1QLWA

The atomic resolution structure of a novel bacterial esterase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
318
structure length
318
Chain Sequence
VPKTPAGPLTLSGQGSFFVGGRDVTSETLSLSPKYDAHGTVTVDQMYVRYQIPQRAKRYPITLIHGCCLTGMTWETTPDGRMGWDEYFLRKGYSTYVIDQSGRGRSATDISAINAVKLGKAPASSLPDLFAAGHEAAWAIFRFGPRYPDAFKDTQFPVQAQAELWQQMVPDWLGSMPTPNPTVANLSKLAIKLDGTVLLSHSQSGIYPFQTAAMNPKGITAIVSVEPGECPKPEDVKPLTSIPVLVVFGDHIEEFPRWAPRLKACHAFIDALNAAGGKGQLMSLPALGVHGNSHMMMQDRNNLQVADLILDWIGRNTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Atomic Resolution Structure of a Novel Bacterial Esterase
pubmed doi rcsb
source organism Alcaligenes sp.
molecule tags Hydrolase(carboxylic esterase)
molecule keywords ESTERASE
total genus 102
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qlwA00
2RIPA 5K3FA 3ICWA 4YK7A 1CUVA 2C7BA 1AURA 3G9ZA 4HS9A 4WCVA 1XQWA 5K5EA 1QFSA 2J4CA 4EY8A 4BTLA 3ZLVA 4F5ZA 1H22A 1ZGBA 3GELA 2CBGA 1U65A 3I2FA 2B61A 2XUFA 2WFLB 3FYTA 4U2DA 3CCBA 4UBMA 5JD6A 3PUIA 4RNCA 2C5FA 3I6ZA 3BF8A 1G5FA 3G9XA 4LXHA 4DMHA 1T2NA 1UT6A 4DSZA 2X76A 1DU4A 1XRMA 4RE6A 3DYVA 4WFJA 1IUOA 1A8QA 5JADA 3C8HA 1XZAA 5JALA 4X95A 2WFLA 3G0BA 4PF1A 1YA8A 1QTRA 1YASA 2BGNA 3HRHA 3BIXA 1KU0A 1RP1A 4H7IA 4IH9A 2OG1A 5ALUA 4LKOA 4QA9A 2RAUA 1BS9A 3K2IA 2BGRA 2VJCA 3C8DA 5AHXA 5CH8A 3TJMA 2EEPA 4ETWA 4W1SA 1YB7A 1DX6A 3H18A 5FUMA 3TGLA 4I19A 3I2HA 3G0GA 4Z49A 1MX1A 1YAJA 4TGLA 2ZVDA 2XQJA 4C01A 3VDXA 3Q0TA 4MJ3A 5AH0A 3MUOA 5HF8A 4Y2QA 5JARA 3K9BA 4UHFA 3DKRA 3DNMA 3QZUA 3ILSA 1TAHA 1LPPA 4B6GA 2GYUA 2Y1KA 4FDMA 5ALEA 5F4ZA 3BF7A 5CXUA 1F6WA 1USWA 1IUPA 3PF8A 1OILA 2GBFA 5ALDA 2PPLA 3QPCA 3WIBA 1E8DA 4KEAA 4FFVA 4MQMA 2JGKA 3W2TA 4E15A 1QZ3A 1EVQA 3HYSA 3ZWQA 1UK8A 1WHTA 2H7CA 4K5QA 5HK9A 4J3JA 1XZHA 3VJKA 1AGYA 1GXSA 1QIKA 1DWPA 4J0HA 4U2GA 5SYNA 4FHZA 4YPVA 3BE8A 3L1HA 1QOZA 4QEKA 1CQZA 1GQSA 2G5TA 4HTAA 4UBKA 1L7QA 2DHCA 1CUCA 2VT6A 1EVEA 3R3XA 3IA2A 4JNCA 2PU5A 2AJDA 1S8OA 2PL5A 4UBIA 3TRDA 5T4EA 4BAZA 3DS8A 3I2KA 3WL5A 4Y2PA 3WZMA 1H23A 5AO9A 2GBCA 3C87A 5EI5A 4EZIA 4B7ZA 1LLFA 1THGA 4XWGA 1MNAA 3O9MA 5AJHA 2JEYA 4FBMA 4F60A 4I3FA 3DOHA 2JGJA 4DNQA 2RHWA 4AN1A 1SCIA 4Y7DA 5DTIA 3H17A 1MX9A 1VLQA 4ZI5A 3KWFA 2XLCA 5ALPA 3B12A 2WU3A 2HU5A 3UMJA 5JANA 3FYUB 5AOCA 2VQ6A 3DYIA 3K6KA 1HLGA 5A7HA 5AK4A 3CXUA 1GPKA 4K2AA 3H1AA 5ALVA 1BN7A 1D07A 1YAHA 4EBBA 4EUSA 5AKIA 2HU8A 5AKJA 3A2MA 1M33A 4G4IA 5BV7A 2O2GA 3R0VA 1F8UA 1H2XA 2Z8XA 4F21A 4X93A 3OTQA 5A6VA 4XX1A 4C4XA 2QS9A 2VSQA 5K3BA 5CH5A 3WKEA 2QZPA 1B6GA 1QIMA 4DNPA 1P0PA 2WHRA 4X92A 3WMRA 4AZ3A 4X94A 5IKXA 4HXEB 5FKJA 3FYUC 3H0CA 4PSDA 4OYLA 4P93A 3QH4A 1QE3A 2NW6A 1XRLA 2JF0A 2H1IA 2X5XA 2ZSIA 3O4HA 1VE6A 3B5EA 4BATA 3N0TA 4RGYA 3WYDA 5DYWA 4MWTA 3WL7A 3PF9A 4O08A 3WKAA 5JZSA 2CJPA 2VTVA 1BN6A 4JUIA 4J0IA 4QLOA 5FDFA 3FSGD 4QDTA 3H19A 4LYDA 1Q83A 1X70A 2AJ8A 5ALYA 4IHAA 1EA5A 1THTA 2HL6A 2H7XA 2ACKA 4H7FA 3DJYA 2I78A 3TEJA 3ZLUA 1TCAA 4UBJA 1QIIA 4MYDA 1EH5A 2WIJA 1EX9A 2G4LA 1AMNA 3WWEA 1EK1A 1DWQA 1XKTA 1Y37A 4J0GA 4UHCA 2XUQA 3GA7A 2PSFA 4RPCA 1DQZA 2ORYA 4TVKA 4KYVA 4J0KA 1GT6A 2PX6A 2BFNA 2XUJA 3UUEA 5ALZA 1XFDA 4LXIA 3I2GA 2HA3A 4B9AA 3QMMA 4FFWA 3H2JA 1U4NA 2XQFA 1XZCA 4G4JA 5AM4A 1QO9A 3A2NA 3EIOA 3ESAA 5LIPA 1TCCA 3QMVA 4BVKA 2CMFA 1H2YA 2HA2A 2QM0A 1DT3A 1A88A 1BEZA 4QDZA 5HQ3B 1MPXA 1BCSA 1LZKA 2YH2A 3IIIA 4X71A 3BXPA 3WL6A 3C5VA 4GBGA 2JGFA 1GPLA 4BRZA 2OQVA 4M0MA 2WJ3A 4BDTA 5AM3A 5E4JA 3WYNA 3OPMA 3I2IA 1YCDA 5CT4A 1XQXA 5LZ7A 4C88A 2Z3ZA 2VF2A 4OB7A 3VXKA 4B0OA 4INZA 1LBSA 3FWHA 1W75A 2VAVA 4FOLA 4DLNA 3DD5A 4PSCA 3HEAA 3R3WA 4C87A 2WUEA 4G1FA 5KWJA 3FCYA 3ZV7A 3G0CA 1AZWA 3H2IA 3OM8A 1SC9A 2V97A 2HFKA 2CKMA 4HXFB 5AIBA 4Y2VA 4HRYA 4ZWNA 2OPHA 1N8SA 2VATA 1C7IA 3MUNA 4QE3A 4B85A 4QDOA 1YA4A 2XMZA 5DNVA 1TCBA 4QWWA 1JT2A 1L7AA 1A8UA 4Y2UA 4CCYB 4J7AA 1U8EA 5HK8A 1ETHA 4OD0A 3BJRA 3QITA 2B4KA 5AI8A 5JAOA 3HXKA 1AKNA 1OXMA 5EHZA 3HJUA 2GBIA 4W1PA 4BC1A 5ALIA 2W6CX 2PSDA 2GYWA 3V1NA 2R8BA 4MEBA 4UFPA 3O95A 1CVLA 1MNQA 3OURA 4G8CA 2VT7A 4UBLA 2QMQA 3IUQA 2K2QB 4PSUA 3VVLA 5AKEA 1VXOA 1UOOA 3QYJA 2DQYA 4X6YA 3WL8A 4P9NA 2AXEA 3IUNA 5DWDA 4BC0A 4J0JA 3ICVA 4ZV9A 1CUZA 3SC2A 1CUEA 4BE9A 5JASA 3G8YA 2OAGA 2IX9A 5AP9A 2DHEA 2JGMA 4FKBA 3F9CA 2J3QA 3LIIA 4UBOA 4GLBA 3GZJA 3PI6A 1CV2A 4J0DA 5AI5A 4XVCA 5JZBA 4GDMA 1ZD5A 1MO2A 1PJAA 4G4GA 4EA6A 1Y7IA 2ZYSA 1YSCA 3W05A 2O7VA 2WILA 3OG9A 2O2IA 2WHQA 3AZOA 4GECA 5BWBA 2PBLA 5ALRA 5DYTA 2HIHA 4JYMA 2Y6VA 4ZXFA 1SCQA 1JJFA 1TRHA 5AI6A 5ALSA 3MGAA 4KR0A 4C6HA 3ESDA 3OOSA 1ZI8A 2CUTA 5AOBA 1JJIA 1EB9A 1ZGCA 3M3DA 1LPSA 4CG1A 5HZGA 1R9MA 1XZEA 2HDWA 5ALNA 5ALLA 5C81A 3EQ8A 4CFSA 3DDUA 2XMCA 5LLSA 4QZVA 6YASA 1LNSA 4F0JA 3KDAA 1T4MA 4H7DA 3O9VA 1K6EA 3WWDA 3AIOA 3I1IA 1W76A 5HKBA 2OGTA 1XRPA 3AUKA 4B81A 3ANSA 4BBZA 5AI9A 4X6UA 1GGVA 5AM1A 3C5WP 4XJVA 4WJLA 3V1LA 4N5IX 3PUHA 3CN9A 1K63A 2XQIA 3ESBA 5C8XA 2G5PA 2JGEA 2QXUA 3WI7A 4AO7A 2WQZA 3STYA 1HQDA 2OCKA 4UUQA 1GKKA 1I6WA 5CT9A 1EDDA 3RLIA 4OB8A 4OSEA 4UFOA 3ED1A 2BUBA 2LIPA 1CFJA 5JAUA 3EBLA 1QIFA 1XZGA 2XE4A 4QLAA 2X8BA 2PKYX 1CUBA 4S0XA 5LKRA 3I28A 3NGMA 1VZ3A 5C8ZA 1FSSA 2P8SA 5ALJA 1G4HA 2YASA 1GPNA 3VJMA 1G66A 5DNWA 1QLWA 3DKKA 4DNFA 3NUZA 1LPMA 4QDXA 5AK3A 2QKYA 4A5SA 3H1BA 3I1YA 1MX5A 1O6GA 1CUUA 2Z5GA 4BZZA 5HFNA 3M83A 2DR0A 3H2GA 5I8PA 2J3DA 2H9YA 4JEIA 2DFPA 1U2EA 4KJXA 3H04A 4Q1VA 1G42A 4CCYA 1QIHA 2QXTA 2BUAA 4CIAA 5DYYA 1QGED 3EQ9A 4NZZA 1RWQA 5JIBA 2GZSA 3A2LA 1QIEA 4K6KA 1CUSA 2HHAA 4Q05A 5HF9A 4X85A 4P08A 1W52X 1R50A 1QFMA 1N5MA 1E89A 3E4DA 1BCRA 1A8SA 3KD2A 2XB6A 2HA6A 2JIDA 4LYEA 1LPOA 1CUYA 4FMPA 1UZAA 1ODSA 1VOTA 1YS2X 3FNBA 4BP9A 4KAAA 2AJLI 1ZJ5A 2VA9A 3AIMA 2D5LA 1IVYA 5EIEA 2ES4A 3C45A 3KOOA 2PVSA 4Y2RA 2XLBA 4AB1A 1CLEA 4B80A 4G9GA 3AZPA 1MU0A 3UUFA 5H3HA 1LBTA 4E11A 1MJ5A 2YXPX 4M0FA 1PFQA 4IQ4A 1CPYA 4FWBA 1Y7HA 1ZOIA 1UKBA 4AN0A 5LP1A 1QONA 4U2FA 4PNZA 1R9NA 1CUJA 4AMZA 2WM2A 3WK4A 5AI4A 1CQWA 3CCCA 5ALHA 2YYSA 5I9IA 4X00A 1TIBA 5C7YA 2ECFA 5EHQA 2BAGA 2QR5A 2CEKA 5AKGA 3R3VA 2C58A 5ESRA 4H7HA 1GQRA 1BU8A 4W1QA 4KAFA 1KU6A 3E3AA 3P2MA 1ODCA 3PFBA 2H7YA 3LIPA 4ITVA 5EIHA 2E3JA 1J06A 2WFZA 4ZREA 3T4UA 4B82A 3QM1A 4YX9A 4G5XA 1WHSA 5AIAA 3G9TA 4DMKA 1DQYA 1XRNA 4Y9SA 2Y2UA 1UWCA 4YASA 4L72A 1ISPA 4BYMA 2QOEA 3WKBA 1XLVA 3OC0A 3WWOA 2HRQA 4HZGA 4H7EA 4CI9A 1XZDA 4CIBA 1BROA 5A7FA 3D7RA 3WJ1A 1XLWA 4FLMA 1JI3A 3E1GA 1C4XA 1XQVA 4BE4A 5A2GA 3QPAA 4DM7A 5BWCA 5ALTA 3WK5A 3DEAA 5D3ZA 4WY5A 1ZI9A 1CUIA 4V2IA 2J4FA 4TPKA 5CH3A 3V1KA 4ZV7A 4FBLA 2ONCA 2RI6A 2XUIA 3IB3A 3HSSA 4Y2TA 4OU5A 3WKDA 4FTWA 1AX9A 1N5RA 3DLTA 4HRXA 2WJ4A 1ZIXA 5FOQA 3KXPA 5KREA 3M81A 2JBWA 2XMGA 4B84A 5E4TA 2VJBA 3WZLA 3C6YA 3LS2A 1SOMA 5AICA 3WK7A 1WB6A 5LZ8A 5IVKA 4U2BA 2EDAA 5ALOA 3GUUA 5KBYA 5EHNA 3HC7A 1AQLA 1NX9A 1X2EA 2HA4A 1QIGA 3PDCA 3VISA 3FSGA 2OCLA 2WTMA 4BVLA 3VKFA 1Z68A 2QUAA 2XI4A 4DMFA 5LZ9A 1LPNA 1MN6A 4NS4A 3FLEA 2OAEA 3AILA 2EDCA 3SX4A 2IITA 2WFMA 3WA7A 1N1MA 1R88A 4A23A 1FFDA 2VJAA 4UFNA 5HF6A 5CURA 1UOPA 5CRIA 4EHBA 1Q84A 4P92A 5CT6A 2QJWA 2OXEA 4A16A 2PU7A 1EHYA 1JMKC 4WFIA 3R40A 4DSAA 5HF5A 2V9ZA 4FLEA 5FXMA 3ZLTA 4UHEA 4M0EA 5D7BA 4G8BA 4BZWA 5DJ5A 5AKYA 1F0PA 4HAIA 1R4ZA 4HVTA 1BEEA 3L1JA 1UXOA 3HABA 5CBKA 4W9RA 4H18A 4GWLA 4AQDA 5AM5A 1X2BA 4AZ0A 4IO0A 2D0DA 3QVMA 2BJHA 3ZI7A 4MYSA 5YASA 1H2ZA 5JAHA 5JD5A 1EINA 2I3DA 1UK7A 3E0XA 4L9AA 1SFRA 3D4LA 5DNUA 2IIVA 1C7JA 1YS1X 2O2HA 1TK3A 4H7KA 5CW2A 2HA5A 2FJPA 4MXDA 4KE8A 2XQGA 5A62A 5ALKA 4DIUA 5BOVA 1XZBA 4PW0A 1H2WA 3V1MA 4KE9A 1VJ5A 1XZFA 4BCDA 3O0DA 5ALQA 3WWCA 2I3ZA 2RGUA 3LP5A 3WIOA 4OB6A 5JD4A 3STTA 1JKMA 2UZ0A 2ACEA 1IMJA 1A7UA 1WPXA 2PSEA 3JW8A 1P0MA 3I6MA 1YR2A 3R3ZA 1EB8A 3WWPA 2PSJA 3I2JA 1LZLA 3MVEA 4H77A 3WK8A 3GROA 1W4LA 4H35A 2DHDA 1FFCA 4D9JA 5T4HA 1NU8A 2XMDA 4IH4A 1CUXA 4KRXA 4FNMA 2WG1A 2HADA 1QTIA 2QJRA 4ROTA 2OLEA 2RONA 1P0IA 5LZ4A 4JH0A 4UHDA 4C4ZA 2XDWA 3G9UA 5LZ2A 4G8DA 5IVDA 2WU4A 4X6XA 5AKHA 4KACA 4NVRA 1CUDA 4W63A 4GI1A 5EGNA 1K4YA 3JWEA 2OCIA 1NU6A 5HQ3A 1PV1A 1J07A 2WKWA 2WHPB 3F97A 1QIJA 3N2ZB 3EF3A 1UKAA 4DGQA 1CR6A 2VJDA 4EY4A 3FCXA 1UKCA 4L3WA 2JGLA 3VJLA 2QVBA 2PSHA 5EFZA 3HZOA 4W1RA 3R41A 3G02A 1W1IA 1TQHA 3QPDA 1OCEA 5A7GA 3W06A 5ALGA 2XMQA 4Q34A 2AJCA 2QRUA 2QT9A 5AK6A 2GZRA 4BB0A 3WK9A 5DTJA 2WUFA 2OQIA 3M82A 3NWOA 1E8MA 4CG2A 4J03A 3QBJA 2HU7A 4LIPD 3S2ZA 4AX4A 4K6HA 3RARA 4NMWA 2VAXA 3I6YA 1J2EA 5K3DA 3FBWA 2G63A 3AFIA 3STVA 4N8EA 1YB6A 1CUHA 4KE6A 3SWWA 4Q82A 5HCUA 5IVHA 4EY7A 4EY5A 1WB5A 1EXWA 4K6GA 3BDIA 3FYUA 4X97A 4QNNA 1UFOA 5I7UA 3BIWA 4WDRA 5CTAA 4ZGBA 2B20A 3WK6A 1R3DA 4RE5A 1WPRA 4N8SA 5AKZA 3WLAA 4EY6A 4UPDA 1Q0RA 3QMWA 2AJBA 4N8DA 4CG3A 1DTEA 2B9VA 2CB9A 1DT5A 3PFCA 1K8QA 1XZMA 1FFAA 2ZJ6A 1XZLA 1ZI6A 4ARBA 4H0CA 5FV4A 4N5HX 2XUPA 2BUCA 2WG0A 2JGIA 3X3HA 5CT5A 3PICA 1E3QA 1ORVA 2C0QA 1VA5A 5ALMA 4UHHA 3WA6A 1KEZA 5LZ5A 2I03A 2HRRA 5K3CA 3BWXA 2QTBA 2WSLA 4BVJA 1P0QA 1WCYA 5KWIA 5FP0A 2XUKA 3HACA 2HA7A 2ZSHA 4PV7A 4OPMA 3STUA 3VVMA 2ROQA 1LGYA 1CRLA 5SYMA 1CUGA 2FJ0A 2HM7A 3GBSA 3DOIA 3U0VA 2XQKA 5JAPA 2WIGA 1XKLA 5CXXA 4B83A 4WDQA 3LCRA 1EDEA 3DCNA 3IULA 1CUFA 3S8YA 5FPQA 1FFBA 2R11A 1XRRA 3H2KA 4PO3X 4OYYA 4X91A 1HL7A 4G9EA 2WUGA 3LLCA 1XQYA 1VXRA 4QWMA 1XROA 2DQZA 3HI4A 1BRTA 4ARAA 2BCEA 2XUHA 5AI0A 3G0IA 2V98A 3D5EA 3JYHA 4MWSA 2ZJ7A 5ALXA 5JYCA 2WUDA 3HLKA 2XMSA 3W9UA 2XUOA 5ALFA 1RYYA 3G0DA 3IVMA 2DCMA 1BE0A 4GHWA 4DYHA 4BDSA 2Y6UA 1DX4A 1SCKA 3F8SA 1FFEA 4OCZA 2Z8ZA 2Y2VA 4UBNA 1GZ7A 1FJ2A 4EB0A 4IH1A 4ZRDA 3C43A 3O4JA 1ZD2P 4LXGA 4LHEA 3C6XA 3H2HA 2WIKA 5FRDA 5E2IA 3D2CA 5K3AA 1JFRA 1CEXA 4AXBA 2DSNA 5AKXA 1EDBA 1E8NA 5K3FB 2GYVA 1HKHA 3WQHA 5A71A 3WKCA 3STWA 2XUAA 4U2CA 2FUKA 2XT0A 4AO8A 5HKAA 2FX5A 1L7RA 1MTZA 4MQLA 3STXA 2XMRA 2ZJFA 2WHPA 1K5PA 3ESCA 4GXNA 1Q0ZA 3F98A 1MT3A 1VZ2A 1WOMA 1UOQA 3R3UA 3PE6A 1WB4A 3DQZA 3V9AA 2C0PA 2CZQA 4JYPA 4E14A 2OCGA 3SK0A 1HPLA 1O6FA 1MAHA 1MAAA 2W22A 4HXGA 2OGSA 2ZYRA 2OGZA 5T4FA 4MEAA 1E5TA 4B9EA 4Q3KA 5CMLA 3FLAA 4KE7A 4DTCA 1LPAB 4KRYA 4OU4A 4U2EA 3R3YA 1XZKA 1J1IA 3RKSA 2XUGA 1ZIYA 4Y2SA 3Q8WA 1XZJA 4I4CA 2RHTA 2WG2A 1ACLA 1WM1A 4BP8A 3KWJA 1ZD3A 4UHBA 4QDUA 4WFKA 5EIAA 2QUBA 3B3QA 1ORWA 3BDVA 5AK5A 1TKRA 3YASA 1CIJA 2WTNA 3CN7A 2O7RA 3WJ2A 2Q0XA 3EQ7A 1ACJA 1CUWA 1EK2A 3DL4A 4Q3OA 5HFAA 3F67A 3AJAA 2ZYHA 4J0CA 1ZICA 5AM0A 4BRSA 5E4YA 2JEZA 4GW3A 2ZYIA 5D3KA 3O4IA 5IH7A 1XRQA 3IUMA 2Z3WA 3V48A 4CCWA 3C70A 4X7BA 3D3NA 1JU3A 5FPPA 3O4GA 1DINA 1ZD4A 3FVTA 1IUNA 1CUAA 4C4YA 4Q3LA 4WY8A 4FLFA 4X3CA 3D59A 4Y2JA 5LYYA 3D2BA 2V96A 5AOAA 4KAJA 3IURA 2WIFA 1XZIA 3BJMA 4L0CA 3FLBA 5T4BA 4XIIA 4DMCA 1IZ8A 1QJ4A 3ANTA 5AKKA 3U1TA 1EI9A 2XMBA 3IBTA 5LKAA 1W6RA 4BAUA 4DNOA 3RM3A 4BTVA 5CT8A 3D0KA 3W04A 2WIDA 4BCBA 4FNGA 1AUOA 1IZ7A 3BL8A 4BAGA 3AZQA 1QO7A 4GEGA 1B41A 1R1DA 2PUJA 2PM8A 2BKLA 3W9BA 7YASA 3A70A 3AIKA 1JJBA 3FOBA 1ODTC 5EHXA 3RK4A 3T52A 1VKHA 3FAKA 1JU4A 3DL7A 3L1IA 2HA0A 5K3EA 5ALWA 3C6ZA 4Y2XA 2PUHA 1F0NA 1UK9A 2VEOA 1UK6A 3ZPXA 4OUKX 1AC5A 1QIDA 4E46A 4H7JA 4AO6A 5JATA 2WJ6A 4C89A 5C8VA 5J3JA 3KSRA 4Y2YA 1GKLA 1LPBB 1XLUA 5AM2A 1HDEA 2C4HA 2HFJA 3NOXA 3AINA 5JZ9A 5D6OA 5DLPA 1VE7A 4BCCA 3G7NA 3C6BA 2WLSA 2GBGA 5IVIA 3F96A 5AKLA 3A6ZA 3IDAA 3IUJA 5ISMA 4PQEA 1JMYA 4AMYA 3GFFA 1E66A 2C5GA 4X90A 5FLKA 4B0PA 1HBJA 2XUDA 3D2AA 1ZJ4A 1VA4A 3FVRA 1DWOA
chains in the Genus database with same CATH superfamily
4PG5A 2RIPA 3MWGA 4EF4A 3MF4A 4OBBA 5K3FA 4D4HA 4PXYA 3KV3O 1J25A 1QRDA 2D2XA 4IIHA 4R83A 4F6LA 5CA1F 4N12A 3ICEA 4WSOA 4CUJA 1AURA 4YUXA 4B5LA 3DHVA 1CDDA 4HS9A 2FPKA 1SQ5A 3JCZA 1ZNZA 1LDBA 3NIWA 3NXKA 4BFCA 4ZVTA 1RM4A 2TS1A 4UUMA 2HPHA 4DADA 1CZRA 2BJVA 3OZTA 4Y0NA 2GHQA 3UW3A 3H9BA 1N2CB 3FB1A 3I3OA 5SY4A 4EJ6A 3DZ8A 5BXQC 5KTSA 1GM5A 4TV9A 1DKUA 1ZGBA 3DEIA 4K05A 4F11A 1N36B 2FJUA 4RLQA 5JS1A 3RC2A 3NWJA 3I2FA 4WUTA 4ZO9A 3LBNA 1X7DA 3EIEA 5LDDC 10MHA 4KIJA 3ITNA 3QOWA 1CF9A 3O0TA 1L5MA 3REFA 2P7IA 4JI6B 3CCBA 3NNNA 2FEOA 2D00A 3MINB 4TWIA 2RHCA 3B8HA 3MTGA 2R97A 1ZXXA 3RS0A 3RF7A 4CQMA 4EG4A 2BGJA 3ZE7A 4BMOB 1XB2A 3EPPA 1QYXA 5FHRA 5MN4A 1BH6A 1ZD9A 1FYXA 4W8GA 4EHAA 3UJHA 2ORIA 3PXEA 2QPAA 5AVVA 4GNKA 3I76A 4UW9A 2F1IA 1F48A 1PKXA 1R0XA 4CFZA 3GLQA 1YGPA 2HI0A 2Q1SA 5DF1A 5FA8A 4BNVA 2AI2A 3K6SA 3A6GA 2BISA 3RIHA 4MUKA 3GFSA 1EP1B 4M9QA 1LU9A 1I7SB 3GIWA 4L08A 2H51A 3DZDA 1YA8A 3U3DA 3E84A 4O4HA 5KMGB 1G291 3IHTA 3OTIA 3WLOA 1SUAA 3O38A 3T7JA 1ZUNA 3BKXA 3T7EA 3E82A 2DETA 1FFYA 2FN4A 3GVIA 1I3MA 1BDMA 4OXNA 1E9FA 4QQRA 5CG1A 2GWHA 5CVUA 3HCRA 3WMXA 2OV6A 5G0WA 2P2YA 2XOKA 4ZKEA 3CF0A 2V9PA 4WN9B 4QA9A 3BIJA 1RRVA 1CNEA 4FGJA 2PJRA 1J21A 3PNKA 4WXEA 3HB9A 3K2IA 5BN4A 2BGRA 1DSSG 4QBTA 3KSUA 5AHXA 3ZG6A 3TW4A 2F3TA 4W1SA 1T5OA 3H18A 3IQDB 3NHZA 4B3BA 5IEJA 1N5IA 4H60A 4RZSA 4RHFA 5FF9A 1A4UA 3IVAA 4IDHA 3CCFA 4EG0A 3IYLW 3DQQA 4I19A 4PR3A 4XGRA 3V6LA 5LQJA 5LQSA 4JI0B 2MR6A 1BQ3A 1NVAA 1PTJC 3I2HA 2P9ZA 4QYIB 1PR6A 1ZC3A 2V4MA 3BFVA 3WQBA 4AG5A 1JQ5A 1CT9A 3NUGA 3I34X 4EEZA 5J2TA 2ZVDA 4C01A 5IKMA 4BFSA 3QXHA 1RJEA 3ENWA 3INNA 3H5OA 4AZ3B 1X13A 5DNDA 3MUOA 4QGGA 4HNVA 4ZZ3A 4Y2QA 1JDZA 5JARA 5JO9A 4JXZA 3AYZB 1G5QA 2FCRA 1YJCA 3OCCA 3KXIA 1XDDA 3PNYA 2EV9A 3TOVA 4D8VA 4UHFA 3KQLA 1FLNA 3ZDDA 2Y76A 1N0WA 1SUBA 2VNAA 4GZ5A 1TAHA 2IYFA 2QUJA 4RIHA 3HFGA 4P35A 4RK1A 2R48A 1CF4A 1Z83A 1GTL1 2R8PA 3INRA 2OFWA 1LPPA 1IN1A 2FEXA 4BLPA 2TSYB 2YCLA 1WD5A 1OXKB 4MKHA 4HAYA 4FDMA 3ZZTA 1E99A 3EEIA 3NS7A 2ZBRA 1MABB 3OA0A 4Q4HA 2KI5A 1JLHA 2R1UA 3QU7A 4I2NA 1JAZA 2BSAA 1U3CA 2FVYA 4MSUA 4PAWA 4BJ6A 5B6PA 5J2TB 1F6WA 1USWA 1XTVA 4C4SA 2JC3A 3PF8A 1QC5B 3H8WA 5B2FA 1MOSA 4RGBA 3T1NA 1TDJA 5ALDA 4BJHB 3LP6A 3PXBA 1T2VA 2YFYA 5BRNA 2AXNA 1YZLA 2NQTA 4G1VA 4EF6A 4IEEA 1HDRA 1OLXA 1R8YA 5I9BA 3G49A 1A8IA 3PR1A 2E1PA 3GIDA 2Q5OA 2FUNB 4U3JA 2IHZA 3W2TA 2XGSA 5DW0A 1QZ3A 1W8IA 3Q41A 4HDSA 4C07A 5EJ6A 2QTFA 1A72A 2PKQP 3I8OA 1GUDA 1ECPA 1M1ZA 4CR8A 3HYSA 4QTYA 1UK8A 4IDGA 3D54D 3W2GA 4B7UA 4MV0A 4LSWA 2IVFA 1CULC 3UEOA 5HK9A 2B6NA 3FMIA 3QEOA 3DZIA 2LCQA 3FF1A 4YDQA 4PG8A 3EEOA 5BUQA 1KHTA 2GEFA 2GK6A 1N1GA 3VJKA 4RPHA 4B3FX 4YO8A 2CLOB 3UGTA 4J0HA 4U2GA 1GTZA 1T8RA 4OEHA 4CM9D 4YPVA 1JILA 5DM1A 1HDCA 2VHEA 3L1HA 1DMRA 4IGKA 1V9LA 2QRMA 2GEDA 3GFPA 3R4CA 1ZC4A 3IJEB 3QXGA 3C3AA 4HTAA 1ZK1A 2F1HA 1W29A 3EOAI 3PP8A 4MRVA 4UBKA 4XCXA 1FJHA 1JXQA 3NORA 2C5AA 1JS1X 2Q2QA 3AKDA 1C4WA 3F7NA 1CUCA 3KUUA 4WKNA 2VT6A 3AP1A 3LI2A 3R3XA 3UAWA 1D0VA 5DHUA 4BLUA 1W19A 4F4IA 4ZIRB 1IHDA 4G81A 4TMXA 1QK5A 2PU5A 1Z15A 5FBKA 4CE6A 2GKSA 1Y34E 3IPLA 4ZPJA 4F5WA 4UBIA 4BWFB 5DBFA 3LT2A 1NOKA 5T4EA 3WLRA 2CVPA 3LOPA 1F1JA 4R81A 4Y3UA 5EERA 4QXAA 4U6NA 1V37A 3S6JA 3DS8A 2QYSA 4JODA 1XHEA 2XWJI 4R9NA 4WEOA 4AJNA 4EDFA 1W36C 2CLKB 5C51B 2NO5A 1C1DB 4WPGA 2Z0MA 2QAGC 4FE3A 3ZDCA 3U49A 3H6HA 3WZMA 2ZI5A 3GMIA 5AO9A 2H2HA 1GA1A 3Q7RA 4F84A 3IIKA 4NFHA 3E3MA 1LLFA 1E1MA 3OQ1A 2WYIA 2GNPA 3MMZA 2HRCA 1JWLA 1PZEA 1VL6A 1P2FA 2X3YA 3MYYA 4IXMA 1S3IA 3VZBA 1NQTA 2V7EA 5B58C 2O8VA 4EVRA 5FBQB 3RUDA 1B00A 2PCLA 5ABPA 5TMEA 1UKYA 3WP1B 2IJGX 1IPFA 1H93A 4J4TA 1MFZA 2PGLA 4I3FA 1YHNA 4HATA 1D6JA 2XE6A 4H3KB 3WRXA 5EHIA 2JGJA 2C03A 2RHWA 3R7AA 5KX5F 1C0PA 3GT0A 1E4VA 4AN1A 2GPWA 4Y7DA 3H97A 4E5YA 1H4QA 4J49A 1FSFA 1MX9A 2G82A 2J3KA 4V3BA 1CU1A 1TK9A 3A26A 3I01A 4W8HA 3O8OB 3RWBA 4W5JA 1GG9A 1LTKA 2WKSA 3CNEA 4WY2A 2H9AA 3UMJA 1RXYA 3V8QA 4AF7A 5L4NA 3W4JA 3V4PB 1YQXA 1A5BB 4KFUA 3NMUF 1JW9B 3C3PA 3DYIA 4O2AB 3T5BA 1TM4E 3SP1A 3EX7C 3RYIB 1N6PA 2RC6A 1B16A 1HLGA 1Y4SA 1BC5A 3K6KA 3M6AA 3OEED 1HQKA 3NH9A 2IP2A 4YHBA 1VGVA 2DFKB 5EE0A 5FADA 5FJJA 5FLXA 2AD1A 2WJAA 5A7HA 4GG1A 3H87A 4TLDA 4UCWA 5CDUA 1RRMA 1Z74A 2VJLA 1ENOA 3F7OA 1ULSA 3H1AA 4K2AA 1D07A 1KZGB 1G2PA 4MVYA 5EPUA 1JYSA 3SKYA 1Z0JA 2H8KA 3WYAA 1QB7A 2OM2A 1MGOA 3TVDA 4N1AA 3PV0A 1KJJA 2GT1A 5DTQA 3VR6A 3JQ6A 5JYEA 1W4RA 3EJWA 1IWPB 4ZQFA 2HU8A 3CA8A 1LS1A 4DEYA 4FGZA 2IZ1A 2ATEA 4G4IA 3KOMA 2V0GA 1FYDA 3E48A 7REQA 2QTMA 5AVKA 5IS2A 2ZXUA 4Q1BA 3K3PA 4DDKA 1MO4A 3N2KB 3R0QA 1FX0B 1NX6A 3H05A 4OAPA 4PQFA 4Y6OA 2O2GA 4KO3S 3HCCA 3HVKA 5FNVB 1S6YA 2WMYA 1YDEA 4IIGA 2O3TA 1G8SA 2DBRA 2HCTA 4Q02A 2P2CA 3FZGA 1R5BA 4QT0A 2AN1A 5D1NA 4CQMD 5KWSA 1GZHB 2VN8A 3ITEA 3TB6A 5BO5A 3GGJA 3Q72A 4OY3A 3SIXA 1XVUA 3LC0A 4RDCA 2VSQA 2JD1A 4ZVOA 5K3BA 1U3DA 5C5CA 4PTLA 1R15A 2JCGA 4XRRA 4GX2A 1NRWA 1RWWA 5F1KA 3T4XA 3OZXA 3BK1A 5KTKA 1E5LA 2ZB4A 4HDSB 1FLVA 4HAUA 4LF7B 4G0WA 4MHTA 1B6GA 1IULA 1SELA 1Y4UA 3CEMA 3A4VA 4RADA 3ZDFA 4BJ3A 4EA9A 4EIWA 4TRJA 1P0PA 2WF9A 4YACA 3R7WA 2PEZA 1P60A 2WHRA 3DMTC 2WINI 1XZPA 3FHLA 1V3QE 1ZGJA 1P1BA 4DQUA 5K20A 1OX6A 2J6IA 1E6WA 6NULA 1W9MA 4KWIA 1UJ4A 3GCDA 3KOZA 4X1YB 4CHGA 5HZMA 5JROA 1V7QA 4YJHB 2O2XA 2WIAA 5FKJA 1W1UA 2BLNA 1OFIA 2HBYA 2WZDA 1IEWA 3DDHA 4OLBA 4RK7A 2QMYA 4OQQA 1T2CA 4F2GA 2PLRA 4P93A 2A9OA 4CF3A 3DPIA 1VPDA 1TQDA 4FKMA 4E33A 3GY0A 2WTUA 2ZCUA 2X5XA 2BDUA 3E23A 4NZ9A 2QMEA 5E6RB 2RDMA 1ISSA 3KQQA 4QU9A 3SU8A 2XBLA 3E05A 5EPEA 1VE6A 4A82A 4TV9F 4DNXA 5K8IA 1CRQA 1Y7LA 2J3EA 2FETA 1N57A 4TL7A 4Z4CA 4YWHA 2VSFA 1U0TA 1DEOA 3I72A 1RQGA 3MQ2A 1A9PA 4Z7JA 4RYLA 1LBIA 1IIBA 2JEOA 2C5EA 3PXUA 3R6GA 4N5NA 3WL7A 2D06A 2DXIA 3QSYA 1UWVA 5C3MA 5JZSA 2CJPA 1BN6A 3KK0A 4WXPA 3CZRA 1SVMA 4F93B 2GM3A 4OI4A 2XGOA 3NH6A 4QLOA 2PUCA 1YKSA 4W4TA 5TC4A 4LAFA 2V59A 2AFHA 1ISMA 4FZRA 3H19A 4B31A 1K5DA 2WAOA 2P5SA 4KMOA 3SOPA 2EQAA 1X70A 1JVBA 3S28A 4H31A 3V32A 1P2SA 3CZCA 3G1UA 4R1SA 5TS3A 1KYXA 1UINA 2FZWA 3OFVA 4AYXA 4H7FA 3QE0A 1AQUA 1QGUA 1OLSA 3AI3A 4GLOA 1F2UA 1JHOA 1GTG1 2KB0A 3ZLUA 4JLKA 4UBJA 3C3WA 1R0WA 5H3CA 4CIYA 1ISGA 4ZYXA 2ZYTX 2YIJA 1LRLA 3WY9A 3SR3A 3ASUA 3WS7A 3X2EA 4NPCA 4I1PA 2JGNA 2WIJA 3U4MA 4MV8A 3L7AA 5NLLA 1YDMA 2NO7A 2VZEA 3T3GA 4ROSA 4B4OA 5JVDF 2KS6A 4JZKA 4NCAA 1SG6A 1W34A 3C6MA 1M2KA 3TAXA 1Y37A 4X54A 4J1QA 3A14A 4CWAA 5B7QA 2XUQA 3E9DA 4MVJP 4RSHA 1VFNA 4US1R 5CA0A 4PCVA 2C42A 4EJ2A 1DQZA 1GZSA 2ORYA 3R6TA 2DWQA 2H4JA 3COYA 3QKWA 4JGBA 4AZWA 1Q7CA 1NDQA 4F1KA 3T1VA 4TVKA 3GLGB 4AI6A 3KLMX 3QLJA 2QRVB 1YT5A 1ADYA 3LX8A 3FOAA 1QHIA 2ZIVB 1LF0A 1E3SA 4AAYA 4I50F 2EL9A 2XNKA 4KNVA 3M3HA 2CSXA 4LF6B 4P7BA 3SLGA 4JIGA 3EDOA 4MVWA 4TMZA 3EF1A 3KM0A 4E03A 3G8CA 1Q0TA 1RLJA 1RBZA 4X20A 3PBKA 2PFKA 5EWMB 3SBXA 4MQFB 2EKDA 2L82A 3QLTA 1R0CA 1AHIA 2PY6A 4KVGA 1L0BA 1SHKA 2OYRA 2HA3A 4FD2A 3VI4B 4B9AA 4H08A 4FD3A 3BFKA 1GL3A 2VJYA 3B6ZA 4MWGA 3DE3X 4ZALA 4HUTA 4PYJA 1T8WA 4GPD1 5K8VA 3HPRA 4G4JA 1Z2CA 3ABOB 4II3A 5IJ0B 3OZWA 5AM4A 2I4IA 3AY6A 4MR7A 4ZQIA 2DFVA 2A14A 3AOEA 3VUFA 3VDRA 3BSYA 2BIFA 2G9VA 2UVQA 2WA1A 4R2JA 1XX6A 3H1EA 4RHEA 4DCGA 2IY7A 5JR3A 2IXGA 3I0ZA 1RRKA 2GLXA 4I9UA 2HA2A 4D5GA 3PXDA 1QE5A 4P54A 2PS3A 1H6DA 2NO4A 2IYLD 2TMGA 3V9PA 2BR4A 1TEVA 4GI2A 3U4AA 5H9WA 1Z9BA 4JFRA 2ZSJA 1RADA 3PJEA 2L69A 3V1YA 2FWAA 4XE5A 1P62B 3U3MA 1VDZA 2Q6VA 2IX3A 3C5VA 3RQIA 5HGXA 2FRDC 5LBUA 1CY4A 3IAS1 4I50B 2ZRKA 3V4RA 1VP9A 3ZDBA 1JQ3A 1L4HA 2GMWA 2JGFA 3IO5A 3OEYA 4QPPA 3LT5A 1DC5A 1FYFA 2P30A 3NOVA 1GPLA 3PC6A 4BVGA 5SZKB 4R1PA 1X74A 2DZDA 1G9TA 3ANNA 1AQ6A 4E6EA 4WK4B 3Q5GA 4BDTA 3E2MA 1WZNA 3NVMB 4D4LA 2XB2A 2OV2A 4JSTA 4OHVA 3ZLBA 4I81A 4A7PA 1LEHA 3H1FA 1KGSA 5L8VA 3GP3A 1V1MA 2QMHA 1PU2A 1A2KC 3JAKA 5G0SA 3TN7A 2Y1OA 2G9QA 4ABYA 4DQVA 3JZFA 3QWBA 5ED4A 3ZS8A 1XQXA 3AEZA 1LSJA 1O95C 4C88A 5M04A 2QN9A 5KYUB 1SBQA 2MSNA 2Z3ZA 3ZWYA 2XD9A 3VHXA 2C1XA 1GKUB 3U60B 2BGUA 3FPKA 4S2EA 1B93A 2QW0X 4XLLA 4HX5A 5D00A 4N5DA 5L51A 3COSA 4G0XA 4B4KA 1WCWA 2Y9PB 1E9BA 5EIWA 4AF8A 3E53A 5EJFA 4FOLA 3RVMA 5JCZA 2R7KA 2VOEA 2HEIA 2O2JA 3FPHA 5KSWB 1D9XA 4NBKA 2WUVA 1J42A 1PKEA 4AP6A 1EA7A 4JX8A 2HRBA 2AVNA 3DUWA 4MNTA 4CF5A 2ODPA 1OPXA 2H3EA 5E3JA 2Q29A 4BJ5A 1A77A 3W78A 1G20B 1EUZA 5DU2A 5AJTA 1UBCA 3FCYA 1AZWA 1D2RA 3ED5A 3ZY6A 3H2IA 1TK2A 1Z7GA 2R1VA 2PZAA 3GT3A 3PRKE 2BEUA 1U0LA 4XVQA 3FOZA 1BW9B 5K2OA 1N5JA 1PAUA 2C61A 4Q47A 3GEHA 4XD7D 2RG7A 1ZUHA 2PJDA 2VF7A 3WNDA 3VH2A 5AIBA 1T3GA 3OZIA 4JT4A 1BJTA 3W8NA 2O23A 3CT6A 1N8SA 1NMXA 3ZYZA 2GEUA 3ZHQA 2I2FA 3K0AB 4ZDIA 3WB9A 4DC9A 1EQAA 2NO1A 2V3VA 3AR3A 3D7SA 4FZ5A 4MH0R 3GUVA 5LOVB 1TF2A 1YVUA 2HZ7A 5DNVA 2I8AA 2ZB8A 4H3HB 4XOUA 4RJTA 3QVWA 2FA9A 3DMDA 2AZXA 5CJPA 3GT4A 1H3NA 2GN9A 4Y2UA 1UMBB 4ZCRA 2C2XA 4J7AA 2HHJA 1OH5A 3OIWA 1J6UA 2HNAA 3MT0A 4N0MA 4WKOA 3LKZA 1MUUA 1GCIA 1U8EA 5DM4A 1UMDB 5T6MA 3WFZA 4DA7A 4EHIA 4NNPA 3PPIA 3DAOA 1NM5C 1O95D 3N3BC 5HK8A 2GZMA 3TEMA 1TYBE 3QITA 5JFGA 5EMLA 2GB4A 3K16A 2B4KA 3UGJA 1ULTA 2ZSUA 4YP6A 2IU0A 4PFQA 4OJYA 1EFUA 2ZRMA 2B99A 3PL5A 3QE3A 3U80A 5AUOB 2W6MA 5JAOA 4LJ9A 3B89A 1AKNA 1OXMA 3E3LA 1Y3CE 3R23A 1FTSA 3HL0A 4ENQA 3G5LA 3HJUA 3NRCA 4BMDA 1T1EA 3ABZA 3QU9A 2FFAA 4FW8A 4HQFA 4WXRA 2CFOA 5JZMA 4FEAA 4PIVA 4QM6A 2CNLA 3PDIA 3L82B 3T54A 1NUPA 3UMYA 2BD0A 1O0CA 1I2ZA 5TB5A 4DV4B 3C2QA 1X7WB 3KU1A 1PK8A 3DE0X 3W5CA 1UJ2A 4LRWA 1TT7A 2GYWA 2A30A 1GGNA 3AF1A 4JKIA 4WA8A 1Q2UA 3NRBA 3P20A 3WFIA 3X1WA 2IEZA 4KQKA 5TT0A 1E0AA 1SC6A 1JE1A 4I55B 4M9CA 2QTCA 1FOEB 5HBRA 4UFPA 2WWWA 5A5GA 4HGOA 1OJLA 4X9XA 4G8CA 2ECKA 4PS0A 4P5EA 2QL7A 2VYFA 2QMQA 3AI1A 3IUQA 2XRYA 3MRSA 4NU8X 4V0NA 3SQMA 3ZBTA 1E7WA 4ZHQA 1JEYA 4BNIA 4KO1S 4HWGA 4KFCA 5F2KA 1KS9A 1YTUA 1MA0A 2Q8PA 4XTCS 5SY9A 4DY4A 4WZZA 4ZC1A 5KJ1A 5HDQA 1BMDA 1UOOA 2X7HA 1K7EB 1QE0A 3WSWA 3LE8A 2EFCB 3HA5A 4KMSA 5THQA 1NYTA 5F1PA 3WL8A 1NFQA 221PA 1C4KA 3RGGA 4BFVA 4DLUA 1Z8FA 1C1HA 1AU9A 3HY3A 1PK7A 5DWDA 4DVJA 4U7TB 2HPAA 3I23A 3LZCA 4M7RA 4J0JA 4KN6A 5BN3B 4DR3B 1W5BA 3K0CC 1T5TA 5IM5A 5A3VA 1Y1PA 1RPZA 3ICVA 2TYSB 5K3SA 3RVKA 4D44A 1CUZA 3SC2A 5E6SB 2FLVA 3W8DA 1XOIA 4AZVA 2QRQA 3PHGA 4RY0A 4ZA2A 2IX9A 3TUZC 2IUYA 3W5JA 3IKLA 4BN4A 4ED9A 5FI3A 1GUZA 1P9NA 3KJQA 3SHVA 1OVMA 2Y67A 4MX8A 4CMAA 5DPMA 1VBMA 1LDYA 1KEEB 4L4XA 3MSCA 1ND6A 2OLJA 4NCKA 3TECE 1G0NA 1XRJA 4PCAA 3PI6A 1CV2A 3MOIA 1SRQA 1SKBA 2QV7A 1I0LA 2VYND 2CHUA 1VKNA 1PO7A 4L5IA 1R8QA 1YACA 1H9BA 2PD4A 2WA2A 2Y4NA 3LA8A 1YZVA 1N8NA 1VC2A 1MO6A 2JCYA 5L40A 3DE5X 3BZWA 3TL6A 1OGJA 5JZBA 3WQRA 4GP7A 2OCYC 4ARCA 4DZZA 2NSJA 4JC8A 3ZU4A 4PGGA 2VRNA 4RV9A 5KJCA 2HRDA 1DX9A 2CNWD 4G4GA 3ZTWA 4EA6A 3AKEA 1EJ2A 3O1HB 1YSCA 3VZQA 2XECA 3W05A 1TZ2A 4PGHA 4OL0A 2O7VA 3RHSA 2WTBA 3CJQA 4JZYA 4XWTA 3VO2A 5DNAA 1G38A 1TECE 5CVCA 3HDGA 3JAMA 3UHOA 2R1VB 3VKUA 2ZS8A 2D4HA 5BWBA 3SJAA 2PBLA 2O3JA 1KXJA 2ZRPA 4OVKA 2OFOA 3THWB 2E55A 5ALRA 4N5MA 1PVOA 1HTBA 2NXNA 4WESB 1MB0A 1ZIOA 4YRRA 1AS2A 1II9A 5DT2A 4NE2A 2EEZA 3KV1A 1JDSA 1QTQA 2IODA 3PQDA 4ZN6A 1GRCA 2R8ZA 3KFLA 3M1YA 3TIVA 4PAGA 3O8BA 2CUTA 2F1RA 1YK0A 3JD2A 1D1PA 4GOLD 2KMLA 4GPZA 4UAGA 3RIMA 5BSGA 3ZKAA 3FTDA 3FNRA 3K1YA 2EFGA 2VKQA 3R5TA 2YJZA 4ADSG 1JT9A 2GK4A 4EI8A 2OVFA 4YQYA 4NS1A 4UM7A 5EUBA 2ZTHA 4BLTA 3NBXX 4JUBA 4LRYA 1O5TA 1AA9A 4DEVA 3A9RA 4IY1A 3AGQA 2I2AA 3EQ8A 1QH8A 1C80A 1JYEA 2FW8A 2AQIA 1YS6A 5LU9A 3G2PA 4C21A 5J40A 1LNSA 3PX2A 4F0JA 5EJ5A 1QG6A 4L7QA 3C7CB 5F3RA 2AV6A 3ETGA 3EAFA 3O9VA 1KE2A 3I1IA 4M8NE 3RUEA 3KEFA 4DXHA 3U6KA 1EG2A 3LF1A 4E12A 2QMUA 4B81A 3KYJB 2NT4A 1KDZA 4F1WA 4H6WA 1EK5A 3MJEA 4Z6KA 3O3NB 4X6UA 1UFQA 2LW7A 4B7CA 5F2NA 5AM1A 2BGWA 4XJVA 1ZVQA 4CMCA 1AVTA 1FRFS 2BONA 2QX8A 1EEHA 3F4LA 3CPEA 4BZQA 4M89A 4PAMA 2CFCA 1T4CA 2EKQA 2VPIA 3CN9A 3PUHA 5EKXA 3RTDA 3I39X 3LY8A 2PX4A 5K0NA 1NN1A 2J67A 4LOKA 3KYCA 1HYGA 2QXUA 4ON9A 2D59A 1E1DA 1WPGA 5DOVA 1MAWA 1XHFA 4BV2A 4CQNA 1LDEA 1WKCA 4O1IA 4CL2A 1K6JA 1FJXA 1JFFB 3JQ9C 1FUYB 3HKEB 3HNPA 1M2OB 4IYJA 4Y6GB 2AE1A 4UUQA 5IFLA 4YAUA 4LZZA 2JFZA 3GJQA 3RRMA 4ABTA 1NTRA 1KDRA 4PZLA 4JELA 4BNFA 1EDDA 3TNDA 1HEYA 4OSEA 2B1QA 5C8YB 4QRDA 1MQSA 2EGGA 5JAUA 2ASEA 5JBNA 1N34B 3IEVA 1NQXA 1Y9AA 2NV0A 2I66A 3A4TA 1UDCA 1DKOA 4IIJF 1JR3A 1Y3FE 2BKEA 2IZ0A 2XE4A 1W5EA 2FPPA 1HQYE 4QLAA 2X8BA 1CUBA 1LVGA 5IC5A 5IJZA 2OQRA 2QGZA 4QOEA 2N46A 2F3PA 2PTHA 3L8YA 1GUBA 3KJGA 4F9FA 3ZN2A 2DLDA 3NGMA 1NAIA 3GJSA 4LK2A 4X66B 2XWQA 4ZAYA 4BNMA 4YCCA 2GAFA 3CO0S 2C77A 4RELA 3UHPA 5IVPA 4JVOA 4RPGA 1HX7A 4RK6A 1MW8X 1G4HA 3X1KA 1VLVA 3EW7A 1GPNA 4TS9A 3R3SA 4TSRA 3R7NA 1G66A 4M76B 5CNIA 2RGDA 2HIAA 1KKLA 3AJ8A 2C9ZA 1RTTA 4DC0A 4ZT5A 5JQGA 3ZY3A 5G1PA 2ZPTX 3SAJA 4DNFA 2C7GA 1VGQA 4URYR 5JMWA 1ESMA 4ND8B 2X1LA 3BYZA 4QDXA 2JJ1A 4UMFA 3CM0A 5IT5A 1F12A 3E9RA 3PPVA 2JI6A 2XVYA 3L6UA 1IN7A 3OTOB 2JH8A 4FX2A 2HF9A 1QHYA 3S29A 3QKSA 2YMMA 4HWSA 2W6QA 3TSYA 1AGPA 1AF4A 3M4ZA 5KTTA 3VNUA 1YUMA 2IXEA 2C4UA 3F6BX 3LXUX 4UUNA 4V3CA 3SLKA 3Q85A 3DHNA 4NR0A 3A6KA 2PH3A 3ZWKA 1VB3A 4DV0B 1XN4A 2E89A 5I7RA 3I9LA 2I91A 2EP5A 2H9YA 1O9BA 1WXEA 3D8TA 4HAWA 2DFPA 2P3SA 2PAFA 1WPQA 1S3GA 1WMFA 1BVUA 4NK5A 4Y0VA 4XB2A 3NTUA 1AJEA 1G2QA 3WOHA 3TZLA 5EG5A 4Q1VA 4GP9A 3RYCA 1J0DA 1G42A 1RHRA 4CCYA 2QXTA 2BUAA 1DJQA 3BTUA 2EJCA 3OKFA 5C5DA 1TPYA 5L4LA 4NZZA 1A4RA 2CL0X 3CNOA 4OAOA 2QL9A 4J1SA 1Y81A 3RTGA 2PWBA 3B82A 1IXSB 3LHDA 4MRAA 3WLHA 2IOQA 1KWGA 1QLHA 5KU7A 3U7EB 4ANFA 4Z53A 3CZQA 3N87A 3EPRA 5EZQA 2J5QA 5FT9A 3UHJA 3NASA 2XA2A 3KU4A 3L7CA 2X8JB 3EZ9A 1D9ZA 1MIOA 4A8HA 1LJ8A 2B4QA 2JAXA 4Z4QA 4JB0A 3PXAA 1E89A 1PJCA 3E4DA 4L4UA 4LJ5A 3N6VA 2I80A 3NZEA 4LWZA 4MA0A 4NJOA 4EI2A 1ST3A 1YJXA 2ZSAA 1GKYA 1FVFA 2X9GA 1IZ0A 1IXKA 2P9TA 3GDFA 1DC8A 3KD2A 3ZQUA 2PX3A 1YZNA 2W7TA 4OMUA 1KEWA 3S70A 721PA 1X92A 2YOFA 3CRQA 3KBBA 3GBPA 3THXA 4KLCA 3I61A 4FMDF 1E3MA 1ZG3A 1ODSA 3EGXB 1VOTA 2ZRAA 3Q0EA 4LA4A 4NMXB 5AHKA 3OM0A 4RSMA 1GQQA 3A36A 1KKUA 5BURA 1A3CA 4UHJA 4LXQA 1QS0B 3D6MA 5BPHA 4KAAA 2AJLI 4C7BA 1ZJ5A 2LCFA 5EZYB 2XKBA 3I3SR 3U31A 2P9GA 4EPXA 3G2OA 3VO9A 1CC1S 1SPBS 2VHCA 2D5LA 1M6VB 3AIMA 3F4BA 1KAQA 2FFHA 3VVBA 3GRYA 4WKBA 1GQYA 1Y0BA 2QVGA 5DW3A 2J48A 1FU7A 1TMOA 3HU2A 1ZM7A 2V5VA 3KHSA 4L5YA 5TQ2A 5DP2A 2HBZA 1H42A 1OFUA 1JLSA 3ZVKA 1ZCFA 2HXGA 1NNEA 2J08A 4B80A 2CMKA 1IDN1 3CLTD 3V3TA 3IA7A 4G9GA 2IUTA 4MPDA 1IN8A 1AHHA 4RFVA 4BEWA 1H3EA 2SHKA 1XJ0A 4X1IA 4JI5B 1Z12A 4JBHA 1N33B 2XGMA 2BEWB 1OBVA 5C4MA 4FILA 5CK4A 2XJ9A 4BPRA 2XOXA 3LC2O 3MSXA 3BD9A 4QDJA 3ZE1B 4M83A 4S05A 1B0ZA 4IQ4A 4TMVA 3WGUA 4BYGA 1KK3A 3ONWA 4JL5A 4HXYA 2GXSA 4UTPA 1JDUA 3QX3A 4XYBA 3JXEA 4LW8A 3L7LA 1S8FA 5GV8A 2BGGA 1I4LD 2R68A 2ZCVA 4PZEA 3SXPA 1QONA 4JSRA 1DADA 1L4BA 2ENWA 1L8OA 2QWXA 1NW4A 4HEA6 4HR7A 8OHMA 3WK4A 2V5AA 4A0RA 1CQWA 2DQSA 2O19A 1P75A 1PQWA 1R5NA 1RXVA 5KCZA 3RS7A 1V11A 1IM5A 4ARVA 3NNDA 1JA0A 1JIIA 1SK8A 5AVOA 4LF8B 4EFDA 2XWPA 4OHUA 3HN6A 3R7WB 4WD3A 1TU4A 2Q3HA 2CXSA 4YJDA 2HCBA 1KBOA 1A71A 4MV1A 3UG6A 5A02A 2QN3A 4DCCA 1O5OA 4X00A 2ZUUA 5F77A 2ECFA 2AZ4A 4A8TA 1WMBA 2QR5A 3HKCB 2P35A 3SYRA 2CEKA 1FSZA 1K68A 5AKGA 4EDHA 3GLGE 2PUAA 4K2HA 1Q1ZA 5HMMA 1WW8A 2XOKD 1XCJA 4H7HA 1XNHA 4RK0A 4B2IA 1DQRA 1BU8A 2NV2B 3WHKA 3A37A 1NW9B 1F0YA 3OX3A 2WRZA 3L0OA 3ZXYA 1E9CA 3WYCA 1C4OA 3JAWA 2OFPA 3NLLA 1S9DA 1ODCA 1WSBA 1X6VA 3KFXA 3PDIB 3PFBA 3KKPA 4NZYA 1P18A 2H7YA 3TS1A 1V1RB 2EKZA 3AM1A 4PZUA 4AJ4A 3UMBA 4UAJA 5AW5A 4CJXA 3B3FA 1C3XA 4FWTA 4UNSA 1Q5PA 3KUDA 1CYDA 4HMQA 4MDFA 4R8LA 4F4DA 4EF5A 2CD7A 5CD9A 2AG1A 3M6FA 1AHNA 1TM1E 1STOA 4Y9SA 4HNTA 1JQAA 5KVVA 4B3GA 3UOGA 4CM3A 4L72A 5KVAA 1GTRA 1ISPA 2O7QA 3IUSA 4J8PA 1BS2A 2YC4C 1YO6A 4QSHA 4AJPA 2QOEA 4O4JB 3WKBA 1XLVA 3O1LA 3PQ8A 4X7RA 1U90A 1UADA 2Y0BA 1E1NA 1N6LA 3K0EA 2R00C 2MSDB 4ZKDA 3ZIUA 2YQ5A 2H4WA 2ATVA 3MGGA 4ZCQA 1WHSB 4V0RA 3T35A 3P9XA 4LV5B 1X1QA 4LRXA 2W6JD 2I8LA 2BFWA 3D7RA 5F5LA 3WJ1A 2ZTSA 1DXYA 5JFOA 5LJLA 5AVWA 3I04A 5LN1A 1N78A 4RETA 4PBRA 1CJCA 1RAIA 2N0SA 5L3ZA 3TZKA 1BGVA 1QMGA 2JFPA 4D3FA 5JFTA 1YVRA 4O5OA 4AKGA 5KOHA 3TLZA 1XQVA 4URVR 1VLLA 1L5KA 1A4IA 4KSCA 2W4QA 3VPXA 1JF8A 1DPFA 4WOCA 4BE4A 5A2GA 3QPAA 1SRRA 3EPKA 4YCBA 3SQDA 2Q9AA 1DBSA 4IX9A 3B53X 3BWMA 1KC1A 3WK5A 4U2KA 2EZ4A 3HYTA 1R00A 2FTKE 3DDNA 5EKDA 3NC1C 1PNRA 2Q4OA 4OFBA 2GM9A 4RZQA 2QL5A 1J39A 3JX9A 5CH3A 4OQ4A 5IW8A 2N1BA 1OBCA 4FBLA 1RWVA 2ONCA 1HDZA 3V7FA 5LP6A 5BR7A 4GD3Q 1K7XB 5K0CA 2VPPA 3ETHA 2Z83A 3I53A 1DEKA 2LTAA 3PLNA 1G20A 1F1BA 1XDBA 4Y2TA 3LGXA 4OU5A 5IKOA 5LQMA 2HB6A 3CIFA 3OJEA 3P8ZA 4AJKA 1NMYA 4FTWA 3UB4A 3MHTA 2SNIE 3NYQA 4HRXA 3JALA 2WJ4A 3NWEA 4MUGA 3N8KA 1JPVA 4H3SA 2K4MA 3IE1A 1ZO8A 1Q15A 3GAAA 1WCIB 3IAUA 1T0IA 4N3NA 5FOQA 4L73A 1T6BY 2CBZA 1J23A 2YVQA 2TMYA 3COWA 5BQXA 3ZHXA 1TMYA 1FYWA 2BFDA 1Z0KA 3GVHA 5E4TA 3QY0A 2VJBA 2RHHA 4DV2B 1N4AA 1N0UA 3MHPA 3ABSB 3FOFC 1QH9A 2X0FA 3FFXA 5DHQA 4AZSA 1RYEA 2JAUA 3PHJA 4UPVA 1JWBB 2HX1A 3PWSA 3K15A 3LT0A 3CKMA 4OOFA 1D8AA 4YJ3B 5LZ8A 1YNSA 4UNIA 3KQKA 1OH8A 2MYNA 2VA8A 2VUUA 4P7JA 1U1GA 1M5UA 1PUXA 4PRZA 1FYVA 5FWXB 1A9RA 1FUUA 2FE4A 5DNEA 4B3IA 2H4ZA 1TL7C 1O77A 2JDIA 4LJ6A 3RVPA 3UXMA 1QIGA 3RC7A 4EJSC 3TX6A 1UAYA 5EKSA 3VISA 5KYXB 1I3CA 2E49A 2QN2A 4KLRA 4OP2A 3SZGA 5JXGA 4YJFA 3T0IA 1Y6GA 1Z68A 2QUAA 3VKHA 3ABRB 1OD6A 4FFPA 4L8GA 1Q11A 4BU1A 5CB0A 5FPYA 1JUDA 3T7AA 1GUFA 2VTBA 4BNZA 3TX2A 4TWZA 3U9LA 5T6BA 2ZTMA 2OAEA 3ICCA 3UMVA 2EDCA 3SX4A 2QD1A 2WFMA 4G2NA 3RVBA 1YJQA 2PMCA 3WA7A 1RRPA 2J85A 2OGUA 3FR8A 3KOYA 1N1MA 3OLYA 3LCCA 2JFYA 1RTKA 1XIVA 3AI7A 1Z08A 1DARA 3DH0A 2NYRA 4M86A 2B8EA 2NU7A 3HB5X 3QSGA 5KYUA 3CVOA 2DERA 4FKZA 3DMGA 1UJCA 2QJOA 2O7NA 2P8JA 3QWIA 3NBFA 4RKQA 3JATB 3X1MA 3QPBA 2OY0A 1N2CA 1RWXA 4P92A 1I2BA 4MUFA 1JQLB 1NMSA 1T1SA 2ZAMA 4LY0A 3ZE0B 3OT5A 1U5AA 3BH0A 4FS3A 4WN9A 4EW3A 4ZCIA 1M83A 5IT4A 5G2OA 4O3FA 3GLIB 1B15A 1OYYA 2H31A 2O0KA 4NU6A 4YO7A 1CTQA 1WEKA 1L5NA 4DSAA 1CR1A 3UJNA 4RNDB 5B7PA 2BKUA 2V9ZA 4TSFD 2CHFA 3ELDA 1ZL2A 2QE7A 2Z1NA 2OTCA 3M34A 4XWWA 1N25A 4CT0A 1JJ7A 3BHJA 4YRFA 4RW0A 4CMJA 3T5AA 2A1IA 4M0EA 2NSLA 3GLSA 1IC6A 3PGXA 5D7BA 3UMGA 2X5OA 1H8HD 1CYEA 3E58A 4PPNA 4IDPA 2KE5A 3DMFA 4HLUA 4F71A 1YR6A 1R4ZA 4HVTA 4DUGD 4KQGA 3VR6D 1JLLB 3N8DA 1BEEA 3H9JA 1KI6B 4LPSA 1AKTA 1VL1A 2EIXA 3EFOB 3HABA 1ECFA 2AF3C 3UCFA 4MPRA 3T4PA 2EBHX 4RLHA 3N2GB 4H18A 4TSFA 5CXSA 2OORA 2P0EA 2CNOA 2J4DA 3K9WA 3JQFC 4GUDA 2OHOA 4QNMA 3RYTC 1IAVA 3LUKA 1U1EA 4PZCA 4L8WB 5AM5A 4BRWA 4B09A 2VK2A 4RACA 1I13A 5MFPA 4D9EA 3PITA 4UVEA 4IO0A 4YLYA 5LMNB 3Q7IA 2E9SA 5CGQB 1U6KA 3HS3A 3I1FA 2HF8A 4IL5A 3H6KA 4R1TA 4KIGA 2YIDA 3ZI7A 2H0QA 2XR1A 2YWDA 1M2JA 3W90A 1TU0A 5JD5A 4PC1A 1RWBA 1UWLA 1H2FA 1VRVA 2B78A 2X4GA 3LO8A 5LM3A 1IBLB 4HTFB 2EFJA 3O4FA 5FOSA 3DBHA 3IE0A 1CETA 4D8UA 1UBTS 4WCFA 3F3MA 1M10A 3D4LA 4H4EA 3KKMA 3L0CA 3BRCA 1XA3A 3JZMA 3MAGA 4AJIA 1O54A 1C7JA 1ONSA 3PUZA 1YS1X 4LY6A 3U5TA 2WTEA 4B46A 4YRLA 4XH9B 4M7OA 2W00A 4GR5A 3TTTA 2WMNB 1FB5A 1RI5A 5F3DA 1T9CA 2ZFUA 1LI4A 4CKXA 3O8RA 1V25A 2HIMA 2XQGA 3T7TA 4EFNA 1JQKA 3RK1A 4A6DA 4PGAA 4GPIB 1IM8A 2IUUA 5ALKA 4DVGA 5K6AA 2EAUA 4I6GA 1Z5ZA 4MUYA 2IPAB 2VPQA 3DBHB 5CEEA 1SIUA 3OHPA 2VK4A 4WCFB 3CMCO 4UTRA 2ECOA 4XGIA 1DC3A 1MA3A 3Q3HA 3TAHA 4BB9A 1GFZA 3PU6A 2PZ8A 4KE9A 3G2KA 2AXQA 5EZSA 2V7PA 4CT4B 2ZUEA 3JVUA 5IDXA 2EHJA 1YZQA 3JRXA 5D5QA 1ZHHA 3O0DA 4FGKA 3UJ6A 4F12A 4K86A 4WACA 5KTMA 1A9OA 4IXWA 1TEZA 1IVNA 4DPMA 3EGOA 2FMKA 2NXJA 1RKBA 2GBLC 2RAFA 3GFVA 3PQ5A 2DJ5A 2G80A 2IHTA 2B37A 2VRWA 1DZ3A 5AJZA 3STTA 5EE1A 1PT9A 2REQA 2VP2A 1AMUA 1QYRA 1XQ6A 1P91A 2OP1A 4GGPA 3ZS9A 1MJFA 1B8OA 4X8MA 3X1ZA 1PZMA 1FW8A 2QE7D 3AUFA 5AFSA 3QGMA 1XFAA 3T0FA 5F7XA 5JH7A 4JI4B 4WQMA 3R3ZA 1AT1A 2IVZA 3FPJA 3WWPA 1KO7A 3H2ZA 3I2JA 3P2IA 2FW9A 4ISCA 1MHPA 4RVOA 1VSTA 1LZLA 2AR9A 2B82A 3MVEA 4YMSA 1AXRA 1RQPA 4IINA 3CUYA 1VYVA 3NM4A 2VQSA 3KSMA 4QO7A 3JQPA 4D41A 4TS1A 4NHOA 1B23P 3GCZA 5TXGA 1LCIA 2F3SA 3HKEA 5TGZA 2UUAB 2PXAA 3DEYX 3K0FA 2RHBA 1XVLA 3ZPXA 6ABPA 2VSYA 4JXXA 1AKMA 1Z0DA 3W5AA 1P19A 4IIJB 4C2UA 3QTLA 1SQ6A 1Y3BE 2OK8A 3P0FA 4J43A 4PBTA 1Z2PX 5CVEA 3QRWA 3EPJA 1PJ3A 4OBWA 1G9XA 3KYDA 1JDPA 4TSKA 1NU8A 4BOYA 3L7YA 5C4IA 3SXJA 1KAHA 3KQUA 2KW5A 2OBMA 4KRXA 3ID6C 4B4UA 2QVLA 3PL1A 2WG1A 4MJXA 4HG2A 1GAXA 2PQ0A 1NNUA 1TYZA 3CONA 5A2QA 1ENZA 1JALA 3B9BA 1VE1A 3HJGA 3JSXA 4FWIB 5F35A 3RUIA 1ND5A 5DM60 3P0JA 4EMTA 3CVJA 4EK9A 3HXTA 1TJNA 3MJRA 4JKOA 1KETA 4PX9A 1CHNA 1Y63A 2FW6A 4WEQA 1RLIA 5FTLA 3H2YA 3K0FB 4WZBB 4QD3A 2SKCA 2X6QA 1PWZA 3OH8A 5LZ2A 3IQIX 5IVDA 3LY9A 1SA0B 2B7LA 5EE9A 1ZVKA 4IWNA 3MB5A 3T9BA 3ZNPA 4QPJC 5CCBA 2R79A 1NUUA 2W11A 2XNJA 4PCLA 2NQ2C 1U9YA 2HCJB 4PRLA 3OZDA 3GPDG 3KJHA 4QFMA 2F1OA 4BO4A 2IPLA 1HDGO 3W77A 4ZI7F 1KOJA 2I71A 2HMAA 3FDZA 4FBGA 5DWVA 2OCIA 1T8YA 1Y1KE 1GYQA 1JEOA 5EJ2A 1HWYA 5K0TA 4GGOA 3S0JA 1PV1A 4A73A 2WKWA 2WHPB 3QLVA 4HD8A 4LMPA 1QIJA 3O26A 4J76A 4QULA 3N2ZB 3HDQA 3UAGA 4LTNA 5IBRA 1K4KA 3VKVA 3ZJTA 2UXBB 4DGQA 1OB5A 1ADJA 2DTXA 4JUAA 3E3OA 3B2QA 1K08A 4FDLA 1UKCA 2D0OB 5CP8A 1XMQB 1YU6A 4CDRA 3T3HA 2JGLA 2QTVA 2JFWA 4U7DA 1J1UA 5D87A 5HOEA 3V2GA 4B5KA 5CPFA 1DBQA 1XPJA 1YQQA 4D8WA 3P4XA 1L5HA 4Q01A 3IDZA 1AKYA 2CMGA 5CX1A 5L4SA 1V1JA 5EXXA 1S96A 3KXLA 3ZV5A 4PHTA 3D6TB 1VI6A 2YV1A 3ZVNA 3ETJA 1QQAA 4PLFA 2JIQA 1SHTX 1P9LA 1C2YA 4GXQA 4FB5A 4NECA 4NH4A 2ZJ4A 4XGKA 3KHUA 4JKYA 4ZU1X 2VJNA 1Q7GA 2XMQA 3ZY4A 6LDHA 4Q34A 1HT1E 1GDDA 2H29A 1TA4A 3EJ6A 1J2UA 2FPSA 2PZJA 3I5UA 4NBRA 1T9GR 3R20A 4HRAA 2WMDA 3MTBA 2FVXA 4MO9A 5BMVF 2GZRA 3BOSA 2AQHA 4DM3A 4JBGA 4AMUA 5SZIA 2VQDA 2MR5A 1CNFA 3OESA 5B3KA 2XY4A 4MUHA 4UE2A 4AJEA 1CY0A 2PRKA 3NWOA 5DM70 1Z2OX 3F7TA 5K9ZA 2I29A 4J03A 1EZZA 2W2LD 3UTDA 3C48A 4EZBA 4WJZA 5G1NA 1RI1A 1JIQA 2RGEA 1L3BA 4G23A 3ON5A 4S1PA 1HG1A 5H81A 3T9AA 2RH5A 2ZIWB 4IR7A 5JAMA 5E6UB 2NQ8A 5EMNA 1GARA 5J5CA 4OTZA 5ICEA 2PT9A 5K3DA 3UK7A 3HB7A 1SUDA 3FBWA 1G8YA 5JC1A 2IS4A 3HB1A 2WWGA 1J8YF 1O03A 1CUHA 1II0A 1WLSA 1ZBQA 1Y48E 1DQSA 4PU0A 3RSGA 2ZJ2A 1M72A 5HZHA 2GZAA 2WDPA 4I5IA 4URFA 1EXWA 1U2ZA 4K6GA 3DMYA 3U44A 4FN4A 2VWHA 5BW4A 1ZSVA 1U3GA 1BXZA 3FTPA 4DCNA 1MJGM 1SY7A 2DT5A 3LK6A 3AM4A 5LVAA 1Z26A 3BORA 3KQNA 4JR0A 2P9JA 1U7WA 4F4CA 5BMVB 1PSDA 2RHMA 3AF3A 3ETCA 5IN5A 1X1TA 4ZGBA 5JAIA 2ZP1A 5DN9A 5TF4A 3L92A 1E7QA 1CQJB 3B7WA 1WPRA 2O1XA 1L7NA 3IESA 1XMXA 4RE5A 3BKWA 3FPEA 4UMDA 4YI5A 5AKZA 5EMKA 2QAIA 5GGYA 3O03A 4BNGA 1YZFA 4UPDA 2BMFA 4AP5A 2QB5A 3JQ8B 4WHMA 5ICCA 2JLSA 1C7EA 1Y89A 3GMTA 5BYAA 1IATA 1DTEA 2YJ4A 2CB9A 2VL7A 2XCQA 4E1VA 1VPWA 1GLVA 4CF7A 5F1OA 4H6PA 1S3SA 3S5JA 1A97A 5CB8A 1K8QA 2R5WA 3NHFA 1OWMA 1PR0A 1KZ7B 2ZR8A 1I01A 3P2JA 4H17A 1XO1A 3DV2A 5A03A 2IU3A 1IL0A 4RA6A 4QQKA 4N54A 3N5KA 1UZMA 3VPAA 2ONZA 3IDQA 1NG9A 5AVQA 1DDOA 3AW9A 2ZRHA 3VDNB 1LFAA 3ZWOA 2Q6OA 1U2GA 1TAQA 1RKVA 5DGIA 4DV1B 3KCQA 3X3HA 4R3UC 1E3QA 2VH5R 5TJ9A 1L1FA 3OCXA 2C0QA 1RJFA 2QA5A 3HDTA 1TKCA 3C3YA 4LDJA 4P80A 3ZK7A 3SQWA 3MWDB 3KVOA 1J56A 1JXMA 1KEZA 2FPRA 4CR7A 1HEUA 2PBZA 4G0NA 3PLAE 2ESRA 3DHEA 1PNOA 1IUKA 2WWHA 3SR4A 3TRKA 1W36D 2VPWA 2WVAA 3RI3A 3PE3A 2IZOA 1XMSA 1W93A 3OJWA 3Q12A 5H1YA 4TMWA 2QTBA 2WSLA 2XSZA 4BVJA 3OHSX 1LH0A 4JQCA 4OGGA 4GXRA 4XB1A 5AD1A 3BTVA 1QCZA 1U9JA 1WW3A 4G5OA 5FP0A 2XDYA 3JWHA 1WSDA 1ZMBA 1U81A 3ZZ1A 2XUKA 2R6R1 5EZYA 2WQ7A 1NWCA 3HACA 4ITUA 2A1TS 2HA7A 5HPYB 2ZSHA 3QEKA 4CEHA 3ZGZA 2X5NA 5THXA 1ZCZA 4N01A 3D6AA 1BX3A 4NFSA 1RKQA 2DHRA 2QPOA 3PQ3A 1QDLB 3A1NA 4OPMA 3UCEA 3VVMA 2B4RO 2F4VB 1GD1O 2DYKA 2GCEA 4Q4JA 3VPDA 1SVOA 3A27A 3CJRA 4LQDA 3VX4A 1X1DA 2VBFA 3HV2A 4I1YA 4FK8A 1Y1LA 1UM8A 3K4HA 3QHPA 4Q3NA 1CUGA 1EUCA 1K6IA 2HJVA 3TYXA 2QT0A 5TLSA 4XUCA 1G21B 2VK1A 5HIIA 2RGWA 5B1HA 1WTAA 4B6SA 3U0VA 1R6XA 3Q2OA 4E2YA 4UTVA 2V7UA 2XDAA 2ID9A 2V45A 4MGYR 3VC3A 2C5SA 5FOXA 3WIUA 4E5VA 1T29A 1ZQ1A 1H65A 1NSYA 2AWNA 2JBHA 4CDMA 3DXFA 5BYKA 1XKLA 3VSCA 3TSCA 2OG2A 1GN9A 3BIFA 3GNTA 5HA5A 1USVA 1OU0A 3DCNA 1XTIA 4MQFA 3S8YA 2GCOA 4A0HA 1X9GA 2CNWA 4P82A 4TMFA 5CXQA 1NNI1 1SZCA 5AW1A 2E5WA 1NW3A 4JIMA 5IX8A 3MPUA 1QHEA 1IK4A 2ALJA 3CB4A 1H1LB 3IERA 4MW6A 4PO3X 1Y3DE 2GZHA 2ZXEA 4G6ZA 2CW5A 1KI1A 4GOOD 4OYYA 1B7GO 3RQSA 1WIWA 2WUGA 1XQYA 4EB8A 4NDZA 5TGDA 2R8RA 3LV8A 1AHPA 1CCWA 5I9SA 3GAFA 4DV3B 1MX3A 1NBWB 4ARAA 2X3FA 3RPEA 3GLUA 4G5YA 3H42B 1HE3A 4BMVA 1FL9A 2I4LA 3JYHA 3MT9A 1C8VB 1Q1NA 1O95A 2LDBA 4Y0AA 1FP1D 2PJZA 1XK7A 2OZLB 3WBFA 5JE8A 3Q9NA 2HPZA 1K86A 5LA6B 1M5RA 3N7TA 5JU6A 3LUHA 1PNQA 3KBOA 2IU6A 2PKWA 3UJAA 2Y93A 4GLFA 3CGGA 3HGQA 4GVLA 3W9SA 4BV3A 2R7MA 1TQ4A 4RTQA 3P32A 3ROQA 3TLEA 3HSYA 2VJMA 3IVMA 1CDOA 4MI3A 4U1RA 1O89A 2V7WA 5DYIA 5BYJA 3ZKWA 5JVDA 4E31A 2DCMA 4GHWA 1L5GB 1Y5MA 2LWIA 4G9EA 3WLQA 3P2EA 4C1NA 1EGMB 2RSLA 2O8DB 4IXTA 4MDYA 1M1XB 3OA2A 1SBCA 1IZYA 2JIZA 3E3NA 4HGPA 1OZFA 4KPUB 4LZAA 2B36A 1IBMB 2Y2VA 2GN2A 5F9HA 1KRXA 2OHHA 2WMOB 4G01B 3RJ5A 1IQPA 2JJYA 4IH1A 4JJFA 2HDHA 2ZE8A 5GY7A 4YPOA 3IVRA 1X80A 4HDNB 5FFFA 4LHEA 3UAOA 5JNTA 3N2EA 4G41A 1JAXA 5EE3A 3FKSD 3LUAA 4MULA 5KDOA 4UJ5A 2Q27A 2RGAA 5FRDA 5E2IA 4AUKA 5BNWA 1M8FA 4LPKA 5B3JC 4DMRA 4YAWA 3ZGNA 3CEHA 1LRKA 4X5OA 4ERXA 1NJ1A 2L18A 3TJRA 1N32B 1CJKC 1I5EA 1ZVMA 5KU1A 3WX0A 5J4YA 3U4QB 4PX3A 4AROA 4YN3A 2DSNA 1Q57A 5AKXA 3KYIB 1E8NA 4TROA 1GR0A 5K3FB 4MCAA 2FR1A 3V7YA 1UAGA 1CG6A 3DMPA 4LE2A 5DCUA 1ZOOA 2Q41A 3U9TA 1X0XA 3H4VA 1MC5A 3L4SO 3IPAA 5A71A 1ESDA 5ILOA 3V8RA 4EHJA 4LJYA 3OQJA 4K3VA 3BZBA 4NICA 2FUKA 2YBEA 4LOAA 4E7PA 3B78A 5LL6P 4F72A 2P4SA 4B3JA 2YWXA 2I7DA 2FX5A 2NPOA 1Z4MA 5KX5B 3GJRA 4D97A 1BEUB 1SAYA 3GD7A 1MTZA 4WZ6A 1JAYA 3WYEA 1R0RE 4E1AA 2VI5A 3CRMA 1JSXA 2BM9A 4YAFA 1NVFA 2XODA 1R37A 1SEPA 1TKBA 3A25A 1ELOA 3M1IA 1VIAA 1KO1A 3VZPA 4A3SA 1UMDA 4D92A 3RT9A 2ZJFA 3GJ4A 4MCIA 4NKRA 3F47A 5GVSA 2GF9A 5DHSA 4F56A 3ZE2B 3VAAA 2X5JO 3QUSA 4KI7A 4Y8VA 4G0YA 1Q0ZA 5TJHA 4C9BA 1F2UB 3N0RA 4ID9A 3ORSA 3RAGA 1W2WB 4R31A 4RMIA 4Y1RA 3SFVA 1WXWA 4GOXA 2BGKA 4CMGA 4MKXA 1QP4A 2E2WA 3Q1LA 2Q4RA 3I9V6 3VSBA 2Q50A 4DIOA 2C0PA 1G6HA 3KD3A 2CZQA 4RDIA 3ROPA 3VR5D 4JYPA 4D4JA 4E14A 2OCGA 5FWXA 3GDHA 4C6TB 5ADHA 2C4KA 4XPIA 1MAHA 2ISSD 4JLOA 1XXLA 1LBQA 1IN4A 1PEKE 1X1CA 2OGSA 2Q5FA 2YR0A 4NZPA 4PPQA 2OGZA 4S12A 1L4LA 1WUYA 4C3ZA 3N28A 4EHLA 1E5TA 1W30A 4B9EA 5JS8A 1P4JA 1WA5A 1EHIA 2B94A 3FLAA 5CMLA 2V65A 1TXGA 1LPAB 4ZT3A 3DFFA 1TUBA 5THKA 3WLLA 5MN5A 2G5GX 3FUCA 3AOGA 4G5GA 1J1IA 1AGNA 2ZI3A 2XUGA 4RTOA 4PYIA 3Q8WA 4BO1A 5KNBH 3GLHB 3PHLA 3V7UA 1NVKA 5ESXA 2WG2A 2F7SA 2CNKA 1NR7A 1ACLA 1OFTA 4HJRA 5DLDA 3KWJA 4BP8A 5KTPA 4WFKA 2Y1GA 5EIAA 4BFZA 5ICFA 2ZULA 2HHHB 2PBFA 3BDVA 3BK7A 5BORA 2IYVA 3UWMA 4TZTA 4L57A 4P36A 4M2LA 3CE9A 4JU9A 2CVFA 1ISHA 1XMPA 4LWQA 5CGZA 1R6AA 5TMBA 1SJ9A 3EAGA 3WTCA 3ELBA 2WTNA 4EQ6B 2VRCA 5SICE 4AJ9A 2WR8A 1VJ0A 2VHVA 3HRKA 3K2BA 2XCLA 3NQ41 2F1JA 2HTFA 2Q0XA 3BFJA 3T1TA 4Q7EA 1QQBA 2IIQA 3CKKA 2OLKA 3U2QA 1JDNA 1VPVA 3CY6A 4IV5A 1CUWA 1BX1A 2VJQA 421PA 4B1FA 1ANKA 3WDSA 2Z2JA 5KAPA 2VFAA 4MEJA 5EPOA 5DX0A 1ADCA 4B6PA 5MGBA 4QRHA 4Z9AA 1SOUA 2D0IA 5HQTA 2G36A 2ZYIA 4Z7NB 4ESVA 4K9PA 4UZEA 4YMGA 3S2EA 5DX1A 3U3XA 3IUMA 3BCSA 5TE9A 3S8MA 2ZT6A 1U8YA 3SHTA 3MGKA 4OYHA 4P58A 1SBIA 3PXCX 1WG8A 3M6XA 4HH3C 4ZI2A 4X7BA 2AB0A 2BFBA 1DNPA 1P1FA 1T9BA 3MCAA 4BTEA 3AJDA 1V2GA 3LFTA 5KIAA 4GC5A 4KDCA 1DRKA 2FPUA 3A28A 3ZDRA 1ULBA 3PFNA 3PFKA 3LDGA 2JPDA 1NPTO 1LKZA 1JI0A 3FVTA 3V3KA 3ZE6A 1Y4ZA 2QTTA 3NNSA 1IUNA 2JHGA 4XCQA 4R69A 2RGBA 4QQNA 3ZCTA 1W44A 1E1CB 3L02A 5LD2C 4TKZA 4UCQA 1OI7A 1P7CA 2QU8A 4K7JA 4Q3LA 4WY8A 4JP8A 3H5NA 4DILA 3AV3A 4YR7A 1PFVA 3FM9A 2OMKA 1AUPA 3HDJA 4X3OA 2DLNA 4Y2JA 1CDZA 3VU8A 5LYYA 3HRIA 3H5AA 1L4GA 2NTVA 1AKUA 2V96A 4WZAA 3MOGA 2Q28A 5AOAA 4IICA 3RLFA 1N9KA 4MV9A 4KLNA 1GTVA 4K8OA 4EB6A 3AUSA 2Q5CA 3KKOA 4HQ0A 4HFNA 4M49A 3A6FA 3DFUA 3HCDA 1TM5E 3EGIA 4KAJA 4ZFNA 4XEHA 4FCVA 4GKJB 1KPIA 1E9DA 2H85A 4ZAVA 1F4PA 1XZIA 1ZDMA 2AK3A 1OWLA 1ZEJA 3NHBA 2A94A 2I6TA 4IMPA 4L0CA 5F64A 3RBVA 2ON6A 4DMCA 1IZ8A 4MS4B 3DFZA 3BK2A 4RXTA 2FG5A 2QM8A 3W3AH 5AKKA 4BMNA 3THRA 4IGEA 5TQVA 3WMFA 1JHZA 2FZGA 1EI9A 4DA8A 1M66A 2DM6A 2GNOA 5KQGA 3C1OA 3IBTA 3QPUA 1H2RS 4MI9A 5A1JA 2QVZX 3GZNB 2Q07A 3OU6A 3T3DA 4WW0A 3U5ZB 4BTVA 5FUYA 3HXLA 3ME5A 2I9PA 4EI7A 1RM0A 3EVCA 5DBIA 3GUYA 3TL2A 3ZE9A 4D02A 1B8UA 3QE9Y 4M1YA 2NVWA 3D7NA 1DJLA 1T43A 2VDOB 4PYRA 4YA6A 1FNDA 1NBIA 3NGXA 2VDRB 3HCNA 4IOKA 3CNQS 4FM9A 1FQOA 1T1GA 1YRWA 4QUHA 1FFSA 2Y05A 3AESA 4M8SA 3BC1A 4ALLA 1BQEA 1GG2A 4WAUA 4E7OA 4U00A 5AVYA 1SIWA 3I5YA 1OUMA 3WWYA 3T4EA 3WB0A 3DUFB 4FDTA 2G0TA 3A70A 1K9SA 1CB7A 2C2WA 4HH0A 3ZDYB 3AIKA 1BVRA 1E2JA 2A0FA 3JPWA 1FMTA 2OL4A 1XTQA 3CUKA 3FOBA 1JDJA 1OJ7A 4UCFA 1NBME 3UJCA 1DGQA 3D8SA 1GZ5A 1QH0A 2Q2NA 2JFGA 3NTOA 5BSEA 2C3UA 1KY3A 1P2GA 4OIMA 3ZKWB 2WD7B 4GBED 2JJMA 5JOQA 2CLCX 2ET6A 4D9CA 3AHJA 4DUGA 1Z36A 2JKZA 3JD0A 1DWUA 1NUTA 4F91B 1YZYA 4BFTA 1E1QA 4ER6A 4FR2A 3DL7A 2IWHA 121PA 5FO0A 1XPRA 4LHYA 1WKBA 4KPUA 2BBSA 4D9HA 2HMTA 1ZWLA 4ENWA 4JYAB 1UBFA 1XT6A 5ALWA 4MRPA 2Z8YM 1OFGA 3EIUA 1N6OA 1WDMA 1OF1A 2VAPA 2VEOA 3ZU5A 1H3FA 1UK6A 2YQZA 3ZGYA 4BECA 2AUNA 4NQRA 2IYOA 3LTEA 1RRCA 1E63A 2H2IA 3SSAA 4NONA 4M21A 3TLGA 3DF7A 4JB8A 3W6PA 4E46A 4BY9E 2BGMA 2WJ6A 4RM3A 1UODA 1MIOB 1SIBE 3H7AA 4GLJA 2BP7B 3RC1A 1U7UA 5IARA 3KDSE 3KLNA 4U3JB 3UGKA 4KH0A 5TV2A 2AYYA 2PQ6A 5C8VA 4GM1A 5EXSA 1GV0A 1O8CA 4E21A 4F7DA 3Q8XB 4INAA 5F78A 2PX0A 4NBSA 4YMIA 3E22B 4CGYA 2D1QA 4R8KA 1S1CA 5KHAA 1LPBB 2DT8A 4ZOAA 1XKXA 4CM7A 1ZMOA 1CVRA 5FNVF 2JGRA 1ZH0A 4P4LA 4KP7A 3AF5A 4GMDA 4NC9A 2VPTA 1S2IA 2ZRGA 4LG1A 1Z5VA 3NOXA 3TM5A 5JZ9A 2IYQA 3K9NA 4HB2A 1EFDN 2KJQA 4J4HA 3MCTA 4U63A 4F5DA 4QX6A 2CJXA 2BY4A 1UT5A 4QLBA 3LXMA 3S81A 3P9CA