1QMLA

Hg complex of yeast 5-aminolaevulinic acid dehydratase
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
342
structure length
328
Chain Sequence
b'MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSLPNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIREYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSDMIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFCYQLPPAGRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-AMINOLAEVULINIC ACID DEHYDRATASE
publication title MAD Analyses of Yeast 5-Aminolaevulinic Acid Dehydratase. Their Use in Structure Determination and in Defining the Metal Binding Sites
pubmed doi rcsb
molecule tags Dehydratase
total genus 77
structure length 328
sequence length 342
ec nomenclature ec 4.2.1.24: Porphobilinogen synthase.
pdb deposition date 1999-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00490 ALAD Delta-aminolevulinic acid dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1qmlA00
1EP2A 3C61A 4ADTA 3M16A 3MP3A 2QCDB 1OF6A 1C9DA 3LRKA 3CU2A 4N6FA 3W87A 1AL8A 3LV5A 3PBYA 3T55A 2QJGA 1OVDA 3HGOA 1EP1A 3DGRA 3NM1A 2YW4A 4YXGA 3V1PA 3L0GA 1JQVA 2CLLA 3MP4A 3MWAA 3IVUA 1QPQA 4FF7A 3DI1A 3FFSA 3V75A 3QMTA 4I7UA 4AMAA 3W88A 2FLIA 2ZFAA 3H55A 4BR1A 3W2JA 4JX6A 5I3JA 3BLEA 3M44A 1VJIA 2EAWA 2V2HA 2A1YA 3MMTA 2Y89A 2TSYA 4E2BA 2CZDA 3HF3A 4O57A 4RX0A 2ZQ0A 3A23A 5F1UA 3OHIA 3LXCA 4UTJA 3HGSA 1SW0A 5CSRA 1I2QA 1DJNA 3EXSA 3NDOA 2A0NA 2E77A 4RK8A 4LV4A 4IMCA 4O52A 2WSRA 1TTJA 5A5WA 1VGAA 1Z48A 4NQ1A 4ONVA 3UZ5A 5FESA 3QW4B 4EWND 2VFFA 4EF8A 4O18A 1ZNNA 2E6YA 2VEMA 3RU6A 1YDOA 4E0CA 1TMHA 1EA0A 2NX1A 5HQEA 4IUOA 3LCFA 1XBXA 4OE7A 4OHQA 5D32A 4DEFA 3L65A 5C55A 4N02A 3OA3A 2WNQA 5CZTA 1QAPA 4N9DA 2WOQA 4K37A 1FXQA 3CIWA 1LCOA 2B7PA 3LBMA 3EWZA 3THAA 4HHPA 3QQ0A 5MHBA 4I7WA 3GR7A 4JYFA 3W7LA 3OEXA 2Q3RA 1YDNA 1D3HA 3FEMA 4XTIA 1LM1A 5BW6A 3CWNA 1CX9A 4KFPA 1H7WA 3N3MA 3CLMA 4EOUA 4FNTA 3NQMA 1QFEA 5LGXA 3YPIA 3NGJA 5C54A 2VEPA 1WYIA 3F03K 5F2GA 1D9EA 4Z1DA 3ZWTA 1OX4A 3K30A 4MJMA 1KFBA 3NQEA 4K7VA 3LX9A 1H1YA 1OF8A 2E5CA 4UFIA 1J5TA 5D38A 1ZAIA 4IPJA 3EXTA 2O7SA 1W5PA 5BRBA 2A7PA 3LLFA 1KFLA 1TPVA 1YXCA 3NQ2A 2ISSA 2QCHA 5HR7A 1KM6A 1LROA 2A21A 3N73A 1S5VA 1OX4B 2R91A 3NQ8A 3W1XA 4XWUA 5DLCA 4Y9AA 2QUTA 4MZ1A 3W07A 3QM3A 3TIMA 3O6DA 1SQ7A 4RXGA 4LUJA 4JTFA 3PF3A 3OVQA 4DF2A 5LSMA 4M6VA 5LGZA 4FNUA 4NZFA 3W1RA 1LRNA 2TYSA 3L66A 5A8GA 3OBKA 2ZRWA 1IXQA 1TCDA 3SGZA 1EX5A 1LBMA 3NPUA 1DJQA 4DXVA 3RLUA 4UFMA 1XUUA 2VFDA 3W73A 4NJKA 1KM1A 4JTGA 4G1KA 5EKYA 3ELFA 2FJKA 5U4NA 1H7NA 3A5VA 3PAJA 5G4EA 2UV8G 3W7QA 1B9BA 1K7EA 3ZFHA 3THQA 3DFQA 1EWDA 2Z0IA 3S5YA 3C4UA 3A9IA 4YMZA 4GUFA 1NFBA 1JRCA 4KWVA 4P2VA 4OQVA 4LVFA 4U4MA 4UTWA 3GDTA 1RVGA 3R8RA 3TSMA 1ZAHA 5CPLA 4AAJA 4PTNA 3KVKA 5LNRA 3N2MA 2ABBA 2J88A 2WQPA 3P5ZA 4FIRA 2VEIA 1NF0A 1F5ZA 5K7JA 5GVJA 3H54A 3NQCA 4HPJA 1ICSA 4ICNA 4LUIA 4TMBA 5DXXA 1XXXA 5DBTA 1QR7A 3MBDA 2E68A 4LS2A 2BXVA 2RDUA 3NL6A 3TSDA 5FI8A 2QAPA 2H3DA 2C18A 1XUZA 1O4UA 4IXHA 1LDCA 3RLVA 4WXZA 4L4MA 1H7OA 4K8HA 4ZQPA 3LTYA 5K9DA 2V82A 2RH9A 1H7XA 1N8FA 2ATSA 4AVFA 2Y6ZA 3S5ZA 4UUIA 2WSYA 3TAKA 3Q2DA 3B4UA 3HB9A 2QCMA 5F4SA 2ATMA 3E02A 3IIVA 3B0UX 4EIVA 1U5JA 2QJHA 1WOBA 4NT0A 2GVGA 1KFEA 5D2TA 2W79A 2PRMA 3IVTA 5FEXA 1Q45A 3W1MA 4S1FA 4O28A 3UPWA 2AGKA 5ABTA 3FYOA 5AHEA 1Z42A 3BG3A 3P7YA 2PCQA 5DXYA 1TPEA 1UUOA 3PVFA 3DFTA 2A7RA 1RR2A 3QW3A 4IX2A 1QO5A 1Q6RA 4JNMA 3HGRA 1GT8A 1J2WA 2KZHA 3G1SA 4OWGA 1QMLA 2YDAA 2Y7DA 2JKPA 1YPFA 3W7PA 4C1KA 4JICA 1HL2A 3TR2A 1C8VA 1W0MA 1HO1A 4PL1A 4QJ1A 5CPOA 7TIMA 1Q6OA 4RZ4A 1GG0A 4DPPA 4O19A 3BG9A 2TRSA 1W54A 2ZTJA 1XKYA 1HO4A 1SU5A 1O5XA 4KKXA 3L5LA 4JIQA 3M41A 1F74A 4O8RA 2WSQA 2H8ZA 4A21A 1MSSA 1EIXA 4Q4KA 4OV9A 3TCEA 4MUZA 3N9RA 4KFOA 4N4QA 3PUEA 4RLIA 1DBTA 4JTLA 3FS2A 4LNYA 3STEA 3MW7A 4HN4A 2VXNA 3C8FA 4UIOA 3I7QA 4NX5A 5K9XA 1LLWA 2DORA 2YCEA 4XZ9A 4K6AA 2CFFA 3UWUA 4N2YA 1VLWA 4HNNA 3GLCA 1GQNA 3W6YA 1KM4A 1PIIA 4U28A 1A5CA 1P0NA 2CWNA 2RHGA 3P82A 4IWWA 3WJXA 1G69A 1ICPA 4CNPA 5DCEA 3B0VC 4N4PA 3GKFA 2LLEA 3USBA 3QFEA 4JTHA 3B04A 1KFJA 1XBYA 2VEKA 5LKYA 1SO4A 1HUVA 1Q3NA 5T26A 3BVJA 1PL9A 4C1LA 3LERA 3LTSA 3W3OA 3NM3A 3PBUA 5H91A 2NV2A 3EB2A 3PB2A 1QNVA 3TH6A 2IQTA 1ONRA 3ANYA 2Y63A 2E6FA 3A22A 1DL3A 1OX5A 5AYXA 1ME9A 3NZ1A 2FB2A 4NXKA 4UC5A 1V7YA 1ZY9A 3W1QA 2ZTKA 3Q58A 4IMDA 2DZTA 3CEUA 3CTLA 2HTMA 4UTUA 3MHFA 4UTLA 3NQAA 4PL2A 2ZRYA 3FKKA 3KXQA 3G0XA 1R30A 1SO6A 1KBIA 1H60A 2HS8A 2V0TA 3C52A 2FDSA 5AHNA 2Z6IA 1MXSA 3VFLA 5F2MA 1DV7A 2DZVA 2C0AA 3QH2A 3W7RA 1PCWA 3CQ0A 5D37A 1I2NA 1WBHA 1VLIA 4RJEA 2BLEA 3HO8A 3JS3A 3R5EA 1UBSA 2ZYFA 1KM0A 4LS0A 3S1XA 4FNRA 3TC6A 1S5WA 4M7TA 4JS3A 4O54A 2OJPA 4O17A 5AYZA 3DXIA 1N7KA 2V8ZA 2QKFA 1J4EA 4XTDA 3DFNA 4Z08A 5AB3A 4UTTA 1KA9F 1R2RA 4YLWA 2J27A 3NQ7A 4W9TA 4KFNA 2BX7A 1H62A 1TSIA 2C13A 1OFDA 1F6KA 3DFOA 3GAKA 3S1VA 3KOFA 5DELA 3EKZA 1JJKA 2XN2A 3W85A 3G24A 4O1DA 3KRSA 1T99A 2QF7A 4M5PA 2I9EA 1TPC1 1W1ZA 3B03A 3W1AA 5G2HA 1IXPA 1AG1O 2GVJA 3EX4A 2J24A 2QCEA 3WK2A 3PC0A 3W1NA 1M5WA 1VYSX 1KV8A 4K8EA 2JGQA 5HJLA 3CT7A 1H1ZA 1S3HA 1G6CA 5E93A 3A24A 3ABSA 4O1CA 2A2IA 5AOUA 1EPXA 1C29A 1PHWA 1YTKA 3QPYA 3TDFA 4AF0A 3LDVA 1V5XA 2X16A 3P60A 3C3NA 4ORMA 1ZHAA 3G3MA 4FXSA 3E49A 3M43A 4TIMA 1LOLA 2PC4A 1JCNA 1UJPA 3W7DA 4DO6A 3LRLA 2QCCA 3PBVA 1U83A 4AH7A 1OYBA 4O14A 5KITA 1FXPA 3SW6A 3W9ZA 3LHVA 4N9BA 4NVTA 4NX0A 3P62A 4FB7A 4HIBA 4CCDA 1GWJA 4YCOA 2ZZ7A 4PODA 4OV4A 3G8EA 1JULA 3W71A 1EUNA 4FNSA 2VFHA 3DAQA 2WJZA 4OBTA 3KVLA 1OFPA 1QO2A 3W2NA 3NG3A 1RQHA 1SW3A 3O6CA 3HMJG 1SO5A 1W5NA 5D2VA 1TB3A 1FCBA 2Q8LA 3TV8A 3W7KA 5EY5A 5DCBA 1W37A 3DH7A 3HPSA 4JTSA 4A22A 2Y61A 1KLZA 3R2GA 3FJLA 2EPHA 3BARA 2FIQA 2ZA2A 2J6XA 2X2GA 5BMXA 3SSJA 1DQXA 4N6EA 5IBXC 2E5BA 5HNRA 1AK5A 1KFKA 3HG4A 3HBLA 2OX1A 4IMEA 4NXSA 2PE4A 1IIGA 2JK2A 2WNNA 4H4IA 3GK0A 1ZALA 4GBUA 5C6MA 4NNCA 3B8DA 4K36A 2R94A 4M19A 3GYEA 3UY8A 3LLDA 3TU9A 3TE9A 1K3UA 1VRDA 2E5DA 4GNJA 4ZVJA 2C6QA 2E6AA 3N14A 4MY9A 4ORIA 2ZRUA 3G22A 1DVJA 1CI1A 1OYAA 3G18A 2CLHA 1BWLA 4M6PA 3FKRA 3CWOX 2R14A 4O0KA 2H6RA 4WOZA 5F2LA 5DY3A 3P81A 4UFJA 3C2OA 3DZ1A 1TPH1 5I3IA 1X1ZA 5F4WA 3LCWA 3STCA 3S1UA 2QJIA 1XFBA 5CZ0A 4QIUA 3TC7A 2TMDA 4PH6A 5FEPA 5AC7A 3MJYA 1PVNA 4GE8A 2QAFA 5CSSA 4PCFA 3GDKA 4GUHA 1I4NA 1GVFA 1KTNA 1MEIA 2BWGA 4LY8A 4QISA 1RD5A 1H50A 2QUUA 2ZZ1A 2WPBA 4NUWA 5K2ZA 3UYCA 3S8HA 1B3OA 2Q8ZA 3EX3A 4WZHA 3KVMA 1RZMA 3C56A 1GVQA 1JUEA 2NUWA 4BK9A 1OFQA 3GB6A 1JCYA 1G4TA 3B06A 4LVAA 5CG7A 3A5FA 4JDBA 3L0KA 3NZRA 3W1UA 1FWNA 4DPQA 2DZPA 3C2VA 1FQ0A 5BMWA 1K7XA 5FF3A 3LXBA 3GVGA 1DKWA 3L21A 3H53A 1MZHA 1FCVA 1Y0EA 2CZEA 3QZEA 3OG3A 2H90A 1QCWA 3HQ1A 2FPVA 3NQ6A 3BW4A 1KM2A 1B4KA 1TPFA 3G0UA 3G1YA 1JCMP 2Z2UA 4MZYA 3LGEA 3DFSA 2A4AA 2AAMA 3UY7A 3T40A 3NVTA 2CLIA 2C14A 2HMCA 1KW1A 2D73A 1LORA 2YXGA 4QSHA 1G7VA 3TJXA 4K38A 4UMBA 2QEZA 3C0JA 3NXFA 2EF9A 1SZNA 2ABAA 1YADA 4UNLA 1GG1A 3KVJA 3MHUA 1MO0A 3NOEA 2GOUA 4I9AA 1XDMA 5BNKA 3G1VA 3NQGA 3HG2A 2DU2A 3PULA 4UFKA 4O53A 3EXRA 1QPRA 3BGGA 5EYWA 1OFEA 2CZ5A 4FX8A 4IXXA 1PHQA 3S42A 1OG0A 1AL7A 2A6NA 3LXAA 5AHIA 4X2RA 3STFA 5I3KA 1R47A 1TV5A 1Z41A 4O11A 3TA6A 3E96A 4ML9A 4JX4A 3NAVA 4O0ZA 4QITA 3IIPA 1QWGA 4JR5A 1BWKA 3QSTA 1ZJIA 4JEQA 2ZRVA 4ZMGA 3S5NA 4EF9A 1SUXA 3W76A 2YW3A 1GVOA 4K7YA 3FJ6A 4UTMA 4B5NA 3CM4A 4WQ6A 1XM3A 5G2WA 3W2KA 5D02A 2GQ8A 2H8XA 2VFIA 2WO5A 4X3ZA 5LHFA 1NEYA 1AW1A 2RDWA 1OYCA 4Z1BA 1TQJA 1NAL1 4BWLC 3TQKA 1OK4A 2VC6A 2C15A 3LHTA 2ZZ6A 4UTKA 1F6PA 2JKAA 1TJRA 4AWUA 1WOAA 2WNZA 4POCA 3T4CA 3G0SA 4I7VA 2B0MA 1VCGA 1VCVA 3PB0A 1WQ5A 2CW6A 5I3GA 3BPWA 3MP5A 4TX9A 3OIXA 2Z6JA 4CQ8A 1JR1A 1B57A 4MY1A 1JCLA 3U2OA 4FX6M 3LHYA 2RDTA 1T8XA 2OT0A 3BG5A 4H6KA 1FDJA 3N9SA 1GOXA 5C2XA 2ZDRA 2JBMA 2GUUA 4R34A 4JY9A 1I2OA 2O7QA 1E51A 5FEZA 3O1NA 4HNUA 4NJJA 4AXKA 3ABRA 2YFNA 3W7GA 2J9ZA 2A7NA 4WOQA 3BO9A 3DI0A 5D2WA 5G5IA 1JCXA 1VH7A 3RK8A 2FPTA 1T0OA 3LB0A 4JDYA 2NV1A 5EBUA 3PY2A 2NXIA 4IX0A 5TQLA 4X22A 5DCDA 3KAOA 4LC8A 4O10A 3W74A 4MZ8A 2EHHA 5H2ZA 3GR8A 5DY2A 1XL9A 3PSVA 2ZZ4A 3TXZA 1G4SA 1WXJA 1SR9A 5KZMA 1WX0A 1SZEA 3WJZA 3PWAA 2Y62A 3DKJA 5K4ZA 3NPWA 1VS1A 3HIJA 2CLEA 3VE9A 2YFOA 1H5YA 1GPWA 3D0CA 3S5OA 3BLIA 1TV8A 1XCFA 2B4GA 2NWSA 2NX9A 4PFMA 1GVSA 5HINA 1YXDA 4TU1A 2HSAA 5E1QA 1VC4A 3M5ZA 4KWWA 2YGYA 4RR4A 4PEKA 2H3BA 3MYOA 2CLFA 4S2CA 2CU0A 3CIXA 1KTBA 1CW2A 4CQAA 4LT9A 5HMSA 3TUUA 2WV8A 1NSJA 1GEQA 1L6WA 5SWUA 3IVSA 1LOSA 3W72A 3P8JA 1LYXA 1P5BA 4CNNA 3KHJA 3QF0A 2WKJA 1HG3A 3EWYA 4DO4A 3M6YA 4ZQCA 3CHVA 4ALDA 1FWWA 4LVDA 4JYDA 2OCZA 3QQ1A 3L67A 3TQVA 3KX6A 3W86A 3L9CA 5TBOA 3C2FA 2OZ0A 4RZ6A 5D30A 1JQXA 4FIQA 5EL1A 4AHOA 1EP3A 1YTEA 3GAYA 1JUKA 4BF9A 3EWWA 3O8AA 3UXDA 5AHLA 4FNPA 1M7OA 5E0KA 3AO0A 3IRDA 4OGZA 2DP3A 1BKSA 4CLMA 4AWSA 2ZBTA 1ME8A 1ML1A 2VELA 4O1AA 2V2DA 3P80A 2ZRZA 3W84A 4GFSA 1OFOA 4PA8A 2DJXA 1EWEA 5G1TA 4RXFA 5D05A 1GZGA 3GXTA 5HWJA 1OHLA 2C19A 5HULA 2Y85A 3DHDA 2FPYA 3DKLA 2PRHA 1UCWA 3LBCA 1FCQA 1EEPA 3LCLA 4O13A 3I7RA 4WX2A 3NPXA 2QDHA 1OABA 4XQ6A 2X1SA 2OMAA 3TX9A 3BK0A 1I2PA 1F05A 1UUMA 2QUVA 5I3FA 3PUOA 3Q37A 3RMJA 1DORA 1ZAJA 1GYNA 3MBFA 3KRZA 1P0KA 1SFLA 3A21A 3HPXA 3TK7A 1R46A 3JRKA 4UTHA 3LHUA 2HS6A 1RV8A 3W70A 4PC8A 1TPUA 3BW3A 4HPXA 1IGSA 1YLVA 4AB4A 1RQBA 1BEUA 5CPNA 3I7SA 1W31A 1LRQA 3O06A 4IMGA 3IIZA 3QMSA 3R12A 1LTDA 3S0CA 4JXCA 3IIXA 5EA9A 3W7IA 3TW7A 1SPQA 3L2IA 2EGZA 3TAOA 5AHFA 1O5KA 3HG3A 1X8FA 5TIMA 3ATZA 4UCGA 3QMRA 5CKSA 3S6DA 1KLYA 4J9JA 5HWMA 3S9YA 4AEOA 4WXYA 5K3VA 4MYAA 4IPIA 5FF7A 4GXMA 4IQLA 3WFAA 4OT7A 2VFGA 4L4LA 1TPB1 1VZWA 3LTPA 4UR7A 3STGA 2ALDA 1IXOA 1TTIA 2I1OA 3O16A 4BFAA 5K9CA 4NJHA 3W7EA 1P1XA 3I65A 2GJNA 4DF0A 3JR2A 1VCFA 1WAUA 3M5YA 5G1YA 1FWRA 4MOZA 2Y7GA 4XBSA 3LI0A 3M0ZA 1IXNA 3M5XA 4P61A 3B05A 3FOKA 4K39A 1LBFA 3NL5A 3SGUA 3T7VA 3BLFA 1XBZA 3PM6A 5FF0A 1QOQA 4JY8A 4UXDA 3G1XA 1H63A 3ABQA 5C5YA 8TIMA 2ISWA 4RKAA 4LW7A 4MPQA 1LP6A 2V81A 2VENA 5F4XA 4Z1AA 4AF0B 2GQ9A 1WBJA 2PURA 4AHQA 3EWXA 2C16A 4N9CA 3T44A 2FTPA 2ZCGA 1VR6A 3OVPA 5LHEA 3O6YX 4Z0JA 1VPXA 2I14A 3E12A 2ZZ5A 3QPZA 1H7RA 3LOTA 3PBWA 2P0OA 3IGSA 5J5DA 4JTUA 3W7NA 1G67A 1TTQA 5KINA 2VKZG 3P74A 4IJBA 3TNOA 4DQWA 4FHAA 2C1HA 2C3ZA 3W7OA 3P84A 1VHCA 1MEWA 2GQAA 2YYTA 1GTEA 4LVBA 3UQNA 5L9FA 3SIZA 2E6DA 2QCNA 3MO7A 1QPOA 3TFXA 4M6QA 1GYLA 3NR0A 1W5MA 1KM5A 1T96A 3BV4A 4NJIA 1BTMA 3DENA 4DO5A 1KBJA 3WK1A 4QNWA 2G5WA 4UMAA 1W8SA 5BOOA 3W7MA 1A5BA 4MLJA 1IF2A 3N19B 4XUGA 3W7HA 1B4EA 1DOSA 5J5RA 1F73A 4WY0F 2CLMA 4MY8A 2VOMA 4Y90A 1NF7A 4R7JA 1TPDA 1FDYA 1FX6A 1RQEA 1TQXA 3PSWA 4YCPA 1SZGA 2V9DA 5KSWA 4A29A 1S5TA 4QAIA 1THFD 5CPMA 4HKPA 3UD6A 4JGDA 1K8XA 1R2SA 1WV2A 4MIMA 1O94A 4DBDA 3ZR4A 5AFDA 3PS7A 4A3UA 1DQWA 2G95A 1YXYA 4QM1A 1SSGA 3NPVA 3M5VA 1TIMA 3HG5A 1OFRA 1YDVA 3P8IA 2J9YA 5HUOA 3DBPA 1ZFJA 2X1TA 1EUAA 3FLUA 3BW2A 3GDLA 3LRMA 4ZQOA 4JTEA 4MFDA 1OFAA 1A5SA 5CGQA 1XC4A 2YYUA 4GWEA 4UTWC 1A5AA 3QYQA 1KM3A 3O15A 1KTCA 5LNVA 3SECA 3SY5A 4GUGA 5AC8A 2R8WA 4HT3A 2YPIA 2B7OA 2DZUA 1M7PA 1K02A 3GNDA 4HNTA 4IMFA 2NXGA 5HR6A 3G1HA 4R53A 2FQIA 2TPSA 2V30A 4LU0A 3GIYA 1QDSA 2YSWA 3GZ3A 1I8JA 3P67A 3BGJA 3W23A 2FB3A 1H51A 4MKNA 3P5YA 4X9SA 1VHNA 5IBXA 1F7BA 3NL3A 4R33A 1WA3A 1I45A 5AHMA 3NQDA 2V5BA 4EVZA 4ZQMA 5DN1A 5G2IA 4BI7A 4JD4A 1ALDA 3INPA 2OT1A 2QCGA 2ZA3A 4FX7A 2ZZ3A 3Q94A 2PRLA 4ZQRA 4CQ9A 1TRIA 5K4XA 2F7FA 3VI2A 5AYYA 1P4CA 3U8GA 3W2MA 5G4WA 1FDZA 4MLRA 3GXNA 3U6WA 3NQVA 3GXPA 1K03A 2ZA1A 3VKJA 3WJSA 1YYAA 3TMQA 4FEZA 4LTSA 1GTHA 3GKAA 1AW5A 1H61A 3G1DA 2NX3A 1JCJA 3PG9A 1FY6A 3TXVA 1LBLA 2Y70A 3G8RA 1KFCA 1WDWA 2E09A 1EB3A 1L6YA 5EMUA 3NEVA 2Z1BA 3MYPA 2V2CA 4WD0A 4GC4A 2VFEA 1VYRA 4HSOA 3SI9A 4IGHA 4LOCA 3VCRA 4Z1CA 2EKCA 3TMLA 3F4WA 1QOPA 3FYPA 3AJXA 4WJEA 2W6RA 3MI6A 4YWIA 4O12A 4Q33A 1L9WA 2BZNA 3N34A 1O95A 1Q6LA 5FEWA 1RPXA 3O63A 4FO4A 4JIPA 3W83A 2JKEA 3NYZA 4LRTA 3TJLA 2Y7FA 1ME7A 4LVGA 3DU0A 3W75A 4XKYA 3WK3A 2X1RA 1SFJA 3WK0A 1TPWA 3LCXA 5HWNA 1I2RA 1FCUA 3DFPA 3NA8A 5CZSA 3M9YA 2RFGA 5D04C 3PG8A 1K8YA 2ISVA 4DF1A 5D2XA 3IEBA 1ZENA 3LCIA 1XBVA 2ZRXA 4NU7A 3SZ8A 4RCXA 1ADOA 3B0PA 1GVRA 3EX6A 4LS1A 1PV8A 3LCGA 4UNKA 4XKYB 3TSBA 4NJGA 4Z0SA 4S2BA 3RNDA 1TJPA 1OX6A 3C2RA 3FIGA 4ZL1A 4JX5A 2YX0A 3EKLA 3RFAA 3LHZA 4O4VA 4WUIA 3UXAA 2NXHA 4NZJA 5LNWA 4GUJA 5F2IA 4BI6A 2X1UA 4JN6A 3C2EA 3KFTA 2DZSA 3CPRA 4JTJA 3W2UA 2YR1A 3W1TA 3I68A 4UMCA 1AW2A 2NWRA 5D33A 2DJLA 3UNDA 4H3DA 3W7JA 4Q32A 4E2DA 2CLOA 1N55A 1SO3A 3CC1A 1A53A 3RF9A 1TRDA 4UR8A 4O15A 4QQ3A 3MUXA 3QC3A 1OFBA 3SJ3A 3PR2A 4TO8A 3SFKA 4A2SA 4MFEA 2BSLA 3UWYA 3LV6A 3T78A 3MI2A 2NUYA 2F84A 4HNVA 1K7FA 3UWZA 3W1LA 1W3NA 1TYGA 2QCLA 1JUBA 1IIHA 3W7CA 2ZZ2A 4DELA 2B7QA 2JGYA 3IGXA 3LHWA 1L2UA 4JTKA 4O1BA 4UTIA 1O60A 1G7UA 3HPZA 4NNAA 2QR6A 5FF4A 1FWSA 3N2XA 1QPNA 4YL2A 2A5HA 4MVAA 5FF2A 1K8ZA 6TIMA 1AMKA 5U7SA 5KMYA 1Z44A 2GJLA 4GJ1A 4LRSA 3F4NA 1JRBA 4ADUA 3L68A 1SSDA 3LM7A 3GDRA 4JTTA 3C6CA 1W56A 1XI3A 2CZFA 3P61A 2FFCA 4A2RA 5IM51 2GPTA 4UFLA 2CLKA 1YPIA 3R89A 1M6JA 3WJYA 1HTIA 2RKXA 4BWLA 3QRHA 3NQFA 3HGJA 5D03A 2A85A 2G96A 1PCKA 4CCEA 4MJZA 4UFHA 3HOJA 3UWVA 3L0NA 1OJXA 2V5LA 3TW6A 3W1PA 4GRSA 2X30A 5DBUA 4UTTC 2NLIA 4N9EA 4FNQA 3G1AA 3UWWA 3EEGA 4CNOA 3EX1A 5AC6A 1PE1A 1TTPA 4MYXA 4ADSA 4AWTA 1G4PA 1LRTA 3UPBA 2Y88A 1X1OA 2G97A 3MHGA 3L5MA 3UWQA 5KZEA 3I6RA 4RZ5A 3EWBX 1TO3A 2NZLA 3ZS4A 3IGUA 1NVMA 3QSRA 3M7WA 3UZJA 4DBEA 2YZRA 2P10A 4XBKA 1FWTA 3E0IA 1G4EA 3ABOA 1MEHA 3TQ0A 4AHPA 1OK6A 1W5QA 2B7NA 3QEZA 3TROA 2DZXA 1F76A 3IIOA 4HSNA 3G1FA 4TR9A 1PS9A 1VQTA 4CCCA 3ZWSA 5D2YA 1TREA 1TV7A 4D2JA 4IOTA 3VE7A 5F1VA 2J9XA 5I3HA 4FXRA 4QNEA 3NL2A 5LZLA 1UASA 3HJZA 3QJAA 1Q6QA 1LLZA 3CB8A 1JVNA 3MI3A 1F2JA 2Y7EA 3M1ZA 3GNNA 1VYPX 4TMCA 2QDGA 1FBAA 2AQWA 2W0UA 4ZQNA 4LWWA 3W22A 5KTLA 3S1WA 1R2TA 4BI5A 4OU1A 3L5AA 3O07A 3F1QA 2DZWA 4O4WA 5L6UA 3PUDA 3R13A 2P1FA 4M7SA 4Y96A 1YTDA 3E9AA 3G3DA 1W5OA 4WY0A 1UB3A 3LI1A 4RV8A 1A50A 3VNDA 3EX2A 1GJPA 2NUXA 3GDMA 1LZOA 1X7FA 1XDLA 3LCHA 3FA5A 1X6UA 2BTMA 1KV5A 2QCFA 1HFBA 4GUIA 5LNSA 4LV9A 6ALDA 3NNTA 5CZJA 1W3TA 3GX9A 3M47A 4Y6GA 4Y8FA 5HUPA 3IV3A 1L6SA 1SZFA 4WY0B 4JTIA 1ICQA 1W3IA 3SR7A 4NNBA 4O50A 5LNUA 3TKFA 1LOQA 1ZCOA 1DHPA 4LC6A 5EPDA 4O16A 4ZZ9A 2QCDA 5KZDA 2A6LA 3NO5A 2XN1A 1SW7A 3EWUA 1H7PA 3DHFA 2Q3OA 3O05A 1FUYA 5D09A 3WJWA 3W2LA 2GVLA 3ATYA 3TFCA 4JYEA 3KRUA 4E38A 3CEPA 1D3GA 2E1DA 5AN7A 3OVRA 2XFWA 2XN0A
chains in the Genus database with same CATH superfamily
3EKGA 1QVBA 3M16A 3LRKA 3GE7A 3W87A 3T55A 3HGOA 3VX1A 3DGRA 4QLLA 1Z69A 2WMHA 1ZLPA 2OKTA 1JQVA 3MWAA 3MP4A 3VX0A 3IVUA 2FVLA 1QPQA 4ROPA 1VF8A 4FF7A 3SUVA 3FFSA 4TUFA 3H55A 4FP1A 4TXEA 3TONA 1EDGA 5I5RA 4M56A 3MSRA 3AU2A 4PMRA 3MMTA 2PWHA 1UWSA 4WSJA 1KRMA 3HFTA 1DWFM 4ZO7A 4ASTA 2X0YA 3T09A 4PRWA 3OHIA 3QV7A 5F1UA 2OYLA 5GPRA 3PPGA 4BEUA 1I2QA 3LEPA 2REQB 4LV4A 4QSFA 4IMCA 4O52A 2WSRA 1NARA 1VGAA 4I8DA 5I2UA 5HAOA 3ENLA 1HGYA 1EJXC 4EF8A 4LSBA 1ZNNA 1NDYA 5ENLA 1V3JA 1GOQA 2J8TA 3BXWA 2DH3A 4ZXOA 1WZMA 2Z29A 4OHQA 5C55A 3HV8A 2VQUA 1D8WA 2PTDA 2WNQA 3WMCA 2WOQA 3QLDA 3H4WA 3THAA 3QQ0A 1Q65A 1UROA 1PUDA 3UJRA 3BMXA 1O68A 1QOXA 2GWNA 1VPQA 4FALA 1ZTVA 3L7RA 2WM1A 3W7LA 2Q3RA 3E5BA 3WF3A 3C86A 9CGTA 1EZWA 3CL7A 1LM1A 4EK7A 1F3TA 1K4GA 4Z2KA 1EOMA 3MUY1 3CLMA 1CLXA 2L5HA 3NQMA 4Y9PA 5IRPA 1W1PA 3NGJA 4C1NB 4Z42C 4IIGA 3WUBA 1S1PA 4JFTA 2QT3A 3ZWTA 1UKOA 4KRUA 4MJMA 2HZGA 4KH2A 3UG4A 1ZAIA 4IPJA 2O7SA 1B31A 4H9MA 1W5PA 3S47A 3MUCA 3LLFA 4ZODA 2P88A 2PSNA 2ISSA 1VEOA 2WC3A 1TUFA 1R3QA 4XWUA 2XJ7A 3VKCA 2BGQA 3MSYA 1UD6A 3W07A 4DWSC 2OFJA 3B3DA 1Z8AA 3O6DA 4MB5A 3UJ2A 1ZGDA 4JQ1A 4NZFA 5A8GA 1EPVA 4S3GA 3HJEA 1IXQA 1TCDA 4K3ZA 1FP9A 1M1BA 1PKYA 3FHAA 5JH1A 3NPUA 3GW3A 1PB0A 2DT0A 3RLUA 1XUUA 2VFDA 3W73A 4XV0A 3SCTA 3KW3A 4NJKA 2FZBA 1KM1A 4F66A 2C71A 4TQTA 2VOTA 4NF7A 3W26A 3P0WA 3A5VA 2V63A 2UV8G 1B9BA 5A8QA 3ZFHA 6REQB 3WFLA 3MU7A 4QDMA 1EWDA 1Q4WA 3LNMA 1AFSA 5HJXA 3C4UA 1A5KC 5D9PA 2HE8A 4GUFA 1NFBA 1JRCA 3P0XA 4BHYA 1EC8A 2GJXB 3MQTA 4U4MA 4LVFA 3GDTA 1RVGA 3UETA 4AAJA 2GJRA 2WHLA 2J6VA 2OO0A 1OC7A 1XSJA 3N2MA 3VCNA 4V1YA 3P5ZA 4Y9OA 3LMZA 4HPJA 1ICSA 3M7SA 2QPXA 3MBDA 4YVPA 2E68A 5MF5A 2RDUA 3DC8A 5FI8A 4E2OA 4XZHA 3NCOA 4Q7BA 3LTYA 5K9DA 2V82A 1H7XA 1F6YA 1P6WA 1MRAA 4E4PA 3VGHA 1Q2SA 3IJLA 3HB9A 2QCMA 5B80A 1U5JA 3MZNA 4NT0A 3V0TA 1ZS2A 1KFEA 5D2TA 2O0TA 2PDFA 1NY1A 4FI4A 3TTYA 4BS0A 1Q2RA 3IVTA 1P7TA 3W1MA 2J4GA 3IV8A 4S1FA 4US5D 3RN6A 4JN7A 5ABTA 3FYOA 5AHEA 3DEQA 4E8CA 2PCQA 3IJQA 3VYLA 5BRPA 1JPDX 1JF6A 1NOUA 3VAVA 1RR2A 1UW9A 2FHBA 4G1NA 3PK7A 3TVAA 4AY1A 1GT8A 1J2WA 2KZHA 4OWGA 3LZ5A 2Y7DA 1F8MA 1YPFA 3W7PA 4C1KA 1RJQA 1W0MA 2ZX9A 1GG0A 2BGSA 4K68A 1YMYA 4XD4A 1U5VA 2V67A 3TLLA 4AEEA 3CAVA 4DJDC 1UR4A 2NQZA 3TZNA 3H22A 2DSWA 4MJ4A 4R9XA 1REQA 2EQDA 4UIOA 5BOFA 5C9ZA 1LLWA 3FJ4A 4J3ZA 4IP7A 1LJYA 1UOZA 4GYPC 3KBSA 1XC6A 4ZTYA 5H8MA 3KBVA 4HNNA 3GLCA 3W6YA 1Q7ZA 1MFVA 4U28A 4XBJA 1BLIA 4IWWA 1U5HA 1CYGA 3BTNA 4CNPA 1UPPA 1E0WA 3TYAA 4TX8A 1C9WA 4JTHA 4DYKA 3BOXA 4ICMA 1N8IA 2VEKA 2Y8VA 5LKYA 3EMZA 4QDWA 5T26A 1UZHA 2PC8A 1JZ5A 1TMQA 3NOYA 4C1LA 3LERA 1CECA 1X39A 3B8IA 3UJEA 4AD3A 2J78A 3CUZA 3NVDA 3V3WA 1LUCB 1DIKA 1GQJA 4G5DA 5FJIA 2NV2A 3EB2A 3PB2A 1Z32X 2IQTA 2Y63A 4LF2A 3WH5A 5BXTA 1WUEA 3WNOA 1OX5A 2CHNA 3MDWA 2ZTKA 3WFZA 4JZ5A 1I75A 2DZTA 3CEUA 4G7EA 2HTMA 5T8GA 4UTLA 4AD1A 3VGBA 3NQAA 4W4QA 1CDGA 2UY4A 2HS8A 2FDSA 1W3HA 2ZOXA 2VVSA 3AHYA 4C7FA 3W24A 4WVXA 2C0AA 5EMMA 4ZOBA 4HMCA 1I0DA 3CUFA 3CQ0A 2EO7A 1X6LA 4UOQA 1JD7A 1EBHA 4LUSA 4GMEA 4LS0A 3WH8A 4FNRA 1JF5A 4XZIA 4O54A 2XIJA 5AYZA 1N7KA 4JIEA 2V8ZA 5I77A 3GHSA 1WDPA 3WDIA 5AB3A 3UR8A 1PDYA 3GC2A 5E0CA 2ZX7A 3ICJA 2QLYA 3NQ7A 4GQGA 1H62A 3WLJA 3CV7A 5I03A 4FSAA 3W02A 1YNPA 3RLHA 4G6CA 3EKZA 2HBXA 4IIDA 3IPWA 1BVWA 1ZP4A 1QNOA 1PKLA 3KRSA 1T99A 3B03A 1M3UA 3FEQA 3VNLA 3UNTA 3FXYA 3EX4A 2O56A 2NQLA 1NIUA 3PC0A 3W1NA 4B2DA 1AQFA 4OFCA 3VOJA 4K8EA 3RGTA 4A3YA 1ISYA 5E93A 1IWBA 3A24A 4O1CA 4W5UA 3WBAA 1EPXA 1C29A 1PHWA 4D8ZA 5HJYA 1WDQA 3S5SA 2BS9A 4KRZA 2Z00A 3VDAA 3C3NA 1CBGA 3G3MA 3E49A 3M43A 1LOLA 4W7UA 1JCNA 3LRLA 4GQBA 2QCCA 1IEIA 1RK6A 4F0SA 3VM7A 4O14A 2X1IA 3WQGA 4NX0A 4FB7A 1GWJA 1HW6A 3ZLFA 3MKKA 4Q8WA 3K8KA 4PUDA 1JULA 1PTDA 4FNSA 3DAQA 3KVLA 1OFPA 1QO2A 4UOJA 3W2NA 4KCTA 3NG3A 3FAWA 5CC7A 1SW3A 3HMJG 3JZEA 1SO5A 1V51A 1TB3A 3RPMA 5A6MA 4HSHA 3ZVHB 2VP8A 3W7KA 2MUCA 1VFUA 3HPSA 3TTOA 2ZDSA 3R2GA 1KLZA 2J6XA 3AHVA 3CHFA 3AIQA 4N6EA 4JTQA 1XLCA 3CL8A 3C2YA 3TWBA 1KFKA 2PLMA 4IISA 2PGFA 3QTGA 2IW0A 3LLDA 1K3UA 2E5DA 4ZVJA 1PBGA 4AZ6A 3N14A 4MY9A 3VD4A 4XO7A 2BB0A 3QPEA 3G18A 4R9OA 3FKRA 5JBEA 1T8QA 2H6RA 4WOZA 5F2LA 3VIKA 4J5NA 3CHDA 3TN3A 3C2OA 3DZ1A 1TPH1 3STCA 4Q3MA 5CZ0A 8XIMA 1XLGA 1EJ7L 1EL3A 5FEPA 1OZMA 1ZJHA 5AC7A 1PVNA 3F2DA 5CSYA 3GSMA 5CSSA 2ZVIA 3OZOA 4UZSA 4AFYA 3AZTA 1OM0A 1RD5A 3UYCA 3W53A 4J2PA 5CBBA 4WZHA 1JL8A 3QGKC 1BXBA 3B9EA 4PMNA 4BK9A 3URBA 2VZOA 3TN6A 3REQB 3GY1A 1S1RA 2DSVA 3UCDA 4DPQA 3POHA 2DZPA 1VAHA 1B2YA 4GNVA 1K7XA 2PB1A 3LXBA 4YVXA 3U2CA 4YYFA 4H83A 1N82A 3AMKA 1RCXB 2VCBA 4HVXA 1B4KA 3WH9A 4P5UA 1FRBA 1QWKA 3T8QA 4ZB5A 3TYCA 1FH9A 2XVGA 2C1GA 3V5OA 2A4AA 4JQAA 2Z2BA 3TYBA 2FJUB 3MZ2A 4XUYA 4W8BA 1S5NA 2CLIA 4XD6A 2HMCA 4UQEA 1LORA 1PAMA 3Q67A 2QPSA 4UMBA 1QBBA 2ZUTA 5ABFA 1YADA 4UNLA 1JDFA 3GG1A 1O66A 2OLAA 3KVJA 1RA5A 3NOEA 5FJJA 2QDEA 5C9XA 1QK2A 1XICA 4I9AA 4C6FA 4MG4A 1UP0A 2Z1XA 3UXIA 4UFKA 4W87A 1B1YA 2XGBA 4NIRA 4FX8A 4H6RA 4QR6A 4IIHA 5DRIA 1PHQA 3S42A 4B4FA 1OG0A 2PAJA 1MDRA 1AL7A 4W84A 4J3VA 2PWVA 5CJMA 3STFA 2PF8A 5DMNA 3VXGA 1LWJA 2W61A 1ZJIA 4IPNB 1UWTA 5A6TC 4JL1A 1PZ3A 4EF9A 1Q6DA 2YW3A 1QW7A 3FJ6A 3II1A 1BYBA 3CM4A 3W2KA 1E6SM 2GQ8A 4X3ZA 1NEYA 4IFRA 3E2SA 2I5IA 5M03A 4GIYA 4GCAA 6A3HA 1A4LA 1ZBKA 2ZZ6A 7PTDA 1QATA 3N2OA 4P8XA 2XU2A 1TJRA 1H09A 1NP2A 2WNZA 2FHCA 4POCA 4I7VA 4HA3A 1AD4A 3PB0A 1WQ5A 2CW6A 3WLTA 3BPWA 3MP5A 1DWIM 2YB1A 2VX4A 1JCLA 1V02E 4FX6M 4UQBA 1FWHC 3WLQA 4JN8A 4MNJA 5JH2A 4ERIA 3E6EA 5C2XA 1NDZA 2JBMA 4R34A 1ECQA 1M03A 4JY9A 1L0PA 2JFEX 2OX4A 2O7QA 5FEZA 4AXKA 3VNZA 4HU3A 5C71A 5D2WA 5G5IA 2IKJA 1OC6A 3SADA 2VGGA 2YL5A 5FA5A 1MZRA 1XIGA 1V6XA 3EWCA 3GTFA 3W74A 1LT8A 4FOUA 3WNLA 1S2VA 2EHHA 5H2ZA 1UD8A 3GR8A 1XL9A 2CBUA 3PSVA 2ZZ4A 2HVOA 2WVSA 1WX0A 3WJZA 2WM0A 5K4ZA 3NPWA 5JQ9A 1GPWA 2PLKA 4PFMA 1O7AA 4H8NA 3CMJA 4LJ3A 2AQOA 4WSKA 5E1QA 1O12A 1VC4A 1Q8AA 3WEMA 1PTGA 4A3QA 2WZMA 1SR0A 2VC9A 5HNUA 4HYRA 4LT9A 3UZWA 3FVMA 4D6CA 3O2LA 1MNSA 1REQB 1LOSA 3IVSA 3W72A 3NUKA 5LIUX 2PI6A 1M65A 4IUGA 4P8VA 1XIDA 2Z1WA 1HG3A 4ROQA 4ZQCA 1A3HA 1FWWA 3L4ZA 1QK0A 4JYDA 2ANUA 3W86A 3OYXA 2XIOA 3M46A 3OGRA 3CB3A 2OTDA 1CXEA 3GAYA 3EWWA 3O8AA 5AHLA 1GORA 4FNPA 3OJGA 4HP5A 2FH6A 2POTA 2QV4A 3BC9A 4HPNA 4NZCA 2EG6A 3WBYA 4GK8A 1ML1A 5BROA 2ZUVA 3BCJA 1U22A 1XIBA 2QIIA 2IPGA 2CIPA 4GFSA 3B9AA 2ADAA 4Q4PA 1GZGA 4L6OA 3GG0A 1TE6A 2AKZA 2WKGA 2OG9A 4AZGA 2PRHA 3T0CA 4G7EB 4QE1A 2JEPA 1FCQA 3I7RA 5CEWA 4XVDA 4XQ6A 1I2PA 3PUOA 4BKNA 3NYDA 3RMJA 7XIMA 4NASA 1SFLA 1RBOB 4J3SA 4QJ5B 5DMMA 1XGEA 4WKFA 1BXCA 3W70A 2ZXAA 1EDQA 1AODA 5AC4A 1IGSA 4LUSB 1J2BA 4IMAA 1RQBA 4B90A 4Q8UA 1LRQA 3JUGA 2VC7A 1JGMA 3URQA 4DO7A 3R12A 2QW5A 1LTDA 1AMYA 4REQB 2QVNA 5EA9A 1XGZA 3W7IA 3NFUA 4CU8A 3MB9A 3ATZA 1V3KA 1QU4A 5AZ0A 5BXPA 3UESA 3S9YA 2WBGA 5FF7A 2O4QA 4IQLA 3WFAA 4YPJA 4UBPC 4S39A 4UWMA 3LTPA 1XSKA 4L5ZA 4UR7A 1N2VA 3STGA 3PJXA 5D9MA 3O16A 1UJQA 4NJHA 1R7OA 3W7EA 3I65A 4GVFA 4H9TA 3OLIA 1WAUA 3M5YA 4MOZA 2Y7GA 3LI0A 1C7SA 1IXNA 1WPCA 3QZ6A 3AMGA 3B05A 5CSUA 5EB8A 3IACA 3BLFA 1XBZA 3R4IA 1J5SA 4JY8A 4DRSA 4UXDA 3G1XA 2WHKA 3T9PA 3WD4A 4LW7A 3AS0A 4JEJA 1LP6A 2V81A 3BAYA 1K9TA 7REQA 4AHQA 3EWXA 1XLHA 2ZCGA 2QV5A 3E12A 2ZZ5A 5CC5A 3ZSSA 1W1B1 1XRVA 4H19A 1Q85A 1UOKA 4CGTA 2VJXA 4I9JA 4IJBA 2PDKA 5EMLA 2Y8UA 1F3EA 1JI1A 1JPHA 2Z7KA 2DY3A 3P84A 3W7OA 1MEWA 2GQAA 2WZHA 1Q63A 6XIAA 4AZCB 4AD2A 5H8PA 2J25A 3KDNA 3GVWA 5FOOA 3K46A 3ZR5A 4DY1A 3NR0A 1W5MA 1KM5A 3ARWA 1VIWA 2PDWA 4NJIA 2CWXA 1TV3A 4WHBA 1FFRA 4RDVA 1PDZA 4U10A 2BV9A 3W7MA 4Z2HA 3W01A 2GUBA 1EYWA 4Q8VA 1QNRA 2BODX 4XUGA 2FMNA 1B4EA 5J5RA 5FCZA 5AZ1A 1F73A 4MY8A 2VOMA 1NF7A 1FDYA 1RQEA 3PSWA 4YCPA 4F2TA 2V3GA 1S5TA 5CJ5A 1RHCA 1YHTA 1MWOA 1HIZA 1GQLA 4HKPA 1TWSA 3LSCA 1R2SA 3OPSA 3KL0A 3NO3A 3WDJA 1FP8A 5AFDA 4XZMX 2P5NA 1HF6A 5EGRA 3NURA 1OFRA 1YDVA 2PODA 3TYZA 3ES8A 1ZFJA 4GINA 2VUYA 1A0CA 2GJPA 4JTEA 3M0MA 3WQ4A 1GKQA 1HKMA 3O15A 1KTCA 4GUGA 3SM0A 3OQ8A 4HT3A 2E9LA 3BCFA 4IMFA 3AYTA 3G1HA 1JNEA 1DE6A 2FQIA 2V30A 4LU0A 3L23A 3RXZA 2VX5A 2P0IA 3PTQA 1FHUA 1J12A 5AKQA 3BGJA 1JDAA 2FZ8A 3ANUA 2WPGA 1UIPA 2JEQA 4S3KA 4PMQA 5IBXA 4R33A 5AHMA 2V5BA 4EVZA 3P2VA 4ZQMA 1Z3NA 5DN1A 1Z7AA 4JD4A 3IJDA 3ZMRA 3INPA 2BBFA 2OT1A 4KETA 1XRFA 4FX7A 3HZ3A 1RALA 4LEQA 3Q94A 4ZQRA 3RJYA 4WSHA 1TRIA 3VI2A 3U8GA 5G4WA 3U6WA 4Q22A 4PRTA 1P43A 1CB2A 3UZYA 1W3LA 4NYUA 1K9DA 3G1DA 1Z9AA 3TOYA 1K9FA 2NX3A 1GONA 3PG9A 3TXVA 3FK4A 1WDWA 2QVHA 3MCOA 4ZBCA 4HCDA 3WDPP 3MYPA 4LB4A 4GC4A 3SI9A 4Z1CA 1B54A 4PE8A 3RR4A 1VENA 3LS9A 1QOPA 3FYPA 4L9XA 1ZCCA 3L4XA 4O12A 3L2LA 3SCWA 2WJDA 1WP6A 3VTRA 1Q6LA 3E0VA 5FEWA 3SIMA 1H11A 1J01A 4JIPA 4KEMA 2PA6A 5FJRA 3W75A 2CXGA 4DB7A 4Q4QA 1U30A 1XDJA 1EFZA 3CUJA 1CENA 3LCXA 5HWNA 3TWAA 4BA0A 3WQWA 4R7OA 1KC7A 1US2A 2YXOA 1MMFA 2ISVA 4DF1A 3APYA 2ZRXA 3EOUA 3SZ8A 3QOKA 2D0FA 1ITXA 1D2KA 4CNTA 1RJRA 3BICA 2VYOA 4HA4A 1UD2A 4NJGA 3KL3A 1KR0A 4WDXA 1IR1A 3C2RA 2CKRA 3RFAA 1HKKA 4PN2A 5LNWA 3C2EA 2Y5SA 4H41A 3AISA 1F8IA 4JTJA 3HURA 5I07A 2PDLA 4K2SA 1AW2A 2NWRA 3BAWA 5D33A 2DJLA 3UNDA 4RNFA 4H3DA 2G3MA 3HTWA 4M0XA 4H9ZA 4DZIA 3CC1A 4ZB2A 2W5FA 4HYWA 4GI9A 3W82A 3DUGA 4O15A 1EQPA 3N12A 3N4EA 4QQ3A 2X09A 1W17A 3WMBA 3PR2A 1U2YA 4A2SA 4UTFA 1FOBA 3UWYA 3LM3A 3VM5A 3T78A 3MI2A 2DFAA 2F84A 3PJUA 4LY4A 2QCLA 4E8DA 1O1ZA 2ZX6A 3W7CA 1J9YA 3UR2A 2PP1A 4DELA 2B7QA 4D6DA 1HKIA 1R5YA 1H0GA 1L2UA 1UH3A 1V3LA 2ZUWA 3HPZA 4NNAA 1KWKA 4MVAA 5KMYA 4LRSA 4JTTA 1XI3A 2CZFA 2QJNA 3VIHA 3P61A 2FFCA 2GGEA 4OOUA 1M6JA 1XYMA 4QS6A 2VZTA 1WKEA 4FPSA 3C0LA 4C6QA 3AYSA 3HOJA 4IJCA 2J77A 3DBNA 3TW6A 2DVTA 5DBUA 5E9XA 3ITCA 1TZ7A 2W92A 2NLIA 1QI4A 5HOSA 3LQLA 4CNOA 3EX1A 5REQB 1TR1A 4ADSA 1FKWA 3RO8A 4Q8NA 3WBEA 1MXDA 1X1OA 3T08A 3UWQA 5KZEA 3EWBX 2IKHA 2VWTA 3WY1A 1NVMA 4DBEA 1S38A 5EFDA 1Y5XA 1CGTA 3E0IA 1H41A 3TQ0A 1LG1A 3GVRA 1W5QA 2B7NA 4XAPA 3TROA 1E5NA 1EYEA 3IIOA 3DIPA 3G1FA 4RL3A 4TR9A 1A5MC 5D2YA 3VZXA 3VE7A 3IS4A 4YS1A 2WK2A 4YWSA 3MVIA 1RVKA 2OWCA 1V03A 3VMNA 3GU1A 4R88A 3WLSA 4NG3A 2XM1A 4ZSTA 1R2TA 3L5AA 3O07A 1NWRA 2DZWA 3R13A 4C6MA 3G2GA 4M7SA 3AIWA 4U31A 5HMDA 4EXBA 3RIKA 3CGTA 1YTDA 1HX0A 3G3DA 1W5OA 2D0GA 4GO8A 4FXJA 1TVLA 4IL0A 4RV8A 4ZO9A 3EX2A 1GJPA 2NUXA 4BQ4A 2BTMA 1KV5A 1HFBA 3PZGA 5D8WA 4LV9A 6ALDA 4JCLA 4JKMA 5FSEC 1E0XA 4Y6GA 5CLTA 1XP3A 5M17A 1ICQA 1OG6A 1W3IA 3SR7A 3PBGA 4O50A 2DUAA 3TKFA 2DGAA 1H2JA 1ZCOA 3BDKA 3HPFA 1DHPA 3CAWA 1JYVA 3OP2A 1J0IA 3RM8A 2XN1A 3DHFA 1X6NA 3NSNA 4XZLX 1K6AA 1QW8A 5D09A 3I6EA 3DG3A 1SFTA 3ATYA 3KRUA 5LXEA 2G3NA 3K4DA 1EZ2A 3OVRA 5AN7A 2C79A 1CGXA 4B5VA 1EP2A 1KD0A 3NEHA 5E09A 4ADTA 2YA0A 1OF6A 1C9DA 3AMDA 1AL8A 4JQ2A 4O0QA 3PBYA 4L80A 1OVDA 4LYQA 3NM1A 2ACQA 2YL6A 3GXDA 5FJUA 1G0CA 1EDTA 4AMAA 3UG3A 4TVUA 2FLIA 2D24A 1QNSA 2J7GA 3IJ8A 4JX6A 5I3JA 2EAWA 3BSHA 4RNJA 2PFHA 7REQB 3GXMA 4G7FA 1PIGA 4O57A 1HKJA 2RGMA 4A8NA 2ZQ0A 1OZQA 3QTPA 1WZLA 1R3RA 1I6NA 2OOGA 3O9NA 4DM2A 2A0NA 3R1ZA 1QBAA 4A4AA 1KBLA 4NQ1A 4EWND 1UIOA 3OZMA 1SJCA 1UWIA 2P3EA 4M24A 4N7QA 2E6YA 2VEMA 1WNOA 3RYSA 1Q13A 3RU6A 1TMHA 2NX1A 5HQEA 1XBXA 4N9DA 1FXQA 3OO2A 3D3AA 3LBMA 4GKTA 3VGEA 2GLKA 3CT2A 3VNMA 1X97A 3GR7A 3NIYA 3RILA 3DFHA 1YDNA 1D3HA 1HP5A 5BW6A 3T05A 3CK5A 4BQ3A 2PCEA 3GHRA 4IIBA 2XYLA 6ENLA 1PYFA 3WQ5A 3THCA 1FVPA 4FNTA 4JFWA 4PTWA 1I1XA 4Q6JA 3PWIA 3FN9A 1XLDA 3YPIA 3RU8X 1KQZA 4GXPA 2WSPA 2VEPA 4Y8EA 4H8HA 4OIFA 1OX4A 3GBDA 3K30A 3KOXA 3LNPA 3EOSA 4OOZA 3A4WA 4IF2A 4PMVA 2E5CA 2Q02A 5T9CE 4XSLA 2WQDA 1XLLA 4AY7A 5I00A 1H1NA 1YXCA 1ZJBA 4LX4A 2ISDA 3WMLA 3KCLA 4H9VA 1KM6A 2QZRA 3N73A 5H1WA 3NQ8A 3W1XA 2HJPA 2WZIA 5DLCA 4Y9AA 2WXDM 1KKOA 4MZ1A 3ARXA 4DJFA 3RM4A 1S2TA 1V3MA 3CL6A 2EBNA 4MB4A 4N42A 1MYRA 3PF3A 4DF2A 4DJEA 5LGZA 1LRNA 4L56A 4JQ3A 3WBWA 3A13A 4WJXA 4QBXA 3LBOA 3WLLA 4DXVA 2WVVA 4D6JA 4QE5A 1V3IA 4JTGA 5EKYA 2PWEA 4RV3A 5JBFA 4ZCWA 3A3WA 4EANA 3E38A 2Q71A 3RCMA 3UGRA 3THQA 4NYYA 4ICCX 3D6NA 3GVVA 2VL4A 5A3HA 2C0HA 3AS3A 4G9PA 3A9IA 4XVEA 4P2VA 4X60A 3B97A 4UOZA 5DT5A 1ZAHA 5CPLA 4PTNA 3MJMA 5LNRA 1NFPA 2ABBA 3OIHA 4IHCA 4HNCA 1B3WA 2W62A 3UZXA 1F5ZA 4OVXA 1K9EA 2PGEA 5K7JA 5GVJA 3H54A 4D72A 1UMLA 4FS9A 1AZ1A 3AC0A 5DXXA 5DBTA 1XYCA 4PRRA 5LIKX 3SRKA 3NL6A 3PPCA 2PDQA 3I3DA 2I5GA 3PNUA 4K8HA 4ZQPA 1UQZA 5C9RA 1Y5VA 2ATSA 1E4NA 3QLLA 3CO4A 3BWWA 1GJUA 3A6OA 1RBLA 3Q2DA 5F4SA 1JNDA 1TV2A 3E02A 3IIVA 4EIVA 2QJHA 3UXKA 4JBRA 5FEXA 4JFVA 4I6KA 4O28A 1CIUA 5M3WA 4IPPA 1Z42A 3P7YA 3U4FA 1NU5A 4F0KA 1R38A 3PVFA 1PO9A 3DFTA 1W9VA 5HNNA 1JCTA 5ABGA 3QW3A 4IX2A 4EXAA 1QO5A 4IG2B 1Q6RA 4FLQA 3V18A 5I6SA 4KEZA 1HKVA 4QX4A 1QMLA 2YDAA 3SRDA 2JKPA 2XIMA 1E73M 1X38A 4E6MA 1YW1A 1HO1A 4PL1A 7TIMA 4S38A 4ATWA 2PDPA 1S2AA 2UZ9A 1C7TA 4QP0A 4DPPA 1TFVA 2SFPA 3BG9A 1W54A 3DCPA 1XKYA 3GTNA 1GVYA 2BVYA 3PNZA 1O5XA 4DN1A 1ENUA 5A6BD 3M41A 3WUFA 5KZ6A 2H8ZA 4AZBA 1MSSA 1EIXA 4J35A 3WG6A 4OV9A 3K2GA 3TCEA 5CGMA 2OSWA 3BJFA 2OGJA 4AX6A 3CH0A 4RLIA 4JTLA 1GZJA 5FL0A 4HN4A 3C8FA 1KR1A 3I7QA 3L4UA 4NX5A 5K9XA 2DORA 1J6OA 3GH7A 4XZ9A 1Z6KA 2CZVA 1A49A 3ZYZA 2QQ6A 4KS0A 1GQNA 5EFFA 3TA9A 3AOFA 1PIIA 1A5CA 2VVNA 2A3EA 1P0NA 3SB0A 3WJXA 1QHZA 3N13A 2NW0A 3B04A 3R79A 4LUYA 3S1GA 3BVJA 2PF0A 3LTSA 4UQ9A 2WMGA 3PBUA 4WKAA 1L8PA 5H91A 1TJ0A 1ZUAX 4YVVA 4FA3A 4EPDC 1QNVA 3VKBA 2AL2A 3ANYA 4GACA 2FB2A 1R9YA 3WX7A 1PXGA 1YNYA 1ZY9A 2GDUA 4H7CA 3Q58A 2R6OA 1S46A 1TKKA 3CTLA 3VC6A 2YBVA 3MHFA 4H8VA 2E67A 3W29A 3K8LA 3QKZA 1HJVA 1R30A 3MC5A 1EA9C 3EPOA 3MCNA 2J7DA 3WLKX 2DZVA 3CBWA 3LY0A 3C3UA 1PZ2A 1PX3A 2GYIA 3ID7A 4H6EA 5BWFA 4GC3A 2BLEA 3EDFA 2JF6A 3HO8A 4V27A 3R5EA 3TC6A 1ITUA 1FWGC 4M80A 1OINA 1LQAA 1SJAA 3T8LA 2OB3A 4YLWA 3LENA 2BX7A 5FJPA 4QG6A 2XIIA 2C13A 1OFDA 1F6KA 3DFOA 1SFSA 4Z2LA 1TWZA 5A2CA 4JHMA 2TODA 3BAJA 1JJKA 2XN2A 2IS7A 3OU8A 1AD1A 1XH0A 4RDZA 4M5PA 1SMAA 2I9EA 3DERA 1C93A 3E2RA 3U5UA 5G2HA 4AWEA 2GVJA 3AQUA 4DM1A 2QCEA 3CUGA 3SDOA 1TJ2A 4PYSA 3SSZA 3U5YA 1K8CA 1AJZA 4HU4A 3EB4A 1WDSA 1M04A 3TDFA 4HU0A 2JALA 3P60A 1O6IA 3LGGA 4TIMA 2PC4A 4XD5A 3PBVA 1U83A 4AH7A 2PGRA 1FXPA 3PZVA 1G01A 4N9BA 4ZFCA 3P62A 3HU7A 1KB3A 1E1CA 1OY0A 3SUTA 2R1PA 2ZZ7A 1PZ1A 4PODA 3N6JA 3ITTA 4KESA 4E5TA 3G8EA 1ECEA 2PWFA 1EUNA 2W66A 2WJZA 1VBRA 1U1HA 3F5KA 2GDQA 2YL8A 3O6CA 2F38A 3ISIX 3ALGA 3ARVA 2O9RA 2Q8LA 3TV8A 4F8XA 5EY5A 3UVIA 2DUZA 1I60A 4A22A 3KRBA 3FJLA 2EPHA 2ZA2A 4PMUA 2X2GA 4KEVA 2YL9A 3S46A 3PHAA 1V6TA 4PCNA 4A8LA 2OX1A 3T2OA 4IMEA 4NXSA 3TYEA 2V68A 4FLRA 3RCNA 1IIGA 1DXEA 3CQIA 4H4IA 4DJFC 3UJSA 1EEXA 1TR9A 5C6MA 4NNCA 2IXUA 1IZCA 3B8DA 3TTQA 1VPYA 2O9OA 4KEUA 3GYEA 3UY8A 4LALA 3TE9A 1BXNA 5CH9A 2VX7A 4GH3A 3V0SA 2ZIDA 2E6AA 3VZYA 2OSXA 3F7JA 4YTTA 1V6VA 2ZRUA 1CI1A 2XVPA 3XISA 2INEA 1AJ0A 3M0IA 4M81A 1BWLA 1JXKA 3CWOX 4O0KA 3WQDA 1DEDA 3DGBA 4DYEA 5DY3A 3P81A 3QQWA 1GVEA 5I3IA 2OQHA 3LCWA 1XFBA 4R7WA 2TMDA 3L2MA 3ITGA 3ZO9A 2Z25A 3MJYA 1OGBA 1MDLA 4PCFA 1I4NA 1GVFA 1KTNA 2BWGA 4DUOA 2QUUA 2ZZ1A 4QEEA 3QXBA 5GNYA 1B3OA 2Q8ZA 2WC4A 3DYMA 1XPGA 3KVMA 4GLEA 3C56A 1WZAA 3AXXA 3HMCA 3S2CA 2NUWA 4HGXA 1EH9A 1OFQA 1G4TA 4LVAA 5CG7A 4JDBA 3KUMA 1FWNA 4PMZA 3VGDA 5BMWA 4Z17A 3C0QA 3L21A 3H53A 4GG9A 2CZEA 1MNZA 2H90A 2FPVA 3NQ6A 2DH2A 1TPFA 1RA0A 3WQ8A 4FR6A 3GNXA 3KS5A 1PJ9A 1D7KA 3RLGA 4PTVA 6TAAA 3DFSA 4IP5A 3EDEA 3UY7A 2W9MA 3T40A 4JTDA 2C14A 4QSHA 1VEPA 3C0JA 1FWJC 1MUWA 3KOWA 3PZMA 4JOMA 1PYMA 1SZNA 2ABAA 2OWWA 3SCOA 1T5AA 1MO0A 4LYPA 5LYRA 3EOLA 2GOUA 5G1MA 4MJ2A 2MNRA 2PBGA 1XDMA 1E72M 3G1VA 3E0WA 3NQGA 4S3EA 4XIAA 2F2HA 1Q6CA 1OFEA 3H4GA 4L9ZA 3WD0A 4F0RA 2A6NA 1XLEA 3EAUA 4X2RA 1QPKA 2PDGA 3E96A 2ICSA 4ML9A 4JX4A 3NWRA 3NAVA 4QITA 2AGTA 1QWGA 2GK1B 3M0XA 5XIMA 3CJPA 1IT0A 4WK9A 2ZX5A 1GVOA 2QJMA 4HMDA 3BOLA 4WQ6A 2WO5A 2VFIA 3VDGA 3GFXA 1SVDA 3UP8A 4AY8A 4DWSA 1OYCA 3ZT7A 4I9TA 4JKLA 3V7PA 3GG8A 3QV6A 3TQKA 2C15A 3LHTA 4KGJA 2D23A 2MANA 2C91A 2OZTA 3AUOA 1SYTA 2JKAA 1MQRA 3G0SA 2HISA 4G56A 1VCVA 1PIFA 1OGGA 4M1RA 4TX9A 2ZVRA 3KZSA 1B57A 5HDRA 1K1DA 3SO7A 4A35A 1DP0A 3LHYA 2C7FA 2RDTA 1T8XA 2Z26A 4H6KA 1FDJA 5I7GA 3OA5A 4RNHA 3T2QA 1AH0A 2QGYA 1POKA 3DHPA 5A6SA 3IWPA 4HYVA 4J40A 2XH7A 3ARZA 4LNCA 1M68A 1MW1A 1TZZA 2WMFA 4MM1A 4NJJA 3ABRA 2YFNA 1IEVA 3W7GA 3PN8A 2A7NA 1GOKA 1W3KA 4XAYA 1VH7A 1T0OA 3LB0A 4JDYA 2VWSA 8RUCA 2WWCA 3CASA 2NV1A 4U2ZA 3PY2A 4IX0A 4OBRA 4PBEA 3SUWA 1NWSA 4X22A 2V3EA 3H2AA 3S6OA 3RPTA 1WXZA 2FTWA 2ZXDA 3IAPA 2KX9A 3FCPA 1W1YA 5DY2A 1VP5A 2NLYA 3IUDA 1WXJA 4B5UA 1E6NA 1J0HA 4MKSA 3D0CA 2NWSA 2HXTA 3LU2A 1RK5A 1GVSA 2HE5A 3UERA 4ERGA 1KGUA 5HINA 1BF6A 1YXDA 4EWJA 2HSAA 4KWWA 3VOHA 1Q5MA 2H3BA 2CLFA 4S2CA 3TR9A 5LIWX 3GHUA 3H24A 3VD3A 2V38A 2WV8A 3DYOA 1GEQA 5M2FX 5SWUA 4IGSA 2BY2A 1CGVA 3P8JA 1VFFA 3R6IA 3PFMA 2BOFX 1TCMA 3WQFA 2HEJA 2WKJA 4D8LA 4F0HA 4AIOA 5T9BG 3GTXA 4TTGA 2OCZA 3QQ1A 3BSGA 3L67A 2I56A 3C2FA 3FYYA 2HQAA 2D2OA 4RZ6A 3KBNA 3IUIA 1JQXA 5HQLA 1HT6A 1EP3A 4L1XA 1JUKA 3UXDA 3O0KA 4XKMA 1J11A 2B31A 4LAMA 1M7OA 3MSDA 3TOPA 1CZ1A 4JNYA 4F40A 5E0KA 3AO0A 3ZVIA 1BKSA 3V16A 1F3WA 4CLMA 4EPEC 3UXLA 5CAHA 2ZBTA 4B5WA 4O1AA 2QMKA 2V2DA 3WUEA 1V08A 3NDYA 4U3CA 4V2XA 4R85A 3WL1A 1OFOA 4PA8A 5G1TA 3C8NA 4V33A 1IQ8A 3ES7A 3BJTA 1OHLA 2C19A 3VCCA 4Q4MA 4IJRA 1UCWA 2GGIA 4WJ8A 1CXIA 4AYSA 4C6CA 3LCLA 3OW1A 4O13A 3D46A 2QDHA 2ASHA 4PUJA 5E6YA 2OMAA 3TX9A 1V7AA 3VUSA 1UUMA 5I3FA 3VMOA 4S3DA 2BY0A 4GYPA 1ZAJA 3F4VA 3MBFA 3KRZA 3XIMA 1E6RA 3A21A 3HPXA 1R46A 3JRKA 2VR5A 4TV5A 2D3LA 4NZ4A 2DVUA 2QNEA 4KBXA 3K4WA 4BF7A 2XTKA 4ZGYA 1NTHA 3CWHA 3BW3A 1E4IA 2VX6A 2PDXA 3I7SA 2GGGA 2W4XA 3O06A 3IIZA 1WKFA 3KDOA 5I24A 2CBIA 1NWUA 4JXCA 1E6XM 3TW7A 3WLHA 1JG9A 1UR1A 2EGZA 2WMKA 4HJFA 1O5KA 3HG3A 5TIMA 1RP8A 4L6HA 4CQDA 4EPBC 5CKSA 3S6DA 1KLYA 5D9OA 5GQBA 4J9JA 4AEOA 1J79A 4GXMA 4OT7A 4XAFA 4AISA 4QS5A 1IXOA 2ZUUA 4H7ZA 5K9CA 4XZNX 3OBAA 3QYSA 1BYAA 2GJNA 2QS8A 3VNIA 1VCFA 1FWRA 2ZC8A 4XBSA 3M0ZA 1XCXA 1PX4A 3M5XA 4P61A 4K39A 1LBFA 3SGUA 3T7VA 1H49A 4NSBA 3VINA 1RP9A 2ZICA 1H63A 3ABQA 3CV1A 8TIMA 3GR4A 2ISWA 3K4AA 1J0ZA 1OQFA 4KF1A 2PURA 3KBMA 3UG5A 3M4HA 4PBFA 4WLCA 3QPZA 1F61A 1H7RA 4INFA 2P0OA 5J5DA 2VRKA 3UR7A 4JTUA 3W7NA 1G67A 2G4JA 3H21A 2YCLA 2BVWA 4GI6A 1VHCA 5I06A 2YYTA 3VD5A 3SIZA 3WZ0E 2E6DA 3MO7A 4Q8QA 1P1MA 1QPOA 4DUVA 1CWYA 4M6QA 3S2MA 4U3AA 1XGDA 3QV9A 4IQEA 1VFTA 3GM8A 3WK1A 4QHRA 1BYCA 4ATLA 4FR1A 1W8SA 5BOOA 8A3HA 2OODA 2PZNA 1V6WA 1IF2A 4X0NA 2X0HA 2DDXA 1XF0A 3GNPA 1TPDA 2DUXA 1FX6A 1TQXA 1JGIA 3DG7A 4QAIA 1BRLA 5CPQA 1THFD 5CPMA 4GY7A 1HJSA 4CEUC 4GCXA 4M6UA 3TC3A 5HBFA 5A2AA 1O94A 3FGCB 4DBDA 4O8AA 3PS7A 4PGLA 3ERPA 2G95A 2F9RA 4DXXA 1ADDA 3M5VA 1TIMA 2PD5A 3P8IA 2J9YA 4C6DA 3B9DA 4W8LA 1FWBC 3FLUA 3GDLA 3BW2A 4MFDA 1CXHA 2PLCA 5E6ZA 5H6HA 5E70A 2FZNA 4PULA 1XC4A 4GWEA 4UTWC 3QYQA 4H00A 3SY5A 2R8WA 1RLCL 2X7WA 2B7OA 2VR2A 3OZYA 1M7PA 1K02A 3GNDA 4HNTA 2NXGA 5HR6A 2OVLA 1QASA 1KO0A 4R53A 1V6YA 2D20A 4HB7A 5FSDC 3AMCA 3GZ3A 2F2KA 3L4VA 1B0IA 3W23A 2QPUA 2FB3A 4NHVA 1JPIA 2GSEA 4BI7A 3VGGA 1O5RA 2JE8A 4AMCA 5J8LA 4AZIA 2ON3A 2Y24A 1XRTA 3A3HA 1WAWA 4CQ9A 2OQLA 4JKKA 2VCAA 5K4XA 2J13A 3EWDA 1P4CA 4X0VA 2PDIA 4MLRA 1K03A 2ZA1A 3VKJA 5M5DA 2F6XA 3WJSA 4FEZA 1EX1A 3N4AA 4LTSA 2XINA 3GKAA 5AVNA 5CC6A 2J8GA 3ARRA 1W6TA 1UBPC 4L4OA 1EJSC 2V3FA 5PTDA 4UCFA 2E09A 1E9ZB 1L6YA 5EMUA 3NEVA 5I78A 2HROA 4WD0A 2FGZA 1VYRA 4QXIA 2EKCA 1NOWA 3SQLA 3LPOA 1K4HA 2DSKA 3MI6A 4YWIA 1VBGA 2XGIA 2E9BA 1L9WA 2BZNA 5DQPA 3N34A 2HK1A 2OEMA 1RPXA 4NZ5A 4PMDA 3W83A 2JKEA 2PDUA 3NYZA 4NAEA 1ME7A 4OECA 3DU0A 3VPLA 4XKYA 2Q8XA 3QY8A 1Y7VA 1IEXA 4NP7A 3NA8A 4V15A 4W8AA 4XZBA 4ACZB 5B7ZA 5D2XA 1ZENA 4YTSA 4GQRA 3MPGA 1GVRA 2ZUMA 4PCTA 2X42A 4UNKA 3TSBA 3VU2A 1E5JA 1C90A 1TJPA 4GX9A 4HZ8A 3LHZA 4MWAA 4WUIA 3UXAA 2Z2AA 4KQNA 2YA1A 4KPLA 4GUJA 5A94A 1T40A 3U4AA 2X0SA 4HZ6A 4HN8A 3KFTA 3W2UA 1TZ9A 2YR1A 2PU0A 3I68A 4UMCA 1EJTC 1X8CA 3TTSA 3DDMA 4E2DA 2CLOA 3KOZA 2CXEA 1W8GA 3HQNA 3TCSA 3CQHA 3WN6A 1YKWA 3SJ3A 4NAFB 1IWPA 4JTAA 2J7BA 1R8LA 3LV6A 3V5CA 4HNVA 1K7FA 2WHJA 1W3NA 1TYGA 1IIHA 1JUBA 1M7XA 3H2OA 3R10A 2VUNA 2ZZ2A 4FMVA 2JGYA 3H7RA 1W2PA 3AWOA 3LHWA 4O1BA 1O60A 4Q8PA 5EMKA 4IZGA 3L4TA 4WCJA 5T91A 2QR6A 4KCVA 1QPNA 1JZ7A 1AMKA 2GJLA 4ADUA 1JRBA 2WCAA 3L68A 4WGXA 3LM7A 3GDRA 3C6CA 1HL8A 1SJDA 1HL9A 1AZ2A 3ZSTA 3SCRA 4MDPA 4AEFA 3WJYA 1HTIA 1R3WA 1VJSA 3NQFA 8XIAA 1UYQA 4UFHA 4GIEA 2BDQA 4PR4A 5CCZA 1GGOA 3ZXWA 4DZAA 1YEYA 4W93A 4KIEA 1WZKA 4X63A 3W1PA 3CMFA 1G5AA 4UTTC 2Z4GA 2A79A 3AMLA 3UT0A 3P3BA 1UR0A 4N9EA 4FK9A 4FNQA 3UWWA 3EEGA 3RAOA 1TTPA 4ZTXA 3THUA 4AWTA 1A5OC 1G4PA 1XYZA 1BHGA 2VCCA 9XIMA 3WD3A 3S2NA 4S3CA 4PB4A 4RZ5A 5A8OA 2NZLA 3V4BA 4BQ2A 4WF7A 3QSRA 2OLSA 1Q8JA 4MDOA 2XGZA 2YZRA 2P10A 3E74A 1OCQA 4L61A 1G4EA 3ABOA 4A05A 1CTNA 4PTXA 4PB5A 3B40A 3ITOA 4YU1A 2DZXA 4GI4A 1F76A 3CHEA 4HSNA 1PS9A 2BY1A 1DJIA 2WLZA 2QYGA 3T07A 4IOTA 5CPTA 1YBQA 5I3HA 3W4RA 5LZLA 4N0RA 1KCKA 4PUMA 1US3A 3HJZA 3H2FA 1EGMA 3MI3A 1F2JA 1W9BM 2Y7EA 3GNNA 1VYPX 1XLJA 2AQWA 4YHGA 4LWWA 2V5DA 3U3HA 4BI5A 3H26A 4O4WA 2P1FA 4EAYA 1TWIA 2J7CA 4PUKA 4ZE4A 4WY0A 5BYWA 1XIEA 3MKCA 3LUTA 3RJXA 1RBAA 3VNDA 1IV8A 5LA0A 1I1WA 1XDLA 3LCHA 4DXKA 1X6UA 4Q4OA 4J1OA 3RRAA 3UW6A 5LNSA 3EEZA 3NNTA 5CZJA 3S4TA 1XQLA 3ONBA 5D4YA 2CLPA 3M47A 4Q8TA 4Y8FA 1IHIA 3ITLA 1L6SA 1SZFA 4D1IA 5HMEA 4QEHA 5DO8A 1WDDA 5LNUA 1J96A 3KBJA 1HKWA 2IQDA 3PANA 2XZ9A 1TUXA 3PZNA 4O16A 1A0DA 3EB3A 4ZZ9A 4GJIA 4TVCA 1WUFA 3PAOA 3GRIA 3NO5A 1W1VA 2E4TA 2OKOA 1SW7A 4Y9NA 1OSEA 3TFCA 1UR9A 3QY7A 4AQLA 1CLKA 3NSMA 2P76A 1EBGA 2EKGA 3VILA 4DJDD 3HPAA 3MP3A 2QCDB 2TAAA 1JZ2A 2FYMA 3CU2A 4N6FA 4HK6A 3LV5A 2CC0A 3AXKA 4GISA 2GGHA 1EP1A 4A3RA 4YXGA 3QKEA 4LFYA 4QDPA 4YTUA 1XLFA 3SN4A 4IPLA 5GJNA 4DBWA 5MKGA 1BVNP 3V75A 3QMTA 1CXLA 4I7UA 2ZFAA 4BR1A 3W2JA 3M44A 2DQXA 2DPEA 1VJIA 2REQA 2V2HA 2VM8A 4KMQA 2FMOA 5AECA 3WQ6A 1RPKA 4RX0A 2YBTA 1W9DM 4KCUA 4UTJA 1XISA 3HGSA 3A3XA 1NDVA 5CSRA 5HPCA 1YQ2A 3KTCA 3NDOA 3NDZA 1DXFA 4RK8A 3PWGA 4HNOA 5A5WA 1L8NA 4ONVA 5FESA 4HHHA 3QW4B 2VFFA 2QUMA 1EC7A 5HQMA 2HPMA 2WMIA 4O18A 3ONCA 2XFYA 1YE4A 4E0CA 4RE4A 4M51A 3LCFA 5D32A 2Q01A 3MCMA 1E71M 3JU2A 3OA3A 4L1GA 3F2BA 4S3JA 1QAPA 1DWJM 1LCOA 1XIMA 1MUCA 5DX7A 3WEZA 3R94A 4HHPA 5CPSA 2WJFA 4I7WA 1C8XA 4C1NA 4J27A 4JYFA 1ZJAA 2WVTA 4PFHA 5A2BA 1G1YA 3FEMA 4XTIA 3CWNA 1CX9A 4KFPA 1S2WA 4GX8A 1LT7A 1CGWA 2GZXA 3HV9A 5AC5A 4NL1A 1ESWA 1DYSA 3DG6A 1A80A 4ERAA 1QFEA 1UZDA 5LGXA 4GHRA 1P6BA 1D9EA 2ZXBA 2XH4A 4WGHA 3P14A 3NQEA 5I79A 5DMYA 2CHOA 3WNKA 1UC4A 1H1YA 1ZL1A 1VFSA 1OF8A 4PBGA 4UFIA 1J5TA 1B9ZA 5BRBA 5GNXA 4L4PA 2HVMA 5HR7A 2A21A 3AROA 2YDQA 4HMNA 3RO6A 2IKGA 3ZR6A 4D1JA 1RSCA 1DPMA 1TE1A 1W9XA 3TIMA 4MKVA 4Q8MA 3RUBL 4Q7IA 1SQ7A 4RXGA 4LUJA 3SY1A 3H2MA 3T0DA 5CG0A 3OVQA 2PU1A 1HZYA 2YJQA 2INFA 2TYSA 3RX3A 1JPKA 3OBKA 6REQA 2WVUA 3KLKA 2ZRWA 1EX5A 1EO7A 4MF4A 4BY3A 4BZYA 4MWAC 1DJQA 4US5A 3WLIA 1GVIA 2GJXA 4G1KA 3ELFA 1ODUA 1HGWA 1RD6A 1CB7B 3W7QA 1K7EA 1R85A 4H7VA 3DFQA 2Z0IA 3S5YA 3GFYA 4YMZA 3T42A 1DWGM 3GNRA 4KWVA 4LYRA 4OQVA 3CHCA 3R8RA 3TSMA 1HP4A 1EO5A 3KVKA 1V93A 1EJVC 2D69A 3KOYA 3T1GA 4LBRA 1DIEA 1PKNA 1XXXA 5C8BB 3WL0A 4K1WA 4LS2A 2A3CA 2QAPA 2H3DA 4IXHA 4NAEB 3BURA 1LDCA 4L4MA 1RLDA 3EOEA 3CMGA 3H4XA 2FVKA 2F6UA 2RH9A 3IJ6A 1DTUA 1N8FA 3WQEA 1UZ1A 4AVFA 4UUIA 2WSYA 3E2VA 3TAKA 3B4UA 2CEQA 3CZEA 1FWDC 2ATMA 3B0UX 3AALA 1WOBA 2W79A 2EPMX 5JVLA 2PRMA 2ODOA 3VMPA 3VKDA 7A3HA 1VFOA 3APTA 4JIRA 2AGKA 5EMJA 3CQKA 3KBWA 4H04A 4RE2A 3IK4A 3GUGA 1TPEA 2PDNA 1UUOA 4AXNA 3IARA 4H9UA 2I17A 5BU6A 4JFSA 4L65A 1PZ0A 2BG5A 2HWGA 4JNMA 1MQPA 4D71A 3HGRA 2Y1HA 1P7TB 1OCBA 3KZPA 5C9WA 3G6MA 1HL2A 2FGBA 1C8VA 5CPOA 2PDMA 4GVIA 2PTYA 3EA1A 4RZ4A 1JFXA 4O19A 4HOWA 4M3PA 3GIPA 2G3FA 3SJNA 1HO4A 1SU5A 3SCVA 3GUWA 3VK5A 1R87A 4JIQA 4Y7EA 1F74A 2WSQA 4QFUA 4Q4KA 4QLJA 3MUAA 3VDBA 4KFOA 2PWUA 9RUBA 4N4QA 3PUEA 1DBTA 3FS2A 4LNYA 2Y5JA 4C6EA 2V5CA 3KL5A 3N11A 2FVMA 3WD1A 4F2BA 3WQOA 2EJAA 1UD5A 4K6AA 2CFFA 3UWUA 5ABEA 2GSJA 3MA8A 1EXPA 3OQEA 3T81A 2PPGA 1WKDA 4HU8A 1R86A 3RG6A 1KM4A 3CZ8A 1LUCA 4UQCA 2CWNA 2ZX8A 3P82A 4GA8A 1G69A 3VZZA 3BAKA 3ABZA 4EKJA 5C2GA 3B0VC 3GKFA 3QFEA 4OUEA 1SO4A 4ZENA 4QJ3B 5E5CA 3TN4A 1UMYA 1KQYA 4BQ5A 4C90A 5BWAA 1KXHA 1XLBA 1IE7C 1ONRA 1FKXA 2E6FA 4LBSA 3A22A 1DL3A 1HVXA 1MW0A 1ZPTA 1ME9A 4NXKA 3TZFA 1E6PA 2J66A 1UR2A 4PL2A 2RJGA 2ZRYA 4AZ5A 1UWQA 4F2UA 1SO6A 1KBIA 2V0TA 3VOFA 1GPFA 2VT0A 5AHNA 2Z6IA 1MXSA 1DV7A 3QH2A 1GZ1A 2W27A 1VIZA 3URAA 4RPQA 1FWAC 1PCWA 3GFZA 1TVPA 5D37A 3BMWA 3GU2A 2ISFA 1M9HA 1WBHA 2VEGA 4RJEA 5C7HA 1U33A 3S1XA 3GWQA 1S5WA 1MI3A 4M7TA 1XH2A 1KNWA 4O17A 3N2CA 3FAXA 4NY2A 4CKQA 1J4EA 4XTDA 4Z08A 2Y2WA 4LAOA 1KA9F 1R2RA 2J27A 2I16A 4WDWA 1KBKA 4FAMA 2XSBA 1LWHA 1TSIA 1F3XA 3AI0A 4D6EA 3GAKA 3S1VA 3AXMA 3KOFA 1BQCA 5DELA 3VDCA 3CZJA 3W85A 5JU6A 3WLPA 1XQKA 1NQKA 4CNUA 1W1ZA 4EP8C 3W1AA 1LWIA 3ARTA 5BXRA 2HBVA 2J24A 1UP2A 3WK2A 1M5WA 1VYSX 1KV8A 3SCUA 1FH7A 2JGQA 3GH4A 3CT7A 4GI8A 2GQ3A 2NQ5A 3ABSA 2A2IA 5AOUA 3M0JA 3K5XA 2BMBA 1YTKA 1US0A 4MSSA 3QPYA 3RX2A 3FXGA 4FZIA 4DI9A 1B3ZA 1QI5A 4ORMA 1DJGA 1ZHAA 4FXSA 3WUGA 2YBUA 3W7DA 4DO6A 1A5NC 1XV8A 2XIBA 1EGZA 1OYBA 3R58A 3ZQ9A 3SW6A 3LHVA 4HIBA 4CCDA 3ZVHA 3T0BA 3N18A 2VNCA 5LXXA 4V1XA 3W71A 3AUJA 2WCSA 4OBTA 4WRHA 1OIFA 5MKGB 3QHNA 4PMOA 3ARSA 2XHYA 3WF1A 2WZTA 1W5NA 4BJHA 1FCBA 4S3FA 1GOWA 2E40A 3E0FA 1W37A 1OT1A 3LN3A 4JTSA 3STPA 3BLKA 2J8FA 3PTDA 3SSJA 4CCZA 1QJWA 4Z1YA 1DQXA 1DWAM 1KXQA 2E5BA 2H9AA 1RCQA 5HNRA 3WLOA 1AK5A 4KW2A 1W91A 2PE4A 5LA2A 4B2DD 4KT2A 2JK2A 2WNNA 1OCJA 3BUVA 4EX4A 1ZALA 2WC7A 3AXIA 2GUYA 3V36A 1QI0A 2V5JA 1U1UA 1GK8A 2WMIB 1VRDA 2VR4A 2WHMA 2DSZA 2C6QA 3WLMA 3G22A 1OYAA 4AYGA 4D6HA 4AVOA 4M6PA 3BZJA 2R14A 3AS1A 1RAKA 1UH2A 1OWQA 3KCJA 4UFJA 1ADSA 3QR3A 2WZEA 2QJIA 2G3IA 4QIUA 3MT1A 3TC7A 1Y65A 4CN4A 3REQA 4PH6A 4HCHA 4GE8A 4AZ7A 4EPKA 4GUHA 4LY8A 3H12A 3ARYA 3QOMA 4KERA 4QISA 4P7RA 1RY8A 2WPBA 3U0HA 4KCWA 1BG9A 1MVYA 4B4HA 2GVEA 4JNZA 3S9IA 2J7HA 1ISXA 1K70A 1GVQA 3WD2A 1J10A 1JUEA 5FL1A 3SBFA 5C7VA 4J3TA 2I57A 3MMWA 4W89A 4C60A 3NZRA 3W1UA 3MMDA 2NSXA 3OOQA 3C2VA 4ZSUA 1FQ0A 5DMLA 4QTGA 4M29A 5BRQA 1MZHA 1FCVA 4B15A 4H1ZA 3OG3A 3HQ1A 1TVNA 2XISA 3BW4A 1KM2A 3G0UA 3GXFA 4ML4A 3G1YA 1JCMP 2Z2UA 4F0LA 3F5LA 2VZVA 4MZYA 3LK6A 4DZHA 3W37A 4HK7A 4CQBA 2NSOA 1Q7QA 2D73A 1ONWA 2G8ZA 4ZOCA 1G7VA 3ORWA 2ZUNA 3ZIZA 3NXFA 1XR2A 4M82A 1W1TA 1A5LC 3BH4A 1GG1A 4ENLA 4EAMA 2D2GA 3MHUA 5A6AA 1QRQA 3CUIA 5JMUA 6XIMA 1XYAA 3ECQA 3HG2A 2DU2A 3S2JA 4GKLA 3PULA 3EXRA 3SEPA 5EYWA 2PTZA 4KWUA 3CXOA 3D5HA 5ABFB 1ZP3A 1R3YA 5AHIA 4LPCA 5I3KA 1R47A 3CS2A 1TV5A 1Z41A 4O11A 3TA6A 1TMLA 4O0ZA 3T6CA 1E70M 3IIPA 4JR5A 1KFWA 2XVKA 4WDTA 3SUUA 1OGSA 4JEQA 5ECUA 4ZMGA 3S5NA 4AUBA 1SUXA 3W76A 1ODZA 4KWOA 4UTMA 4B5NA 1XD0A 1XM3A 1XW8A 5G2WA 5D02A 3CZKA 1DE5A