1QLEB

Cryo-structure of the paracoccus denitrificans four-subunit cytochrome c oxidase in the completely oxidized state complexed with an antibody fv fragment
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
252
structure length
252
Chain Sequence
b'QDVLGDLPVIGKPVNGGMNFQPASSPLAHDQQWLDHFVLYIITAVTIFVCLLLLICIVRFNRRANPVPARFTHNTPIEVIWTLVPVLILVAIGAFSLPILFRSQEMPNDPDLVIKAIGHQWYWSYEYPNDGVAFDALMLEKEALADAGYSEDEYLLATDNPVVVPVGKKVLVQVTATDVIHAWTIPAFAVKQDAVPGRIAQLWFSVDQEGVYFGQCSELCGINHAYMPIVVKAVSQEKYEAWLAGAKEEFAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE POLYPEPTIDE I-BETA
publication title The Cytochrome C Oxidase from Paracoccus Denitrificans Does not Change the Metal Center Ligation Upon Reduction
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/immune system
total genus 61
structure length 252
sequence length 252
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 1999-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1qleB02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1qleB01
1XMEB 3NSFA 1J9QA 1J9SA 2PP7A 4M3HA 2QT6A 3QJSB 4HHWA 2JFCA 4YSEA 3TA4D 4G7RB 5PAZA 1A4AA 2IDQA 2XX1A 2GHZA 1KYAA 1GS8A 1ZDQA 1OCCB 2IDFA 2UXVA 1M57B 3DIVA 3FYEB 4X4KA 4E9WA 3T6XA 1BYPA 3QQXA 1X9RA 3S3DB 4FAAB 1IUZA 2XWZA 4RH4A 3EH3B 1MDAA 3V9EA 1JXGA 1TU2A 3WI9A 1PNDA 4BDVB 1RKRA 1ZIAA 4A2FA 1OCZB 2XV0A 3GXUB 2PPAA 1JZGA 2HLEB 2YQBA 1AZCA 1DYZA 3ABKB 1ZV2A 2PPCA 2FTAA 2XV3A 4W1TA 4UANA 4AZUA 2IDTA 3H56A 2FT7A 3NT0A 7PAZA 5B7MA 1AS6A 2DV6A 2HRHA 2HX7A 2I7OA 1B3IA 5B1AB 2FT8A 1CUOA 3MBWB 3S3CB 2VW6A 1NDTA 1RZQA 1E5YA 2IH8A 5B7EA 1E30A 2XLLA 4WKXA 2CCWA 3FS9A 3GDCA 4GP8B 1BQ5A 3CZUB 3SQRA 3OQRA 4M4RB 4E9YA 4YL4A 1PZBA 2QPEB 5B1JA 3AG4B 3NJLA 3D12B 3CG8A 1RCYA 1AZNA 4HCFA 4E9QA 1AOZA 1JERA 4YSAA 2IDUA 3PAUA 1SNRA 1AS8A 1KV7A 1UATA 2Q9OA 1AANA 1QNIA 5I5JA 4CSZA 3T71A 1L9PA 4DP5X 2CUAA 1ASPA 1ETJA 5I5IA 4E9SA 8PAZA 2OJ1A 5TK2A 1OE2A 3FT0A 4JHUA 4KO7A 3NSYA 4YSTA 1BQKA 3UADA 3KW7A 1ET5A 2VSKB 4Q89A 5B3SB 3FSAA 1NTDA 2DYRB 1PZCA 1BXAA 2YAMA 3FU9A 4A66A 1IBZA 3FQYA 3X1EA 1JXDA 3QJQB 1TEGA 1AZRA 4KNTA 1AIZA 3FSZA 3NJFA 2PPDA 5F7AA 1SHXA 4DP4X 2PP8A 2TSAA 5F7BA 2VMJA 3X2QB 3S8FB 2YAHA 2FQFA 3WKQA 2P80D 1BYOA 4BXVA 3NJNA 2VN3A 1JVLA 1GYCA 1AG6A 1CYWA 1KCWA 3RYMA 4DP7X 2IWFA 3UABA 4MFHA 1SFDA 3T6ZA 2BW5A 3ABMB 2HZHA 3X1GA 2R7EB 4HALA 5I5MA 1N70A 2XXFA 2AANA 1BXVA 1AR1B 4HIPA 1ET7A 1L9RA 4KOBA 1J5DA 4HAKA 4K9JA 1XB6A 3DKHA 2J5WA 1XB3A 1DZ0A 3MX0B 2UXGA 4AX3A 3OMNB 1WA1X 4YSOA 1JOIA 4KNSA 1SHWA 1SF5A 3G5WA 4GXFA 4G7SB 3QPKA 1AZUA 4E9XA 2PLTA 5AKRA 3PCYA 3WKPA 3NP3A 4A2GA 1PLCA 1AACA 2H5UA 4DPAX 3TU6A 3U25A 5D4IA 3H4HA 2EIKB 4WTQA 5TK4A 1FFTB 2AZAA 1E5ZA 1PF3A 1J5CA 3WIAA 2IWKA 1QLEB 4DP0X 4G70B 1E65A 1OE3A 1WA2X 1HAUA 5ANHA 2A3TA 1KBVA 3T6WA 3NSCA 3CVDA 1PMYA 2DYSB 1IKOP 1I53A 2VM4A 1MG2C 1IC0A 2MTAA 1ADWA 3T9WA 3UGEA 1EZLA 3WNIA 3AZUA 1SDDB 1PY0A 3AW5A 3H4FA 3ABGA 2AZUA 1N68A 1L9QA 1WS7A 3CDZB 3X1FA 5I6LA 2BZCA 1AZBA 1RZPA 2ZOOA 2VW7A 1A4CA 3N2JA 2XUWA 4A2EA 1XB8A 3QJRB 1M56B 4EF3A 3UAEA 2J55A 4FA7B 2GC4C 3N55A 1KCBA 1JZHA 2VW4A 3FU8A 3NJGA 2AFNA 1R1CA 1L9SA 1NICA 2UX6A 5AZUA 2ZONA 2YARA 2AVFA 1GS6X 4TXVB 2FT6A 3AG3B 2PPEA 1EHKB 4NAJA 4AI7A 4KO9A 4P5RA 2XU9A 3FU7A 5IY5B 1W6LA 4G71B 2BWIA 4AKQA 5I26A 4DP6X 3ASOB 6PAZA 1SJMA 4DP9X 2HX9A 4DP8X 3PAZA 4DP1X 3ABLB 2UXFA 1HFUA 1PAZA 2LLNA 2YAPA 3PAVA 2XYBA 2EIJB 4GY4A 3ASNB 1FA4A 5I6NA 5B1KA 1A3ZA 1JZIA 3AG2B 2YAFA 1PLBA 1ASQA 2YEVB 1KGYE 1L9TA 2P80A 1AG0A 2ZWNA 1WAEA 2YXWA 2VSMB 1MZYA 6PCYA 4W9ZA 3SBRA 1GSKA 5I6OA 4G72B 4JKNA 2RACA 4YSPA 2BP8A 3X1BA 1X9UA 3NJJA 2BP0A 1BAWA 2BW4A 2EIMB 2CBPA 4BWWA 1GS7A 4YVUA 4QKTA 2YAEA 4KO5A 2J56A 1WA0X 1JZFA 2QPDB 1ILUA 1SFHA 3NYKA 4GYBA 4A2DA 4YSRA 1TKWA 3QJVB 2FQEA 3AY2A 4G7QB 5EHFA 2BWDA 1SF3A 1AQ8A 2HRGA 2HXAA 4HCIA 4HCGA 4CSPA 2PCYA 1NIBA 4HZ1A 1NPJA 4E9RA 4GP4B 4NB7A 3FSVA 3SBQA 4UAHA 2WO2B 3S3BB 2R7EA 2BZ7A 5AFAA 3CVCA 1NIDA 4L0PB 2XXGA 2FJSA 4E9VA 1MG3C 1ILSA 3EHBB 1TEFA 1NIAA 4YSSA 5A7EA 3C75A 1V55B 1GY2A 3ZDWA 2EINB 1IBYA 2GBAA 2QDVA 3OMIB 4YSQA 4KOCA 5FC9A 3NP4A 3FQ1A 3ERXA 3L45A 3NJIA 3OM3B 3TASA 5B1BB 2I85A 5I28A 4QLWA 1ET8A 3BVDB 3JTBA 1GW0A 2B3IA 4BWTA 1A8ZA 4PAZA 1JVOA 3S8GB 2TSBA 1GY1A 3IN2A 4ENZA 4YVNA 2GSMB 1NWPA 3OD3A 4JHVA 5I6KA 1BQRA 1OOWA 3DTUB 2WO3B 2OCCB 2IAAC 1L9OA 4P5SA 3TBBA 1OE1A 2PCFA 1KDIA 4DPCX 4BDVA 2CJ3A 2YXVA 4DPBX 1WS8A 2X88A 2UX7A 1ID2A 3PPSA 4F2EA 2CALA 1CYXA 2CAKA 2IH9A 2W88A 5D4HA 1A4BA 4N4YB 3HB3B 2XV2A 4A2HA 2DWSA 1A65A 1E67A 2BO0A 3KW8A 1ZDSA 1NWOA 1PNCA 3AG1B 4YSUA 1NZRA 2FWLB 1SDDA 2QDWA 1KBWA 1PZAA 3CVBA 2B08A 3EH5B 2FQDA 4NERA 4PCYA 3CDZA 4AKPA 1V10A 1F56A 5I6PA 3PXLA 1PLAA 3IN0A 3HEIB 3IBOA 1NPNA 2GI0A 5E9NA 4BXSV 1AS7A 2I7SA 3ZX1A 1PCSA 3FU7B 5B7FA 3WG7B 3TBCA 4BK5C 2N0MA 2YAOA 4YSDA 3QJTB 2IWEA 3NJMA 3FPYA 1JZJA 2HX8A 5D4JA 2GIMA 1GR7A 1ZIBA 1QHQA 2YAQA 1URIA 2JXMA 1VLXA 2XVBA 3ZBMA 4F7KA 1OCRB 1ASOA 1W6WA 4E9TA 7PCYA 2X87A 2DY2A 2FQGA 1BXUA 1NINA 1HAWA 2WSDA 3SBPA 3JT2A 2PP9A 2IDSA 2E86A 4F2FA 4DP2X 3OMAB 2W8CA 9PCYA 3FPXA 4HHGA 2BP8B 4UF7C 1W8EA 3T6VA 5B1JC 2BP0B 3NSDA 3FQ2A 3FYIB 4Q8BA 2NRDA 2UXTA 5PCYA 3GYRA 2DWTA 2Q5BA 4N8UA 4A68A 2EILB 2XX0A 4KNUA 3V9CA 3WNJA 3UAAA 2ZXWB 3EF4A 1NIFA 2OV0A 2J57A 1FWXA 3UACA 5LDUA 2Y69B 3BQVA 1JZEA 2FNWA 2MRYA 1V54B 3IEAA 4YSCA 2BHFA 2H3XC 3NJKA 3X1NA 2PPFA 3ZIYA 3QJUB 1T5KA 1MZZA 1J9RA 1BEXA 1KDJA 3FSWA 2GB2A 1J9TA 4BWUA 4AKOA 1OF0A 1M9WA 2JKWA 5I6MA 1CURA 1YLBB 3IE9A 2Y1AA 1OCOB 4ZK8A 4KO6A 1JXFA 1NIEA 2VM3A 4GP5B 1AAJA 1CC3A 3NJHA 3EH4B 1ZPUA 4A67A 2H47C 2GC7C 1OV8A 3PLYA
chains in the Genus database with same CATH superfamily
3RUGA 4WI2A 5BXFA 4JFHE 3T1YB 1XCQB 3DUUA 2QE7G 4CRPA 1RK0A 3NVQA 4HIJA 1BVNP 1NCDH 5JH7A 1XGTA 3NIDB 2CO6A 1K3EA 1XX9C 2O5YH 4G8GB 4YL9A 1AD0B 1AHMA 2OSXA 4PJXA 3MRHB 5CN2A 2NY3B 3TEWA 1JTTA 3CSXA 3CCVV 4DUYO 2JCWA 2AF2A 4AQ8A 1N0LA 1O9GA 4ODUB 1W0WA 1V54C 2DQGH 4OW6A 1BEYL 3FYEB 4RUFA 3ZMVA 2WTPA 4JRYB 3GIZH 4RDBA 5T1MB 3QB7C 2LU3A 2VXUL 2C1OB 2DI7A 2IAMC 2NY2D 2UWEB 3S3DB 4GINA 4FEIA 3QIWD 3SQOH 5BQDA 2WSKA 2EH7L 4MX7A 4AIEA 5C09A 1ZHBB 3ALWA 3G9VA 1J0ZA 1EJ6A 4JO3L 4X5PA 7TAAA 3L2MA 5DJ2A 2BSKA 2Y22A 3PWPB 5I1CH 3QCUH 1Q6UA 3ZKQD 4PJIA 4YDKL 2NY1B 2X4QA 4R90H 4HSQA 1VF5B 1PZ2A 4G2KA 3FUKA 3QDMA 3AXIA 4D8PA 4GKZA 1M3JA 2FT8A 35C8H 1CUOA 3MBEC 3RB5A 4JM2D 2ZYHA 3CSYA 3MAQA 3HB3D 2JS3A 5LGNA 3ZQWA 3ESNA 4Y5VA 2MOGA 5DLML 3CZUB 4DKFL 5LMUB 4GLXA 1EHXA 2LE9A 4GSUA 1XXFC 2NY0B 4PA9A 3B3IA 4FD0A 4LCVA 5IQMA 3X14A 4HCFA 4HU2A 3WU2Z 5E8EB 1FXVA 1I94O 1HDMB 4PV8A 3GBEA 5IVXE 2VL4A 1LNUA 1ZVNA 5IQ9B 4JFYA 1AO7D 1KV7A 1FO0A 4XBEL 2J2ZA 4U6XA 3BZ5A 1GYVA 4DHLA 4CGUB 5JDSB 4HEPG 1FFQA 5D72L 4W9HC 1F02I 3BH8B 3F7VB 5CGYD 3FT0A 4YIQB 1CL7H 2VXVL 2JVDA 1H3WM 2VIRA 2WP3T 1FVDB 1WDAA 3IF1A 2BXYA 4N2DA 2VLKD 4XPBL 2EEAA 2L8AA 1L4IA 3NAAL 3ZE2E 1I5XA 4EI5C 2IU0A 1QLNA 3OKNB 1P4LB 3NTCH 1NTDA 2MJWA 1NC4B 2C9RA 4OAWA 3GLZA 3QHTC 4JFDD 4TOIA 4ODHH 1AIZA 5E08H 1D7CA 3V6FA 3HG2A 3MKKA 3QCTH 3B1UA 2HLAB 4X9BA 4U7SA 2V7QG 4LF7B 1MAMH 3STZC 2VMJA 3ZPDA 3KWTA 1CXFA 3CJJA 2JDIG 2V4DA 4KMTH 4I89A 1KCUL 4Z7NE 2LVCA 5C0BA 4OFYA 1I7ZA 2N05A 2QFRA 2Q0OC 4P5MA 3CHQA 4I3RL 4MAYB 3TJHC 3GSNB 1RUKH 1LGVA 1UWFA 2DTML 2GKIA 5LAXB 3W37A 3ZBHA 4N5ED 5IHHA 3CXDL 1JVLA 3QIBA 5DJZA 3UFIA 4G6KL 3WENA 2GJZA 1WIPA 2Y6TE 4DN3H 1I9JL 1TFPA 2VNCA 2WCPA 5J1SC 3HE7D 4HDIA 5KANG 3ARBB 1KMIZ 3D36A 2ZXGA 1SBSL 1EXGA 5EBWC 4FQCH 2ZYSA 4QD2E 4GYCB 2YS8A 1LWHA 2NXZD 2NYYD 3JSNA 5BY1A 4XTRD 4KOBA 3Q1SH 2VDKL 4M1DL 4U1MB 3HMWH 3ROOB 4X7DC 3DSFL 3HMXL 4XPFH 5MHSD 4LNUA 2IO5A 1UYWH 1M93A 5C0JA 2GBTA 2PN5A 3TCUA 3KPMB 4PRBB 2XJLA 3QQ3A 3IXTA 3KLDA 4EMZA 1U8NA 1A9VA 2FEDD 1AQDB 2RALA 2JB6A 1TSRA 4BW5A 4GI9A 1KYOF 3K5NA 5JYMA 1IGIL 2KMWA 5IVOA 2ZP8A 1KCRH 2QSCL 4NQED 3VFWB 2OMXA 1NSNH 3N6YA 3TCTA 1AACA 4F7PB 5ICYA 3TU6A 5D4IA 2IC2A 4QY8A 2J8UB 5EO1A 3EBAA 3CHSA 3MZTA 4IMLA 5EZJB 4LF3A 4GAAA 1XZ0B 1J5CA 1NAMB 1OZUA 3GHBL 1YEHH 5AKSA 5I2IA 5JDJA 4N9OB 3BPNC 3KVDD 5K39B 1CLOL 1D5MB 1FJ1B 4C4KT 5C0CD 5CSBA 3CH1B 2DYSB 1IKOP 3Q5OA 4DXWA 2K6ZA 4PJDF 5DS8B 4ZXBB 4NN5C 4DFIA 3KXFB 2CH7A 4AEIL 1QBZA 4GS7B 3QR0A 1EZLA 3L3KA 4HX1A 3MOBL 2IGTA 4PTUA 3ARGC 1UB6A 4JM2A 2ZE7A 4R6ZA 1FRGL 2VABB 1C1EH 5D2NE 7FABL 1IGYA 5F70A 4CH3A 3WY3A 4BCZA 2FUQA 2YGOA 4FXGA 3MZGB 4S1DD 4WJKB 5E1HB 1YEDA 1CXZB 1EX0A 1NGYA 3RJOA 4H0HB 4ZPVB 4OCNC 4LCCA 1R3IC 1HHJB 5FXCH 3P4NA 1KCBA 4UUJA 4K8XA 1W0JG 4LPYA 3RT3C 2AFNA 1AO7A 3MN8A 5JOEA 3W81A 5CUSH 3EJQA 4PYGA 5DD0H 2E7DA 4G1MB 2DDQL 3O8XC 2E75C 4LCWB 3WNLA 3IDGB 4QHUB 2GUYA 1EHKB 2FGWL 2DB8A 4RFEA 1GAFL 1TR7A 1XSOA 2VZOA 5E2WL 1KULA 4OJFH 1QR1A 1M05A 4FQLH 2VLKA 5JXAH 4MRCA 3VYPA 4BIKA 1HIML 2DI9A 5DHDA 2XI9A 4FQXD 3K71A 3GMQA 1LO4H 5LBQA 4H5SA 1TVHB 4HMEA 3GO1H 1HFUA 1YYML 1T5WA 5IHUL 1S7SA 1JK8B 2OTUA 2JK5C 1K3ZA 1YA5A 2D4FA 4BR6A 4FZ1A 2L7UA 3TIEB 2MQGA 3OF6D 3AGWA 3GBML 3OPZL 3V0JA 1MPAH 3LKNA 5GGTH 4NKDA 4NKIH 1ZS2A 4RGNB 1KEGH 4O51B 4PREA 4LF8O 1P4RA 1WAEA 2R9HD 3WU1A 1B9KA 4QTIH 3K5RA 4DYLA 3TF4A 4QO1B 4IKIA 5IUSA 3T8XA 5KBNC 4NKQB 4LEOB 4MS8D 3CLFL 2EVHA 3U7YL 2VAAB 5TFSL 5D5MB 5I1KL 1E43A 5BO1L 3HI1A 4NDMA 4CVZA 3U0WH 2NR6C 1ZA6A 5LQBH 4YE4H 3HE7A 3PL6B 3UT5A 4BWWA 3EOBB 1ONQA 5AZEH 2AV7A 3I6KA 1INDL 2XAQA 3QS3A 5TF1H 3SPHA 2KERA 4QXUL 1T1XA 4B7KA 3N3EA 2OMYB 2JKRM 3KPNA 3SY0A 2C4XA 4YSRA 4P57A 4YJZL 2Q6AA 4DRXB 1YN7A 1GYUA 1DN0B 5IF0B 4HXAH 2QDOA 3NFSL 3MNVB 3KM1A 4HCGA 3SKJL 5DT1L 2P22C 1NIBA 3SO5A 3DV6B 2QADD 5J2TB 1U95A 4HXBL 4OJAA 4PJ9C 4XP1H 3TFKC 3V0IA 2XASA 3ZHDA 5ABZA 2Z8VC 5EOTB 3W7WA 5C0GB 1DTOA 2IBZY 4AXWA 2X2UA 2A6DA 4WFED 5A7EA 1ES0B 3RVVD 4NQEA 3VG9C 2AITA 3FRPB 5E4EC 4D9LL 3OTFA 1N34B 1ZSPA 1CTOA 1VZIA 2IOIA 2LJ2A 2VLLA 3QDJB 2VDRB 4HOZA 1KOAA 2V7HB 4DV2O 1PSKH 2XXCB 5ACZB 5LNEA 5AW8B 1U4EA 1NL0L 1BMFG 2IDCA 1CDHA 1D5IL 4NR1A 1D5RA 2EC8A 3UIYA 3CFDB 2DQ0A 1GOFA 4OV6F 2DEXX 4UCOA 2E6PA 1JVOA 2KHAA 3PGDB 3GRWL 4PAZA 4Y2LA 4PI2A 4KRMB 3B3BA 4JI3B 2WNGA 1XR9B 5JW5B 5K1JA 1P4IL 3WD5L 2ADIB 3WIIH 4Z7OF 1NMCC 4ZFOB 5JHLL 3LZFL 3VXQA 2FB5A 3CXCU 1G6RH 1YHQV 2IPKA 4PRPE 2XBZA 1I3RB 2OMZB 4NC1C 1CIDA 2GW5A 3FMGL 1U9KA 2YUAA 2WIIB 5EZLB 2AXTZ 2VLME 1Z2GA 1M90W 3EBGA 4NP4H 4PV9A 1IT9L 3U0TB 1KDIA 2CNYA 1YTFB 5G5DA 2V2WA 4JM4H 3ZKSD 4BKSC 1N3NA 1NFDB 2Q2EB 3EO1A 4G6JH 4B5EA 2IH9A 2W88A 3W9EA 3FB6A 3WN5B 2DMXA 1G1XB 4HBNA 3LNMB 4NRYB 4PG9B 5HHPB 1PJWA 5EU5B 4NYKA 3KAAA 1BLIA 2J20A 4L4TE 4QRRB 3A24A 4NSKB 4X4YB 1NBMG 4ESKA 2CBOA 3TBWB 3LB6D 2QSQA 1FZOB 4JGUA 1T7ZA 2WINB 4H44B 3ZRFC 4PJ8C 4Q0XH 2F43G 5B1BC 4IIJA 3DHMA 2HTKC 2FQDA 2EADA 2NX5D 1F90L 3MBWA 2LR4A 4YBQC 4F37F 1S78C 5ANMB 2P06A 1Q81W 4FQXA 4PJFA 5C70A 4GT1A 1JNNH 3HG1B 4RMTA 4Z5RB 5I6XC 4HMDA 3MLRH 1PYWB 5EIBD 4BH8B 4FJZA 5IBTL 1YPZE 4KQ3L 4OLYL 3DJZA 4XN7A 4UT7H 3CN1A 2HP8A 4JY5L 1AOHA 3CC2V 4YSDA 2ZOKB 2LFGA 3I6LD 3ARTA 3DYMA 3OF6A 1C5CL 3QQ9D 4X7FC 2XKNB 4XBPA 3GT6A 3P2BA 3VE0A 3O2WH 3QXVA 1ODUA 4LOEA 5KS9B 2UZXB 2G75A 4I48B 3OHMB 3HNSL 2XVBA 5IHWA 2L6LA 4MD4B 4AGNA 3MUHL 2VMCA 3U83A 3W1ZA 5DD5L 2BY3A 2CIIB 3BGFB 4FFVD 1X9LA 1HAWA 4JHAL 1AE6L 5LGTA 3DI2B 5IFJB 2UZIH 2IDSA 1AIFA 5AKTA 5T1LB 2BDNH 3QAZB 4B95C 3ARXA 4ZUWA 2YEVA 2WGNB 1FQ9C 3KZIZ 5K59E 4B3TO 1YUHA 1C8QA 3OG6B 1ZA3B 3KD4A 3OB8A 3RN4A 2X4TA 1YYCA 3I02A 5C0AE 1VFOA 2V9UA 4PJ5B 5I8EA 2BTQB 5MEPB 3EF4A 1QO3A 5BQ7A 4DGYH 2PXYC 2LQRA 3RKPA 1E4XH 4JMNA 1FFOB 5AAWC 1U3ZA 2FNBA 1CF8H 1UEYA 2JQZA 2F18A 3RGVA 3W2DL 3ZZQA 4N90D 4KVCL 3C60C 4UM8A 1GO3F 1ORQB 2BS8A 1H2MA 1I1FB 3RPBA 2GY5A 2LLGA 2UVFA 4WFEA 1BBJA 2PZSA 1KGWA 4D9QE 3NCWA 4WV1C 1M1XB 3MJ9H 4UBDC 4NI3A 3QRLA 4P9MH 1K92A 4GW5B 5DLLA 3NIGE 5JQHC 1WWWX 4JFXA 4IOIA 4XP6L 1LEIB 3BFOA 3CK0L 4KXZI 1IM3B 3IDJA 3MUUA 4FCAA 3MNWA 3J2PA 1KBHA 1JXFA 1NKGA 5DRWA 5TE7L 1S8DA 2VM3A 4PY7A 4GG6E 3LKQA 4HJEA 4GQ9L 3VG0L 3LMJH 2VQEO 4P2YA 1R3HA 5B21A 3BZFA 3T0EC 3MX0A 2PP7A 4IRSD 1MSPA 4CNIB 1ZLEA 3ZIAG 4TQIA 1FUNA 5D7HA 1OW0A 1WD9A 3NRQA 4OFQA 1QUNA 3K91A 2QR0A 1FF5A 3ZRXA 1UOKA 3BGMB 3T04D 3KWVA 4AT6A 3A4AA 4DUVA 4KK6D 4K0KB 1VEPA 3L3GA 4WW2A 1N33O 1ECZA 2I60H 3CFIC 5GIRB 3V52L 5J6SA 1L7IL 4YSEA 4TMPA 2H3NA 5BUGA 3QO1A 5GRJL 1QNMA 1SMOA 3ORJA 5GGVY 1P7HL 3UZQB 1ZDQA 4CSTA 4F7MB 2Y69C 2FJFB 5CBAB 4DEPB 3LIZA 4PS3A 3D07A 4PY8I 4ZG1A 3FAVB 4K73A 1T2JA 2YPVH 5B3NA 3O2VL 3HOGA 1HI6A 1ZHNA 1U3JA 4ERSH 2YC1B 2VDOB 2Z31D 1Q9OB 3SE8H 5E9AA 4KTEL 5AZ2H 4RH4A 1RMFL 2YEQA 4OCLC 4H26B 4LF9O 4LEBA 2DQTH 3ZHUA 2CG9X 1RD6A 3Q8EA 4O58H 5EMYA 4D0DB 2FE0A 2W95A 3D2UB 3SPCA 1LDPL 3LAFA 2EUXA 4LIQL 1XSJA 3IU4H 4Y1AB 2K0RA 2KLSA 4Z7VE 4E9LA 1ZV9A 2UVEA 5JPNC 1LJMA 1URZA 2XV6B 2CBQA 3JUYA 4NT6A 4LFHD 4ZMXA 2W94A 1TAEA 4XNXL 4E5XB 1G9EA 3T09A 4PUBH 4OUUB 5E51A 2IW5A 3EJZD 1CS6A 5BMFL 3S3CB 4YHNA 3VI4B 5DC4B 1XH1A 1BVKA 1NU1H 3GSWA 5L3DA 1DANT 2CDFB 2QBWA 4K3GA 3HE6C 4QT5B 4YXLH 2CDGB 3N1MC 1P6WA 2B8OT 2ZX5A 2BCMA 2B14A 1MFAL 2TAAA 1NCCL 4JFOA 1B0RB 4Y4HB 4GAFB 5F1KC 5BZXA 2DQCL 4RMQA 4J7RA 1OK8A 4DP5X 1MN4A 1SLXA 3FQNA 3KDMA 3MV11 3HAEH 1KJVB 1R6TA 1G0XA 1E42A 2C3GA 2EAEA 3V0EA 4YSTA 5DHEA 1T83A 1FGNL 5TDPA 5IWAB 3Q2VA 3UP1A 4BFIA 3B1TA 1WGVA 3STLB 3V55A 2H26B 3C6LD 5IJ0A 3FU9A 2GFBB 3BKCL 1RQ5A 3QJQB 5C0DB 1X5XA 4AQEA 3HHRB 3NJFA 2LHAA 3FTWA 4FG4A 43CAA 4BRJA 1F4YL 2A9MH 1SHXA 4J42A 3GM8A 5FDYA 3WIHA 2ZNWA 1IGTB 3CMGA 2MCG1 4DR7B 2YAHA 4OIIH 4JI4O 2YS4A 4RMUA 5KVGL 2FWSA 1R6VA 1UT1A 1FL3B 3PQYD 2X0VA 3QUZD 4XWOC 3RX5A 1IBHA 3L73H 1TNNA 2WLJA 1OGPA 1OAXL 3WG7C 2FIRT 2J88L 3BKYH 4OZ4B 2LVEA 3VXTA 4R0LA 1BYOA 1D5XB 3UJJL 4GAYB 2E59A 1FJGB 2PWGA 4PJAE 4JRWA 5EBMB 4XO5A 3TN0B 1GMGA 3RURA 2IALA 3PP4L 3VD0A 3VMNA 1VKXB 3T3PB 4X0NA 5FW8A 5J56B 4B0MM 2P67A 1TQCB 2IWFA 1WIOA 3MLWL 1KGCE 1JDCA 1JGVH 5JLZA 3P30A 4PGBA 5LOVB 2VXQH 4D3CL 3GMLA 1EDYA 4ZI7B 2R1XA 5LCVL 4IRSA 4HH9A 5EUOA 4NC1E 2EUZA 1OIOA 3QRFM 2WXMA 4WHYH 2J5WA 1NCNA 2CO2A 5H94B 4ELME 4NZ8A 4C47A 5EC2C 1WC7A 2TRYA 1LEKA 4R4NC 3TT1H 4B3SB 1I1YA 1DZ0A 2ZUQB 4MCMA 1T20A 5HYSA 2XFXA 3QNZB 4X8AA 3MRCB 4DKEL 5ENWA 5HDBB 5DC9B 4ACPA 1MJ7H 2EUWA 4IMKA 5C8YA 3O3EB 2IPTL 3QUXD 1NMBH 1LP9E 2F5BL 3IDMA 1H0DA 4I4WA 4JO4H 3DXAD 5GRZA 1NVPB 3RY6C 3TNMA 1DL7L 3KLLA 4KY1H 1QFHA 3BCCH 3NGBC 4CU8A 5IMMB 3OAUH 2Z31A 5F7MC 5CBEA 3LKPA 3NP3A 3CX5F 1URLA 4MNQD 5FHBL 1TTBA 5J6HB 1PLCA 2YXYA 3BWZA 1ZT1B 2HPTA 3VDBA 3ZJZA 3D3QA 4KXAA 4B41A 2ED7A 1G7MB 3GMOB 2VWJA 3PWUA 3QCVL 3HPLB 4Q52A 5GGSY 5DQ9B 3ZDXE 2MEJB 5F7DA 1VRSA 2AJZB 3DK0A 4TF4A 1JGIA 1QR8A 1DJXA 2KBGA 3ULUD 2ZKHL 3D48R 4J3WA 1OCOC 4HS3B 3CBKB 4ZAKD 2CJUL 1SOSA 3MCYA 3CVDA 2AXGB 1IAOA 4PLJD 5CA1A 1QCEA 3DPDA 4GIPD 1D7FA 5FWRA 4BHUA 2FD6L 3OR7A 2CMRH 3HIZA 3GI9L 5C3IA 2UU9B 5EIVA 3CFBA 1LE5A 3QAQA 3KPRD 3S3JA 1KN4L 1CDJA 3AW5A 1IGJA 3FB5B 3TEUA 1I7RB 5DUJA 3ZRCC 4X1IA 5GJTL 4CH5A 1IE4A 1HXKA 2R0LH 1WB7A 4K23L 1VADB 2JGDB 4Z7UB 5J9PA 5JIPA 1BJMA 1JOYA 2GSGB 2NY3C 2FTKA 1DCEA 4XZUA 4FXLA 2YKLH 1XB8A 3BD5A 3QJRB 2RQEA 3J7AU 4K15A 4MJJA 3FN0L 3UAEA 2IQAB 4OGQB 4LOFA 1BW8A 5I1AB 4WNSA 1Y74A 1KB9J 3VWJD 4AQ8C 5GRUL 1L9SA 1NICA 4WCEV 5DO2D 4RNRB 4DK1A 3H42H 1A3RH 1U92A 1HW7A 5BMVB 1V7NH 3MODL 5C93A 2EIKC 2UY7B 4FFZH 1DQML 4XVTH 3RX7A 3EFOA 5DF0A 5ICZA 2PI4A 1HNGA 5KLVH 2HFFA 2W07B 4KO9A 4RZCB 1T0OA 4CVWA 3FT9A 4X88A 1MFUA 3GSXB 1YG9A 4R50A 1J8HD 3ZGIA 4AKQA 3C6LA 3LRLA 4J6IA 2BJML 2HX9A 4AIZA 5DYOB 5KVEH 1P4UA 2XYBA 3KBHE 3LZNA 1TITA 1KJ3L 1MCFA 4XXCA 5T3ZL 4BFRA 2GTWA 4J2XA 3DX6B 3CDFA 3PHOB 1CU4H 2JIXB 4N21A 1LK3H 2CDEA 2QHLA 4LNRB 1GM7A 2F95B 3VWKB 3D51A 2CGRL 2ADPA 2RBLA 3JARB 2DMGA 4DPRA 1F23A 2VSMB 4F9LA 6PCYA 4X6CF 5HYJB 5I6OA 5MEQB 3T0EE 2B59A 4MCYB 4PJEE 3HCVB 4OFPA 5IZ7A 1HQRB 4OLWL 3MLZH 3X1BA 2V2TA 2F8IA 1LEGA 1BAWA 4JANB 5FLUA 2K6WA 5TQ2H 4P59L 5IBLD 3ARWA 1TETL 1FDLL 3QHFH 4GSXA 4J27A 2R1WB 4Y88A 4FADA 5A2JH 4HBQA 1XGQA 4K9EL 4Z7QB 3HC3L 3EOAA 1JPTH 4RDQF 5ILTH 1QQDA 1OD9A 1ILUA 2BHUA 5IY5C 1RZGB 5K93A 5C07D 4G9DA 5HVHC 2PCPA 5FYJH 3HFML 3FUDA 4L48A 1QASA 3HR6A 3F7VC 3QJVB 4Z9KB 3U2JA 2OJZH 3L3IB 4UTBH 4V1DE 2FJHB 2ILLA 3U9WA 2VJXA 1OF2A 3C5SA 1JFHA 2L04A 4FRWA 4L87A 3OE7G 3H3PL 3U6RB 3MFFA 2NZ9D 5E2VH 4MVOA 2ZXBA 4H2AA 4LPUA 4OCYH 4LCYA 5GS1A 3GKWH 3QUXA 5GS0C 4EEQA 1QHOA 4YWGH 4N68A 3DXAA 4HBCH 2YD8A 2ENQA 1QYGH 3G5XA 3BVNB 4L0PB 3D1MC 4NNPL 1J5EB 3GRWA 2C9VA 3VB9A 1F1GA 3AM8A 1WFMA 3OAAG 1LHZA 3I84A 4IHOA 4I9WE 5F88B 1SXSA 5GSVA 1GPOH 4MNQA 5ISZE 3RWJB 1DE4B 3P9MB 1A6UL 4ZRGA 4X7SL 1JVKA 3GSNH 3DO3A 5E1AB 2Z35A 5JHLA 4BE5A 2H2SC 4QRSA 5FKPB 3TZVD 4OZIA 4ZX6A 4JZOB 1FG2B 3N85H 5D7LE 4XMUA 2PW1B 1KY6A 1ET8A 1WGOA 4OFIA 1PKOA 4XNQA 3RWCB 3WSQH 1HC1A 3S8GB 4AQYO 4ZAKA 4JPIB 1SYVA 1QZNA 4N8VA 3KJ6H 4QRUA 1DQQB 3G6JA 3VCLB 3N0PB 2EVGA 4EFBA 4NP9A 5D96C 4EI5B 4JHVA 3SIKA 1VZGA 3CSFA 1TJHH 3KPRA 1BQRA 5SWSB 3BIBX 5D7JB 3STBA 1A6AA 4D7BA 4U0RB 4EI6A 1VA9A 3TJEL 2NXYB 2ZWLT 3C6SA 4N2CA 5FOBA 1FFNA 3OAZH 2VQFB 3ZHNA 3HPJA 1M7UA 2BCKA 1VFUA 4GUPB 4RA3A 4DPCX 2YXVA 1OM3L 3N27A 1TTCA 1LNQA 1EO8H 3MJGX 1U8JA 1CYXA 2VH5H 3CMOL 3SGKA 4EDWL 4XCEA 1IXMA 5CLZA 3U9UA 4MJID 3VWJA 4N2KA 2ZSVA 4PD4F 1L5GB 1KXQA 1VSCA 5BOPA 4UTCA 3PP3H 1BA9A 4U1JA 5CU9A 2CK0L 1WZAA 2VISA 3MCKA 1SVCP 4UILH 5C6WH 5F0JB 3APQA 1YRKA 2NY2C 1KP2A 2PWHA 2DL9A 3FT2B 2F9BT 3DK2A 2A6KB 3KR3H 3L9BA 3QIWC 3HR5A 1FNLA 1MF2L 4JKWA 4QTFA 1V10A 1BG9A 1XF1A 4J6RH 5IQOA 5HPMA 1LM8V 3U4BL 1DVQA 1NAMH 3MLYH 1U58A 3UBXB 2BSRA 1AJQA 3GPEA 2UUBO 4XWGH 4F15C 5HP5A 5JR1L 3ICXA 4HKZA 3CFEA 5D7KD 4XPTH 1OP5K 4Z7WE 1J1PH 1J0YA 1EAPB 4F7TB 3B5TA 1WZ1L 4CC1A 2N0MA 1SUJA 4NO2B 4FMTA 3HZMB 2IWEA 4ODTH 4LLMA 4G9FB 4UQCA 4W9CC 1E3XA 1W59A 4TQEL 3HS0A 1CGXA 3QORD 2P42B 5EWIH 1SYSA 3DX8B 3VJ6A 3COOA 3FCBA 2X70B 2KDGA 2BSTB 1JHTB 1EA9C 1FNSH 2Z34A 3FUEA 4JM2C 3FH8A 3WUWA 1WFTA 4LVHC 3HB3C 2YPKB 1YEIL 4C83B 5HSFA 1PX4A 5JO5B 5TH2A 3APNA 5CN0A 3QUMB 4JO2L 5IE9A 3WFVA 5K9JL 4DP2X 1YF2A 5DEJA 2W8CA 2MK3A 2PWEA 4RVBA 3N1PC 1HEHC 2K8MA 3AWFA 2NOYA 3HZYA 4LCCC 4N85A 2YDEA 4UUJC 2HYMA 5C07A 1FFPA 1EXHA 3AJ7A 5D6CB 5HVGB 3ZMSA 3KEDA 2XX0A 1FN4B 2L35A 1IAIH 5IIEA 3B8MA 4RFNC 1RPOA 1DVUA 2IGFH 3LRSB 5CGYC 3ZRWB 4PA3A 1TUEB 2XN9E 3FTGA 1YYLH 4TSFG 1MY5A 3HN8A 3JYCA 3D7PA 1L6XA 3T77B 3R0NA 2J44A 1UQSA 3PFQA 5CLXA 3VW3H 5HI3C 1CFSB 2KZBA 5KYNA 4HJIA 5HGBA 4H1LG 2WA3A 3MRKB 2AJVL 1A9EA 2VL5A 4XPAL 4IM8A 4P5TD 3QH3B 1S7VA 3QEGL 4BSVA 2UY6A 4O2AB 1CGYA 1G4MA 2BS9A 2BP3A 4JDEB 2JJ2G 1CXEA 5ITFA 3TZVA 5F9WB 2P7TB 4QXVA 4I13B 3HA0A 3ATBA 2ZX9A 5DWUL 3CVIL 4J8RB 1BD2D 1EO7A 1FKAO 2DWEB 4RISH 4X9YA 5I0DA 1AQHA 4N5EC 3F6LA 1DVTA 1A9BA 4AC2A 5FF6B 1XMEB 3IC9A 4G8GE 1VARA 2VOTA 1XMOB 1U8MB 3V4PB 3UM7A 1UGNA 1UUNA 1Z6JT 4J3UA 2EIZB 1C5DB 4J10A 2PF6A 3V5KA 4TV8B 2XVLA 3OKLB 5I24A 43C9A 3GVMA 1JBJA 1G5AA 4Z0BH 2NXZC 2XWXA 1KYAA 2GK0A 3GNMH 2FX7H 4XTRC 5TDNA 2UWEE 3D39D 3BO8A 3RYFA 4GLRH 3VFPA 5SWQB 3ZX6A 1HX0A 4MTGA 2B4CH 5DUBA 4HHAA 3GS4A 1UXSB 5FUOL 2F4VB 5BZWB 4FTVB 4ANUA 3CN3A 1O7SA 3FFCD 4GMTH 4K94H 4MJIA 2Q87A 1GN2A 1RFDH 4YHOH 1JXGA 4Y19D 3L5WA 1PNDA 2H9GA 2YBRA 3APDA 3PWPE 3SKUD 1Q9WB 3FBKA 1UM4L 2VDRH 1O9VA 3NA9H 4OTXL 3A2FA 3LDEA 1IC5H 3V0WL 3ABKB 3BHPA 4W1TA 4NJAL 3C6EA 3ZRVA 3QNFA 3LH2H 4MXWL 1MFMA 2AMGA 3CZFA 1A1MB 2EDYA 1PL4A 3DIDA 1T1YA 1AS6A 2DV6A 2G60H 3QDME 1TTUA 1N12A 3UOAB 4ALAL 4MSWA 1E5YA 2AXHA 1E30A 1XF4B 3F6JA 4JO1L 4ZDHA 1M71A 2AQ3A 2CLVA 3B37A 2BOBA 3DIFB 4PJBF 3NZSA 1S4IA 4ZTPH 1F58H 1ENVA 1X5HA 5FLXN 2FJGB 6FABL 1UACH 4CS2A 3THML 4E9QA 2OQJA 3IS1X 2NCEA 4MB5A 5J3HC 5M94B 2HEPA 1KPRA 3NZHH 4Y9EA 1QNIA 4LFHG 4HNAA 5FYJE 4HJGB 4S1DC 3BIKB 2F1BA 1JJ2U 5T3ZD 2AK1H 2KPNA 2WO4A 4G8EA 4E9SA 2JQAA 3VQ1C 2Z8SA 1VFBA 4N0FA 4U1GC 4BGLA 4QDGA 4JN2B 4XPHL 4ACTA 1F86A 2Y07H 3TBVA 1A66A 3S35L 2CA4A 2DYRB 2J6WA 5JVDB 1NC2B 3IFNL 4O4HB 1XBLA 2YEZB 3ULVH 1IQWH 1KZQA 1U8OB 4PB0L 5FX3A 4FNRA 4DP4X 4OJYA 2HVBA 3VX1A 2V5SA 1D9KD 1RM1C 4MQTB 4AYFA 4HSAC 5LCVA 4KROB 3BAEL 2IXQA 1KFGA 2PW2A 4P5TA 2W0KA 3GRBA 1S7XB 2KQXA 3A4FA 5L88L 3JSSA 3FQWB 4QRBA 5DD1H 4OLUL 3BPLB 2JB5L 5E8OB 4AYGA 5LXGL 1NAKL 3DX7B 2ZOUA 4TNFA 5EU6D 2Q9LA 2VZSA 3BVTA 3KPLB 3SCMD 4DT2A 3GMMA 3VFTB 1DQTA 3P2DA 1T0MB 5IREA 4NUMA 1GJIA 1YCSA 3UO1L 2XXFA 1KENH 3G80A 2AJSL 3BP7B 1AGEA 1K6QL 5IB2A 5KJRH 4F33A 4F5CA 3U0PA 1OT4A 1A14L 2AGJH 4M00A 4QAMB 1XB3A 4P46B 2XOKG 4WNQA 1V9PA 4G83A 1HKLL 1GMEA 2XPGA 4MA8L 4C4BA 1B3JA 5IB3A 1O0VA 2G5RA 5F3FA 3RRQA 2VDLL 15C8H 5BOJA 1NEZB 2ZX6A 4J39A 1AP5A 2BXZA 5FYKL 2VITB 4ZFGH 3HG4A 5ALBH 1RUQH 4F80A 3D39A 2HRPL 2AQRA 3TGXA 1MRFL 1PQZB 3LDBC 1AHWB 1S9VB 2H6UA 4LF4B 4TNWF 1YNKL 1LMIA 4PP1D 2A83B 2B2XL 3FFCA 3RL2B 2O93L 1E4KA 1RVFL 2JF1A 1WBYA 3JV0A 1OGAB 1SZNA 3NFPA 4Y19A 4JI8B 1AY1H 2QADC 2X89D 2YBGA 4NENA 4WEBL 4XVUD 3L6FB 4OF8A 1BIIB 4P2CG 5TK4A 4DV4B 2DD8H 4O4YL 5HDRA 5KBMA 1J5HA 5J8OA 4Q74A 3CH8A 4B08A 3QDAA 1JN6B 1HAUA 3E22A 1BLNB 3KXFE 1SQ2N 4ZBJA 1EN6A 5FO7A 3SDXB 4WHTA 3JAWB 4QHMB 5AOZA 3RIFK 1RZ8B 5T8IA 4PJ6A 4GSDL 3WNIA 5HI5D 1SQMA 4WU5A 4WHDA 4YDIL 2E7BA 3BWUC 3LUTB 1PNLA 2R29H 3ECBA 4IIZA 5DURB 2VT0A 1QBLL 3C5JA 4MJ6A 3B2UD 4FCHA 3H54A 2BRRL 1AZBA 1SOXA 3ETTA 2VO8A 3OGCB 5ESQB 5SWZB 4LPXA 2V8MA 1A4CA 3EYUH 3ETDA 3R1GL 4D2NA 3PNWB 4WW2C 2APBA 2HFGH 5I19L 5E6SB 1DSWA 4P9HH 4G5AA 2UX6A 1AO7E 3CQPA 4JGSA 4R7XA 1YHPA 4XN2A 1R3KB 2VDOH 3P0GB 2HVJB 5K1PA 3AADB 5BRZB 4NQDE 3ZMZA 3T2NH 4AH2A 2YA0A 3A5VA 2ATPA 1R24A 2K45A 3M88A 3H2PA 4RQEA 2IPUK 3DVFA 5D2LB 2OP4H 3LB6C 4MB4A 4S1QH 4XXDA 3ZL2A 1K4DC 3FQXA 3PAZA 5F6IC 4LQFH 2IH1C 4F24A 4JFDE 4NN7B 3VGGA 4EUPB 1KGJA 1PAZA 1WLHA 3HLAB 2AW9A 3TPUA 1QKZH 3ASNB 2LGNA 1FA4A 2KYIA 3P4OB 1D9KA 2XKUA 1KGYE 4K3JL 4OD1H 2XWJA 4ZSOA 4QNPE 4PJ0Z 1UEMA 5I17B 4MHHI 1FIGH 4WGWB 3TYFB 2OAAA 1YO4A 2OR7A 5I30H 1KYOK 1OAKH 2FX8L 4LLWA 5BPPA 2W0LA 4HPOH 3C8KA 4OM0H 1JE6A 4W4LA 1PG7W 3D85B 5KAQF 1JAEA 3QQ9C 1GC1L 3QI9D 1MIEL 3D0VB 4PJ7B 4DOHE 3DJSA 2KLRA 4CBCA 3I6GA 5EU6A 1U4FA 3NSXA 3WDHA 3IJ4A 3SCMA 2CBPA 4EN3B 1RJYB 4B27A 4FG6D 3RBSA 2MQ3A 1F6AA 2WCGA 5IVXF 1TQBB 4A7QA 3RLSA 1DF5A 1AYRA 2Q76B 1MLBB 5KMGA 5IK3B 4X4MA 4X64O 4FFVC 4CL7A 2XQBL 3OHXA 1BV8A 1RZ7H 4ZTOH 1X6LA 1EM1A 3V0HA 5FM5M 1E5BA 4EJ1C 1N36B 2EULA 3QXUA 5E2TH 4LFAB 1MCPH 5MHSE 3ZE2F 3AS1A 4DGIL 2LOEA 2GSIA 3GSUB 5DQJB 4F2ME 2B3RA 4O4LB 1XEUA 1K4CB 1JPXA 1S7UB 3RB7A 2YD0A 2JKLA 4YXHL 4Z7IA 5EN3A 1IC7H 2G4EA 4KKBD 4M02A 3EO9L 4PJDA 1RK0B 1KGUA 3QDJE 4HIJB 1UA6H 1XGTB 5JH7B 2CO6B 4FMFA 4JFEE 2LAGB 4GW4A 1MLCA 3SKNA 5IEKB 4X5WB 4WGVB 1IQDA 4B9KC 4YSQA 2X89A 4Z7NF 1QRNB 2V1DA 3FO1A 2R4SL 3BUYB 4DR5O 4M7LL 3TASA 4FMVA 5EBMC 1N0LB 4WWOA 4GAGL 4NO5B 3TN0C 4FNSA 4C55A 5CD5C 1N59A 1TQUA 3ME0B 4ODBD 1NJ9B 2CO7A 2Y48A 2NNAB 3JTBA 4NQCB 1MJ8L 1QBBA 1S9KC 5C0CE 5TISZ 2WJ5A 4IIQC 1TVKA 5I1IH 1PG7L 4PS7A 1U8IA 1KLGA 3BAJA 1U8LB 1E5AA 3JWDL 4MX7B 1KB5A 5E1QA 2H7WA 2HPOA 4Y4KD 2IADA 4IRSC 4KJYB 2IAAC 2R4RL 2OSLA 2XN0A 4ZMWA 4KRPB 4P5SA 1QFOA 2ZUQC 3NIFB 5AYTA 1UXMA 2PNDA 1UKSA 5MI0B 4GX0A 1SETA 4QRRE 2R56H 2H2PC 4U0QB 4UIMA 2P4VA 5KAFZ 1JRHH 3GSOB 5GGUB 4S2SA 2IIJA 1YSOA 3QT2A 1M7XA 4IMKC 2VTFA 4UT6H 1QFUH 4NGHH 3PGFL 1WAAE 1O9HA 1PFOA 2NY7L 4OJDH 3D69B 3O45B 3X13A 5L9DL 3ZKXB 2QDWA 2KKWA 2DQDH 2NZ1A 1A25A 5LGHH 2ZWYA 4E41D 2WWOA 1JZDC 1YY8B 3U6XS 3U30B 2QVMA 3HBZA 4UQIM 5IW6A 2Z31C 4AKPA 1MNUH 3ULVE 2H41A 4IBYA 3B3IB 4Q97A 1QLRB 4UQ2A 3NA4A 2N0KA 3IN0A 5F89A 4GG8B 3TPKA 3EYOA 1LNUB 3WDJA 3TESA 4JFYB 1ED3B 4B3VA 3KH4A 3HUJF 1G9MC 4NJ9L 1SMDA 2K9FB 4U6XB 3LPFA 4P9PA 3KPSD 2E8YA 5TE6H 4POYA 4JFFD 5F21B 3CSGA 4RWYH 4ZT1A 4JZNB 2OCCC 4O4JA 4ZOLA 5D4JA 5DQDH 3H0TB 5E03A 2VZ1A 4NTWA 4E4EA 2GIMA 3W9DA 2YAQA 4F57L 1OB1A 1P9MC 1S9YA 5GGVL 3EJZC 4F7KA 2W6IG 3MV9A 5A16B 2C7UA 2X87A 2VR8A 3QI9A 5LA6A 4JRXD 3WMQA 2YI9A 3MGAA 1HNZO 4HAFA 4LPCA 2YQGA 2DBLH 1VF6A 4F2FA 3Q2NA 2FECI 1N0NA 3PWNB 3CSTA 4J23A 1YDPB 1LO5A 4PJ5E 2W9DL 5I0XA 3U9PH 1EZVX 1FV1B 3JAMN 1XF2B 4LVOB 2VUYA 4I3SH 1ZMYA 3HG5A 1A1OA 1MXDA 2JLLA 5HDLA 2HJFA 4N8UA 2A73A 2Z92B 4O9HL 3DMMD 4CC6A 4UIKH 4HPYH 4LSTH 1E6OH 1INEH 2J57A 3MROA 4M8QA 3WNMA 3BQVA 1CYGA 4X4XB 3ZTNL 1FXKB 4PLNC 2BHFA 3C6LC 1G7JB 1WP6A 4QXGL 3ZE1E 1J9RA 1NR7A 2WWKO 5HHOD 5DZLA 5D70H 3BEVB 4WI8A 4AKOA 4EVNA 4H88L 1CICB 4JY4A 5IP4A 1JK9B 1KY7A 5I6MA 2CK2A 3VWKC 3FTYA 3QYCA 3QUZC 5C08D 1OLLA 4J3OG 3G71V 1DFBH 1UHVA 2K8QA 4XMPL 1PKQA 5C0JB 4DV1O 1V7ML 3KWUA 2QJ1A 4XNZB 5DMYA 1NGXB 1QD0A 3QQ3B 5LJYH 2OXHB 1U8NB 3APFA 4UMGA 4YC2B 5MEOA 2V2XA 4KHPB 4X1YB 3NJHA 1X4YA 2JB6B 1IAII 3D9AH 3U1SH 2HLFD 1UCBH 2BZDA 4IRZH 3DROA 1J9QA 3LVTA 2IMMA 1ORSA 5JMRA 2OMXB 3QUYB 1JPFB 2GABA 4LSSH 4XI5D 5K1VA 4OD3H 2O61A 2YD9A 3MLTA 2HFEC 3QJSB 4TVPL 5DK2B 5JOFB 4Y4KA 1RIHL 4HV8B 4LF3B 5EC1A 4ZUTA 1SDYA 3L3OB 5T33H 4CH6A 5EOCL 1DQLL 3QXDA 1BVZA 5I2IB 1J1OL 4OF3A 2IDFA 2W91A 1IL1B 1M57B 2BMKA 4X4KA 2VN4A 4HF5H 4NRXA 3D0LB 5ACMA 2JJTC 3CN2A 1RUAH 3P77A 3RTQD 4BQ6A 2KDYA 3PRZA 4X7EC 1ZJBA 3RQ3A 3V7MA 1PKXA 2E76C 5F7NC 1UKTA 2P24A 1SVZA 4IOFD 3QUXC 4MTOA 4KBPA 2Q86A 1HJCA 1SKVA 4N2EA 5ITZA 1G9NH 3IFPB 1F41A 2FSEA 4YLCA 4ONGH 4W4NA 1JX9A 4E41A 1IGYB 4F58L 1U3YA 2HLEB 3BKJL 5C2BH 2ADQB 2FTAA 4POUB 1YEDB 2NX5E 3AU0A 1REIA 1XWVA 3F5WA 2WANA 1FC1A 1OSEA 1DBMH 3P4NB 1K34A 1GZQA 1TJGH 2UZYB 5B7MA 2GQHA 1A47A 1CFNA 3RY5A 2ITFA 5DEZA 2YUZA 3CSBA 3KPSA 1AD9A 3WV0A 3FH7A 1U33A 1Y76A 1H6EA 4IRJB 4IOSD 2ZM6B 4X6FA 4JFFA 1NDTA 2WBKA 5LBGA 1WICA 4ZAKC 3I6LE 4ZW5A 3PIQA 4PLJC 4LNVA 4M7LT 5DJ0B 1TZIA 2VLKB 4CSSA 2AI0H 3QGVA 3P3YA 3QEQB 1PZBA 1KU9A 5CEXA 1I5YA 3CVHL 3CLEL 2CTPA 2ATAA 4AGOA 1A1NB 3MU3A 1P2CA 1ZWIB 4W9EC 2MKWA 2WVTA 4JRXA 3II2A 3G7TA 3VFRA 2A6IA 5EO0A 3L7EA 5I5JA 5L4IA 5TE4H 1MZFA 1V3KA 4G8FA 2E7LA 5K9OB 1L9PA 4RFOL 3TEZA 3HNVL 1FZKB 3AREA 3L3HA 4XCNB 2WTRB 4NKDB 2EZPA 1BVOA 3BSZH 2FBRA 2PYEA 3NSYA 5J4MA 2ZWSA 2LGQA 4AMKL 3BH9B 5BUPA 5C0RH 2VDNB 5LMNB 2OTWA 1VAHA 1AVMA 3VWJC 4QJFB 3R8BB 2DICA 4HG4K 5A6LA 5DO2C 4I87A 1H3VA 1NTZH 1U97A 5LKNA 3RPIA 4D8OA 1LWRA 3ULUL 2DLTA 3DMMA 3DTDA 4C56D 3DVNB 5DGQA 4H25B 3V6ZA 3HE7B 4DR4B 2CPCA 2PP8A 3L1EA 1CR9L 3TO2B 5DU7A 3TH2T 2ICEA 3SJBC 3I6KB 2ED9A 3BYTA 5LNGA 2UYLA 3IMRA 2CKBB 1HSAA 5TGBA 5FFLA 5C9JA 1UTDA 4Q6YA 5A43C 3X3FL 1W80A 1X5GA 1YPZF 2XAFA 3HN5A 4P57B 1A3QA 3E80A 3FCSB 1Q6HA 3T3PE 1XIWB 3L54A 4UNIA 3BDXA 2H3KA 3H6JA 4PJCB 5AVVB 3S96B 1HHKA 2RB8A 5C08A 3CXHF 5A2QN 3RYMA 4J9YB 1EGJH 4ZW8A 4PRIB 3UJIH 1CBVH 3MNZA 2C9AA 2Y6SD 4Z76B 4XCYA 4HC1A 4WO4D 2D03H 1U95B 3BXNA 1ZXQA 4BGDA 1RJZB 1PTZA 4KH2A 2EDDA 1X44A 3AXLA 3WXVH 4AY0A 4N0CC 3EKCA 4ZS7L 4YHLL 3G04B 5D8JL 1J8KA 1VQPV 3QUMH 1PS3A 4AM0A 2A6DB 2VERA 1ZT7B 3RHWF 5ITBL 3CWBH 4NUGH 4Z3IA 5HDBE 1Q0XL 3Q9QA 4Y2NA 2FO4B 4AM0Q 1Q6IA 2JLPA 2UXBO 5E8DH 5I76A 5K59F 1CO1A 1Q9KB 3UZEA 2Y4UA 3ARPA 1PM9A 3FQRB 4QLRA 1EFRG 1EPFA 3ABTA 3DRTB 2WWMD 3GI8L 3EZJB 4F27A 1PNMA 4R4FL 2WOYA 3RTQA 4P06A 4XP4H 4MQ7A 3T2MA 1DQDH 1I7TB 2H5UA 1WLEA 1W0YT 3O9WD 1XTMA 3VXQB 2UUAB 1S7QA 1U6AL 3QQDB 3C09B 2IPKB 3IVKB 1MQKL 2LABA 3NPSB 3PDGA 1E5ZA 3ZN0A 1LO0H 5KVMC 5E94A 4PV9B 3L1OL 4F8LA 2HTLD 4GI6A 1XNRB 3VH8B 3H2QA 3EO1B 3NIGF 2OKMA 4XNYL 3FB6B 1ZGLP 4P4RB 4QPKA 2GK2A 1LILA 4UINH 5T1DH 3TZVC 5MENB 2MTAA 2DWEC 5L7XL 3S34H 3UIZA 1BX2A 5I74B 1PFCA 2E9GA 4NEHB 4PW3A 2VWEC 3NQIA 5CILH 4GG6F 4OB5L 4PCSA 1B3QA 3IGUA 1RZKL 3V4PH 4IOSA 5HJ3A 4G42A 4IIJB 1XHHA 4Z7UE 1B90A 4NZDA 3TV3H 2DI8A 3X1FA 3GEWB 1LUWA 3BUPA 1BFVH 1G9HA 4WFFE 4K2UH 1IKFL 4WDIA 3V4LA 4FQ2H 4Q9BA 4I1RA 2KB1A 4DAGH 3KWXA 4PJFB 5JPMA 2AC0A 4GAJH 3LEYH 2W0PA 1BAFH 4IBQA 1FAIH 1FNEB 5FPRA 4DV5O 1A7PH 3ZT6A 1VPOL 5A2IH 2AVFA 4PRAA 4HYOA 4QYOA 4IKJA 4TXVB 3WFHB 4TUOA 5CEZH 2APWA 4JJOA 1I1AB 3QXWA 4NNXA 3L4UA 3DBXA 4NBXB 1A7RH 4KY2A 3IE4A 1T04A 4U6VH 1EZVH 2G75B 1EHLL 4KZDL 1NGZA 1W6LA 4WRLA 2VM9A 3MRFB 2R2EA 2WZ6A 5IROD 1MI5D 4DP9X 4R26L 4DP8X 1CD1B 1J87A 2KH2B 3TYGH 3MA7A 2A74A 2OIGA 4C56A 3WFCH 1O5PA 3DUHA 4Z7VF 1IGCH 3MACH 5CLYA 3QA3B 5KG9B 1PLBA 3BAXA 1MHCA 2YEVB 4NXKA 3PQYE 4ZUWB 1WG3A 2PTVA 3MJ7A 2DZEA 5HYJE 3MLXH 1KC5L 5EG6C 3MLVL 3VXSB 1TZ8A 2ZCKH 2ENSA 4L8DA 4X66B 3KCWA 1H8EG 5DJCA 4MSWC 2EICA 3PG2A 2YIHA 3CX5K 4Y9BA 3UTSB 4YSPA 3CSPA 4WI0B 2SEBB 5CJOH 3K81A 4Q6IA 5BQ7B 3K06A 2F68X 2ARHA 4OGXH 4Z7QE 3QORC 4BFGA 1NH2B 1I4FB 1X3DA 2GJJA 4ZUSB 4ZMAT 4WO4A 2YD6A 5HHMD 4YVUA 3RGVB 2AQPA 4I0CC 3AG3C 3SDLA 4H4NA 3DA0A 3DO4A 3DI3B 4KX9A 4UM8B 1UJTA 3U11A 2FYVA 2X4RA 1OTSD 4JDTL 4P3CL 32C2B 4ZW3A 1FL5A 3AFLA 1XL6A 1ZANL 3MV8D 4P2RB 1PY9A 1ZLSL 3FOLA 4FQIH 4IU3A 1EBAA 1YEJH 4JFXB 4AGMA 4IOIB 1ZGLM 2I5YL 3N44F 4JGMA 2WKLA 4D94A 3ZY7A 5FA4B 1EN5A 5F96L 5LLIC 1S8DB 5AYQA 1A3LH 2EEBA 4FKEA 5DSCB 3QWNA 3W0WB 1ADQH 2P5EB 1KXTA 2YIBD 5FPOA 2DMHA 5F8RC 2BZ7A 4M48H 3S97C 2DW5A 2GJ6D 3CVCA 3G6BA 3DXAE 3IC7A 5J2UA 3C87A 4J3OC 5IOKA 1JGDA 4N28A 2XXGA 2FK9A 3QG6A 2VLRD 4XMZA 1V55B 3DX2A 3UDWC 4WCYL 4MNQE 3L71H 2QKAA 1N2RB 1XT5A 1ICTA 3OMIB 1AR1D 2H3NB 1RZJL 4LCIL 2UUCO 3ARYA 4ISVA 1MEXH 3H9SB 3B8NA 4PJAF 3ZRSA 1GW0A 3DOHA 3H9HB 4GRMA 5FNVB 5EV7A 2YPLA 3S36L 2LTQC 3FN9A 1J9CT 1S5JA 3L1FA 3G6JE 1HWHB 4MYWB 4UT9A 4UTAH 3MDSA 4G43B 5SWSE 3MBXL 5D93C 5F1IA 2EZOA 2JJUA 4KX7A 1OOWA 3EIFA 2AK4D 4DZ8A 4HJ1A 2WO3B 3WJMA 3L4WA 4P46C 1WAPA 5IB4A 3WS3A 1L9OA 1BDYA 2XBDA 1OE1A 3TVMD 4ELMF 1M9SA 4ICXA 5TQ0H 2WAHA 3VXRD 1YAIA 2UX7A 3NESA 4HIXH 1JS4A 4PMEA 2ARJA 4WJ5A 4Q9QL 4QNHB 5DFVC 4O5LH 3WTSA 1CZ8H 2H1PL 3MCLH 3EFDH 4HZ3A 1XH2A 1LP9F 3ILQD 2DLGA 5EF2A 1DVYA 2ARJQ 2PETA 4QTHA 4OZHF 2FWLB 4R2GD 1IC4L 5AL0A 4NKOA 3ZLQC 4R4BA 4XOBA 3CVBA 5J12C 2HKOA 5HD8C 2IOOA 2L7EA 4NWTL 1CJYA 2NYKA 5EORL 1ZLUK 2LW7A 5I6PA 1PLAA 4YIPA 3L5XL 1J8HE 3S37H 2XHBA 3OAYK 3IBOA 4X6CA 5IROA 1MI5A 4HH8A 3N42F 4JN1H 5FCUL 4ADGA 3LHAA 3M1CA 1NGQH 1UD5A 4JASA 4FFYL 2LU5A 1AS7A 5DZPA 2I7SA 3ZX1A 4U7OA 4M6NH 4OT1H 4BCYA 4FHJA 1Q0YH 5T1KD 2E4FA 4YEEA 5EEUA 1Q7YW 1JRHI 3CWGA 5JNYB 4ODVL 3MRMA 4MJ5B 4N5UA 4R7LA 2HX8A 4X6DB 1Q9LB 4KZ0A 1WBZA 4DK6A 3QZNA 2JE8A 4LPWA 3ML9A 4R96B 4CUCA 5C9KA 1D2DA 1E4HA 2XVKA 1U3HC 4MTXA 4MZIA 3ZBMA 4ZMYA 1C12B 3PE9A 1Z3RA 2BSSA 2MH4A 3AS2A 1ZLWH 43CAB 4APXB 3B2XA 4WI5A 1JPSL 3AG1C 3ZVVA 2X4NA 3BYYA 4WFGD 5IMOA 1MRDH 4Y5XC 4QJ5B 4R0LB 2HVJC 2OMWB 4MAUL 2G2RA 1FLTX 3MV8A 3AWGA 2VDKB 2VQTA 4OLVH 2FBJH 5E8PB 4K5LA 3K5OA 2GUOA 4G6ML 3UAAA 1Z9OA 2H1XA 5LN4A 3US9A 3KNBA 3P32A 4EUPH 1E0OB 2YIBA 5EZPA 5IQ7H 2R1XB 3X1NA 1F4HA 1HNXB 4HH9B 1E27A 2GJ6A 2N74A 1SRYA 5JIHA 2YI8A 3K3WA 1P5UA 1X5AA 2RCVA 1X6NA 4ENED 2VLRA 3WY2A 3C5XA 3O3BA 2R8SH 5IYZA 1E1QG 1DBAH 3QW9A 5BVPH 4RAVA 2DQIH 4PD4K 1PAMA 2NQCA 1D9KC 2IH3C 2Y1AA 3BWAA 3VFNB 4GX2A 1XILA 5DR5L 5EZIH 4DTGL 1K8DA 1AR4A 1SOKA 3PDOA 5EBGA 1SQGA 4LF7O 1H0DB 1U93B 1ZKAA 2R0KH 3FAXA 5SX4I 2XZAL 3FSOA 2HVKC 3QARA 5JJNB 3LXAA 5EFIB 1FC2D 4RAUA 3ZK0A 4U3JB 3JVGA 2ISDA 3REVA 1TFHA 5KSAB 2JH2A 1R5IA 4EQ2A 3SZKC 2BOCB 3E2EA 2XVGA 4L9LC 3SCMC 4KXCA 4WFHE 2ZCLL 3LS4L 4ZMVA 2A2QT 5BW7C 3QQ4B 3HW7A 1U91A 2AK4A 4FI7A 4XMLH 4XAWL 2XX1A 4RIRA 2APVA 5DUMH 4HIQA 1VERA 1I8AA 5IFAL 2HT4D 4UYPA 1ZVSB 4L1HA 1V3LA 4ZJ9A 3TVMA 3UC2A 4E9WA 4FI8A 3VXRA 3OHXC 5CEZE 1IAOB 1JWSB 4UB6Z 3LH9A 2X7LA 3KYMA 5I66A 2R51A 1PD6A 1PIGA 3OR7B 2HH0L 3NN8A 1KYOJ 3I50L 5H4ZA 1VF7A 4N6QA 4OH2A 1LE5B 2VN5A 4K3HA 2IG2L 4G8IA 4LBEB 3WI9A 1OAQH 5KTEH 4IK6A 1HHHB 1QSFB 3Q43A 3EDFA 4X99A 4ZX5A 4AL8H 1IM9A 3L3DA 1R0AL 2AXJA 4MDJA 4X1IB 4PWEA 1NCBH 2FB4L 3IFOA 2PPAA 3TX4A 4YHZH 3VFOA 1QWUA 3BEHA 4D0BB 3T1HO 3RW0A 1XF3A 3RU8H 4OCWH 5J9PB 2FATH 2JI3A 4AZUA 3VQYA 1QLEL 2IDTA 3BP6B 3H56A 3Q2LA 2MCPL 3CVHA 1HWGB 3RVXC 1XGPB 1HSBA 1Y74B 2ENYA 1FH2A 3B43A 1I8LC 3C08H 2NDGA 5D7KE 2OMTB 5B1AB 3R06B 3QPQD 1FSKB 5IW1B 5HFLA 5T1KA 4XNMA 3QEHB 1WUNT 4WKXA 1ECYA 2ZJSH 4I5BA 1ZSHA 2R72A 4Y9GA 2ODIA 4IBTA 4JZJB 5GGSA 4N2HA 2WQVA 3BP4A 1N18A 5HI5C 1AOZA 2YC0A 4ADIA 1JERA 3CPWU 5MI0C 2Q9OA 3RE0A 3OSKA 5C0ND 4Y8AA 1M9NA 1HINL 3B2UC 3MRBA 4GX1A 2I9LA 2CUAA 2JXMB 2XHNA 1C8PA 1ASPA 1DCLA 4WFGA 3RBGA 2W1NA 1F6LL 5BV7L 2ORBH 5E4IA 3F6IA 5BZDA 1CD0A 1NA8A 1QOKA 3IWVA 2CK3G 4I18B 4KK5D 4HJJL 3UADA 3ZKXC 4R5XA 1IBLB 5AVXB 3UTZA 4H20L 3FSAA 4MKTA 2BLFA 3MGOB 3EZ8A 3LPPA 4K8RH 4WTWA 3FK3A 1B0GB 1J05B 4ABUA 1ZLDA 1N4CA 3IETB 1LEGB 3KYAA 2Y1VA 2N7SA 1JGUH 3IJ9A 1WP8A 1ZT4A 3CIQA 1SJVA 1TPXC 2MIZA 3R18A 5G4MA 1JNHA 5F7BA 1MW1A 1BXXA 4AQZA 3S8FB 3FO2B 5E0FA 2DLFH 2FEJA 2I9TA 5EZYB 5LHHA 3EFFA 4EDXA 3W56A 2P47B 3FAWA 4JB9H 1AGCA 1F97A 4PHXA 5DVMA 4Z7WF 1VQ8V 4I9XA 4P5KB 4BXVA 2VMEA 4FM2A 3CBRA 1IXBA 1A6TB 2K78A 2Z4QA 3CLWA 3NZUA 3LJ3A 1PDKB 3C5SB 2NY6B 5CKAA 3PHAA 1AGFA 3ZTDC 1JXJA 3MFFB 4IJTA 2NUTA 4DP7X 1RFYA 5H35B 4MVQA 2OTLV 1KV3A 3F58H 3K5SA 3RWEA 2ZSWB 3GSQB 2MKLC 1BD2E 5L2JA 3G5XB 2EEFA 2XC8A 5I82A 3UBXI 5IESL 4PGEB 3AROA 3QI9C 5GSVB 4G28B 1XB6A 4APQB 4F5CE 3Q05A 1IX2A 3WS6A 3ISRA 3E7JA 2O5YL 5I1GH 1XV8A 4FG6C 2XTJB 3K6DA 3VQLA 2J1YA 2AJYL 4LVOC 4WUUD 4OGAC 3JVFC 1FBIH 1R5WA 4L1TA 4X89A 3WL9A 4XBGB 1FNGA 4S1SL 2IV8A 1ZGLA 4XNQB 2NW2A 3OFNG 2DQGL 5F1OB 1I1RA 5CA0A 3G5WA 2IFGA 1S5HB 2Y2TA 1OAZH 1BM3H 4G7VH 5IVZA 4ZOCA 2F5AH 2WTOA 3FFCE 2AJXL 4KHXH 2BVOB 2C4FT 4WTQA 4X7TB 1K5QA 2NZIA 2J25A 4ZOAA 3K6SB 4JAVA 2X42A 3RKDC 4HQQH 3CDYA 4KKBC 5DMGC 4JFHD 3SOBH 3CCSV 2LU7A 3SDXE 4ZKIA 4PJBA 5CZVH 2OIEA 3T6WA 3NSCA 3KYNA 5CP3A 3UMNA 4HK3N 3EGXB 4NPKA 4Y2OA 4LSPL 1ADWA 5GZND 3UGEA 2FIKA 1HXMA 4GNKB 4LLAA 5ABDE 5G55A 3TNNA 3BDYH 1NQTA 1FE8L 4MRBA 2AZUA 5SWZE 2WCSA 1I8KB 4E9VA 1DO6A 4DR6O 5E6IA 3G67A 3HS9A 2XA8H 1W2BU 4GEIA 4MTMA 1FZJA 3IMWA 1TZGL 2Z7ZA 4P2QE 2O6DA 4NQTA 4BUGA 4Y4KC 1CFMA 4JI3O 4M8VA 4UXNA 4Q9RH 5EC1C 1RXLA 1S3RA 3IT8D 2X38A 2QL1A 1GGUA 3LZRA 2V17H 2UWEF 4R6UA 3VD7A 4LLUB 1DJWA 4E0RB 1KTLA 2X6CA 4LLMB 5L8JB 2IQ9L 2ZG2A 4XB3A 4I55A 3DUSB 1D2OA 3HS0B 1THCA 2NNRA 1SYSB 5D2LE 1CL7L 2X3BA 3IU3A 4DP6X 1RUMH 4J3XA 5E6ZA 2H8PB 5F9DC 3GM0A 5LVEA 3NTCL 5DMJB 4ES8A 4RLDA 4HUKB 5I0YA 5CB4A 2AJ3B 5TH2B 4ODHL 5I18H 4F7EA 3QCTL 4JQIL 1CGTA 5HHXL 5A2AA 2ICCA 4W4OA 3F5WC 1FPTL 4PDVA 4Z95H 1TIUA 3CJHA 1EDHA 1KCSH 4CZZA 1IZKA 2VXTH 3FOMB 4IRJC 5IT2H 4TRPL 4TNWK 3T0BA 1RP8A 1K5NB 1RUKL 4CC4A 2HMID 1M6OB 2C9UA 4K7PL 3JTTB 4JKNA 1F13A 3WLBA 1ZL8A 3RWGA 2EH8H 1MCIA 1EXUA 3FTGB 3LVEA 1N67A 2EUVA 3HVNA 2XWTA 4NCC1 4KH9A 2HJKA 4PB9L 1OO2A 3L4ZA 3KMDA 1NFIA 1P4BH 1GAXA 2QQNL 1ZWIC 4JHZA 4MVBD 4OLXH 4B9ZA 1UQSB 3PJSB 4DEUA 4HFWB 3K03A 4FZ8H 4FQCL 3PHQB 5K5YA 3TWCH 5HGBB 1CI5A 5E5UB 1A9EB 1TG8A 4OCXL 5J11B 4KDVA 4JYCA 2UY6B 5EHFA 3MRJB 1MHHA 3OL2A 2VDNH 1G1YA 3M1OA 4X8XA 3VXPB 2Y0PA 4WUUA 2W59A 3DSNB 1J8RA 3S5YA 1JZ2A 3H1KH 1XGYL 3PWLB 4OLZH 3Q6GH 2BH0A 3A67L 3FB7A 4GRLD 4X80H 1BJ1J 3VO0A 2Y1ZA 1A9BB 4B0MB 4LSVL 3U4AA 5H6QA 3D25B 2P46B 3DNKA 5AW1B 2X9ZA 3DMMC 1HE7A 2IJJA 1MG3C 2P8MA 3IJHB 3M07A 3MDJA 2CKBH 4DKDC 2ZICA 1WA8B 3K4ZA 1S7TA 2ICEC 3FO9A 1OHHG 4LPVA 4NQCE 4AG4H 4NQDA 5I28A 1KTDA 1IEAB 5FDWB 1YEHL 3RIAF 5IJDC 3VFPB 1A8ZA 4N8CL 5FOJA 2J21A 1Z0NA 5A6MA 1TUBB 3B7RL 1SM3L 4JKPL 3VU1A 1SF9A 3QNXA 3OKOB 1HZHL 5CIPA 5GZNA 3C5ZD 3S3XA 3IPFA 4TNVK 2YMXL 1TTAA 4UV7L 1U8PA 4HG4J 1COBA 1GGIL 3L5WB 2H9GB 5I6KA 2X6AA 4JV5B 2J8OA 1RV6X 1WWBX 2Q20A 4RO2A 1M2VA 2Y7QB 2HLFC 1C1EL 3V4VL 1CDYA 1N4XH 1FL6A 1WBXA 3I2CH 3NH7L 3ZDYB 1BHGA 5EUKB 4BDVA 3NMEA 1A4JB 2P26A 2D3NA 3CZLA 3PPSA 4LXFA 2GG1A 1F3JB 4UDUA 1DUYB 1OSPH 1R3IL 1RIVL 3BAAA 1KXHA 1UH2A 2Y4TA 3BX7C 3GJEA 3IRCA 3JYBA 3BEWB 3LNIA 5F3BA 2JELH 4FFYA 2NLJC 1A21A 4K7FA 5IM7A 3GJFB 1BQHB 2ENPA 2Y36H 2YOCA 1VACB 5CUSL 1SQPH 1PZAA 3LNFA 4C4UA 4NUQA 3WDIA 1KUMA 4ZDHB 3RTQC 1GZHA 2BNRB 5FHAH 3FRUA 1KBBA 4FZ0A 1MWAL 4OPHA 1HH9B 4OJFL 2OL3L 3SE3A 2ZQKA 1CE6B 4KI5C 4IOFC 2BSBA 3HEIB 3LNEA 4IS6B 2GI0A 3CFCH 1HQ4A 4U1IA 2LFEA 2X40A 1KPRB 3HKBA 5LDSA 2OCJA 1CTMA 3LZOA 3D30A 2HHHB 4FYSA 1PVHA 4DUZB 4LDEB 3MA9L 4GW1A 3DC0A 1NJIW 4O2FB 3FTXA 1JZJA 4AUUA 1MPAL 3T3MB 5GGTL 5IVXA 4QOKB 2GIXA 4M43H 4ZODA 4U3HA 5EULV 1CK0L 4N0RA 1FG9C 1RPKA 1VCAA 4GT7A 4KKCD 4NNYA 1QATA 3FO0H 1BOGA 4XMTA 4FX5A 2JCCB 3G6EV 3U4KA 2WSDA 3U0WL 1R17A 4KUCF 3JT2A 3LKOA 4YE4L 2IF7A 4J3VA 3K8MA 3TC9A 1HZLA 4ILDA 3L1GA 1AC0A 4AYFB 3CEIA 1OSZA 3EGSA 5KYXA 1A7NH 4AVIA 4KJQD 3WB0A 1BGXH 5H8DA 2PW2B 1HHGA 5C8JA 2X9XA 1I1AC 5C7ZA 1INQB 4YJ2B 3O3DA 5PCYA 3LKSB 2DWTA 1L9NA 4D0CB 3QFDA 4HXAL 3MLPA 1TO5A 1RJCA 4HIEA 3OJVC 5LP6B 3OEEG 4XN8A 4MCZA 4GRLA 1ZCRA 4XP1L 2X2HA 1HT6A 2KC0A 1EFXB 4FQQB 4X98A 5AVSB 1Q1JH 4JY6A 3Q3GA 4UOQA 2D0FA 2QQKH 3OWRA 5IB2B 1RJLB 3M8OH 1F11B 4JG5A 3U0PB 3OMZA 3X3GH 5T5FA 5KA6A 1M9WA 4DV7B 2F7OA 2XPGB 3D0AA 1AGBB 1VQ4V 4QNPF 1PSKL 3LDCA 1Y18B 3O6FB 2Q7YB 3EH2A 1A5FL 2NNFA 3L81A 4XOCA 4CVXB 1Z3GH 1UKQA 2EVJA 3D39B 5T3XH 1TVDA 1KIQB 2IEPA 2QSTA 4BQ8A 4NLHA 1OK0A 1P7KB 3GHEH 4GB9A 3DX9A 4Q6IC 3C5ZA 1KFAH 1ZXKA 1UZ8A 3WIIL 5C6TH 1FXHA 2Y6SC 4FNQA 5EZOL 1P7BA 1TT6A 3KH3A 4FXKA 2A1WL 1THZA 1ETB1 3SDDA 2JFCA 2R9RB 5CGMA 3TA4D 4H37A 3EHBD 4G7RB 5AOJA 3B9DA 1GCFA 2KUTA 3KJ4B 3ML8A 2WSSG 2L0DA 3A6OA 4GBXB 4UNVA 4N6RA 5HGHB 1UVQA 4Z8FH 4W9FC 4JKKA 4YPGA 3SDCB 4JHWL 4H33A 4PDLA 2M2DA 1T7YA 3T6XA 3F01A 2QKIC 3N04A 3NXSA 3UXFA 4WHTB 1IMHC 4OD2A 1KPVA 1AMXA 4FAAB 1BEYH 3G6DL 5CO1A 2XWZA 5K33A 3MREA 4HISA 2X2JA 5L2KB 3HUJA 4WWKB 3CX5J 4FFKA 4FE9A 2B1AH 3EBIA 3LQZA 1CVSC 2ZT9B 1V55C 2XV0A 2EH7H 3ESUF 4ATTA 4Q0XL 4YPJA 4E41E 4KZCA 3DPBB 4HCRH 3ALXA 3VX0A 4HETA 4JO3H 1SEBA 3GXFA 3MAWA 4JPVH 4UANA 4NZTH 5DC2A 4DEWA 3S5LA 3O9WC 3TO4D 5BS0D 3FZUD 1CTNA 1JNNL 4AQAB 4XXWA 5D2NA 3MLRL 5DM6V 4DZBB 3N2KA 2G9KA 2HTLC 2QMJA 2ZCZA 4UT7L 3GS0A 4MMXA 4LLYB 3ZHSA 1X7TA 1VGEL 2IMNA 4FZEH 2PUQT 5JZ7D 4GMSH 3TGUH 4L4TD 5I1JL 4YL4A 5AYUH 4EI5D 5DYFA 3M7MX 2NT1A 4YLQT 5E4AA 4LK4A 4DKFH 4XXDB 4X9HA 2AABL 1WE5A 4RMSA 4Y0GA 1EUUA 4YSAA 3CN4A 3WGUB 3UBHA 3K5MA 4FG0A 4NHCL 3IMSA 4JRXE 2FX9H 4PPTA 4AVJA 2UU9O 3B34A 2B5IB 1HHIB 2AQSA 4ASUG 4HUWB 1ETJA 1R5VA 1BVLA 2EE3A 4YHKL 1PPIA 2BDNL 1MCKA 4KO7A 1QSED 4NZFA 3QJHA 3SJVB 4L3CB 4H40A 3BCFA 5D72H 1WAAF 1ET5A 2XUMA 1KT2B 1IZJA 4A66A 3CMEV 1YAZA 4XPBH 1H8SA 4DV3B 1O75A 2H45A 5AUMA 4UB0H 3JT0A 2R69L 5TDOA 4AK1A 2F8XC 3KPOA 5C2UB 3TBSA 3ZSTA 5EU6B 3JV6B 3ULVF 3FB8A 5F7AA 1UJ3C 1I8IA 5K1NA 2EDJA 4ZD3H 1E4XL 3A8TA 5HVWA 2PO6B 2R0ZH 2GBOA 1CF8L 1F6AB 1PEZA 2D0HA 5HHOE 3U4EA 3RX8A 3SYCA 1OTTD 1KCUH 1JPGB 3OSVA 4DR3B 1HP8A 3GTTA 4WI9A 3MJ9L 4YDJA 4MMZB 3F5TA 4JYAO 4I3RH 4PRIE 5KS9F 4R7NA 4FN0A 2WYZA 1S9WA 2AV1A 1JD7A 2GTZB 2V5TA 1S7WB 3K2KA 2GSIB 3CXDH 5I8CB 4NZJA 5JWPA 1UZ6E 1YY9D 1QI5A 1XNQB 3DDFA 4PGDB 4JFTA 3UTQA 1I9JH 1BZEA 1LQBC 5C71A 2I07B 3ZUNC 2TRHA 1WZMA 3R19A 4UCTA 1OAYH 4NN6C 5GXBB 4NQVB 3SKNB 3INUL 1BBDL 4EO5A 4M9OA 8FABA 2VR7A 5D1QB 2VDKH 2I60L 3FT4A 3BA9A 2GY7B 3TBYA 1XL4A 1OTSC 1V05A 3NRFA 5F1NB 1IFHL 4CW1B 3CX2A 1N59B 3SE9L 5EEYA 4YO0A 2CO7B 4OSUH 3DSFH 2D2CB 1SHWA 3HMXH 4JDVA 3CQFA 4D9QD 1HZKA 3FC8A 4DVBB 3VD5A 1DP0A 2YPVL 4WBNB 2NCMA 4G7SB 4F20A 2PLTA 1U8IB 1I9IL 4ZFZA 5D9SA 4P3DA 3WKPA 1NCJA 2FH8A 3SE8L 2GHWB 1LXMA 5AZ2L 4KI5E 3UO8B 3IGAB 3TFBA 3NCJH 4CC0A 2FZ3A 1MCOH 2QSCH 1ZUQA 4ZFFA 1N5YH 1Q82W 1FAKT 2DQTL 1HCFX 4QRAA 3HKCB 1P5UC 3EO0A 4Z1PA 1O6SA 3R7RA 1VZHA 1XREA 2C3XA 3J81N 3KG5A 5MENE 1G0YR 3V0DA 3GHBH 1TU2B 4H8PA 4UIMB 3TO4A 4U6YA 1J5EO 1AR1C 4S2SB 3MRLA 2WHVA 1MG2C 4PRPA 1IJNA 2H0FA 5LG6A 3RDTB 4KTDL 4L0ZA 1I3GL 1E6JL 1E90A 4PUBL 3V5HA 5B38A 3T0XA 4YHPB 2DW4A 4Y4FD 5IQNA 4AEIH 1IURA 2BOCC 5H37G 3OR6C 5JHDB 2DQHL 3BFQG 3JVGC 2C3VB 1TLMA 1WS7A 5EOCJ 4NC0B 1RP3B 4L4TA 5BZBA 1JF6A 4M1CD 2BFGA 4UQ2B 3P9WB 4EI5A 2M7WA 4PV1C 1N6VA 2YZ1A 1A6WL 2LP7A 1F1AA 4AQ1B 1VEOA 3H3KA 1QX1A 1ROCA 4F91B 4ZO6A 3V0VA 5HHQB 3CXHK 3T0AA 2K70A 1T4KA 1H3PL 4PD4J 3G6AB 4UM9D 1T7VA 4JQIA 4A1RA 4H0LC 5GONA 4Q6GA 4Q56A 4I0XB 4XCFH 4D9RE 1IE5A 4ZOLB 1QSEA 4MB1A 5DFTA 1EEZB 5HVFB 4MVRA 2VQFO 2BX5A 3F12B 4WK0B 2ZE8A 1C7TA 3LSOB 2X6BA 1I7UA 2P28B 5DI8B 3ILQC 3KLAA 1GAFH 1YPZA 3FT3A 4PVNA 3VRJB 4R2GC 2WXOA 3K5LA 3MV9B 2C7UB 1LD9A 1OT2A 4JYYA 5LA6B 4FFBB 1HIMH 3BN3B 5F7WC 1BQHG 3ZHKA 4QGTA 4NBZB 1T5EA 3GXPA 4GY4A 1ETZA 5B1KA 3OKMB 3CPUA 1OZTG 3E2HB 4BJLA 4OIIL 4MB3A 3ARFD 2VQ1B 4P23B 4J1UA 4X0KB 5EBWA 5C0IA 4U2YA 3NUKA 3KYKH 1Z5LA 2ZWNA 4XZ4A 1ZD6A 1FD9A 4QGYA 3UTSE 4AV5A 2J7LA 2XAHA 1TQSA 5HYFA 2WYIA 2XYCA 2UV3A 3SBRA 1MVUB 5T3XE 1MJUL 4U49A 1E2VA 1WTGT 2BP8A 4DR1O 3FQUA 3QR2A 2VS0A 2BPBA 4HA1A 2BP0A 1B0IA 3A21A 2ZE5A 3MROB 4M3JA 2BW4A 1WAZA 2PTTA 2PYJA 1JGVL 4X20A 5TFSH 5I1KH 2XG5A 2VXQL 3SO3B 4QKTA 3N06B 4PDRA 3TFKD 1DZBA 2N1KA 5JIQA 1H19A 5BRQA 5EO9B 1QBMH 4MNHB 4G6FB 3VM7A 5I71C 4CS3A 2D7TH 2ZF8A 2CCVA 3L4YA 1AQ8A 1WV7T 4NAMA 3TT1L 1QVOA 1T22B 2RTTA 2P5EE 4BKTC 5CR1A 5DHYA 1MJ7L 2GAZA 1T1WA 1GN4A 4UAHA 1NMBL 1XH3A 4PIRF 3SKJH 2KZWA 2HG5B 3NK4A 3GTVA 1GZPB 4M6MH 4KY1L 5FB8A 1FVEA 1KCVL 3L3JB 1ORSB 2EJRA 4IJ3B 4JE0A 1K8IA 2FHCA 3OAUL 3ZGHA 4JTCB 3QJFA 2AEPH 3UPAA 1NOAA 3VXUB 1SJEB 1S3JA 3EVKA 2VE6B 1ERNA 1KGCD 4L4VB 4WVRA 5IJVB 4GG6A 2DIEA 1W91A 2QLVB 3IGKA 4TSAH 4NTXA 3ATFA 1E4WH 3H9SE 3ERXA 1MFBH 4YMPA 1TCRA 1ITCA 5FK9A 2DLEA 3VXMB 5SX5K 4Z78A 4ENEC 4BIOA 3EYSH 1CT8A 5TF0A 3V4VA 3T3PF 2W9EH 1OCWH 2X4OB 1KYFA 4LHUB 2A77H 1D5IH 5IV2A 3R65A 1TTFA 4W9KC 3A4DA 3QZWB 4H8VA 4L2LA 4QPEA 4FP8H 5CZRA 1U3NA 2CMRL 3GMPA 3BUIA 3QFJD 4R7DB 3DGDA 1L7TH 2CCLA 4NZRH 1I94B 1FYHB 4W68A 5EU3B 2Z93A 3LRKA 3O8XA 3UAJD 4CJ0A 5IJKA 1NCIA 2OM5A 1KB3A 3LZFH 4PJ8D 2EX3A 3LD8C 3T1FA 2HTKD 4IHBA 1MWAA 1WFUA 5HDBF 4NLAA 2Q7HA 2OL3A 3HRZB 3OJMB 4BBWA 1S78D 3J27A 3CFJA 1EZUA 2ZD0A 4QUOA 1GZQB