4IQHA 5D93B 5B66Z 4P2ZA 3GXIA 3PJSK 1GYCA 1MHCB 4HF5H 4HD9A 1YUKB 4ONFH 3VYOA 2XQYA 4CUCA 4OB5L 2KB1A 4JAVA 4QTIL 5AWNH 3WS3B 4HLEA 4PJ0Z 3HKDA 4JFEE 2LGWA 5A6MA 1TU2B 2JJSA 2GJJA 3VXSA 5LAPA 2CR3A 2AXJA 5HHPA 5D1XA 1U21A 5T8IA 2BIIA 1T80A 1PSKH 2HVJC 4IJ3C 4KHPB 1CZ8H 2YQBA 4PLOB 1VRSA 2DH2A 3H9ZA 4HMCA 1A66A 1WWCA 4HBQA 4JZNA 2ZUTA 1R3LB 2IMMA 3QA3B 4D9RD 4U1LA 1ODAA 2H2SC 2J44A 3QXDA 2DQJL 4KJPD 1BT8A 1C12B 3NUKA 1HWHB 3DJSA 2PMZA 2IGFH 1AAJA 1EDYA 1MHEA 4PELA 2NY1B 2UZIH 3H7BB 4KC3B 5GJSL 1JNNH 3DO3A 2X4TA 3P3UA 4O02A 5MHSD 1QPXA 1WFNA 2WYIA 2Y0IA 3K0DA 1UVQA 1LO0H 4OZGE 4P5KB 2ODMA 1UWFA 5CLTA 3MC0A 4Z3GA 3T8VA 1MCRA 1AI5A 2DQUH 4PJXE 4Q6IC 3CSPA 4X6EA 4AGLA 4J42A 1SM3H 1E4JA 1MCWM 1MPAL 3D39E 2R23B 3UBHA 5E4IA 4YHNA 2VXQH 5IVXA 3VQLA 3RFZC 1MRCL 5CA0B 5DJ2A 1P84K 1OAYH 2FL5B 4XNZC 3RWFA 1BX2A 2J21A 1Q6HA 4UQ3B 4I4TB 2PNDA 2BP8A 1HYRC 5G2NA 1I9EA 1Z9MA 4RMTA 4RUEA 4ABVA 2BSEA 4FQCH 3Q5YA 1FV1A 4QJ3B 1XHZA 3OC8A 3JWNE 2DW4A 1YUHA 4FZEL 2P5WE 3CVHH 4LPCA 1RUPL 1HHHA 2UXNA 2BCKB 3INUL 4L3ED 2V6HA 4NBZB 5TQ2H 3SZ6A 1FNEB 4J2QA 3GB7A 5HGGS 3WSQH 3BLKA 1ADQA 5F21B 4WUUB 1JZ8A 2HKOA 4XC3H 5G5DB 3W39A 1YEEH 2IGLA 1HNXB 2ZXCA 1O0VA 4XO3A 1BA9A 1QRND 3TX4A 2X5PA 5E2TL 5H6QA 4IYHA 2YAMA 4OI7A 3ETGA 4F8PA 4QRRA 1JZ3A 1OT2A 3WXVL 2CO1A 1D5AA 1MCSA 3LPFA 5EZIH 2YKKA 3SD5A 5F88A 3TEZA 2ZPKL 1CFVL 4YHPB 2G5BA 3NJVA 3CD4A 4DV0O 2BY3A 2GI7A 2CGNA 3CDFA 1EZLA 2Z8SA 1CIUA 3COOA 3PL6B 1PIGA 2IALB 1N8ZA 2O4EA 3A5VA 1GZHC 3E2HC 4JFHD 4NQUA 3L95B 4PJ6A 4XI5C 1BW8A 1VFAA 4MVBD 4BHUI 3HW7A 4P4KA 5CGBA 2O26U 3F85A 2CK3G 2GHYA 3OHXB 1OM3H 4OF3A 5ANMA 1Z5LB 4PJAE 4D8OA 4I0PD 4OJFL 2R69H 3OGCC 1MEXH 4WWKA 4X98B 2XAQA 3ZE1E 2HLFD 4XVUC 2EKSB 4BK4A 1UA7A 3SOBH 4B3MO 4EDXB 2YXFA 4J3VA 4N85A 3T8XB 1DQDH 5KN5A 4J7KA 4JYAB 1HCVA 1GM7A 4GSRA 2WCGA 2YAFA 4WFFD 5K39B 4G1EA 3I56V 3O41A 4LF6O 3VAEA 5DFVC 2HHHB 4PI0A 3EOBB 4YGAB 1AIFB 2W6JG 3AQDA 1PKOA 2W9DH 4FQXC 3ZS8C 1ET5A 1G9NL 4AYEC 1XF4B 1IGJA 2HRGA 5FOJA 1BQ0A 4PG9A 1DVQA 1UCBL 2YHGA 4Y1AB 2ZXBA 4RISL 1CGSH 3WAJA 4V1DA 1CVSC 1KB9J 1OARL 4QHKJ 4NLHA 1R3KC 3OR6B 1E27B 4F2ME 3OD4A 15C8L 1NC4B 1TQUA 2CO7A 4K7PX 5EC2C 1N5YL 5IJKA 4PVMA 3G6DH 4YZFE 1YEKL 3ZRWB 2EXYD 2OQJB 1A6TB 1MCLA 2G3NA 4YHIB 2BLFA 4ZXBB 5CIPH 4GKZA 3FTZA 3MUGA 2CUHA 1N10A 1AXTH 4OCXL 1LM8V 3MLYL 3JTSA 4JFZH 3X2QC 3NP3A 4UAOB 5FK9A 5BOJA 3MBXH 2UX6A 2PI5A 3O9OA 4BEIA 1IBLO 3ZDZE 4M7KH 4XMTA 1JF1A 4FXKC 1BAWA 4I9WD 4XMKL 3U7YH 1I8MA 2ICES 4TRPL 3IGAC 1URLA 3O3AB 4Y4KD 5IW6B 3D1MC 1NLDH 3QFDA 4PJBB 4X5QA 4ENED 1B6QA 2E75C 4NO0A 1TMCB 1FIGH 3KCPB 5E95B 1QNZL 2PTVA 4IHBA 4ILDA 4KJYA 5FHBL 4UBDD 3MYJA 2X3CA 3ZKNC 1E6JL 3MYZA 1NU1H 2D3VA 3BAEL 5M95B 3QC5X 1I8LA 2HRPL 3ILQC 3VGGA 5DXWA 5L4IA 3N27A 2F54D 3SDCD 3B9KD 2YPKB 1D5RA 3VSUA 5F7YC 3D4ZA 1J10A 1M7DA 2ICWA 2UZPA 3BN9C 2NY6D 3K0YA 4XN4A 1HOEA 3BMVA 3MRIA 3UZEA 4DN3L 4L1LA 4JFDB 1Q9LB 4M8QA 3QO1A 2I60H 3FCUB 3G5XA 1YY8B 2DV6A 3MRFA 5I5JA 2HKFH 1I1AB 4YHOH 1REIA 3ARED 4TUUA 1A3QA 3LD8C 1ZLWH 2Q4PA 2WSPA 3TJHC 3UPCA 2YSSA 1QBLH 4WU7A 4UDTA 4OIBA 4PRAA 3U0WH 1DO5A 3X14A 1QLRB 2IH8A 3CRCA 1HQRA 2XKSA 5DD0L 5AUMB 4B9FA 1TJHL 3IT8D 1CI3M 1OEZW 4NOBA 4WQOA 5F6IB 1LE5B 2GABA 1AO7E 3H2WA 3OB0H 5HDWA 4KL1A 4TSFG 3EOTL 1JZEA 1L9TA 3QIWC 2X9ZA 3RWCB 3WY2A 3BPZA 1ZA6B 3JWOH 5KS9A 2ZIDA 2AQQA 3OT7A 4MAUL 3F12B 3FUEA 2BVOB 2OTWB 1EEYB 4NAQA 5EBWB 1AMYA 3R7QA 3RGVB 4LSUH 5DHMC 1RLWA 3CC2V 2BS8A 3A67L 4OZFA 2MWCA 4I18B 3BWAB 3DTXB 3JWDL 2N1KA 2FL4A 5KSAB 3BSZA 3OM3B 1AGFA 5J5EA 1IVSA 4NRXB 5FYJL 2XYBA 3GBEA 1U3HD 1R6KA 1KXQE 3MAQA 2EXTA 1QWHA 2HFGL 3MOBH 1NA8A 4A63A 3M6DA 4ZG1A 3HG4A 2CGZA 1F18A 2VM9A 3QE5A 3QI9A 4P46B 1ZT7B 3VXSE 1QSVA 4GXUN 3IWVA 4UOW0 3TPKA 2IDUA 4LHUG 1NIAA 4ZT1A 2RGSA 5KANG 4BE6A 4XZUB 1J0HA 5D1XE 5IESH 5CCKL 1CLZL 4XWGL 5EZLA 3OXRA 1S9VB 4KKPA 1JVLA 4NJAL 4KU1A 5CSZA 4EB6B 3VA6A 1EGJL 1KENH 2P8LA 1X5KA 1U91B 5I23A 4ZMXA 2O5YL 3KHQA 4HSQA 4YDKH 1DDHA 1M2VA 4H88H 1EIBA 2VB5A 2AXGA 1M05A 1YN6B 2BNQA 4DUVA 2NPLX 4E9WA 4QY8A 1J1PH 2NY3D 4DUZB 2XNAB 5JH7B 2Z3YA 2VQTA 4AWJC 4QD2E 3RY6A 5DMYA 4I9XA 4MLSA 5E1IA 2EDLA 5JIIA 1RHHA 2BTQA 3CZJA 3W3BA 1A25A 2CDGA 4RRPA 5DU7A 3STBA 1LWJA 5I6LA 1UYWH 3MMEB 3N04A 3DC5A 4IKKA 5T5NG 4BZYA 1OSZA 1XQ4A 2VITA 3HHSB 5E2VL 1S9WB 2CCWA 3FU7A 3KWWA 4O9HH 5C8YA 5IFAL 3LVEA 4G8FB 3PY9A 1LEKB 4XMVA 3CCHB 4JZJB 1GK9A 2VJ0A 4JPIB 2Q87A 5AFAA 1EXUA 4YHHO 1IC5H 1JP5A 2QQKH 3PJLA 4YEFA 2OS7A 1VQOV 3IXAA 4P57B 5FC9A 2FHFA 2VL4A 3HS9A 4ZS6D 3VXUB 4FLZA 1ZLSL 2DQCH 3NSXA 5C92A 4B08A 1NIDA 1F3JA 5DD1H 2EZOA 2G2RA 1T66C 4E41A 2AK1H 4UT9L 3S37H 2WXPA 4AEIH 5JXED 2C26A 3C6LB 4ZO8A 5AVTB 3UYRH 2FE0A 5AOZA 1WCBA 1ZJAA 3QNEA 1Q8MA 2UUDH 4BW5A 4L1TA 3U6XS 4WRLA 5EIQA 2Z65C 1MA1A 2Q8AL 4F5CA 1L3WA 3CC5A 2CK2A 2W65A 2Y7QA 5F7EH 5CJOH 3UIZA 1DFBL 3BUYA 4LMQE 4PRNA 5D1QD 5ADPH 5I1HL 1R3IH 1XCXA 4QRRE 4ZW5A 3EFOA 5AG8A 3LN5B 3D4CA 3J7AU 3IMUA 4QE9A 1MG3C 5I2IB 5INDA 3RAJH 3LSUA 3LQAC 3DA0A 4PP1C 4QT5B 3ECWA 3P2TA 1KNOB 4M1CD 3DVIA 4K71B 1Q4NX 3LNHA 5D4QA 4D0BA 3FOLB 1WC7B 2ZINA 4UNVA 5ANME 4Z3HA 3TZVB 1UEMA 1C1EL 2WUCL 3G08B 4MJ4A 5FGBA 1EEQA 1M2OA 3HMWH 1S77D 2OTUA 4LKXB 4B9YA 1IEHA 1MLCA 4MRBA 5EU5B 3T2NH 1E5CA 1BQKA 1N70A 3DYPA 4PW9A 2XAJA 2OSYA 4UDUB 1KUQA 1IQDA 4FNQA 3RL2A 4WUKH 1SF5A 5AOMA 2LW1A 2NW3B 4JI4O 5AVWB 1BQHB 4X66O 3TN0D 5D55A 1NCGA 2EE6A 3E6HA 1CDHA 5AW1B 3RTQB 4PJIF 4RWUA 4DUYO 3L5WA 5F9JA 2YPLD 3PIQB 3EJYC 4HIJA 5IVOA 1MCPL 5FCSH 4LF3B 5E5MB 3ASOB 4B7LA 2YK1L 4J7RA 4G6AD 1I7ZA 1MAKA 1ZV2A 1X5YA 3BE1L 2L4OA 1JPFA 2PPDA 4GIOA 4YOKA 5AWNL 3GZKA 4X83A 5EYPB 3PQYA 1FPTL 1NCHA 3ULVL 3GWJA 5F9WC 1DEDA 3L4ZA 3JV4B 1BVLB 3FFDA 4XNQB 5T1LA 4G82A 1Q6IA 1N7ML 2BIMA 1VA9A 5H2BA 3MR9B 3N1GC 3FK3A 4YAQB 1HSAB 3E38A 4DP1X 3LKNB 3CVHA 1TYRA 1NEZA 3TA3D 4U1JA 3DX6B 2VDKL 3H7LA 2LFSA 1KCSL 2GIMA 3FB8A 1FIEA 5D96C 2UX7A 4C56D 5C0EB 4XVSH 1A4JA 1JMKC 3P9WB 5EG6C 3N2GB 2BFVH 4YDVB 4JPKH 1YSCA 2Q6AA 2F61A 1NFDF 1GYAA 1DBML 5C93A 4ODSL 3RYIB 3NFNB 1XMOB 1WA1X 1S7WA 2IADA 4PJCA 2FEJA 2NXZD 4KRPB 4GX1A 3Q43A 1NC2A 2DQUL 3JXAA 1EJ8A 2CRMA 1YEIH 3MRMA 1SM3L 3BUBA 3HB3C 3RB7A 3TV3H 2EYTB 3WJMA 2J43A 4JJHA 5GZND 1H3PH 1FLRL 3ARFA 5IG7A 2NY4B 4N21A 1ZS2A 3AU1B 5FX3A 3WFCH 2QKAA 5DVMA 2MOVA 3C60C 1JZ5A 4XE0A 1A7NL 2GJ6D 4NKIH 1KB3A 4XCCL 3OMAB 1BMWA 5JIMA 2D31A 3UGUA 1KCUH 3QORC 4CKQA 4FFBA 1CN4A 1V7NL 3C5JB 1ZL8B 4RBPK 1DJYA 4FQCL 4HXBH 3TO4D 2LTQB 4JVUA 3N41F 5IMOB 4X20A 3BAXA 3GHBH 7PAZA 4TVPE 3LS5L 1BF2A 5FYKH 1ZD6A 2PPAA 3L3JA 4LLMA 3UAJA 4F7KA 4L4VD 1HQ4B 5J11C 4D6TH 3K5NA 5CBEB 2OLDA 3CX5F 3HJ0A 5IEHB 4IRZA 4HYOA 4PBWD 2HZHA 1NEUA 4HK0B 2H5UA 3P32A 3MRGA 2ITEA 4AW7A 4X1IA 1G87A 2ARJB 2HFTA 3BPOC 4N5ED 4DR6O 3CVIL 3NR7A 4JJOA 4P59H 3UYPA 4HZ1A 1EO5A 3CFNA 4XC3L 1YEEL 2P4KA 2KZKA 2A83B 2OJEA 3FQXA 3RG1C 1CG9B 4XPTH 1IIKA 1PDKA 4BFIA 5C2BH 1TCRA 2J88L 3ARGC 1I1YA 2MNUA 4AYMC 5EMYA 1SUJA 3ABGA 2GBOA 2CHDA 3QRGL 4WKZB 1U97A 2IV9A 5T3ZD 5GSVA 4JO4L 5KS9E 1X6LA 1XGQB 1M9WA 2PTUA 1C8QA 3HAEB 3C3SA 2O6PA 4MQ7A 2D7QA 4F15B 1GN4A 1NFDB 1FL3A 4G8GA 2WVVB 1FCGA 1IFHL 2CR6A 1LQBC 1F3DJ 4GS7C 4UB0L 4ETYA 3HRZA 3U4EB 1AILA 1MW1A 3VBBA 4FL4C 2X6CA 5AZEH 1UT1A 3B43A 4OLYL 4GFTB 2ESVD 2YJLA 2X40A 4FQ1H 4ZKIA 2Z93A 4P2OC 2YMTA 3MZTA 2B16A 2OSWA 1HKLL 2PCPA 1Q43A 2VAAA 3V79C 3ML8A 3SOBL 5LGJB 1HSBB 3GIZH 1BECA 2HKHH 3GRWH 4DOHE 1S9YA 1VB9A 3AK3A 2R1XB 5DEDA 4X0KA 1J5CA 3VXRD 2JMRA 2DQ3A 3WI9A 4XE5B 3BQVA 5DJCA 1FG2A 1QNMA 1MJ8L 3CN0A 4AGMA 4BUHA 1SKVA 3N41B 3F62A 3AG1C 3KM2A 4CU7A 5D70H 1S9XB 4WFHD 1X4XA 3VTTA 3GMOA 1XT5A 3CYOA 2QDOA 3NN8A 4DEUA 2WBJD 3OLIA 4MZ3A 4LLAA 4E5XA 3T77A 3O2VL 4FQLH 3WBDA 3L5XH 2Z0AA 2WP3T 4MAYB 4F8NA 5H2FZ 2BNQE 4HUUA 2CE6A 3Q3GA 3VFGH 4U6VH 3GT6A 1YEDA 3G7TA 1A6PA 4Z7WF 1AGCB 1HXYA 3ALPA 2VRAA 1UQSA 2G3MA 3JT2A 1J5OH 2CPCA 2IDTA 1R46A 5HHXL 3MTRA 4FLQA 4OLWH 1YC8A 3GSQA 4LKCA 4JM2C 1E67A 2W0FB 4UT6A 5TJWK 2XVBA 5EBLC 2ZG1A 1UD8A 4FGMA 1AXTL 4F8QA 3MXVH 4LQ1A 3BT2H 5AW4B 3S3BB 1VACA 1U95B 2ITCA 4OX9O 4NWTL 2EO9A 5KTEH 1J5EB 2XN9D 3AGVA 2VW6A 2B5IB 2BERA 3UG5A 5I0ZA 2JGDB 1G7QA 5D1ZB 5IB2B 1OF0A 1OO2A 2F5AH 1U8NB 4QXTB 2WW8A 4FNPA 3C09B 1CL7H 3UMNA 5MENB 4U4BA 4MCMA 2G60L 4ZI8A 3BAAA 3QEUB 1A3RL 5H6RA 3EH1A 3L3OC 1GM8A 4U0QB 3BGAA 3LMJH 5A7EA 4ZUTB 3CPUA 3EGSB 3GXDA 2HLEB 4QIRA 2ARHA 4E41E 5JOPE 2OCJA 3ASNC 4IU2B 3K6SB 1D5XA 2KHAA 3BRFA 4ZI7A 1FP5A 4AEHH 2XWTA 4IGBA 3MTXA 1DJXA 1A5FH 4AVJA 1PNKA 5CJ8A 1T1YA 4J11A 3OZ9H 3BFQG 3F6LA 5EPMB 2GUZB 4LF8O 1X5MA 3V9EA 4F5CE 1O75A 2Q8BH 1E43A 5LJYH 3TBTA 5IMLB 5JUEH 1JYNA 1WP6A 4OZIF 3D7PA 3IAPA 2EDFA 2GC4C 4HXAH 4O4JA 3UTZB 1VKXA 1NTKH 2E74B 2EILB 2J20A 3OAUH 4RAVB 2M7WA 3FB7A 4QHLA 2BOBB 5HDOA 2P8MA 3T2OA 2HG0A 3JUYA 1IBFA 1YTFB 1NMAH 2BINA 5BMVB 1QBLL 4Z7WB 3UDWA 1WP8A 4CL7A 4OCWH 3RBGA 3SB3A 3OSKA 1F6AA 3FRPG 3S4SG 3P4MA 1RJYA 2WHVA 4YDIL 4KKLD 4CVUA 5C0BA 3TNNA 1NGYB 3V6FB 1DUZB 3B1UA 2W38A 2JKLA 4HAGA 3B2MA 3RVXD 4DKTA 1UZ8B 2BTOA 4Y1SA 3MHHC 2CGYA 2BCCH 1OGAA 1U8JB 1FJ1A 5IEKA 3CFJB 4LHJB 3CDGB 1E42A 3Q6FA 2ORBL 2XBZA 4DPCX 2HVJB 5SWZD 3MRDB 4PG2C 1KCRH 1DVZA 5ALBH 4JANA 2DYRB 2J6WA 3HNTH 4LSTH 3PWJB 4POUB 1WZKA 2ADJB 1ZV9A 3JV6B 1MFDH 1U6AH 1X44A 2J12B 4PJ9A 3E8GA 3ZTDC 1K8AW 1GGYA 2FBJH 1I9IH 2H6PA 4XVJL 4S1SL 5IWAO 3X13B 4IYKA 3IDMA 3A0HZ 3IJEB 3IMRA 2VQEB 3AVEA 1J0YA 1GMEA 2A9BA 3PQYE 4DV1B 5C0GA 1P5VB 2WQWA 2LR4A 4Q6IB 2EIDA 2HB0A 5E9DA 2JK5C 4KK6D 4ODTH 4KTGA 4G8AC 5HHQA 5IESL 4OZIB 5KHIA 2KUTA 3E35A 3C9NA 3RFZB 3ZDYF 2XIBA 2QR4A 1K3ZA 4MNGB 4KGLA 1JFQL 1KFAL 5HYJB 3BRGC 4XNZB 4QXUL 2X70B 4Y2DD 3GIVA 4LF4O 1CDIA 2EE0A 3MRNA 4YDKL 3QRBA 1PU0A 1VPOL 5IQLA 3FSZA 5LAXA 4BKLA 2A9NL 1KCWA 1MW0A 1J1PL 4J8QA 1HOCB 2CPUA 2WAHA 3UBXI 4DGVH 1D5IL 1SJHB 1NCCL 4G43B 1AKJB 1HHGB 3KPTA 5E8DH 5TK2A 5BR8O 4L1SA 4BR6A 2ZAHA 4N8PA 1QG3A 3D39D 4UV9A 3IJYA 1V3JA 1AZUA 5JIPA 2H0PA 4NOFA 4LC1A 1PLAA 4G3YH 4U7OA 5JR1L 3OKEA 2QEJA 4H1LB 4PI2A 1HILB 5DEGA 4UUJC 4NM8L 5H94B 3QEHA 4PUBH 4LCCA 3TCLB 2PABA 4IRSC 3U9WA 4B9GA 4WVRA 3AWFA 2QQKL 5DYFA 1FVEA 3VXOA 2BH0A 4EAEA 1OB1A 1LD9A 1OIOA 3M17A 2DQCL 4FFZL 4HFWB 1AJNA 3TLRA 1KGYE 2MCPH 2VDPB 1ENVA 5C2UB 2UXVA 5EN3A 5E79Z 2EDXA 5DD1L 2YFNA 4UM9A 5HJBA 4PJ5B 3S3JA 4YO0B 3L71H 2YD3A 1OD7A 4I5BA 4ANWA 4O4LB 3S37L 1NJ9B 4P2CG 3ZBHA 4G9FA 3EYOA 1CYXA 4Q6YA 5SWSE 5ILTH 3RW0A 1EV2E 3OGCB 4H2CA 2X4UB 1Y0LB 5FO7B 4JO2H 1EBPA 1N3NA 1UOWA 3QUXA 4IIQB 4UCFA 3ZDYB 3VDBA 3LB6C 2Y3NA 1T2QL 2QJ1A 5F7EL 4HG4K 2YQGA 3CZKA 3TFKC 1T89C 1GSMA 3WS6C 2WTOA 2EH7H 4MJ6A 1JPST 1GZQB 1KXVC 3KW7A 2XRAL 1JMZA 2GAZB 2DKMA 4UTBA 2XQYK 3RAJL 1XSJA 1YYML 3FB6A 4G8GE 4R7LA 4U1HB 2B1AL 4FQXB 4XMPH 1IBMO 4O4YH 1DQMH 2BVYA 3CNKA 4NN7C 5EU3B 2A9AA 4R83A 5DUPL 2DLFL 1NCDH 2XQ0A 4APXA 4KKBC 4DUZO 1XCWA 2ALAA 4OR1A 1IGIH 1AS6A 5HI3C 1U8HA 4PV1C 3VWKB 5T1KB 3K72B 5HYEA 2WWWA 1XB3A 1R3KB 2DRUA 3OX8B 4NXSA 5TF1H 2Y7LA 4U1MA 4F27A 4K0KB 4DR4B 4KRNA 4L8SC 2PW2A 3ZMNA 4K7PH 5DHDA 5EC2B 5FOBB 2VDLL 5LP6C 3RY4A 1SZNA 1QSEA 1DQKA 4WUKL 1NICA 2MKWA 4DR2B 3ZMUA 3HI5L 3VM5A 3QJHB 3KLSA 1ACCA 2UYLA 2WXKA 4M93C 4NO2B 1A3LL 3SDDA 3GBNH 5CN3A 2AXFA 2DLEA 2GVYA 4HAKA 5I24A 3K5LA 2ZKYA 2VR4A 3FT4B 3M1CA 2XTSA 5EB9A 3DSQA 2Z31D 3X2QB 3DXRA 1RIVL 1JZDC 1COBA 3CHXA 2HJDA 4NNXB 4WSKA 3ROLB 3FDWA 1EK3A 2FQFA 4FXKB 1EJ6A 4L37B 1ZRUA 1J9TA 3PNRB 35C8H 3IGAB 3ELQA 2FYUH 5KSUA 3SGEH 4XMXA 2QADD 1T2JA 2E75B 5GGTH 1TFPA 4KJPC 3JAKB 3DHPA 4W93A 1NLBL 3B6SA 3RVWD 4K3JH 5CINL 2FJGA 1F2QA 3C8KB 3GSNA 3KXFB 2AJ3B 4O2BA 4PH8A 4TQFA 2DOSA 3TYGH 1AP6A 2DMHA 1HINL 5DGRA 4RMUA 3P9LA 5F7LB 1EH9A 1NFAA 3FONA 3U1SL 4OKVA 3WNPA 3GZPA 1VQ8V 1NFIA 1B2WL 1KYFA 3RFRA 1YYLL 4LNVA 1YNLL 2QKIA 4OQTL 3PPEA 2X4PA 3KKYA 3GUFA 2FDBP 3NSDA 4V2BA 1YEIL 1FDLH 3UAFA 2CLRB 3WEXA 5KYYB 3TV3L 2Z92B 2ICWJ 3LD8B 3CHOA 4OBRA 4ACTA 4BCZA 2FNBA 2UY7A 5E8NA 3SYOA 2FYYA 5AW6B 2ZAGA 3EFDH 4UILH 2HP4A 2LVCA 3GSVB 3FO0L 3GMPA 2F1MA 2I07B 3QJXA 3QDJA 3AG4C 4WNQA 1U8CA 3MREA 3BEVB 1K5SA 4X6DF 4DV2B 2H3OA 2AW2A 1DE4A 1CR9L 2N01B 3QIWB 4JUTA 2O6DA 5L4MA 4FN0A 3KLAA 4U7MA 5JDSA 4HXBL 4CVZA 1SQMA 3ZHKA 3DROB 3GHBL 3K59A 4UQDA 4P9HL 3NH7L 4R0LB 4YLQT 2FVNA 4Q4EA 3QWNA 2HG5A 1ZLVK 3P77B 1KN4H 4WIQA 1WF5A 3O9WD 4BZ2L 1EMTH 3DOHA 1WSST 2I9LB 3RZCA 5E03A 4A2EA 4AW4A 1DSFH 1UM6H 4AYGA 3MCYA 3WS3A 1AO7D 1CB4A 3ESVF 4BWWA 1CE6B 2PPCA 3VWJA 4GX0A 3EKCA 5HHMB 3ZT7A 2DN9A 1F97A 2MKLC 5FV2A 5KAQF 5C0BE 4NT6B 3US9A 2PO6D 3NA9H 4MVBC 5HD8C 2TRYA 1IBKO 3L9RA 2ZXQA 2EIBA 5AL8A 2GSMB 1R0AH 1TSRA 4R7CA 1OGAE 1I7RA 4M9PA 1CDYA 4UCSA 1OW0C 1R3LA 1YEGH 4OFVA 1CLOL 5CZXC 3B8MA 2HLFC 4GT7A 4NO5B 5GS1A 3Q8FA 1E1QG 3V4VA 3LSOB 4Q58C 1M3JA 3V4PA 3V5HA 3VDAA 1GHFL 1WAEA 1H3GA 3VGAC 4GRWF 1NANH 4AGQA 5B1BC 4TUJB 5DUML 3IAQA 3U30B 3V6OA 4XNAA 5CP3H 1G7LA 1OP5K 5KA5A 4H0LC 4X6DB 3VXSD 3DLQR 1QR1B 3SE8H 4M3HA 4OUOA 3L4CA 1DBKH 2A7WA 1D7CA 3CBKB 4NCC1 5D1XD 5F0MB 5JO5B 1HYSD 1LK3L 5E9DE 2CM6A 1KP3A 2ADGA 4G80A 5CN0A 1GS6X 4LFHG 2D7NA 4XPHL 5PCYA 2RCSH 5JJJB 3MLWL 5KAFZ 4G5AA 1BFTA 4OM0H 3WFDH 1AR5A 4YK4C 5EORH 3QZPA 1BFOB 2LW3A 1ZT4A 2EXYC 2FEDD 1MCJA 2YA1A 2ADYA 1QZNA 1A1OB 1AJPA 3MRQA 2GPZA 4ORGA 3VFGL 3DHJA 1VF6A 3MI6A 3OAYK 3S3DB 1B04A 1FNEA 1E1RG 1CFTA 5LMNB 1PCSA 1BZ9A 1WBXB 1YEFH 4OLWL 5T5FL 3K46A 3RB5A 1KIRB 4HUNB 4UM8A 4Y4KC 3HTLX 3BGMA 3BT2L 1MRDH 3ME0B 1T3FA 1NGZA 1SHXA 3R4DA 4QPKA 5JQ6L 2UXTA 4ENEC 4BSJA 1ED3A 3MOAH 3KDMA 4HKBA 5IZ7A 5F7WC 4F58H 1WPCA 3TEUA 2IH1A 3VRJB 2F5AL 4AIZA 2AQTA 3PWUA 2MPVA 4K9EC 3LEXA 4L4TA 5GHWH 3WFEH 1BGXH 1AFVH 3L95A 4GRWB 5KVEH 3SDCC 4RQQA 3RWDA 4D8PA 4PJFF 2B14A 1BD2B 4TQIA 3ZRVA 4J2XA 3HLAA 1ZAGA 3L4VA 3BZ4B 1N64H 3B40A 4QRPB 1ZXKA 2NY6C 3DUSB 4X98A 1LO2H 3NCFB 3ZRXA 1KPUB 1YQ2A 4AJWA 1S7TA 1EANA 2R29H 4IMKA 4CH5A 5I18L 2NX5A 1FXHA 4G9FE 4FCHA 4JG0H 4H7VA 2CBTA 2P22C 1WN7A 2OMZA 5BZDB 4DPAX 3LDDA 3AREC 4MJ5B 1MABG 3FOMB 2K70A 3M1BA 4AVHA 4QRRD 4JK0D 2PR9A 4MSWC 4QRSA 1MG2C 5IWLA 4JFFB 2VDRB 2FUQA 2A73B 4ZOLB 3LRSB 1AIFA 3MLSH 3DPBB 4N0FA 1QR8A 5KW9H 2X2YA 1DJHA 1O7SA 5BO1H 3QIUB 4YIOA 5LMUB 1XD0A 2DD8L 4FTVB 4YSDA 1U2YA 4BZ1H 1F0LA 4JGJA 1DQIA 4DO4A 4UQ9A 4EI0A 3JZYA 3A6CH 4IYIA 3EO9H 4P4KD 3E83A 2ZQMA 2NY2D 4HJ0D 1JNJA 1YECH 1DVFA 1OAJA 2AQSA 4HDIB 3EBIA 2UXFA 4HUMB 4N3TA 3HAEH 1BWMA 4AYFB 3N1FC 5ADOH 4WWKD 1XGUB 4OT1H 2Z35B 4XMUA 2AEPL 1MCNA 4JRWA 4AHCA 2WANA 4JO3L 3F00A 1OD9A 3NDZE 1EAPA 2RH0A 3KPSD 4QR7A 4HKJB 2BIPA 1W6LA 1T4WA 1QSEE 3P11L 2JCCA 2F1EA 5J1AA 2M26A 3WU1A 3QO8A 1AVMA 1U3HC 3FUHA 1KMIZ 4FYSA 1TNMA 4HEPG 4LGPB 2NYZA 4NENB 3WXWH 5TDNA 4ZSOB 4BUGA 4ZFZB 4PJFB 2J3SA 5LGHL 1E5UI 3G5ZB 5D96B 2F4VB 2XQBH 2DWDC 5FF6B 3WFHB 5FA3B 3UXFA 3IF1A 4MCYB 2FBJL 5EIVA 4PJBA 1M4KA 2BVUA 1BQHG 4JQIH 2CTWA 3NJMA 3V4LA 2L7UA 3MV8A 3BUPA 1FORL 4X7CC 1CBVL 5C70A 2R0LL 2R4SH 4D9LL 4IKNA 4NQEA 4JRYB 3HB3B 4G2KA 4PHXA 4AI8A 5FYKE 1IGTA 2XXCB 5CSGA 5DZ9A 1JPTH 2NY3C 5TDOA 4LLWA 3C60B 4Z3FA 1S5LZ 1RH8A 2N59A 3FAVB 4ZPTB 5AVRB 2QSTA 4WJ5A 3TO2B 3O65A 4NN5C 1P7BA 3QORB 4R4ND 4FXGA 4M43H 1YY8A 4R4BB 2EDTA 1I85C 3OBAA 4PGDA 4LIQH 1IARB 5CWSB 4Z0BL 1FNLA 2CDFA 2FT8A 4GO6B 5E8DL 2AITA 2GTSA 4PCKA 3SY6A 4BFEA 3CXHK 4OFPA 2EIMC 4MLIA 5DJ0B 3THML 5IBLD 3M86A 5GPRA 3NSCA 3T4AC 1AD0B 4BDVB 5JJNB 1KYAA 4WI2A 1JGLH 2PF4E 1RUKH 3BPOB 1ZX3A 5GGQH 2VZ1A 2WGNB 2LFRA 4U3JB 4ZS6C 4PUBL 2R2BB 2BVTA 1VGKB 1K73W 1JCKA 1PIFA 2ZG2A 3MJGX 1I82A 1L9PA 3QDJE 5LBQA 1JGVL 3EYVA 2A1WL 4IBZA 3V2AR 4FQ2L 2OTWA 2D3OW 1D9KB 3ARGB 5FYJD 1D5ZB 3TURA 5CFAA 1GTNA 3FRUB 1Q82W 4QCIB 4TSBH 1NUFA 2HTLD 5ESAB 4UTAA 5JXEC 4ZTOH 5JHLA 1VQPV 4JM2F 2FSEB 3DTXA 5GSRA 4Q9BA 3S34H 5I0XA 4Y8DC 3HHMA 3RE0A 4BINA 1W0YT 1JWUA 2IQAA 2CXGA 4ZYKB 4JN2B 1KYOF 1PW3A 5C1MB 4NQDB 3D0AA 4UOJA 4BE5A 1NCAL 3IJHB 4JRXB 4KVCH 4FL4B 5ANHA 5ILTL 1FGNH 4JB9H 5C0RL 2VQEO 4CU6A 4P46A 4JO2L 1Q9KB 2GG1A 1YJ9V 4P2OB 1WZLA 1PY4A 3DGDA 3DV4B 4XWOD 5SX5K 4ABUA 4JHWL 3GXMA 3EJQA 4M1CC 5TPWH 4HUCA 3FTYA 1CD8A 1S9VA 1YJDL 2CBPA 2C1PB 2FO4B 1ZA3A 2VN4A 3CFTA 1ETJA 4QYAA 2AMUA 3GZQA 1V27A 3UMTA 3AG1B 1TETL 3F2LA 3H9SA 3IDYC 2X9WA 3QW9A 2XBDA 1DQML 5IYDO 3OFNG 4UMSA 5K9OB 1HNZO 3HAEG 5T1MA 5JH7A 3QCTH 1TITA 2VXSH 2JGUA 2E3CA 3IEAA 1ZTXL 5F96H 3TN0C 3VACA 1E5YA 4J3TA 3JTTA 4GRLA 1PAZA 4OZ4B 4ZOCA 5C0FA 1IE5A 3PDOB 3QI9D 4JHBA 1A1MA 5A16B 2HJKB 4U6YB 2VR7A 3MMEA 5E94A 3V6OE 3D50A 3AGWA 5FLVA 4GMSL 3K74B 4G6AC 2OL3L 3O4LA 2OXGB 3KBHE 4JM2B 2IIJA 3U2SA 1E4XH 5HVHB 1QFWH 1WVZA 5EOCL 3RA7H 3MLRH 1KT2A 2WTRB 1U4EA 4QHUB 3ZQ9A 4GEIA 4FYTA 4K5NA 1WTGT 4HHWA 4XNUH 2HLDG 4P57A 1SOXA 2XXMB 5E08H 2EEDA 1BBDL 4TLSA 2DQIH 4HV8A 1J18A 4NQSA 4JYBA 3TA3C 1CICA 1JZIA 1FZMB 4MX7B 2XZCH 1ASQA 4R26H 3L3OB 1X5FA 2AJSH 1F90H 1UZGA 3QG7L 4MYPA 4LLVB 3W2DL 3HS0C 5I15H 2A06H 3IE4A 5EH1A 4I55A 3QUYB 5JHDB 4TT3G 4ZMTA 2UXBB 3ASNB 3QXUA 1K4CC 1HK6A 1UFIA 4GXVL 3BDYL 3ZHFA 1BL8A 5FDWA 2NXZC 3Q6GL 2QGBA 3TCTA 1WT5A 2F23A 2XIDA 3O6FD 4KHXL 2CKBB 2YIBD 5FM8A 3VFNA 3CCJV 5CD3B 3FCGA 1INQA 1EN5A 3IDNB 5BOPA 5GZNC 4S1DD 3I6KB 3RUGF 1NGPH 3PXJA 3H1HH 1RIHL 4QHMB 4L4TE 4QT5A 1KNOA 4H1LH 4LAQH 3OKOA 2K1MA 2H1XA 1L6ZA 4NXNB 3FOLA 2JELH 1NZ6A 1CGYA 1UKSA 4GT0A 4LWSA 5AW3B 5JOPD 4E9QA 3SKJH 5IP4A 3BP7B 1DVSA 1XV8A 3EFDL 4Z78A 3TO4C 3G6AA 3QUZA 2BP0B 4K0KO 4LKXA 3AG2C 3TBWB 1X4ZA 1LP9F 5D72L 2NX5E 3O8XA 4HUWB 2VDPH 2OCCC 4JM4H 4UDUA 5EIIG 2WZPA 3TONA 3ZYIA 4DO6A 3BLBA 4DR2O 1U93A 4LSQL 4PS4L 2L7JA 4M8VA 5J1SC 1FO0L 4B3SB 1MY5A 4N5EC 5ENWA 3AY4A 4LT7A 3QWRA 4FZ0A 4W4NA 4LF3A 3BEWB 4QMEA 1XL4A 3QH3A 4HH9A 5KVFE 3MRJA 4O51A 4ACPA 4EVNB 3L9YA 3FX7A 4DP4X 4YLCA 1A22B 5DUBA 2CIKA 3S88L 2EULA 4Y1AE 4N2OA 3RWHB 2EYRB 1DBBL 2DM4A 4Z7IA 2ADQB 1JK8A 1GXEA 3VQ1C 4KZEH 3JV4A 1RL1A 4H20L 2IJHA 2XG4A 4I48A 3HCVB 4BIZA 3NA9L 5ESQA 3MR9A 2WLNA 4L8JA 5HDBE 4ES8A 1HN1A 3SGDH 2WO3B 2JK5B 5LCVL 1R0AL 3QQDA 1WJZA 1N6QH 4HCFA 1E9PB 3CBJB 3B8SA 3H56A 3RUGB 3UJTH 2FT6A 2JCCE 3WFBL 4JI3B 1N32O 2RFXA 2ENSA 3WNLA 4IMLB 4XOEA 1F4WH 2YAHA 1ZTEA 5KSBF 1O6SA 1A02N 1FXKC 3NFNA 4GYBA 5D2NC 2GC7C 3IJSA 4JY6B 1NOLA 2IJ0C 1X7QB 1BZ7B 4LE8A 4PJBE 1LP9B 1P4IL 1P7KB 3CHPA 4QE7A 4PLJD 4FNSA 2HLAB 2EYTA 4R90L 3MV8E 1Y74B 1A2YA 2EIZA 1S3KH 1MFEH 5T1LD 4I0CC 2WBJC 4Q97A 1G5AA 1P4RA 1NSNH 2P8PB 2IEPA 5C0CA 1PNDA 4P2RA 2BNUB 3BYYA 3KH4A 4YJZL 4KAQH 1QPPA 4QF1A 4M8UA 2CH8A 4XAWH 3C5JA 2YD0A 4PGBB 3B9AA 4IRSB 1VQ6V 3WFDL 4DK6A 4YBQD 5F8QC 1RZFL 5IMOA 2QSVA 3RPBA 3MRKA 3L9DA 4R8WH 5BMFH 1B4RA 3H9HB 2VRKA 3O2DL 5H4ZA 1A7RH 2ZKXA 4XN5A 5L4FA 2L3BA 2YD8A 3GGWA 3HN5A 4S2SA 1LO5A 2ED9A 1E40A 2IF7A 4JI1O 3HE6D 3VFUB 4Z7AA 1QHQA 2CBQA 3SGIA 3B2EE 1DN0B 4XXDB 1Q0XH 2HPOA 1CPYA 3AS1A 3QPXL 4OFDA 1RZ7H 3MRCA 4X9GA 3RZWA 4PVBA 1A7PH 5DHVB 3LSQA 1F41A 2RDCA 1CGUA 3EXJA 3RWGA 3ARFD 3UJIH 1GZPA 3MX0A 4KUCF 4OXSA 3TBYA 4P30A 4OD1L 5KBDA 4WLCA 1YEHH 3RN4A 3MOAL 4DYLA 2YGVA 1XGQA 1FFRA 4QTHB 5KVDE 5IB3B 1GVIA 1Y6MR 5EZOL 4MDJB 5KSBB 3H4FA 2WTPA 3GLEA 2WVVA 3OL2A 2CO6A 3ZX1A 4F33A 1T6WA 4ZX6A 4H1LG 2VNCA 1R3JA 3UAJD 3R1GL 3CWBH 4MNHA 4M8RA 3UP1A 2DTMH 4NC1C 3L4TA 4M7LH 4GRMB 4F2FA 4X7EC 4GXFA 1HU8A 3OR7C 4NN7B 5B3JF 3OQ3B 1LO2L 1FD9A 3WHXB 4CVWA 4CDGC 5SWSD 1OE1A 2FECI 2R29L 1QLEC 2P4AB 1PLCA 2F7IA 1NUGA 3FQNA 4APQB 4JG0L 1J9QA 3DVNB 4XX1G 4GP4B 5IBUB 3LNGA 3M8OH 3MJ7B 2B2XH 4TPRL 4XNMA