1QLEB

Cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
252
structure length
252
Chain Sequence
QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Cytochrome C Oxidase from Paracoccus Denitrificans Does not Change the Metal Center Ligation Upon Reduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/immune system
molecule keywords CYTOCHROME C OXIDASE POLYPEPTIDE I-BETA
total genus 61
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 1999-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qleB02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1qleB01
2BP0A 1XB8A 4UAHA 3EH3B 2I7SA 3T6ZA 4DP5X 4Q89A 4YSUA 9PCYA 2P80A 1JZFA 1SF3A 5TK4A 3WI9A 3S3BB 3NT0A 5I26A 2DYSB 4DP6X 2FT6A 2BZCA 4DP2X 3FQ1A 3PAUA 4NERA 1IUZA 1PY0A 4YVNA 8PAZA 3WKQA 2FT8A 2WO3B 3UAAA 1BQRA 1SFHA 3NP3A 3V9EA 1ZV2A 4K9JA 3HEIB 2P80D 4KNSA 2QDWA 1CURA 3N55A 5I28A 3N2JA 4N8UA 2ZXWB 2EIJB 3KW7A 4L0PB 3NSDA 3UGEA 1GSKA 2HRGA 4AKOA 1L9RA 4KOCA 2FQDA 2X88A 3ZDWA 3X1NA 1J9TA 1NICA 2H47C 3BVDB 4YSOA 2CALA 1QHQA 1GS6X 3AY2A 1AIZA 3OM3B 3NJMA 4BWUA 4KNUA 1OE3A 3UABA 1V55B 2EIKB 1TEGA 3SQRA 2VSMB 4AZUA 1JZEA 2UXVA 4F2FA 4HHGA 5B1JA 1PZCA 1AS6A 2LLNA 4HHWA 4G70B 5PCYA 1BYPA 1R1CA 1ZPUA 4HZ1A 4GY4A 3QJVB 3S8GB 3EH5B 3JTBA 4YSRA 2GSMB 1OCZB 3C75A 4G71B 1JZGA 2VM4A 3AG2B 4A2DA 4PAZA 2W8CA 1AZRA 1KBWA 4DP8X 1L9QA 1XB6A 5F7AA 2RACA 3TBBA 1X9UA 4AI7A 1NPJA 1ASQA 4AX3A 2XXFA 2GBAA 1AG6A 3ERXA 1AOZA 1JVLA 3BQVA 3PCYA 1ADWA 4EF3A 1JZJA 3V9CA 3G5WA 3FT0A 1NPNA 4X4KA 2Q9OA 2OV0A 5D4HA 1NTDA 1ZIAA 2TSAA 1OOWA 1MG2C 3HB3B 2ZOOA 3T6VA 1MG3C 5I6PA 4GP5B 1TEFA 1IBZA 1M56B 1RZPA 2YXVA 1YLBB 5I6NA 3ABMB 2DYRB 3SBRA 1L9OA 1ILUA 3OD3A 2XVBA 4GP4B 5FC9A 1B3IA 4DPBX 2GIMA 4FAAB 1E5ZA 4QLWA 1FWXA 1F56A 5I6LA 3OQRA 2YAFA 3H56A 1WS8A 1ILSA 5I6MA 1RCYA 2J55A 2UX7A 1A4BA 1TU2A 3GDCA 4MFHA 3ASOB 5EHFA 4E9XA 2EIMB 2HX7A 1AACA 2IDFA 3CZUB 3FU9A 3MX0B 4A2GA 4CSZA 4N4YB 4NAJA 4KOBA 2CJ3A 1BXVA 2FQFA 1MZYA 2FTAA 1KYAA 2XLLA 1AZUA 1AR1B 2QDVA 4A67A 1OF0A 1PMYA 2HLEB 1DYZA 1JZHA 1GS8A 1FFTB 3WNJA 2X87A 3WNIA 5ANHA 2IH9A 1AZBA 2PPAA 1RKRA 4KO7A 1GW0A 3TA4D 3NJHA 3D12B 3IN2A 2E86A 2NRDA 1W6LA 1ZDSA 4E9SA 3CVBA 1XB3A 1NWOA 2AANA 1SNRA 1M57B 2CAKA 2VMJA 4YSTA 4YSQA 3FSAA 1OCOB 2PPCA 1PF3A 1VLXA 2BO0A 3NJJA 4HIPA 4DP4X 2GC7C 3OMIB 4A2EA 2FQGA 2XYBA 2MRYA 3PXLA 3NJGA 3EF4A 1SDDB 2CBPA 4BDVB 1I53A 3UADA 4QKTA 1BYOA 4BWWA 4W1TA 3ABLB 3QJTB 2A3TA 1AZNA 1GR7A 2IWEA 3IN0A 1X9RA 1RZQA 5I5JA 4W9ZA 5B7MA 4DPAX 6PCYA 1SDDA 4BDVA 5B3SB 5I6KA 1NIEA 4HALA 3FQYA 3NJKA 4YSAA 2IWKA 2EILB 2N0MA 1PLAA 1CC3A 2HXAA 1E30A 2GC4C 4YSPA 1MDAA 4YVUA 2DWSA 4A66A 3S3DB 2BW5A 4GP8B 5B1KA 2I85A 4E9QA 4GYBA 4JKNA 3TASA 3FYIB 1N68A 3ABKB 1PLBA 1NIBA 2PP9A 4YL4A 2DWTA 6PAZA 4HCFA 4M3HA 3NSYA 3NJFA 1AS8A 1PAZA 3NJLA 4KO9A 1OCCB 1GYCA 5B7FA 2FT7A 1BXAA 3X1BA 3IE9A 1BQ5A 4AKQA 2J5WA 2BWIA 3WKPA 1JZIA 2H3XC 1E65A 3SBPA 2AVFA 7PAZA 2QPEB 2YAHA 1EZLA 2AZAA 4WTQA 4BXSV 2MTAA 1KBVA 3CDZB 2OCCB 2QPDB 3UAEA 3FPYA 2I7OA 2DY2A 1JOIA 2TSBA 1CUOA 1L9TA 5E9NA 5TK2A 7PCYA 1UATA 2HX8A 2HRHA 1A3ZA 3QJUB 3X1GA 1WA2X 2HX9A 2QT6A 4DPCX 1GS7A 2XXGA 3ASNB 3PPSA 5IY5B 3EHBB 1J9SA 1HAUA 2JFCA 2PCYA 4YSEA 2VM3A 4HCGA 2VW4A 1ZIBA 2R7EB 2YXWA 3FSVA 5I5MA 1SFDA 4WKXA 1J5CA 1BEXA 5F7BA 1KDJA 3FU7A 4PCYA 4ZK8A 2FQEA 2YAPA 1KDIA 1AANA 3WG7B 1NIFA 3IEAA 4DP0X 1SJMA 1JVOA 1E67A 1OE2A 2GHZA 3FU8A 1M9WA 3ABGA 3AG3B 3FSZA 2J57A 1JERA 2PP8A 5B7EA 1AAJA 3QJQB 4AKPA 1T5KA 3FU7B 4BK5C 1NWPA 4M4RB 3PLYA 4E9TA 1XMEB 1AS7A 1ET8A 2ZONA 3CG8A 2VW7A 2XV0A 4A2HA 4DP7X 4E9WA 1GY1A 3AW5A 3MBWB 2CUAA 3X2QB 5B1AB 1URIA 2IAAC 3X1EA 4KO5A 3QQXA 1OCRB 2Q5BA 2YAQA 1QNIA 3RYMA 1JXGA 3ZBMA 3AG4B 1A4AA 1A8ZA 3OMNB 3NSFA 4Q8BA 1AQ8A 1NIDA 2BP8B 4HCIA 5AFAA 2BW4A 5D4IA 5AKRA 1IC0A 2JKWA 1PNDA 1E5YA 2CCWA 1TKWA 4E9VA 3U25A 1OE1A 3T6XA 2Y1AA 1CYXA 4G7QB 3CVDA 3X1FA 3S8FB 1IBYA 3SBQA 1J9RA 3FS9A 4E9YA 2BP8A 2YQBA 1ASPA 4HAKA 2XX0A 2FJSA 2XU9A 1W8EA 3T9WA 3GXUB 4P5RA 2XV3A 1HAWA 1FA4A 1PLCA 2FNWA 1IKOP 4YSDA 1ID2A 4G72B 1ET5A 2ZWNA 2AZUA 2UX6A 4A2FA 2GB2A 3DKHA 2PPFA 2WO2B 4YSSA 2GI0A 2XV2A 2XUWA 3KW8A 5LDUA 1L9SA 2YAEA 4RH4A 2YAOA 1EHKB 3JT2A 2IDTA 2XX1A 1SHWA 3T71A 2XWZA 4JHUA 4BXVA 2BHFA 2PPDA 3EH4B 4KO6A 3CDZA 3ZIYA 1AG0A 3S3CB 1KGYE 1NDTA 1SHXA 1PZAA 1J5DA 2JXMA 2IDQA 2Y69B 1ET7A 2HZHA 4DP1X 3CVCA 3AZUA 3NJIA 2H5UA 1BXUA 1PZBA 3FYEB 1MZZA 4UF7C 2VN3A 1N70A 1J9QA 1A4CA 2J56A 4DP9X 1ASOA 3FQ2A 1DZ0A 1JXDA 2IWFA 2DV6A 1V54B 3WIAA 4F2EA 5B1BB 2IDUA 3IBOA 5D4JA 2R7EA 2YAMA 4F7KA 1PNCA 1BQKA 1ETJA 2W88A 3QPKA 3DIVA 1SF5A 1KCWA 3FSWA 2YARA 1JXFA 2IH8A 2B08A 3QJSB 1HFUA 4BWTA 3PAZA 3DTUB 1NIAA 2B3IA 4E9RA 2UXTA 4G7RB 5I5IA 1L9PA 3AG1B 1QLEB 4A68A 1WA0X 2FWLB 1WS7A 3H4HA 3TBCA 2IDSA 2PPEA 1ZDQA 3T6WA 4NB7A 4ENZA 2AFNA 3PAVA 2PLTA 3NP4A 3OMAB 1A65A 1NINA 1WAEA 3NYKA 5PAZA 3ZX1A 2EINB 2BWDA 5A7EA 1AZCA 2UXFA 1WA1X 4P5SA 3FPXA 2YEVB 2OJ1A 1BAWA 4TXVB 1W6WA 4JHVA 3TU6A 1OV8A 2BZ7A 4KNTA 3NSCA 3QJRB 4CSPA 5I6OA 2WSDA 4G7SB 5AZUA 4GXFA 2BP0B 1V10A 2PCFA 1NZRA 3H4FA 2PP7A 2VW6A 1GY2A 3UACA 2UXGA 3GYRA 4YSCA 4UANA 5B1JC 1KCBA 3NJNA 1PCSA 1KV7A 4FA7B 2VSKB 3L45A 1CYWA
chains in the Genus database with same CATH superfamily
4BW5A 5CEZE 4UINL 3UG5A 2OXHB 1MOFA 3RYHB 1GMIA 3MCG1 2ETWA 4LIQL 1AD0A 3HZVA 1UT2A 5LDSA 1UOKA 4JZJA 3QQ4A 3V52H 1IQWH 2EDQA 2Y7QA 2OYMA 3E2HC 3GBNL 2HP8A 4Q74A 1I1AB 1LD9B 1MCDA 2VDOH 4XI5C 1NH2B 4Q97A 5I1DB 2X9ZA 3WY1A 5I1AB 3UTTA 2FR4B 3IU4L 3TZVB 5IJKA 2DI9A 2OMTB 1S5HC 3QNYA 4MASA 3JV0A 3ZN0A 1VQPV 1NPUA 4HJJH 4N0UE 1FNAA 5B22A 2QPFA 1KULA 1X5LA 1N7ML 2E5EA 2EAEA 4L0PB 3GMLA 3OHMB 5F9WB 1BPVA 2VDRH 2O30A 15C8L 1IC4H 1QVFU 4Z7VA 1E6OL 1N4XL 4LZKA 3MRRA 7TAAA 1ZUQA 4R7LA 2DD8L 1LEIB 3I55V 4XN9A 2QSAA 1RZ8A 1WTLA 3C6LC 3E8UH 3GKWH 3L16A 4UVCA 1H3WM 3KPSE 5TE7L 3V5HA 4LR3A 5JHLA 3TYFA 3U0PB 5EORL 4UT6L 2IPUK 1NCWH 4PRHD 5IBLD 1U6AL 5IWAO 1A9EA 4XZUB 5HTSA 3MJ7A 4R0LA 2YK1L 4POUB 5LB1A 2XHBA 1W0VB 3O4OC 5C0BD 4QNPE 2AQPA 3B40A 2X0VA 3BVVA 3D51A 4ELKA 4F8OA 1U92A 3UFIA 5IV2A 1N34B 4FI6A 3MOAL 2ICWB 3KPRE 2WBKA 4UDUA 2AITA 3CMAV 2E4FA 2WIIA 4LCCB 3VXSB 5AAWA 1MLBA 4WW2B 3QPXL 4PJFA 3D5OF 2UY6A 1OK8A 2H3NA 3EJRA 4O51A 3DIDA 4UZSA 1RJYB 4L5FH 4OPHA 1A6TA 4DOHE 1AIFB 4JQIH 3L54A 2G2RA 1NCNA 3N9GL 4HBCH 4YR6B 3SN6N 3SPVB 3TWCH 3V0FA 2AZ0A 3CJHA 1XH1A 2ZUWA 3K4ZA 4FEIA 4F92B 2DLFH 2W1NA 3LYRA 3VX0A 4BFBD 3FT0A 4K5MA 4XB7A 2K1EA 5EZIH 3E8FA 4F4LA 3S9DB 4M1DL 3QG7H 1PBYA 1MFAH 2ENPA 2WZ0A 2ZOOA 3B2XA 3NEOA 4IBSA 3T6VA 1E5CA 4MVZA 3H2WA 1FZJA 5IB1B 1NSNH 1QAWA 1A6AB 5I6NA 1PX4A 1WP6A 5BXZA 4WF7A 3FQTA 4XCEB 5KANI 1AD9A 3L5WA 2DEYX 5D6DC 4FFKA 4M6MH 4MZRA 4PSPA 2E27L 2BSSA 3BGFB 1IIKA 5K9OB 3L71H 2OJZH 1FCCA 1WS8A 2K6WA 3BAEL 3QGVA 4WK4B 2J55A 2FRGP 4TUYB 4YDJB 2WNGA 1HWYA 3LNMB 1W0YT 3D87B 4XCEA 2XFGB 3EJCA 2E7DA 2EJRA 4ZX4A 1WDAA 5EHFA 2Y07H 3MZTA 4N0FA 3LDCA 4DR7O 2HX7A 3MLXH 4JI1O 1BDYA 5CWSA 3QEGH 4OF5A 1WFUA 1KFAL 4NAJA 5FWRA 3DHPA 3W5MA 3N1PC 1IM3D 1X3DA 1CL7H 3LKPA 4JE4B 4KK9D 3W0WE 2FTAA 1I9JH 1FVDA 3P4OB 1ZE3H 3JV6B 4MXQC 3RDJA 1T0MA 2AXFB 3CSTA 4OLZL 3D2UD 5SWSB 4ONFL 1P84K 1YSCA 1HH9A 3HUJE 4ZUVA 5DYFA 4YC2B 5DLMH 2B9BA 5D2NA 4JG0H 1VPOL 2H6UA 4FE9A 3QQ3A 2ZT9B 1ECYA 1TLMA 2PXYA 2VERN 1OD7A 1YMMD 4ZFGL 1NMBL 1O7DC 1S9YA 3NJHA 2OYPA 3T77B 3K57A 3W7TA 4W6YB 5IB4A 1WZLA 3JD4A 3F00A 2OCJA 3CDGA 3KPSA 3VGEA 3ZKMD 5C2BL 4HULB 1L3NA 1BHGA 4P5TA 4L8SB 2YZ8A 1HE7A 2DYRC 2W0LA 2R0ZL 1VQOV 1RP3B 3K3QA 4KQ0A 2HJFB 4DYLA 3DC0A 1OO2A 3NCCB 4IBZA 5F6IC 5KSUB 5CGMA 2GTWA 3EHBC 1EN5A 4ZAKC 1YN7B 4Z3JA 2JIXA 4XPAH 3ATBA 3IDJB 2GAZB 1DN0B 3P4MA 4PP2A 4I5BB 1A14H 5E8EA 4JHAL 1LO2H 1F4HA 4U6TA 2D7PA 2PUSA 3BH8B 2A3TA 4QHNB 2H32B 3CU1A 3EH2A 2DJSA 5KVMC 1FPTH 3H9SB 5ITZA 1ZLSH 2P5WD 4IKIA 4L2YA 1YYMH 2O5XL 2EXYC 3NAAL 3L95B 4LMQI 2EXSA 2DM4A 4Z2WA 3FTWA 4HMDA 2UUDH 3N50A 3RNQB 4BGDA 2JDIG 5MI0C 1FS0G 1J1XH 2EJ7A 1AR1C 1T04B 1K85A 3SO3C 3IJ9A 5HGBB 4Z3TA 3VYNA 1WP8A 4OZIF 4A66A 4A7SA 3EG9A 3VI4F 1TAEA 2L7JA 2HFGL 4B9GA 4LVNC 4X6EB 4YDJA 4UOQA 1N68A 4YHLL 5C0EA 4AGOA 2FYYB 4P9OA 4WW1A 3HC2A 1C5CH 3U9UA 3NPZB 1W72L 2P4VA 1MCCA 3NJFA 3MJ9A 5E99H 3RX7A 4AUUA 4GG6E 3A67H 3ESVF 2FLBT 3KDMB 4OD3L 4UILH 4YQXH 2HN7B 4FNTA 5IJVA 1ZVNA 2FT7A 1IBDA 5DN6G 2YMTA 4P23B 3D0LB 4P2CG 3BUYA 3EYVB 1L9NA 2JK5B 5L6YL 3D33A 4U3SB 2AEWA 4L1LA 2BNRB 1EZLA 3O6MH 4MX7B 4OIAA 1O0VA 5DMGC 3K3WA 1Z3GH 4M29A 1DQMH 1YY9D 4JO8A 3ZZLA 2CM6A 4HPOL 5J56B 4HJUA 3TJTA 1G6RB 1NLBL 1ZE3C 3D3QA 3FONB 1GGCL 1B0RB 4JREB 1IQDB 2E74C 2GBVA 4W9GC 1FD9A 1U93B 2W0FA 2YXYA 5D7LE 2CGRH 4EUPH 2H9GB 2RFXA 3C60D 1VF7A 2XXGA 3NIGB 3PPSA 4NQXA 4PI2A 4POYA 2C9QA 2OMZA 2VXUL 4I0KA 5HHNB 1LLAA 1R3KA 3F65A 4OFKA 2JI1A 1RJLB 2N56A 1BM3H 4P4KD 2VC2B 2R51A 5L8JB 4ZMOA 2V7QG 4JPWL 3AG1C 1KCUH 1BJ8A 5HHOA 2D4FA 4ETQB 1MJ7H 5JWPA 1U93A 2OQJA 2W0FB 2IALA 3P3TA 2CHZA 2B59A 3M7FB 4HXAL 1XQ4A 1MLCB 3ARXA 1U91A 2IAMD 3TFKD 2VL4A 3HZKB 1PNLA 3GSXA 3LN9A 4LOVA 2O61A 2AVGA 5I1CH 4WJG3 3ZMNA 5L3FA 1I7ZA 5B7EA 1HZKA 1E27A 3QUMA 3RY5A 2NY3C 3FU7B 3J7HA 4UV4L 1A1OB 4M4RB 5GONA 2QM8A 3G08B 3VFSA 3K5MA 3MRDA 3QRLA 1HOCB 4E9WA 5DD6B 3IMVA 3WD5L 3U83A 1Y6KR 3LOWA 5HHMD 2TAAA 3NESA 5GRJL 3B8NA 5L4MA 1TJMA 5HHQA 3ML8A 3D3VE 1J8HE 1X6LA 1I7RB 5F7DA 4GQQA 4Z3EA 4FLXA 3BIBX 1DBBH 2WQRA 4PIBA 3ARDA 3BZEB 3CHQA 4JFUA 3WDHA 4BCYA 4NKMA 4PD4F 2VYRE 2KB1A 1QNIA 3UPRA 4KKPA 5C7XL 1A4AA 3BPLB 3B6SB 4XP6H 2DBLH 2IXQB 2UZIL 1WJZA 3QC5X 5AD0A 5HI4D 5E6YA 4N24A 2V9RA 3AUWB 2Z8RA 1XEDA 4UNIA 3VU2A 4BRVA 5GS0C 1N0LA 4FADA 3TTSA 3PY9A 3SDCB 5DEZA 3W0WD 2HH0H 5I6XC 5FYJD 1MIEL 1J5CA 3T65A 4NQEE 1HCFX 3Q0HA 1IE5A 2ENJA 4OZFB 1P7BA 1AQMA 1SQBH 4PJEF 3IMSA 1E4KC 1HYSC 4MD4A 3GIVA 2APSA 2FJSA 2GY7B 3BKMH 4Z95L 1S7XA 1N32B 3QE5A 4LCWD 3AWEA 3BH9A 4WSKA 2VWEC 3G4SV 3T0EC 3DJTA 5GSVA 1ZRUA 1J8KA 3M45A 3T4ZA 3QJFB 4M7ZC 2DLIA 5JIPA 5IR1A 4E5XB 4Z76B 4GG6A 3WFZA 1F45A 2PPFA 5INCB 1TJIH 1UACL 1EAOA 1P5VA 1FZOB 5LQBH 3ZS8C 1A1MB 1J1PL 5DVMA 4AVHA 2YAEA 5L7XH 2CUGA 1HHKB 1EHKB 2H0EA 2YD7A 2WQVA 5IP4A 1RPOA 4DR4B 2PPDA 2ZKOA 2YMOA 5FIEA 3UTTD 3WFCL 5FKAB 4LF3B 5IB5B 5DT1L 3UC0H 3MU3A 1UOWA 4AUJA 3DHJA 5E2JA 3QIUD 4JFTA 5BMVA 4DKFH 5BO1H 5DHYA 4JMNA 2OMBA 3RGVB 2B5UA 4I1NB 3C08H 5INDB 1KPVA 1BXUA 2CLVA 1SQQH 3KYAA 3BW9A 4WEBL 4UTBA 5T1LA 1MZZA 1QSEB 5JZ7D 3K4DA 5L9DH 1A4CA 3K2UL 1UCBL 1V54B 5K1NA 1I3GH 2N05A 1PSKL 1LO0L 2R7EA 4MLSA 4I7ZB 4LHUA 1K8DA 5D1ZA 4HX1A 4F8NA 5DUPL 5LA6B 4ZAKD 3RIFF 3SDAB 1LVEA 1QFWM 4DQOH 2OYKA 4BH7B 4XHQA 4XC3L 5CR1A 1JXFA 2HVKB 4Z7NF 1GMEA 1ZEAL 4QWWD 4PJFE 3BVXA 1XL4A 3HBGA 2Z5UA 2X0LA 4WV1B 4KXBA 1Q3EA 4X98A 1I8MB 5E94B 2FGZA 2HVBA 4XP4L 4YL9A 3HI5L 4ICXA 1IGML 4ZI7A 5H8DA 2OX5B 3CFDB 1WA0X 1RY7B 2YEQA 3Q6FB 4XP9L 3JWDH 2GITA 4PJHB 2B5IB 3P02A 4Q52A 1B0IA 4FFZA 1J0IA 3IRPX 4Z7QF 2DJMA 5D1XB 2EINB 3MYJB 5F1IA 2OP4L 4QHKI 3LTVA 4ZUSB 3ARBA 2JS3A 3D3VA 3O41B 3OB8A 4IDLA 4OUUA 4XO8A 5J6HB 1D9KC 5T33L 1MEXL 4MQ7A 2WXJA 1W2KT 3HN5A 1VQ4V 2F5BL 2XQBL 3ZDYF 4CSPA 2AJXL 2FWUA 1AFVH 4K23H 2JKTM 4PJEA 3QEUA 4GKSB 2OTUA 4X7FC 3JBG7 3VDCA 3ULVE 1Q94B 1LK3H 2ZWZA 2IFFH 1V7NH 2F5AH 4TUOA 3VWKA 4OLEA 4PGZA 5JXED 2UXGA 3VXPB 4NPYA 3GBLA 1YAZA 4AMXA 4A2LA 4PRBA 1GH7A 3JALA 4ECNA 4P9HL 4RLDA 4YJ2B 1GHFH 1MCOH 1BX2B 1CD1B 1PG7W 2YC1A 1E1QG 2QTSA 5MERB 1XB8A 3FUFA 4MD0A 2I7SA 2XI9A 3RVYA 3SDXB 3OAYH 4YE4H 4WKZA 4QHLB 9PCYA 4XVSH 1SXZA 1YA5A 4DN3H 2DM3A 4PGCA 5TK4A 4N5EC 4AZ8B 4I48A 3KH4A 2BZCA 5DC2A 4LGRB 2K4WA 4BR6A 3UAJD 1F58H 2DOSA 3CZGA 4XBGB 1G7QA 3PHQA 4RGNE 3UTSD 1F1GA 3WKQA 4FKEA 1ND0A 4I4TA 3VH8G 4ADJA 1BQRA 3B2VL 4M6OH 4WEMB 2W9EL 3D3VD 2WXGA 3T0ED 4CC1A 5F7HA 2YO3A 1P0SE 2WWWA 3CRRA 3N2JA 4UYPA 3MGOB 4IT5A 2VWKA 1F6AB 5E00B 5F2VO 4B9YA 3K2KA 2G75A 3WTTA 1BW8A 2B4CL 3II2A 1M7IB 4LHQB 1AGFA 2B4CC 2JF1A 5TH2A 4AKOA 5HDQL 4PJ8B 2V4DA 5MEQB 4LVEA 2CRIA 3KXFD 1I4FB 3FRPA 3ZDWA 4DV1B 4M61A 2APVA 1A14L 3BVDB 4WNQB 3EZ8A 4Y9FA 3ZHDA 5ACZA 4F15B 4V2BA 5F9JA 5E2TL 2QSQA 1MQKH 3C9NA 1TYRA 3PGFL 4S2SA 4AQ1B 2KPWA 4IRJB 4P2OC 4JI4O 1CJYA 1G7IB 1UURA 5EBMC 4IRZL 4YUEH 3CLFL 4ES8A 1PYWA 3CHRA 4F7MB 1JD9A 2B8OT 3H3PL 3P11H 3SDYH 3O2WL 2FLMA 4UI2A 1QR1A 1T21B 2CH8A 3PWUA 4Y19D 1WE5A 2LLNA 1AZZC 3RPBA 3W9EB 3GQFA 5DD3H 4ELDA 4WI9A 4TLTA 2J6WA 3BUIA 5C0CA 1D7FA 1H3TA 2H2PC 2ZYRA 3QEQB 4OI9A 4ZTEA 5FDWA 2F7PA 3N44F 4KZCA 2GJ6B 3K2UH 5JA8B 1JSYA 1DBJL 4AL8H 5I1KH 1D6VL 2AK4D 4OBSA 2QSCH 1VFUA 5LKNA 1T21A 3T09A 1DQQA 3B9KC 4OJEH 4HGWB 1NPJA 3M6DA 1NFKA 3U46B 3U6XA 1YSOA 3D06A 3KPRD 3BFWA 5I15H 3C5XA 2HKOA 3L1OH 2ZF9A 3HG5A 5HDWA 3HG1B 3BQVA 3RTQD 2DYSC 4JBSA 1QVGU 2EO9A 4OCMC 5TE4H 4EF3A 3IGLA 2QGCA 1REIA 3T0DA 4AYSA 1LWHA 4G1MB 1UQSA 4FK5C 3SKMA 2VXVL 1C08A 3P3NA 5FUCE 2HMID 2YQGA 1DQKA 2QV4A 3RWDB 3BYYA 4FLHA 1JL8A 3RWHB 4A38A 2COVD 5JUEL 1YCSA 4UIKH 3JWOH 2ZXGA 3TZVC 3D30A 2G3XA 4HK3J 1N6VA 2WXKA 4PW4A 1N2RA 3CX5F 4OGAC 2L0DA 1PG7H 5FC9A 1MXGA 1X59A 1LO4L 2P46B 4MVMA 3FZUC 5SV4A 1SQPH 1AFVL 1LWRA 5DHDA 5B39A 4W9IC 2X1OA 2Z6FA 4D0BA 1JZDC 1PDKB 1HR0B 4NHCL 2JCCB 1LO3H 2VZSA 3U6RA 3VFPA 3O0RL 3TBYB 1QW8A 1ZS8B 5E6IB 4NYLB 1LE5A 3ABUA 1WPCA 5DJDB 2NW2B 1XGQA 4PGBA 1MCWM 4ODWB 4MKMA 4XCCH 2P8MA 3CAFA 3RUGA 2CJ3A 2MOGA 4AQAA 3K71B 2N7BA 3E8BA 2XLLA 4LSRL 3D52A 4JL2A 1JHKL 1UA6H 2PYEB 2YJLA 4GXVH 2QPUA 3C8DA 4OCSH 5F0PB 3DX4A 4NO5B 5DJXB 1URFA 1COBA 3ETGA 1G9NL 3WNJA 1TGOA 5F71A 1TTUA 1PZUB 1QFHA 5HGHA 1PZ2A 5ANHA 2CDEB 1MAJA 2DH3A 4ABVA 4LESA 1VESA 1TPXB 3AM8C 4RMBA 3JAMN 5JA9A 4JM2D 4HWZA 1PM9A 1OSZB 5C9JB 3Q2CA 4DH2A 1QU7A 1YEJH 4LEOB 3LEXA 4I9QA 3D12B 3RGHA 1MH5A 1KJMB 4E41A 1A21A 1I1FA 2WHVA 3OKNB 5EEWA 1OD9A 1G7JA 1NWOA 3O6FB 3K03A 2CAKA 3RJQB 4EI5A 4I18A 5FM8A 1OCOB 1M1XB 5F3BA 1WD9A 5M94B 4UAOC 2LHAA 3BVNB 4QNPF 5DWUH 3O6FD 1KEGH 1JYXA 1BEYH 1JYNA 4HG4K 4TVSa 4LBAA 2RDCA 1AJ7L 3WFEH 3ZDXB 3T4AC 5HGBA 2WLZA 3SZKC 1NANH 1AZNA 4AENA 2GJJA 1X5XA 3FB8B 5IKCA 4LF5O 3L7FB 4G8IB 3WEXB 3NOIA 4DPAX 3MRPA 5I71C 4PGEA 4JF3A 1CZ8L 4D0DB 2KLRA 1CE1L 2I32A 3PDOA 4KXRA 4OLWH 1IRAY 2VSCA 3MRKB 1MDAA 2IQAA 1Y0LA 3BHPA 2YD8A 3QUZC 1U3HD 4WY7L 1X6NA 5FO7A 3D0LA 1PZ3A 1O6SA 3WD5H 3SPCA 4WWNA 1IL1A 3H1IH 4PV1C 4RQFA 3E89A 2A6DA 3D39D 5H37H 1KXVA 4I9XA 3FFCB 5E6IA 3WTYA 2N74A 3P77A 3S35H 1AS8A 4N8CH 3T0VA 4LQFL 4P5MB 2HLFD 3IF1A 5D70L 2WYIA 4Q4EA 1AJNA 3ZGHA 4BE6A 4XAWL 1WF5A 4ODVH 3RHWK 3VFMB 4ZSOE 1HNZO 3ILDA 4PG2A 5K9KB 1WBZA 5E1QA 2HKAA 4JRXD 4Y19E 1TQWA 4LSVL 5T1DH 3BCFA 1CTNA 2LAAA 2WB1A 5F97E 3VD4A 3QUXC 3CX5J 5I75C 5AOKA 2ICES 3D07A 1Z0MA 1R3KB 1PKQE 3BPLC 3A0RA 4I2XE 2CDYA 4KTDL 1KJ2L 2K7QA 4JY6B 4XB8A 5ENWB 3BABA 4J3BA 2VIRB 1DDHA 2QT6A 4U0QB 2DQJL 3K1KC 4ZFQA 4ZXBB 2V2XB 4YSEA 3DXAA 1F1DA 2HFTA 2Q0ZX 5FYKH 3KPOA 3DXAD 3GHPA 4M1GL 1OB1A 4GLXA 4QO1A 3EBIA 5C09B 3F7VC 4ZUTB 2B2XL 1HQ4B 3FX7A 2K1MA 3P2TA 4FM1A 1Q6IA 4CL7A 3G6BA 4NLHA 2NLJB 2HKFH 3BUPA 3MN8A 3MLVH 4QLRA 2QQQA 1MRDL 2NY6B 1A9VA 1GGUA 1I1YA 3N41F 1VQNV 2OXGA 2JXMB 4LKCB 3MDSA 1E5UI 3UAFA 2SODB 5LNEA 3RKDC 4G6MH 3WFVA 4LSUL 1DLFL 4O2FA 4UZGA 1S8DB 4KUCF 2VJ8A 4UVAA 3EYUL 4ENEC 3IE4A 4FL4B 2XV0A 3F7QA 1WITA 3ZMTA 2JJTC 1F2QA 1RZKL 2G2NA 3IFOB 4UTAH 4E41E 4J3OG 1IQDA 4OV5A 2VM9A 3MBEC 4YMPA 1GZPA 3DECA 3LKPB 1TQVA 4ZS6D 2D2CB 2YZ1A 4HEME 2D8KA 2NTFB 1ZTXE 3L9RB 4MLIA 4QTHB 4N1HB 4X6EA 5F9DC 4KO5A 4R5XA 2YAQA 2F19H 4X89A 2BMKB 2HJKB 3RYMA 5J8OA 3AG4B 3GB7A 4P2AA 2X6AA 1NVPB 4Q8BA 1A7OH 4G6JL 4IRJD 3UOAB 3QXWA 5ETUA 3LDBC 4HCIA 1HESA 3O0LA 1VEMA 4NKOB 3J07A 2CRYA 1E5YA 4PS8A 4N25A 5DQJB 1TVKA 2DTMH 1JI1A 4JI7B 2EP6A 4ZI8A 4YGVB 3V0HA 2GBUA 2WC7A 2Y3NA 3S8FB 4JTCB 4JFHD 5FECA 4QRUB 4UBDC 2Q68A 2WXIA 4HF5L 4ZS7H 4HGKC 1LILA 2ESVE 1X5AA 4XMPL 1Y74A 1QLEH 4L0YA 5DHVH 4U1GC 5D7LB 1TZIB 2YRLA 1NKGA 1XF3A 3UTSB 5FLXN 1UWEH 1F3RB 2ZWNA 3TO2B 5IVXE 3UJIH 5GZOD 4R2GD 5AG8A 1A7BA 1F97A 1EXUB 1UZ6F 4ERSH 1F3JB 3LH2H 1MCIA 1L5GB 1K92A 1OGAB 4NZRL 2C3VA 2L7EA 2VMEA 3FQRB 4BZ1A 4IKKA 3FB5C 2K3TA 5EO1A 3Q3GA 3BPCA 3N1FC 4ADGA 1TZIA 3HW7A 4YLQT 1I8IB 1EJOL 1ZL8B 4G8EB 1T03L 5KYYB 2VQ1A 1KGYE 1NDTA 4I50B 4PJ0Z 3VXNA 2FX7H 2IDQA 1MPAH 3ETBJ 1KB5B 5F8RC 4WFHE 4HLJA 2AJVH 1Z9SB 5BXFB 1RIVL 2Y2YA 1M57C 3MTRA 1OM9A 3JASB 1UUSA 1OALA 2AGJL 2VDNH 3PP3H 2X40A 2YICA 5IW3A 1ZLZA 1T7XA 3FTGA 4X98B 3RZCA 4ZOLB 1KN2H 4O2CA 1BZDA 3VWJB 3G7TA 1F58L 1J05A 1XGPA 4N2FA 3N1MC 2VITA 2VXQA 3C2SA 1ZLEA 5E70A 3MLPA 1BZ8A 2ZP9A 3GRWL 2LR4A 4HJJL 2ENYA 3NCMA 5F9OL 2FX9H 3OJVC 3VRIB 2A74A 5EFIA 2V5TA 2ICEB 1NCIA 1HCZA 5I5IA 5DTFA 3W7UA 4Q6IC 3VMPA 1AY1L 3RA7L 3SJCC 3GMMB 1A66A 3ZLQC 4OD2B 3GEFA 1RSOA 1A9BB 1NA8A 2PPEA 1UFGA 3F6IA 3MNDA 2OR7A 3IDNB 2XAQA 3MLRH 2HKFL 4OZFH 1XF5A 2ZIMA 1EERB 5FUOL 3OMAB 3H1LH 4NX0A 5TFSH 4Z7WB 5BMVB 4KPHL 4MQXD 1TTGA 1JGUH 2G4GA 5C6PB 4HIJB 2NNXA 4WWID 5GTIZ 2GK0B 3LXCA 2YEVB 1PQZB 4FLUA 4U1LA 2O5ZL 1JFFB 2M1KA 1LP9A 2DN7A 4XNMA 3RI5K 5B3JE 4Q56A 4RZKA 2Y06L 2YI9A 4P5TC 4R5VA 2HLFC 4X9YA 5BZWB 3U6XS 4NUMA 2JEUA 1IFHH 3GM8A 1MHPH 2QVKA 3JWNE 4YZFF 2BVPB 4UT6A 4MAUH 4J7ZA 1Y18A 3SGJC 2OIGA 2XZAL 3WHE0 4UANA 1FJGO 3ULUF 1DLHA 4PJIE 1JFFA 1PCSA 1D9KA 1BOGB 1T4WA 2JSFA 1CFSB 1ED3B 2ADGB 2GTZA 2Y22A 4ZBJA 4CS3A 1OQOA 2CIKA 1CBVH 5BR8B 1NCAH 2BNQD 1QPXA 2EKSB 5IHLB 1MFDH 4NZUH 4B27A 5L8LB 2CGOA 1OV9A 2ZQKA 1AGCB 3SDXE 1ND0B 3F7VB 1UZ8A 2DQDH 3PJLA 3CDYA 3NK3A 4BA8A 4ZOAA 4XNUL 4GMSH 4MCZB 3GMQA 3RWFA 1SYVB 2BP3A 3RFZA 1DVQA 1QBZA 5AUMA 4LRIA 3V95A 2VUKA 1HC1A 3FQ1A 3OKDB 5ADOL 3BWZA 4FYRA 5BS0B 1RZJC 5E9DB 4EIBA 5IJDC 1M7IA 2FYUH 4QXVA 3EJZC 1IXMA 4N86A 1H8NA 3U48A 1LDSA 2XT9A 2YUWA 2YXLA 3CC5A 5E0QA 2OZ4H 2Z31B 1YDPA 3F5WC 2O6FA 2AV1B 4ONGH 3MNWB 3T3MF 2ARJQ 5D6CA 2FTKA 4Y5XC 4MZ2A 1R3LA 4YH6A 1EEQA 5DC4B 4LFAO 4MB5A 3TXQA 2G3ZA 1CVRA 4PV8B 4MKTA 4B96A 1IVTA 4RAIA 1YUHA 2BS71 4LF9O 3NCYS 3O4OB 2VLJD 3ZDZE 2X7RB 4X7SH 1ID5I 3DBSA 1XEUA 2WLHA 3X12B 5KAQF 2BVTA 1ORSB 4XHJC 3L4VA 2ZKXA 3MJ8B 4J41A 1F7YA 3IDNA 3RUGE 5JW3H 3TL5A 2LFEA 5D6CB 5IJKC 4PD4J 4DW2H 4ZFOL 2OXHA 3KYKH 3QUZB 3SE4C 4XNZC 4YHIB 3LNNA 2QWRB 5F1IB 1OP9A 1S9XB 1WRFA 1B88A 1DSFH 2Y72A 1XEQA 5FYLE 5LBVA 1H8EG 4HHGA 4JZJB 5CMAA 3VXQB 1HW7A 1PZCA 4FXGB 3A4DA 1OLLA 1RUQH 4RSVA 3RBSA 1SQMA 4YJ3B 1FUNA 4OFYA 4YSRA 1AOHA 2AAAA 2JQZA 2NX5E 5CM1A 4TRPL 1MSPA 2Y6TE 1ZT4A 4YLCA 1GC1C 5JORB 1AZRA 4MMZA 5DRXA 4MVRA 4GAYA 1U8HA 4Q14A 3JV5A 1MHCA 4AI7A 1NGZA 1E6JL 2F74B 4M7LH 4LOUC 1A2YA 2IBBA 4O4LA 3L1EA 1A7QL 4DR7B 1JHLL 4GIPD 4KTGA 3VXUA 3ERXA 4K94H 4PJ8A 3ULUD 5ICYB 3NA9H 5IESL 1KBKA 1Z3RA 2GSIB 3G5ZA 3FH7A 3OKKB 3SJAC 4Y8AA 3OAYK 3O3UN 5FO9B 4PRPD 5ALCH 3HPLB 4JPWH 3CMOH 3BGFC 2BE3A 2D31A 1SY6H 3VXOA 4AG4L 4OAWA 1SXBA 3ECVA 1WIPA 1XGTA 2NXZB 4N23A 2XFXB 4NN5B 1OARL 3ARDC 4PY8J 4EN2A 5CFHA 1KCRH 4PYGA 2IADA 4I87A 1J10A 1CLOH 2A2QT 3MRQB 4U33A 2D2OA 1DSYA 2PO6A 5GW7A 3H0TB 5ABDE 4JI2B 4UB6Z 1TJIL 1FJ1B 4UUJA 3ETBF 2JCCA 3K5SA 4NENA 5E9AA 1MW1A 4G9FD 5D1QA 3HKEB 2HVJB 5CLZA 5DJCB 4IBTA 3TESA 1E5ZA 3CJJA 1P1VA 2ZKYA 4MB3A 2I27N 4MYWB 2GJ6A 1XUQA 1OEZW 1H5BB 1U8NB 3JWDC 3SE6A 5ADPL 1E4WH 1XO8A 4J3OD 5F7KC 2XQYK 2W80C 1B90A 2Y1VA 1Q9OB 3N44B 3ULSA 2CSPA 5CBGA 2YR3A 1YAIA 2EYTB 3AMLA 4KKCD 5LGHL 4DKFL 2VDKB 3PP4L 3C87A 2E5LO 2YGQA 3EJPA 3JSLA 4QNHB 5BS0D 4U4IA 5L9DL 4MGXA 3CHOA 1OSEA 2FWOA 2N7AA 2WINB 5FYLL 5F2FA 4F7MA 1GN3A 2YS8A 3M1OA 3CJHB 1M2VA 2UZXA 2AJUH 3HRZA 4I13B 4KOBA 4ZX6A 5CEZH 1F4MA 1PNMA 4FXGA 2KHAA 4G6AD 2WWMC 1P84F 3ILPA 5FM5O 1U8KB 4PI0A 3CC4V 3U30C 4H37A 5BW7C 2P22C 3K74B 4I0PC 4NBZB 4AGNA 3GXDA 4EDWL 3GMOB 4HU2A 3EJZD 4XC3H 1KOAA 1TZGL 2X6CA 4OLXL 2P5WA 4XNAA 5LLIC 3WCYA 2R4RH 3FKSG 5BVPL 3TEYA 3DO7B 1RIHL 2BPBA 4FLYA 4KK5D 4APQB 1B6QA 4N0CC 2ZM6O 2VO5A 2HRPH 4WI3A 2DH2A 3FMGH 3CIAA 1RHFA 2EDMA 2HFEB 4XE0A 3MJ9L 4JDVA 1SBBA 4XP5H 5GRZA 2BNQE 2P24B 5DQDL 3DX6B 3G5XB 4BSJA 3NJJA 5DDHA 1VLXA 2EO1A 1P4LB 4PJHE 2ITDA 1L0PA 2B77A 3OXSB 3EOBB 3FJTA 5L7XL 1J5OL 4XVTL 1TTCA 3MRFA 3MRPB 4D9RD 2L04A 3HI6L 3KPQB 4IKLA 1B9ZA 2R69H 4QOKD 5L0QC 5I0DA 4LSQH 1R6NA 3BZ4A 2Y23A 2NX5A 3DYOA 2F8VA 2F68X 1BQSA 3UZVB 4M62H 2MKLC 3UTOA 1NBVH 1UJ3B 3WGUB 3KCYA 5HYSA 5JIDA 1ETZB 4LOEA 2ZTBA 4H8WH 1NCCH 1TJGH 4PA9A 3MD0A 1BVKA 1JDAA 1EO5A 3F83A 4NZRH 3KM2A 4U0RB 5KAIZ 3GSNH 5G4NA 1FNLA 2V2WA 4U1HA 3P77B 3AK2A 4QHKJ 1AR1D 3QZWB 4JKWA 2N0MA 2YIHA 4BV1A 1PD3A 1A4KB 5IMLB 1ZA6A 5IW6A 5IMMA 1XHZA 2CK2A 4C83B 2YPVH 2Z31C 2Q73A 2CPCA 2EVJA 4IS6A 2X6MA 3UX9B 1U41A 4A7UA 3K1DA 2BVUA 5BZBA 5LGUA 1G1XB 5IV2B 1PAZA 4KO9A 4CJ1A 2X89D 3L9EA 4OLZH 5C0AE 4HCRA 2D3VA 1BQ5A 3IGAC 3LXAA 4HV8B 3TV8A 1ANUA 4WTXA 5IW6B 4EZKA 3QS3A 1E65A 3GUTA 7PAZA 1DDHB 4ODBD 4OCWL 4X7TB 4WTZA 2MNWA 3QWOB 2F95B 3RVTC 2DKUA 4HWUA 2GAZA 3BPOC 3GRGA 4ZMLA 2DY2A 1AIFA 4HW6A 3NCJH 3SODB 1QW9A 4EQ2A 2ENQA 3UJTH 5HI4C 4B95C 2W65A 3WS6A 2HRHA 4QXGH 1A3ZA 3WO4C 1U97A 1FVEA 2PWEA 5JHDB 4N1CA 5J13C 1C5DB 1E8YA 1XGYH 2W9DL 4JO4L 3B2EE 3EHBB 1WGVA 5I1EH 4HF5H 2VLJE 5I5MA 4J3VA 3HMXH 3BEVA 4Y9CA 1QNMA 3SOTA 1KDJA 1I85C 1OW0C 1DHKA 4PCYA 1F4NA 4ZK8A 1C5BH 1HINH 1CICC 4WENB 2YAPA 5AZEL 5BV7H 1EHAA 1KXTA 3CGTA 2W65B 4KK8D 5J9PA 5JHDA 2CKBH 1I7TA 8FABA 5HVHB 2MHAA 2EYRB 2IV9A 1WFTA 4S0HA 1DCEA 1GCFA 1P4BL 1FAIL 4HIHB 1N8ZB 3HOGA 5H37A 1QLFA 1OM3H 4QRQA 4UCFA 2CO7A 4GRWF 5AKTA 4K8RD 5FGBC 4X1IA 1YPZB 2Z7YA 4ZQTA 3PHSA 4X65B 2WOYA 1XREA 4OJCA 1L1FA 5DURB 4FQIH 5CJXC 3BFOA 5HYFA 5GRYA 4G8IA 3RU8H 1Z66A 1I7TB 3P2BA 3WEXA 5I1KL 3OJDA 4AV5A 1JPST 4BKTC 4X4XB 4NYLA 2XAHA 5SWZE 1MWAH 1T0OA 4RMUA 4RWYH 1AI1L 2RJMA 2VAJA 5EBMA 4C83A 1M9SA 4JRYB 1X7QB 3PWPE 5SX4H 1TSRA 1V3JA 2WNWA 4XC1H 3I85A 5KVDL 1P4RA 2Q5BA 4JFDB 35C8H 1CF1A 2TRHA 1TUPA 4Y4KB 3KBFA 4ELMF 2OCCC 4NQED 4HEPG 4YDIH 1NIDA 1CK0H 4FMVA 4P3WA 4X8XA 2BP8B 3M7MX 1WZKA 4LHJB 5BMFL 2XPGB 1IX2A 4XH2B 4BKLB 5AW1B 3CB2A 4QY8A 4U6YB 1WBZB 4JJHA 2GCYA 2A77L 4TVPE 1PKXA 4A7VA 3DGEA 1K3EA 3HZKA 5E2VL 3V79C 2QVIA 1NCDL 3QAZB 2VZTA 1O9WA 4Q9RH 2ADPA 2OL3L 2YQBA 3NRFA 3WKNA 2IH1A 5IROA 2A3QA 2Z9TA 1U42A 3BP5A 3D85D 3GXUB 1INEH 4W4OA 3DUUA 4QRBA 3GI8L 2EDKA 2DQFB 5KN5A 1I9IH 3OSKA 1TQCC 4YSDA 3WFDH 4CVZB 2IGFH 2J44A 5E1HB 5D7JA 2HJDA 4YIPA 1YN7A 3DXAB 2X42A 3EOTH 5FGRA 3D08A 3EW3B 4AHCA 2FBOJ 1A6UH 4QRTB 4ZXBD 3NZHL 1OB0A 1IAMA 5J1AA 2VXTH 3L48A 4GJTB 5DJ6A 2RCSL 3ECWA 2YAOA 2FJGB 3NQIA 3O65A 1E90A 2XX1A 3IFXA 4Z1MG 2OSWA 4C7UA 2EDOA 2XWZA 5H4ZA 2OMUB 3F6JA 3N2GA 1QSFD 1AG0A 3ARED 3JUYA 1YC8A 4XNQA 5IVOA 1FI8C 4FFZL 1ZTXL 3PL6D 5I15L 4FNUA 1J5DA 2P7TB 3MA9H 1RK1B 4MS8C 1SKVA 5FCUL 4LFHD 1QO3A 1KLUB 2CO1A 3N27A 3K5NA 3LV3B 3OAUH 4MJIA 4P4KA 3GVMA 2H6PB 1SN2A 2JCWA 1JN6B 4LB8A 4LE8A 4PWJA 2BFGA 1A6ZA 4JQXA 4G8FB 2I60L 2IMMA 4X50A 3U4KA 2L7QA 3FFCA 3L7EA 3VVWA 4EI5C 5A2CA 1EWHA 2FCBA 1G6UA 2NXYB 1I31A 4V33A 4AYGA 4WFFA 2J6EA 4WGWB 3FFCD 4ZW7A 4HNAA 1JGIA 4LBEB 3ZHSA 2BH0A 5KJ4A 1KEML 1T1WA 1E3FA 3ARWA 4BAYA 4URTB 2G38A 3VXSE 3X11B 1T66C 4F6RA 2NY5H 1CGWA 2PWDA 3PP3K 1INDL 4YHPB 3DIVA 2ADQB 1XH2A 5I6XB 3FSWA 2QSTA 5DHVA 1KLFB 1DBMH 1NUFA 3DTUB 1F5WA 3OE7G 1NGQH 2VLKB 4H0IA 4JASA 4LBEA 3I6GB 4FNRA 4BUHA 5FKPA 3GGWA 3O81A 3WFEL 1NBYB 1Q8MA 4D7SA 4XMWA 3UC2A 3KGUA 1CLZH 3V8CA 3S88H 3JAKB 4RX4A 1TVKB 3NSXA 1I8IA 2R2HB 4PA3A 2YXMA 2BSEA 2WQWA 3DNKA 3IPFA 3FTUA 4Y5YB 3MTXA 1RP8A 3KPOB 2CKBL 1OAZH 3LVEA 2UUCO 1A65A 1PZSA 1NINA 1MAMH 3NYKA 4RQQA 4WI7A 4CS2A 1JNJA 2ATPB 4KMTL 4XT1C 4I9WA 3IB4A 5EZLB 1P7KA 3FPXA 5E4EC 3ML9A 4EJ1C 3GGWB 3NZUA 3WG7C 1Z9SA 4I9WD 4JK0D 4K0KB 4XNXL 4NWUL 3EVKA 2F66C 3DGGB 3KR3H 1M1KW 4FLSA 4I18C 3UTSA 4PJAB 5AD0B 3DRTA 2M7WA 4DV0B 1MHEB 1RFDL 3GMRA 4IRZA 4MA1B 1Q0EA 2AXGA 1FXVA 1FDLH 4HSQA 1Y6NR 4GAJH 1F18A 2B7DT 5D96C 4W4NA 4F7EB 5I8CA 4N8CL 4XX1G 1T7WA 1EJ6A 2VN5A 3A8TA 3WGVB 4DVBB 4LFBB 3FTXA 4OLYH 5B1JC 1MRCL 3T65B 1CFQA 2I25N 2UXDO 1QR4A 4RAUA 3WS3B 4RAVB 1IGIL 4OGYH 3U9PL 4X5XA 2F08A 2EDWA 1KY6A 3ARZA 4M1DH 5EB9A 4HK3N 1BVOA 4X4ZA 4NKIH 3CFMA 1ZTMA 4UAHA 3SD2A 5FNVB 2PYED 1R19A 5BRQA 2GUZA 5TTRA 3T6ZA 2DWEA 3G6DH 1OZTG 4JFFD 2AK1H 4FQJH 1CMOA 1OT1A 1EX0A 3C5ZB 4H8PA 3CRMA 3HHRB 5BVPH 1Z1WA 2HJKA 3O4LB 4N87A 4DP6X 1PZ5A 5IR1B 5CA0A 1CDHA 3BIAX 8PAZA 4WV1C 1Z5WA 4H44B 3B09A 1S7QB 5ANMA 3DX1A 1YO4A 3WO3B 1CCZA 1QKZH 2E7BA 4OZIB 3LNGA 1KIUB 3BHBA 3KYNB 4ONOA 4F58H 5J9PC 3V9EA 4ZRGA 2VQEB 4L3ED 1YNKL 1CPYA 4PDLA 2P80D 1IBLO 1MCHA 1U8LA 1NCTA 4HIXL 5DMIL 2JK5C 4NP4H 4HVBA 2C7UB 4QXUL 1ZPLA 5AL8A 3SJVD 3N5AA 4KOCA 5IMOA 4CBCA 1C7TA 25C8L 1G7MA 3VVVA 5IHBA 4GBXD 3KMDA 4ZMVA 1D9KB 2ZOLB 4LLWB 4HAMA 4UT6H 1GS6X 5H94B 3PWNB 5DC9B 4CBZA 4K3DH 3RIAF 3P2DA 4ZUWA 3I2CL 2V5YA 3IAQA 2YUZA 3B4NA 1KCVH 3QRGL 4NQDB 1D5ZA 3UABA 3LSOA 1LK3L 5EO1B 2UXBB 1N0NA 4KY2A 1LP9B 3ZHTA 1CLCA 3GXTA 4PIRF 4F33B 2LP7A 1NMBH 2Z92B 4Y1TA 2ILLA 1I0HA 1D5IH 1KT2B 4HLZG 4NNXB 2A83A 3G9VA 4MDIB 3KG2A 2Y48A 1NUNB 43C9B 4ZBMA 3ZPDA 4J6IA 4DGVL 2XAFA 4N2IA 1ZJBA 2RACA 1FC1A 1CFMA 4K73A 2OZ4A 1G84A 3JCUZ 2BNUB 2JKXA 2R9AA 4A7TA 4BSWA 3WN5B 3O11A 2UZYB 4GKLA 3QJZA 1E8XA 3LSQA 3OTFA 3DO3A 4GFXA 3R7QA 3WE6A 2GFBB 2GJRA 2NY0C 3SY0A 1M3IA 3BGAA 3TGUH 4X65O 2DYPA 3QORA 3CX2A 4NQQA 4FYTA 3VXTB 3ZBHA 4PB9L 4B9PA 1RZJL 5AWNH 3KNBA 2NNAA 4DO2A 3MACL 1FG9C 3KLAB 5DUBA 1ZHNA 1MFNA 5J3HD 5FF6A 1B3JA 3H1HH 1KELL 1G1CA 1MG2C 3UIYA 1RULH 4Z18A 4BFIA 5ELIA 4JI3O 3RYCA 5GJTH 2BS8A 4Y4HD 1THAA 2XG4B 4GP5B 5I6PA 3CMGA 5KG9A 4KRNA 1UH3A 3BUTA 3LKOB 3B9KA 3FH8A 3IC9A 3DX8B 1AXSB 3L2NA 5C0DA 4R8WL 3QQNA 3JALB 4KMTH 1JF1B 1L9OA 2EDNA 4KJQC 1TMCB 3R1GL 3EYUH 5KSAA 3VQ2C 4H1LH 4HETA 4WHCA 4XXDA 4E0RA 2CTQA 3IAYA 5D5PA 1N5YL 5G4OA 1S7RB 1E3XA 2O72A 3K8MA 1K4DC 1G7MB 1NAKH 1ZWIA 4QXWA 4QCIA 1JFHA 1L0YA 5FLVA 5IW1B 3LXUX 5I9QC 3CVHH 4GAYB 5EUOF 2XRAH 1UM6H 3DX3A 5FK9A 3ZTJG 3UMNA 4HCRH 2QHLA 5EU3A 2H26A 1R6VA 4MQ7B 2NYKA 5MEND 3Q2LA 2CTRA 4CH4A 2BCKA 3KPPB 4NN7B 4OLYL 4XAKE 3VI4E 1F1AA 4JG1H 1MCNA 3L2MA 4NQVB 4YZFE 4M3KB 2LE9A 3MODL 4Y2OA 1BQZA 5ANME 3WNMA 2H0PA 2ZNXA 2EKJA 4FHKA 2DWDB 2P9RA 3UO8B 2HSIA 1QYGH 2QDVA 2ZX6A 1K4DA 2HUEA 3F7PC 3SGKA 4FULA 4NHUA 4LPVA 3E86A 3N3EA 4MD5A 3U4BL 3FHQA 2QKSA 4I1RA 4X20B 4J12A 4A04A 1P4IL 1N6QH 1IJ9A 4LKXA 4PA4A 3OLGA 4R4ND 2PPAA 5ID0A 3TX4A 4HMEA 2NY2B 1EEYA 2DIAA 4HUUA 4LLAA 4GZRB 3A6CH 1A7NL 1P1ZB 2FBJH 4KVPA 1JP5A 5GS1C 3TA4D 5AUMB 4EZMA 3BT2H 3I50H 4LVHC 1PYWB 1YEFL 2MFNA 2DM7A 3A6BH 2GTQA 2NRDA 4H88H 1CD9B 2R9IA 2E9JA 3ZHLA 1XB3A 4XDJA 2XKUA 3RDTD 4X20A 2RQEA 4I0PB 4YSQA 5I19H 4HIPA 1OGPA 4JVUA 4P30A 1X9LA 3KJ4C 4YNYB 1KJ2A 3AC0A 4CU6A 2XYBA 1A7PH 3DROB 4CVXB 1VQ8V 4GUPB 1FHNA 5AB1A 1T80A 3LKQB 1I3UA 1I53A 4HAFA 3U2SA 1RZGB 4L37A 4Z23A 3AMKA 5EBWC 4G9FA 5DRZA 5HBBA 3WFDL 3FCBA 2AEPL 3KYOA 4YBQC 4EUPG 1O9VA 2I9LA 4OM1H 2WBJA 2FATL 4XTRC 4QE7A 5A16B 3IK2A 3Q06A 2EDFA 5EOCH 1HE8A 5IEHA 1QFUL 4J39A 3IJ7A 1LK2A 2CUHA 4YHZL 5EPMA 2Z0UA 1P2CB 3SJVB 3WMQA 5GS0L 3ZQ9A 4PJ8C 4JPKH 4DZ8B 2IJHA 1NIEA 1BFOA 1RJYA 2E3VA 4X0NA 4YHLH 5A6MA 5IFJB 3RWIB 4IIQB 4AEHH 1JCVA 2VCOA 5EU7E 3A47A 3K5RA 2PR4L 2XA3A 2X9XA 1AB3A 5KSBE 4HV8A 3L5JA 3SDAD 1EGJA 1HJBC 3FYIB 3PWUB 2EYTA 1PLBA 5CJBA 3AXLB 4DUWA 3FB7A 3QAQA 2KSDA 4FQXA 4H0LC 3RVUD 4L87A 1DVYA 1IC7H 3GTVA 5DMKB 2ED9A 5MENB 1BFOB 4WO4A 4N2BA 3DX6A 3ZDZF 5JOPE 1UZ6E 5FW7A 3MV8E 5C0AB 2QTOA 3CPLA 2JKLA 4L5FL 4X99B 4JYCA 1RUML 4MJ6B 5DZ9A 2HTLC 3TVMC 2VB5A 1DEEB 2NUTA 3B3BA 2QBWA 4R97B 2JKIS 1QR9A 4OFYD 3HR6A 3SKJH 2HTKD 4ISVA 3X3FL 2B9ZA 1HNZB 2HAZA 4IHBA 4MJIE 4L1BA 3UTTB 3D1MC 1SOQA 5DO8A 2FR4A 5BJTA 3K0YA 4JAVA 2AMGA 2NSQA 4GKZA 4F7CA 1UJ3A 4EBQL 4HS3A 1CQYA 2O6DA 4K94C 1URLA 5IQLA 1JYWA 1AQKL 4TNFA 1QLNA 1J9SA 3MKGA 2UU9O 4Q2ZB 3A22A 3AS2A 1GKFA 3GC3A 2DMHA 3RNQA 3S88L 3CCHB 5E23A 4ISVB 5EIBC 1GIGL 1A4KA 2GVYA 3OV6A 5IMLA 1YNLH 4BFOA 1BIIA 1E2ZA 5A2AA 3SYOA 4HJSA 1IU1A 4DW2L 1SDYA 4L1HA 1RMFL 4MAUL 1TJXA 3ZSSA 3T3PE 4GQZA 1NIFA 2VDKH 1CTOA 1MIMH 5GTHZ 5C08D 1U8IB 1N2RB 1E67A 1F51A 1A6TB 3CXDL 1M9WA 3ABGA 5C08A 4JLRB 1UB6A 4M8VA 2WLMA 1AAJA 3IJ4A 1MFDL 4OD3H 1RPRA 4UILL 2EUVA 1XH3A 3ZX6A 1MNUL 1P7QA 2MNUA 3FQUA 1FYHB 2I5YL 5CILH 4PG9B 1G0YR 2A9NL 1D5BB 3MA7A 2F7IA 2Z4QB 4FQLL 1KG0B 2NY0B 3GSWB 3O2VH 4NZJA 3SKOB 2A6KA 4J4PA 3P0VH 5DVOA 1GPOH 1SRDA 4JRFA 2V2WB 4JLRA 4NGHL 4TQ8A 3MRCB 4FQCH 4J6RL 3QIBA 5DO2D 3MBED 3ROOA 2VTFA 5GIRB 1AD9B 1N36B 5ICZA 1FG2A 3P54A 3PXJA 3SYQA 2C4FT 2N1KA 4FTVB 2V3EA 5AW4B 5CINH 3ZBMA 5BR8O 4K3JL 4KTYA 3GSWA 1QBMH 3QIWC 2F53B 4LSVH 5FGSA 4FXKA 3WB0A 1D9KD 1KKDA 3MUGB 1KB5H 2JKWA 3F8UB 3GWKC 3AU0A 5D1QC 5IKCB 3G6AA 2IC2A 2RH0A 2F23A 3IGAB 4X7SL 4M9OA 4XODA 4TQEL 3T0BA 3TJEL 4QIWF 1RP9A 2QLVB 4I9WE 1AY1H 3RA7H 2FYVA 5JPMC 4HLZH 4EI0A 1Q5OA 1Z5VA 3GRWA 2RD0A 1GJUA 3AQDA 5BZDA 2O26U 2L3BA 1XQ8A 4IRZH 4YUEL 4UTBL 2ID5A 2G5UA 5J1AB 4LU5H 3DV4B 1R3KC 3U11A 1OQXA 3P0YL 1QFPA 3L4ZA 1NDGB 4I4WB 1TCRB 5DJZA 3VW3H 5T5NG 3CXFA 1E79G 3G08A 4PJIA 3TA3B 5D5MA 1DVUA 1DN2A 2ARHA 2G60H 4EI6B 3OX8A 2DQ0A 4A2FA 3RY4A 1QI5A 2PCFB 3MBWA 1SBSH 4NRYB 2ZOKB 4LAQH 3W39A 3B9KD 3L17A 3JXAA 3FUNA 2NTFA 2XICA 3JT2A 5CZXC 5CBHA 5F7DB 1SHWA 3OL2A 2HVKC 1K72A 4MHHI 4UT9L 2RN9A 1WWWX 1L0NH 4ZMYA 3K79A 2DDQL 2CBMA 4TQHA 2CJSA 4Y2DA 3QZWA 5EYPA 1A7QH 1NFDA 3KPNA 1JYVA 2HZHA 4ALAC 2JI2A 4ZODA 1QD0A 3F04A 4QXTB 2V2XA 1J86A 1QSFE 1HIMH 3PDDA 4QHMA 3FDWA 1KNOA 2E76C 1JXDA 5IZ7A 4PYHA 1WHPA 2YGVA 3VD9A 2YPLB 1B4JH 4Q6YA 1EEZB 2VLKA 3O3EB 5J89A 2YAMA 4O5LL 3FB5A 3NEXA 3R0MA 2ITFA 1ZJAA 3SCMD 4HJGB 4TMPA 3LEXB 3CFNA 5FCSH 4ZMZA 3WENA 3HCVB 2YA0A 3ARRA 5EEUA 5E8OB 3CD6V 3KPMB 3SIKA 2BFVH 3G04B 3OKOB 3UBHA 1CU4L 3NFPB 3OLIA 4W9LC 5JHLH 1FZKB 2LU3A 2NQCA 3RVWD 4XPHH 1LXMA 5FM5M 4CUCA 5ENWA 2FDBP 4OIIL 4LDCA 3VB9A 3E6HA 2DMBA 1ZDQA 5GISL 3L6FA 1H3GA 2Y7LA 2H1XA 1ES0B 2O1AA 3EJTA 2IPUG 4PBXA 3V4UL 5EU5B 5CBEA 4YFDB 2BSBA 3D4YA 4XCFH 2BXZA 2ALWA 1YJDH 1T22A 3T4YB 2E75B 5EU6B 5DMYA 2A0LD 4ZOCA 1E40A 3IDGA 3QNZA 3TA3A 4BYHA 1O7SA 2GPZA 4F5CA 3D09A 1BVZA 3E6HB 1G43A 3OPUA 1CT8B 4E36A 4HQQH 2D4DA 1UCBH 1Y6MR 4GAGH 5EOTA 4RO2A 3FB8C 4AEFA 1OAYL 3RWRD 1N3NB 4J3TA 3VQMA 3D05A 4DV1O 1KJ3H 4HWBA 4JM2C 5E6SB 1YMMB 4N2KA 1IAKA 4UM8A 4X8JA 1K8DB 3GJFB 2MQGA 1U3NA 3GLZA 4OJFL 4LH6A 3HE6B 4XOEA 2HMIC 2FZ3A 1BSMA 2MOVA 4DZBB 4FFYL 1PZ5B 2P4KA 3OM3B 1RJZA 2Q8BL 2HJLA 4KGJA 4N8VB 3UBXA 2ICEA 4FS0A 4DP5X 2F58H 1TFPA 4RGOL 2VKXA 1HNXO 2P80A 1FYTD 1NEPA 3MV7E 5T3ZH 3QNXA 3WYRA 1FV1A 3NT0A 4WFAV 1I85A 1BREA 1KNOB 1OW0A 4MX7A 2X4SA 4MZIA 3VWKC 1NBQA 4NSKA 3SEPA 4B60A 5IGXH 4HG4J 4YVNA 1UYWH 2CR6A 3BT2L 5EF3A 3APNA 4OX9O 4DWHA 4P2OD 3S5LA 2WOBA 5AVQB 3S8WA 1GN4A 4LQ1A 4ZT1A 1P5VB 4AYFA 1N18A 3HFFA 3QNXB 1F4XL 5T33H 4LU5L 3DRTB 4ELMB 3I6KB 3QA3B 2R83A 4GB9A 4XVJH 1B06A 3OFNG 1NGYA 4FP8L 5EUKB 4ZG1A 3MOAH 1U3HC 3WUZA 4EIZC 5D9SA 4F7EA 5EEXA 2LFRA 3LN5B 4B53A 1G0XA 5AQ0A 5I74B 3WLWD 2Q1EA 4CMHB 5FGCB 4Z7WE 5TDPA 1AGBA 2WLNA 1YJ9V 2PO6C 3FRUB 4PJGA 4DR1B 4WU7A 1CPUA 1S5HA 1AHKA 1A6PA 1BECA 2ZWLT 3PYCA 3VXPA 3ZY7A 2JCCE 2QVFB 3TLRA 2N59A 2R9HC 4ZIBA 3I6KA 3QA3A 3BEWB 2ZX8A 1R24B 3LKSA 5EU4B 3TV3H 2FD6L 3V4PH 1TG8A 1Z5YD 4B6ZA 1TEGA 3SQRA 2ATPA 1UGNA 1XV8A 1WFMA 4RESB 5LA6A 4YE4L 4G7VL 1BG9A 1AS6A 4HUXB 4K55A 2YBGA 4JFOA 5C71A 1YEJL 3FOLA 4GY4A 2YWZA 4X6DB 2V37A 4ZX3A 2J8UA 2GSMB 1VFOA 1JJUA 4XMKL 4HZLB 5A2FA 3ZE2E 1UKTA 4H1LB 4APQD 2W8CA 5MEPB 4DP8X 1SXAA 5I0ZA 4NDMA 2ZOUA 3QUGA 5B5EZ 4OLXH 5IREA 4U3CA 4PJHA 1AHMA 3A0BZ 4K8RH 3VXSD 4NKMB 3ZMRA 1NCOA 2FX8L 3I75B 4NQDE 1AG6A 2B1AL 2DQJH 1FF5A 5KX5B 3IETA 4FLZA 3CC2V 4WK2B 3FTGB 1D7DA 3FO1B 4RDBA 4H40A 3MBEA 1DBKL 1FFOB 2EIZA 3ZRSA 4QHUB 3V9CA 2J5LB 4R90H 2OYLA 2ZCLH 4J4PC 3MV8A 4PELA 2AJSL 1Y7VA 2QQKL 2TSAA 1G87A 5I19L 4WFFD 1H2KA 2H8PB 5AOIA 2A9HA 3M7OA 2AQTA 4UOW1 4LP5A 3RKDD 3VXRD 1ZMYA 2G0KA 4OZHA 5HFMA 4HFWA 4NOFA 3E1ZA 4JREC 4YHIA 2YXVA 3HUJA 5GGQL 1J5IA 1YEHH 1FFOA 2AQ1A 2DYRB 5DA4A 4NN5C 2VXTL 4GKJO 2WLIB 4GW5A 4Q6IA 2IW5A 2Y2TA 4ALAL 3RU8L 5KW9H 4PGDB 4FXKC 4NNXA 4DKTA 2BINA 5FHAH 1FYJA 1TEYA 5CCGE 2WA3A 4BK5A 4KXDA 3V0VB 1TMQA 3ECBB 2NTSP 5I18H 2HT2D 1WFNA 1KUMA 2Q76A 3W2DL 3MGAA 4KXZI 4N2HA 4ODVL 3TTYA 5ERWB 3INUH 3G6EV 2VAAB 2ZSVB 3JV4A 1U58B 4HK0A 3P4NB 1I1AA 2GJPA 3NCEB 4MJ5A 4A2GA 1HOEA 3CC5B 4IQHA 4IBWA 1X5GA 2Q8BH 3VGHA 4NZDA 3HG1A 2WQ8A 4OJAA 2DLEA 3APDA 3TWCL 1HEHC 1AR1B 1OCWL 1H38A 3UG3A 5A6IA 3TEZA 3JATA 1TQCB 2YFOA 4XBMA 3LHAA 3SGJA 2IAND 3W3BA 2XG4A 4G8GB 5DHMC 1VMGA 2UWEB 3RRQA 5JNYB 3S37X 1TENA 4C58B 1RKRA 2GHWB 4LEEA 2VGLM 5ITFB 4N8VG 3AG3C 2E9IA 5HGAB 1LYQA 5JIQA 3CFJA 1M71B 3N2KB 2F54B 3IN2A 1SVBA 2IPTH 4R2GC 3MFFB 3IKCB 4L3CA 5EK0A 2DLTA 4Y9GA 4MNQA 3LRSA 2LV4A 4AG4H 1M57B 4LRIC 2PGGA 1ZA3B 2NY7L 4OVUA 1DBAH 2RA1A 3BH9B 4BFKA 4DP4X 3MJWA 3GUFA 1NCWL 3B9AA 2HLDG 4KKQA 3UBXG 4BUGA 2WJ7A 5GS1A 3FT1A 5KYXA 3EF4A 1P2CA 1TOXA 3US0A 4GO6B 1JJOA 1D5AA 2DQUH 5KSVA 3IWUA 5FF6B 3D7PA 2OMYA 4JN2B 2YA2A 4WFEE 2FWOB 3QJTB 3GSVB 3RWJB 3S6CA 3TNNB 3WKML 2A74C 3B2UD 1A47A 4AM0Q 2IGLA 1B04A 4GLRI 2EO7A 2MK3A 1E4WL 2WY3B 4P07A 4L23A 3VQ1C 1Q1JH 3PWNA 5I0VA 4Q6IB 1N5AB 1SDDA 3ARFD 1FO0H 3A24A 3C5SA 1IBGH 4G11A 3KPLB 4FQIL 5I1DA 1KN4H 4PVMA 5MENA 5DEFA 1U8CA 4NQDA 1OL0A 2XKNB 1GAXA 2X9YA 5CILL 2GC4C 4GX1A 2WNXA 3L3KA 4YSPA 3S3DB 2BW5A 4GP8B 4U1GB 4NVPA 4E9QA 4GYBA 1N64H 2JTYA 4NFDA 1DJZA 1OSPH 3BAWA 4K15A 3SHSA 4RDQG 4D0CB 1YHQV 5GZND 4FFBB 1JWMB 5E9DD 5EZIL 3VAEA 5SX5H 2AKRA 5FHBL 4HIIB 3TOPA 3Q43A 2BCKB 2C1OB 1DBML 2XG5B 4KKZA 1T0PB 1TO4A 2AJ3B 1G7JB 1LO5A 1QLRB 2DMCA 1HYRC 1TF4A 2P8LB 2KZBA 3S34L 2E7LA 3C9NB 2VDQH 2JJ1G 3K6FA 1ADQL 2UXNA 3UYRH 1CFNB 3MGTA 1ZVSA 4IKJA 5AB0A 2BNUA 2LGWA 2CKNA 1D5MB 4H25B 4G9FB 5DRZB 3BA8A 2ITEA 3CDZB 3KAAA 2JE8A 2CNZA 3QWQB 3UAEA 4RFNB 3GJFK 3ZL4H 1JOYA 5HI3D 1X5IA 4F8PA 3RWGA 4NP4L 5TK2A 3B9VA 4TNVK 1CI3M 3QJUB 4LDEB 2UUBB 2XETA 3B7SA 3D34A 3HC0B 3U79A 4F3FB 2F9BT 3LPOA 1XAKA 1U8IA 3R06A 4MJHA 3DX9B 4WFGE 1U36A 1SFDA 4L2LA 1RZIA 1AGDA 4PGBB 4YLBA 1K4CA 3CRCA 3W56A 1EAQA 3QXDB 4FNQA 3V4VH 2CDFA 2VQTA 3MROA 4PLKD 5ESVB 4HLEA 2GSGB 3RVVD 2F54D 3LKQA 4Z78B 1X4YA 2VN7A 3PJSB 1EJFA 5DYOB 4FZEH 1M7DB 3O6KH 3QJQB 4XCYB 1RD6A 3ZHQA 4PY7A 5LXTB 1A7RL 2VQEO 3E8VA 1AGEB 5HDBE 3L73H 2CU9A 1KJ3L 2IANB 1XL6A 2DQIH 4KZ0A 4F7CB 3OQ3B 4PW3A 2OTWA 2QLYA 3CCMV 4W68A 2V9QA 1EDQA 3NCBB 4Z7UB 1BMFG 2DL9A 1EFRG 3AREC 4G3YL 4LAJH 3X2QB 4R6UA 4Z7QE 2NNUA 2D7OA 3DURA 1DR9A 4FFTA 2CCLA 4P9MH 1KBBA 3POHA 2HJFA 4NXKA 1GM7A 5IJ9B 2D7MA 4NEHB 4UQAA 1EN4A 4DN3L 3FB7B 3OMNB 4FQXB 4GRLC 5L8KB 4DO4A 2E4TA 1B0WA 2Z4TA 4I4TB 2MQ3A 2AHYA 3A4FA 4TULH 1DK1A 1US6A 1IGFL 2D73A 2GUYA 3QK0A 3THMH 1F4YL 1IC0A 5KJRH 2DICA 5I16B 4PCKA 1FFRA 3V7AG 2DD8H 4L8CB 4KY1H 3ZZSA 3H9SA 3LQZA 1U8OB 3QNYB 1BT8A 2BJMH 3OF6A 5D1ZC 1OE1A 2YN3A 5IY5C 2A6IA 4NKGB 3ESNA 3IDIA 4QD2E 4G28B 4RFEA 5D5MB 5TJWK 3GS0A 4LPCA 3QZLA 4DUZB 1F4XH 2HFEA 4PJBE 4Q0XH 2WGNB 5DS8B 4QYAA 5B3NA 3G6JA 4HT1L 2IQAB 3T9WA 4WNQA 3T2MA 4GRMA 1OGAD 3L13A 3V0WH 1HAWA 2E8YA 2HFGH 4UMSA 2A7BA 3VXRB 2VUOA 1SETA 3MLWH 2WPGA 3OKLA 1OF2A 2QFRA 2MSPA 3BEHA 3BP4B 3L74H 3P73A 4K7PX 3II3A 3MNMA 2WBXA 4L9LB 2GB2A 1I3GL 1FYTA 2VERA 2V9UA 1K4CB 1CZ8H 4YSSA 2P4AB 2QGBA 5TDOA 4GG6F 1LP9E 1OSZA 2XUWA 3LKNA 1FG2B 3V4PL 3OWRA 4QE9A 4EMZA 1SLXA 3BO8A 3I3EA 3P4LA 3QEHB 3DSFH 4QXTA 2J8UF 3P11L 2GSGA 1XAUA 4Q9BA 2IO5A 3ARQA 4DEPC 4X9QA 1OSYA 1BGXL 2PW2A 2LT9A 3JSSA 3S5YA 3MV7A 4X4YB 3L4CA 2WUBL 3EJUA 5L3GA 3EBAA 4NM4L 1WJ3A 1FFXB 1ZLWH 2YLHA 3PL6C 4OJFH 2X4PB 2XTJE 1E9OB 1F11A 1FRGH 1J5HA 4MYPA 1UC6A 3QQ4B 3S36X 2E59A 4MS8D 2X10A 4XN7A 1N33B 4JDTL 5B4MD 2MIZA 2RGSA 2VDNB 4KROB 2UUAO 3V6OC 1X44A 3VA6A 5CGYD 1JGDA 1CFVL 2K3HA 1H3PH 2QQLL 2R2BA 2RFXB 2Z35B 1O9HA 2FMLA 1DZ0A 2X4UB 2Z93B 5DMGD 4AXWB 1HS6A 2IV8A 3MLUH 3MRGA 3GZQA 3IDYC 5EEVA 1OB1B 1YVWA 5EG6C 2X6UA 2XZZA 1EANA 3VFGH 1XI1A 1IGYA 3CE2A 1BQKA 4N1EA 1O5DT 1TCMA 4M93C 2E9GA 1SF5A 4B5EA 1JPFA 1Z9NA 4PH8A 1H15A 5KBPA 2YARA 2KS0A 3B8MA 4M5YH 3FUEA 5DUMH 5GXBB 1WAAA 1E7VA 3IJHB 1A7PL 3V7MA 5E56A 1ZSPA 3O2DL 4OM0H 3RTQC 3VGGA 2VLLB 1TTFA 4FABH 4MS2A 1YEIL 4A7QA 4TSFG 1UXMA 2ZNWA 2DI8A 1U8OA 5GGVL 1EVUA 2J43A 4R7DB 1H9VA 4JFXB 1LE9B 1KLGA 3RNKA 4AIEA 3MV01 2PLTA 3V4VL 2X2UA 3NRQA 4ZFFB 1QQDA 5IQ7L 2VLME 4UDTA 4B3RB 2UXFA 5D7KD 5E6RB 5HHOE 3T0EE 5B39B 2VQ1B 5KW9L 3VWJD 1JXJA 1R6KA 4R7CA 3QZBA 3P9WB 1BAWA 4M43H 1W6WA 4TM9A 5TE6L 1ACZA 3P30H 2YRBA 4I0XA 1ETB1 5C09D 5F96L 3WY4A 4JHWH 5DLLA 5AZUA 2RAMA 4GXFA 4S1QL 4RGMB 4U3JA 4DR5B 3ZL4L 2F8OA 1K9MW 1FYTB 4S0TD 3V7AE 1DQDL 2PP7A 3GSNB 4UDTB 1OAQL 3NEEA 1E50A 3N42F 5JDSB 1TZGH 3T0AA 2IJIA 4TUJB 1BF2A 4LPYA 3A4AA 3IMUA 4AVIA 2YRZA 4XMKH 4IIZA 4M48L 4X1KB 5FCUH 3HR5A 4XN5A 4BCZA 3GXIA 1VIWA 3FF7A 4FQ2H 4N6QA 3CSYB 4W9JC 3UBXI 4J2QA 5C8JA 5L6YH 4X4XA 2WSPA 2XT1B 4RAHA 1EH9A 4JRXB 4KXCA 2J2ZA 5HY9B 5AAWC 3M17A 3VRIA 2NUPA 4DQAA 1KCSL 1NM9A 3P3PA 1JZFA 4LHUD 5D1ZD 4D9RE 1NH6A 1SJEA 5CD5D 4R2GB 1S76D 4X7TA 1DQLH 4OFPA 2FT6A 3PGFH 2VN4A 3MHZA 1SQGA 1IAIH 1NM4A 4RNRB 5H6QA 3TO2A 4D9LH 3CYOA 5HYSG 2ZAGA 3T8MA 4CMMA 4PJDB 1T22B 1FYTE 5INCA 3IMRA 3IGAA 2WWKT 3N55A 5AZ2L 1F6FB 5JW5B 4K2UH 2Z65C 1VACB 2ZXWB 3VH8B 3NSDA 5I66A 4DR6B 3RB7A 3CZFA 1D5XB 2HRGA 4FNLH 5K93A 3EYQC 5HHQB 3DDGA 4I50A 3VXNB 3BX7C 4QRRA 1KTDB 4LCIH 1OCOC 1J11A 4L3AA 4PG2C 4YOKA 5I1CL 4A7GA 1J9TA 1ECZA 2YGPA 2QJDA 2FZ3B 3BZEA 5CA3A 1QHQA 2BSDA 3FXIC 4AY0A 3V0EA 3F05A 4Y7MA 5C0FB 1NVPD 2DQ6A 4KVNL 4DGIL 4HNAB 1BV8A 3NFSL 4GRWE 1SZTA 4L3EE 4Q4IA 4BWUA 1IC7L 1DJGA 2CIKB 1YMHA 2WKGA 1V55B 5IEKB 3KLSA 3PNWA 4Y5XA 5HGGS 2J4WH 2YQ3A 5F7MC 1JZEA 1JQ0A 1VB9A 2V5SA 1SQVH 1XNQB 3LNIA 1FDLL 4FQCL 1BA9A 2H2SD 1S0VA 3HG4A 4G70B 2FJGA 4PMEA 5PCYA 3WXVH 1ZPUA 4OB5H 5J11C 2ZDIA 4HFUL 1NCBH 3JTBA 3U7AA 2VDRL 4I3SL 3QUMH 4Z0XB 3GIVB 2Y69C 3QQ3B 1LGVA 4NUQA 2WN2A 3D48R 3IU3A 4GUCA 5KVDE 1QPKA 4C54A 4N90D 3ZL2A 2B59B 1IAKB 4UM8B 4WJ5A 2R2HA 1P4IH 1LDPH 1X5HA 1SOSA 1JMKC 3I74A 1SN0A 4GPVA 4AGPA 3QZMA 1WSST 5CR8A 2AW9A 2ZJSL 2VDQL 4G8FA 4KL1A 1GOFA 1MUJB 4LVOB 4M7KH 2NY6D 3HS0B 3HZMB 4R4FH 1K7DA 4GRWB 4YBHA 4PRPA 3M17B 2K9UA 5J2TA 4B7IA 1H6UA 3QQ9D 1FZOA 3K6SB 4IIQC 2P47B 3ARBB 4QY8B 4V1DA 3WXWL 1MJ7L 5LOVA 3RL2A 1FV1B 3ESUF 4WI5A 2Q9OA 5FYKU 5AZEH 4Y16C 4N26A 1DP0A 3SDDD 3CH8A 2IH3C 5EBWB 4Q9CA 1FO0A 3HMWL 2QWNB 3HKBB 3HS0A 1Q7YW 3O9WB 4TOYL 5EO9A 2KKQA 1Q94A 3CFKB 2VDML 3GZPA 5FFOA 3ZE1F 3OPZL 4LAQL 1ILUA 1QVOA 4MMYB 5HP5A 2VDLH 4MTFA 4R3SB 4L3FA 4S1RL 1SQ2N 4QLWA 5GRVK 1N59B 1F56A 1XSIA 3TVMB 5J4MA 5ISZE 3EGSA 3PP4H 4PJCF 3CFBB 4APXB 5MERA 2CK3G 1JGVH 2CPUA 4IMLB 4AEIL 2AHIA 4JS7A 3WJLA 4HH8A 4UM9A 4LLUB 2F53D 4YBQD 1T5WB 3TGXA 4BH8B 3EXAA 3HS0C 3QNZB 4QRAA 4U1JA 1CGTA 4WU7B 5E8DL 2BSKA 4DW0A 3JWNC 2UU9B 3T1FB 5BUGA 2YKLH 3VJ6B 3ZRCC 3H85A 4GIAA 4XP6L 3ZKXB 4NKDA 1UM4H 5GHWH 4H26A 2YXFA 3MBEB 3JTTB 3ARBD 2NT0A 5C6TH 2FQFA 2AC0A 1UTDA 3Q48A 3C5JA 5CLWA 1UFIA 2HVJC 3QB7C 4BIOA 4KDTA 3M1BA 3EBHA 1FH5H 5C09E 1SXCA 4RAUB 4N3TA 3RL1B 5I1EL 3QCUH 3LEVL 1UH4A 4WHYH 3MNZB 1RU9L 1V05A 1MI5D 1MREL 1A0QH 4W4LA 5F0JB 1SOKA 1EZVH 1G6RH 1HHKA 3GXNA 3LIZH 3ZTNL 1NC2A 3JTTA 2ZOLA 1UPGA 1A25A 4KO7A 4HUVB 3CFIC 3CH1B 2Z8WC 5DVPA 1GGCH 5A2LH 4Y4HA 3T2LA 3ZRFC 5I17B 1IBHA 4KKBC 2BOLA 5F44A 1IVLA 2R1YA 2IIJA 4G7YH 3HKEA 2BJML 2HVJA 4RGMC 3RGVA 4D8OA 1V27A 3QARA 2HTKC 2O5YL 4TUOB 4Y19B 3OD4A 4MXQD 1FN4A 5IB3A 1YQVH 1UACH 4JI8O 2WNKA 3GMPA 3OZ9L 4ABUA 4UCSA 4JFYB 2Y9RT 4F2MA 2R2EB 1LE9A 5I76A 1UWGL 5J12B 5IOKA 1C12B 4IDJL 4CC4A 4EKWA 4NHCH 2DDQH 3AS1A 1UM5H 4UUJC 4JY5L 3RHWF 4W1TA 3ABLB 1L5GA 2EEXA 1Z9OA 3IS1X 3CFKA 3L4XA 3J80N 2P3YA 4LCYB 1D6VH 2ZX9A 3HAEB 5I5JA 5EC2B 3JVGC 3QQDA 3DK0A 5B7MA 3AU1B 2V2TA 4XC1L 5E9DA 3EYOB 2I5YH 2HLAA 1S5IH 4PWFA 2B1HH 1PLAA 4ZMNA 2OX5A 1GZQB 3EXLA 1KSRA 1KGCD 4JKNA 5D1XE 3ZO0A 3FT3A 4I77H 3LSOB 2C5DC 3WN5C 5FEBA 4J3XA 1ZHNB 3HHSA 2WXMA 1HKLL 2AJYL 1N34O 2VDPH 5C07B 3D0VA 1YUHB 2CO6B 2HLAB 3NIFE 4JPQA 3SGIA 1ZLVK 1X4XA 5KS9E 5MEPA 4LHUB 5D1ZB 4D9QD 4EFBA 4PLOB 4AKQA 3B7RL 4Z3GA 3HS9A 1ULVA 4R4FL 2ATKA 1XGUB 2L7UA 4NQSA 5ITBH 1DLBA 3ZYIA 2XNAA 2QM7A 3Q2WA 3EYQD 3MXWH 1WCBB 1JZ7A 4XVTH 5KJRL 5JMOC 2FBJL 3UKMA 3UCSC 1J1XL 2QPDB 5EFIB 4P2ZA 5TQ0L 1MWOA 5ISZA 7PCYA 1SZXA 5GGVY 4LCUB 5HJDA 3S48A 2R4SL 3ZKND 1MAML 3IFLH 1K5QA 4JY4B 5EEYA 3HG2A 3DGCR 2VXSH 4HYTB 4PUBH 1H8HG 1GS7A 1MI5A 4K8XA 2YK1H 1BVLB 1FLRH 3BN9C 4KZDL 2ZZUT 1KPUA 2AJXH 2ATKC 2M2DA 3MNVA 3P9LB 1MCFA 1RAMA 3RYFA 2XTAA 1D5RA 5KVGL 1UFUA 5EF1A 3AT0A 5E8PA 1Y67A 4JVPA 3OC8A 3ZMEA 3RTQB 1S7VB 3ZRWB 5IBTL 1R0AH 1LUVA 4OM1L 4CH5A 1ORSA 1Z9LA 1BVLA 3V5DA 5D7IA 2ZIDA 2XG5A 5L2JB 1GYWA 3AITA 3GMOA 3Q8BA 4WNJA 4Z7UA 3FO2B 2OTUB 3FB6B 1EEYB 1UKQA 3B83A 4X66B 5K33A 2FE0A 4FCHA 1OAQH 1Q9KB 1QTYT 2FAUA 4AE1A 3QZOA 1YY8A 3BXNA 4NI6A 1WB7A 3FD9A 5T3XL 2FEEL 4QUOA 5CKGA 2BSRA 4X7DC 2CA4A 2VXQH 1FFPB 1BQHB 2MMXA 3I9AA 4K4KA 4PJXA 3UGXA 4AV4A 5L2JA 1AZVA 2ZNIA 2UWEE 3MLTA 3PHAA 4OTXL 4WKZB 1HNWB 1AH1A 1G9MC 4JCLA 1FJ1A 4UUJB 4KKBD 4Y4FC 3EOBA 4ODSH 1BMGA 2X3AA 4JDZB 1KEGL 2PI5A 3OB0K 4N8PA 1HL4A 2DW4A 1IURA 1A8ZA 3AXIA 4GYCB 3CN0A 4H2AA 4MNHA 1PY9A 1UA7A 4WUKH 4OZHF 4NO2B 5C0JB 2DQTL 1I8MA 3FUMA 1HJCA