1QMVA

Thioredoxin peroxidase b from red blood cells
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
196
structure length
195
Chain Sequence
b'SGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN-2
publication title Crystal Structure of Decameric 2-Cys Peroxiredoxin from Human Erythrocytes at 1.7 A Resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 195
sequence length 196
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1qmvA00
1K3YA 2VOCA 4J56E 2O8VB 4K6XA 1AAZA 4DSSB 4ISDA 4GTUA 2DJJA 2WZ9A 1OYJA 1YF1A 4DSSA 2TRXA 1ZCPA 1G7EA 4BA7A 1ILOA 1TU7A 3GX0A 2VCVA 2YPMA 4FO5A 4EE0A 3M3MA 1XWKA 2QKEA 7GSSA 4PXOA 2DJ0A 2JZRA 1LJRA 2AUVA 4TW5A 5IMCA 3F8UA 2FWGA 5G1KA 1JLVA 3QAWA 5ECQB 3FRCA 4HS1A 3ZTLA 2LQQA 4V2NA 2MMOA 2V6OA 3LG6A 5A4VA 4YH2A 4KCEA 2CAIA 1EWXA 3F9UA 4MABA 2OE3A 4EL1A 1K0CA 1RW1A 3KZQA 4XS1A 1PL2A 2LV3A 1SJIA 2CV4A 2VCTA 2KHPA 2DC5A 2OE0A 1M0UA 2WGRA 2H1DA 3C1RA 1PD21 3P90A 4AF2A 4RI7A 4HU7A 3FHKA 2GSRA 2DMLA 1I9DA 4KH7A 2JADA 4D73B 1PQNA 1X9WB 3FEUA 4NXIA 1EEMA 1KNGA 3APQA 4LMWA 1SENA 4XHMA 4OO4A 1S3CA 4D73A 1GWCA 5H5SA 3HA9A 2LS5A 4GQFA 3G7JA 4G2EA 3CMIA 5GAND 4MMMA 1SYRA 2GS3A 12GSA 1ZZYA 3ZREA 5IO0A 6GSVA 5G1LA 1K0MA 3EE2A 2IWTA 3HDCA 3Q18A 2C4JA 4G19A 2PMTA 2KUCA 4KA0A 1Z9HA 2EIQA 3UVHA 2ZNMA 4CW9A 3D6IA 2CVKA 5IMVA 3RBTA 4DSQA 3F63A 1GULA 3TOUA 1M9AA 3RPPA 3TJBA 5IM9A 2LSTA 1O8WA 1DBYA 3CTFA 1F6MC 1X9MB 2ZCTA 3OR5A 4PQ1A 2H75A 5GAPD 4K7IA 1MEKA 2B7JA 2YV9A 1J9BA 4NV5A 5EY6A 2X64A 1GSYA 1PMTA 2HZFA 4N30A 5CREA 4IVFA 3GX8A 1HNCA 1OKDA 1FO5A 3TKPA 2AB6A 3ISOA 3IV4A 4FIWA 2G2QA 2VL2A 4MPFA 4IW9A 3GSSA 2NBSA 1SL1B 1K0BA 4YAPA 4HQZA 2B5EA 3KH9A 2HNLA 1O73A 4O5RA 3GSTA 2BMXA 4KSMA 3F3QA 4PGTA 5FT3A 1W4VA 2O87A 1K0OA 4J57E 1OAZA 3TB2A 3GKNA 2O89A 1OVNA 4IBPA 4XTSA 2FY6A 3HVXA 5HR2A 5JCGA 3RAZA 3UL3A 1UVZA 1ZL9A 2H01A 3M9JA 4I97A 1JZRA 3UARA 4XS4B 1XWBA 1PRXA 3BD2A 1A0FA 4H86A 5CAXA 3H93A 2AAWA 2GZPA 4XS4A 2H6ZA 3IC4A 1GUMA 3CYNA 4OMVA 5ELAA 2H73A 4KGIA 3QOUA 3D0ZA 1H4OA 2PWJA 2PVQA 4HZ2A 3IK7A 3UIWA 1NSWA 4ZXGA 2E2MA 1GSQA 1EGOA 3KD0A 2R3XA 3FR6A 1AUCA 4ZIJA 3N9JA 4IP1A 2FCHA 2I1UA 3AY8A 1ZMAA 1G0TA 4HEA2 3K8NA 3DKSA 1F3AA 3TJGA 2LTKA 4PNFA 2H71A 1ML6A 1EP7A 4MZWA 1XVWA 4POMA 2V1MA 2L6CA 3L9SA 5KN3A 3KCMA 4XRAA 2VCZA 5ECPB 2LUSA 5DAKB 1XZOA 4YAVA 3EVIA 1BG5A 3CSJA 1UA5A 4WBRD 4NMUA 5JCUA 5DAKA 16GSA 5IOWA 4KDYA 3TRPA 2NPBA 4X0XA 5ID2A 3J7Yb 3Q74A 3MNGA 3ZITA 1MTCA 4RQRA 3GKKA 4O7HA 5HR0A 3TJFA 1A2MA 2JL4A 4MH2A 4LL4B 1NHOA 1YEPA 3IA1A 3ZIVA 4BWSA 2CVBA 1E6BA 2HSYA 2RUEA 2L4CA 3ERFA 2GT6A 2I3YA 4PUFC 2X8HA 4MF6A 3EINA 2DBCA 3TRQA 4K7OA 3FKFA 1YZXA 4N0ZA 3A2XA 4XRDA 2C8UA 3ZIJA 2VCXA 3GNJA 3GH9A 2B5YA 2GVPA 3ME7A 1O81A 2IJYA 2J23A 3F0IA 4KX4A 1EGRA 2WS2A 3FR9A 1VF3A 2LJRA 3CBUA 5GSSA 2L59A 3WGDA 3ZMKA 4HI7A 2CVDA 3CSIA 4YQVA 1PKWA 2RM5A 3LXZA 5H5RA 3GYKA 2F8FA 2C80A 1PX7A 1NW2A 2CX4A 2RLIA 2VLTA 2PBJA 3QAGA 1W89A 2L5OA 1T7PB 3NIVA 1J0FA 1X0RA 3UBLA 1WE0A 2H1GA 2VLVA 2HYXA 4LMVA 1GUHA 4MJAA 3A2WA 4L8EA 5ECOB 2YWIA 1X5EA 1TW9A 3EWLA 1HNAA 5F06A 3ZVJD 3GURA 2OE1A 5D73A 2LRCA 5DCHA 2OA7A 3VWWA 4L0WA 2HT9A 3VPQA 2C0EA 3MSZA 3TJJA 3BCKA 2J9HA 1YQ1A 5F07A 4TR1A 2H66A 2C0FA 1GP1A 1K3LA 1FVKA 3TDGA 4Q5FA 4F82A 1N2AA 1S3AA 2FHEA 3GL5A 1XWCA 1O6JA 2K8VA 5J5NA 3DEXA 2FWFA 5HR3A 6GSSA 2GSTA 2NDOA 1ERTA 3HZ8A 1JZDA 1GTAA 9GSSA 5B8BA 4ML1A 4HJ2A 4TOPA 1JZOA 3ED3A 2ES7A 3EURA 1PA3A 1Y25A 1A8YA 1BAYA 1MDIA 5DALB 2DJKA 4JR6A 2FWHA 1TOFA 3A5WA 1THOA 2VO4A 4KDUA 1FOVA 2HZEB 2P5RA 3C7MA 3TOTA 5D9XA 3CSHA 4ML6A 4NHZA 2GDRA 2WDUA 2P5QA 3DVXA 3VK9A 3IRAA 2PUKC 2KP2A 1M99A 1XW6A 2H0IA 2B6MA 2H74A 5HFIA 1Z7RA 2IFQA 4MDCA 1F3BA 1QFNA 4LA1A 6GSWA 5ECHB 3C8EA 1XWGA 5AIVA 4BL7A 1GNWA 4OCEA 2HRNA 3ZYWA 3LSZA 2A2RA 4ECJA 4IHUA 3V1WA 3VFIA 2R4VA 3F6DA 3KEBA 1SJ6A 1XXUA 3C73A 5L71A 3FZ5A 1B8XA 2YCDA 1K0NA 2B7KA 1XW9A 3IK9A 2ALBA 1AW9A 2I4AA 3US3A 1V58A 5J41A 3UBKA 2EIRA 1IYIA 1Z6NA 2GQLA 4WKWA 1GLPA 3LEFA 2AHEA 1VRSD 1XPVA 2WB9A 1AXDA 3PINA 1EOHA 4K1FA 2QGVA 5D9VA 5DBQA 1TXXA 5C04A 4ECIA 1E2YA 1X5CA 3HJOA 3QMXA 5ECSA 1USBA 1VF1A 4JEDA 1QGVA 5IMZA 3L0HA 4L5LA 2H6YA 3GN3A 2N5BA 1MDJA 3F6FA 4BPYA 5ECNB 5A4WA 4K8MA 1GNEA 2H1AA 3IDVA 1SL0B 3PH9A 2L6DA 3D21A 2F3MA 1ST9A 5HFGA 1JHBA 2E0QA 2B5XA 3KXOA 1GSFA 1GUKA 1DE1A 3E0UA 4I6XA 1GSEA 1TK0B 1SD8A 2D2ZA 14GSA 4HJMA 3RPNA 4MJEA 3KTBA 3GRXA 5D93A 4ZL8A 4HUAA 5ECIB 1GL8A 1Z7PA 4ZILA 4ZBBA 2VAFA 4XCSA 5DJLA 1FAAA 1OE7A 1LU4A 1FW1A 4GLTA 3QFAC 1OKTA 18GSA 1B48A 2M72A 4EDYA 3Q6OA 1A2JA 2R37A 5JWRB 5J9CA 1Q4JA 2VCWA 2H70A 1A24A 3GH6A 1U3IA 4N10A 3HY2A 1GSUA 1M2BA 4L0UA 3HJPA 4GXZA 1ZYEA 4NAXA 2K18A 3UEMA 1Z5YE 2YNXA 4POLA 4WR5A 1A0RP 1TRVA 2FGXA 4OCFA 4TR0A 8GSSA 2R2JA 4O92A 4OFTA 2GSSA 3MAKA 1OC9A 1VGLA 2GQMA 4QL7A 1G6WA 1SK1A 4AJ8A 3L4NA 4WF4A 5IMDA 4IJIA 3GMFA 5IPHA 2C0DA 1JFUA 4GSSA 4N0VA 3A2VA 2GZZA 4MZBA 3L78A 5CP1A 3TKRA 3QFBC 2GT5A 2VLUA 3VWVA 5JCWA 1TTZA 1G7OA 4E8HA 1TK5B 1PN9A 11GSA 1V9WA 3GFKA 1Y6EA 3I6AA 2F8AA 4MJCA 2TRCP 2IMIA 2H1BA 4N11A 4KUNA 4MJBA 2I81A 4MF5A 1THXA 5HR1A 1X9SB 1G6YA 4OWYA 3D4TA 2C1YA 1B9XC 3KMOA 3P8WA 5GZZB 4ID0A 1PGTA 3G7IA 4QL9A 3TKSE 4KE3A 2E7PA 2LKUA 3LORA 4Q5RA 3CRUA 2YOIA 3EMPA 4IKHA 1EV4A 1CQHA 2WJUA 2DSAA 1SJZA 4K9ZA 2G0FA 2IMEA 1YDKA 1XW5A 3KMNA 2V41A 4ZL9A 4MA9A 2H30A 3GKMA 3I43A 3LJRA 4K7NA 1TRSA 5ID2B 1JLWA 5D8IA 2FNOA 1Z3EA 2XBQA 3Q19A 3W8JA 1T3BA 17GSA 1SYXA 4WXTA 3TRXA 3BJ5A 3EYTA 20GSA 3DVWA 2IL3A 3GA4A 1K3OA 5A4UA 5G5EA 3KH7A 1ERWA 3GHAA 1U3AA 1TRWA 1XVQA 1I5GA 1SK2A 5D9TA 2YWMA 5CO3A 3LQ7A 2KP1A 4HQSA 3PGTA 1YKCA 3WD6A 5F8BA 2WULA 4TR4A 4OFMA 1URMA 1R5PA 2FWEA 3RDWA 2VD1A 4IS0A 3VPTA 4V2MA 4WBJA 4JBBA 4EUYA 3DMLA 3IE3A 5LNKe 2FLSA 3EU4A 1FVJA 3VWUA 3KTLA 22GSA 2CZ2A 2L57A 1JZWA 5G30A 2CX3A 2TIRA 3UOMA 1X5DA 3R2QA 5DDLA 1TI3A 5AISA 1UN2A 2X8CA 1BQ7A 5F0GA 5DQSA 4ILFA 4BWQA 2OJLA 4IN0A 2N5AA 5IPGA 1VF4A 1F9MA 4TR1B 5JWOB 3DYRA 2MMAA 2XPEA 5B8AA 4YQMA 3I69A 2V6KA 3P2AA 1QQ2A 3VI5A 4NPBA 2AV4A 4PQHA 4ZB6A 13GSA 3ZVJA 3HHVA 1F2EA 1SKRB 1FB0A 1M2DA 5D9WA 4GSNA 1OC8A 3GTUB 4J2FA 2JZSA 1NHYA 2DIYA 2GGTA 3IAS2 1RQMA 2LJAA 4JU5A 6GSYA 1IYHA 2FUG2 2CAQA 2HFDA 1U88A 3GTUA 4GWRA 4TKYA 4MLYA 1QUWA 2NVLA 2AYTA 5E4WA 1GSSA 2VM2A 2MMZA 19GSA 3H8QA 3IHQA 3A3TA 1PSQA 3TUEA 1LBKA 1A2LA 3WGEA 2BTOT 3ME8A 2H72A 1WJKA 4KSOA 5DVBA 2REMA 2GZYA 5J9BA 2VUPA 1UC7A 5KN1A 1ZOFA 1EOGA 3IBHA 3ZMLA 5LCZA 3ZFBA 4FYBA 4F0CA 2Z9SA 1EZKA 4JR4A 2VD0A 2IFQB 4KDXA 2HLSA 3IOSA 4EXJA 3O3TA 1GTIA 2VM1A 3FW2A 4PURA 4IP6A 2QC7A 2GQKA 1KEBA 5EL8A 2JACA 1SKWB 2LEGA 3DGQA 1B4PA 2OBKA 3TKQA 4MZCA 1FHEA 5ECRB 3DWVA 2XC2A 3VI7A 4HOJA 3E9JB 4KAEA 3D5JA 4OFNA 3O76A 2V32A 3TKSC 2FA8A 2F9SA 2HXKA 2ON5A 3L9UA 3WT1A 2YJHA 1A23A 1XOAA 3HD5A 1EV9A 2X8GA 3IR4A 3O6TA 3FZ9A 3L9VA 1ON4A 2HE3A 3TJKA 4V1Ap 3DRNA 1V57A 2P31A 3ERGA 3IXRA 1MDKA 4MCUA 2IMFA 2CQ9A 1CQGA 2PERA 4Q5NA 5ELGA 2MMNA 3GUSA 2DJ1A 3M9KA 2K6VA 2C3TA 5ABRA 4G9HA 5IMAA 2XBIA 2LQOA 3LWAA 3WGXA 3WT2A 2JSZA 2MZCA 1YJ6A 3D22A 4XIHA 3HXSA 1ERUA 2OKAA 3GL3A 2MBSA 5D96A 1KTEA 5FWGA 2PN8A 4TXVA 3W6GA 1GTUA 2IIYA 1TU8A 4WETA 2VL3A 4IQAA 2L4QA 2ON7A 3GKXA 2BJXA 3F4SA 1V2AA 1ABAA 5KEJA 3FR3A 4V2LA 2YWOA 3E3EA 2ZUPA 3CTGA 5CYYA 2H8LA 3IPZA 1TKDB 1EP8A 1YY7A 1QK8A 3ERWA 2IMKA 2YV7A 1T4YA 1J08A 2N5FA 3SBCA 5DJMA 2PGTA 4DSRA 1VF2A 1O85A 2XPDA 1SL2B 3UVTA 4ZB9A 3G9BA 4FH8A 5HFKA 4KNDA 3ZFLA 4V1Ag 1RK4A 1XFLA 2KOKA 4L5OA 4KW6A 2VCQA 5A5KA 10GSA 2FD3A 2RUFA 1AIUA 1GSDA 3P7XA 1R7HA 4GQCA 5C00A 3HVVA 3KJYA 2OACA 4ZBAA 1XBSA 5E59A 1M7TA 2H6XA 5B7CA 1XIYA 4I8BA 5F05A 1WOUA 5G31A 4RQXA 3VWXA 3N5OA 4DEJA 3D4MA 3FYGA 4TXOB 3W8SA 4MPGA 3U5RE 3M8NA 4X1UA 4EO3A 2XHFA 4TXOA 2KLXA 1A8LA 1DUGA 2DMMA 1OE8A 2P0GA 5IO2A 2A2SA 2R5GA 4MP4A 5ENUA 2LJKA 4RUVA 4POBA 3KP8A 1ZGNA 3BBYA 1GRXA 1OC9B 5H5QA 4PNGA 1T8EB 2HSHA 2HI7A 1R5AA 3ZZXA 3DXBA 4ULXA 4JE1A 2YANA 4DVCA 2CT6A 5CRWA 3FZ4A 3APOA 4EDZA 2YJ7A 4AJ7A 5IIZA 3BOAA 1SKSB 1BEDA 1BJXA 1WIKA 2H0HA 1WP0A 4LLRA 5IOXA 3DIEA 1PX6A 5FHIA 1TI1A 3UMAA 1QMVA 5J4UA 4Z7XA 5CRGA 1AQVA 2LRNA 3QAVA 4CHSA 5B6NA 3HCZA 4OO5A 4NWYA 1GLQA 1SD9A 5J3RA 1K0AA 3KIJA 1T00A 2O7KA 1AQWA 2DLXA 1QXHA 5B6MA 3HKRA 4WF5A 3KM6A 2I9HA 3TKSA 1HNBA 5KN0A 3I9V2 3CXGA 3GIXA 3TCOA 4ACSA 4HZ4A 2WCIA 2LNSA 4BVXA 2QSIA 3DD3A 1DSBA 3M1GA 3GV1A 6GSTA 1BX9A 3NOFA 1M2AA 4FYCA 4I5QA 1T4ZA 3HVSA 5ECMB 2X99A 1SK0A 6GSUA 3SWLA 5IQYA 4F0BA 2GLRA 1K0DA 1FB6A 5CNWA 1O7UA 3M0FA 4F03A 4GCIA 1WPIA 3EC3A 2PPTA 1DE2A 3LYPA 1R4WA 1HYUA 1V98A 4IJ3A 2C3QA 1S3DA 2B3SA 4TR3A 3ZLPA 3WYWA 6GSXA 3QCPA 1AQXA 3APSA 5INYA 5DCGA 2LRTA 2E2GA 1PL1A 4K0GA 4OD7A 3ZL5A 4E8EA 2L5LA 2DJ3A 2M80A 4EC0A 3U6VA 3KGKA 3VLNA 1WWJA 4CDOA 1B4QA 4MF7A 5EPFA 4POKA 2OBIA 2CZ3A 2MYGA 5G5FA 5G2ZA 4O32A 2EC4A 4NHWA 4AGSA 5COHA 3HZ4A 1PKZA 3C1SA 2MBTA 3C71A 2A4VA 4F9ZA 3FZAA 1TJDA 2RIIA 3FK8A 2JZTA 2RM6A 2F51A 2AJQB 1SU9A 4TN8A 2B1LA 3RHBA 1O8XA 1U6TA 4HDEA 1XCCA 2VIMA 3PR8A 2IPAA 2FA4A 2K8SA 2V2GA 5LD0A 1N8JA 1WMJA 5JWQB 4PUAA 3S9FA 3H4KA 1YEXA 4F2IA 1M9BA 3QDNA 1XOBA 1GH2A 1FG4A 1NM3A 3MWHA 1TK8B 2OADA 2H0GA 4PQIA 2H19A 1Q98A 3BCIA 1GTBA 4LL1B 4RI6A 3QD9A 4WEYA 3LGCA 2C0GA 3CRTA 3LFLA 4MH3A 3MDKA 2R6KA 4EF0A 1Z6MA 2CA8A 1TP9A 4EVMA 2JSYA 5GSTA 1MD4A 3J7Yk 3H79A 1OC3A 2GSQA 2B1KA 3F3RA 1KBNA 4PX1A 1EEJA 3VURA 2DJ2A 4NV2A 1F37A 4P3YB 4ZB8A 5ECLB 1TRUA 4BVYA 1ERVA 3NZNA 1T1VA 2IN3A 1YKAA 2K9FA 3HYPA 1H75A 3EMXA 3FY7A 3QR6A 1MD3A 2EIOA 2NTOA 4I2TA 4K2DA 2VL9A 4ECBA 4GRFA 4ZL7A 2O85A 5DQYA 3TGZA 1U87A 5IMFA 3RHCA 2YWNA 4IQ1A 2LNTA 3LXTA 4MK3A 4JZQA 4X43A 2WFCA 1R26A 2WRTA 4XS6A 4GSTA 2PU9C 3QPMA 2JU5A 4KB3A 5AN1A 3UAPA 4JRRA 3UJ1A 3F4TA 4G10A 1XWAA 3KP9A 2PVOC 4GF0A 5EVOA 1BYEA 5CRDA 1V40A 2M46A 2VL2C 1C72A 2GTUA 1WRYA 4HU9A 5DALA 4I2UA 2DIZA 2IMDA 4IGJA 5AIXA 5AGYA 3JCML 4Q5QA 1HD2A 2YZUA 4K0NA 3H1NA 3IAM2 5CRHA 4KCAA 5KN2A 2YZHA 3LYKA 2YN1A 2HZEA 5HQPA 4FYUA 3HJMA 1B9YC 3EU3A 4EKZA 2YP6A 1AC1A 1HQOA 4AJ6A 2C3NA 4QQ7A 4TRXA 4ZBDA 1TDIA 3F4RA 3G7YA 1ZYQB 4WR4A 4IELA 4ECCA 2HRFA 3ZRDA 1ACVA 4TVEA 1YF0A 2H76A 4YQUA 5ECKB
chains in the Genus database with same CATH superfamily
1K3YA 4A5PA 2VOCA 4J56E 2O8VB 4K6XA 1AAZA 4DSSB 4ISDA 4GTUA 4YKGA 2DJJA 2WZ9A 1OYJA 1YF1A 4DSSA 2TRXA 4X4JA 1ZCPA 1G7EA 4BA7A 2HRKA 1ILOA 1TU7A 3GX0A 2VCVA 2YPMA 4FO5A 4EE0A 3M3MA 1XWKA 2QKEA 2X4AA 7GSSA 4PXOA 2DJ0A 2JZRA 1LJRA 2AUVA 4TW5A 5IMCA 3F8UA 2FWGA 5G1KA 1JLVA 3QAWA 5ECQB 3FRCA 4HS1A 3ZTLA 2LQQA 4V2NA 2MMOA 2V6OA 3LG6A 5A4VA 4YH2A 4KCEA 2CAIA 4G0LA 1EWXA 3F9UA 4MABA 4CY6A 2OE3A 4EL1A 1K0CA 1RW1A 3KZQA 4XS1A 1PL2A 2LV3A 1SJIA 2CV4A 2VCTA 2KHPA 2DC5A 2OE0A 1M0UA 2WGRA 2H1DA 3C1RA 1PD21 3P90A 4AF2A 4RI7A 4HU7A 3FHKA 2GSRA 2DMLA 1I9DA 4KH7A 2JADA 4D73B 1PQNA 1X9WB 3FEUA 4NXIA 1EEMA 1KNGA 3APQA 4LMWA 1SENA 4XHMA 4OO4A 1S3CA 4D73A 1GWCA 5H5SA 3HA9A 2LS5A 4ICYA 4GQFA 3G7JA 4G2EA 3CMIA 5GAND 4MMMA 1SYRA 2GS3A 12GSA 1ZZYA 3ZREA 5IO0A 6GSVA 5G1LA 1K0MA 3EE2A 2IWTA 3HDCA 3Q18A 2C4JA 4G19A 2PMTA 2KUCA 4KA0A 1Z9HA 2EIQA 3UVHA 2ZNMA 4CW9A 3D6IA 2CVKA 5IMVA 3RBTA 4DSQA 3F63A 1GULA 3TOUA 1M9AA 3RPPA 3TJBA 5IM9A 2LSTA 1O8WA 1DBYA 3CTFA 1F6MC 1X9MB 2ZCTA 3OR5A 4PQ1A 2H75A 5GAPD 4K7IA 1MEKA 2B7JA 2YV9A 1J9BA 4NV5A 5EY6A 2X64A 1GSYA 1PMTA 2HZFA 4N30A 5CREA 4IVFA 3GX8A 3FMWA 1HNCA 1OKDA 1FO5A 3TKPA 2AB6A 3ISOA 3IV4A 4FIWA 2G2QA 2VL2A 4MPFA 4IW9A 3GSSA 2NBSA 1SL1B 1K0BA 4YAPA 4HQZA 2B5EA 3KH9A 2HNLA 1O73A 4O5RA 3GSTA 2BMXA 4KSMA 3F3QA 4PGTA 5FT3A 1W4VA 2O87A 1K0OA 4J57E 1OAZA 3TB2A 3GKNA 2O89A 1OVNA 4IBPA 4XTSA 2FY6A 3HVXA 5HR2A 5JCGA 3RAZA 1PN0A 3UL3A 1UVZA 1ZL9A 2H01A 3IHGA 3M9JA 4I97A 1JZRA 3UARA 4XS4B 1XWBA 1PRXA 3BD2A 1A0FA 4H86A 4HSCX 5CAXA 3H93A 2AAWA 2GZPA 4XS4A 2H6ZA 3IC4A 1GUMA 3CYNA 4OMVA 5ELAA 2H73A 4KGIA 3QOUA 3D0ZA 1H4OA 2PWJA 2PVQA 4HZ2A 3IK7A 3UIWA 1NSWA 4ZXGA 2E2MA 1GSQA 1EGOA 3KD0A 2R3XA 3FR6A 1AUCA 4ZIJA 3N9JA 4IP1A 2FCHA 2I1UA 3AY8A 1ZMAA 1G0TA 4HEA2 3K8NA 3DKSA 1F3AA 3TJGA 2LTKA 4PNFA 4EIPA 2H71A 1ML6A 1EP7A 4K2XA 4MZWA 1XVWA 4POMA 2V1MA 2L6CA 3L9SA 5KN3A 3KCMA 4XRAA 2VCZA 5ECPB 2LUSA 5DAKB 1XZOA 4YAVA 3EVIA 1BG5A 3CSJA 1UA5A 4WBRD 4NMUA 5JCUA 5DAKA 16GSA 5IOWA 4KDYA 2A4HA 3TRPA 2NPBA 4X0XA 5ID2A 3J7Yb 3Q74A 4G0KA 3MNGA 3ZITA 1MTCA 4RQRA 3GKKA 4O7HA 5HR0A 3TJFA 1A2MA 1ZYNA 2JL4A 4MH2A 4LL4B 1NHOA 1YEPA 3IA1A 3ZIVA 4BWSA 2CVBA 1E6BA 2HSYA 2RUEA 2L4CA 3ERFA 2GT6A 4YKFA 2I3YA 4PUFC 2X8HA 4MF6A 3EINA 2DBCA 3TRQA 4K7OA 3FKFA 1YZXA 4N0ZA 3A2XA 4XRDA 2C8UA 3ZIJA 2VCXA 2R0GA 3GNJA 3GH9A 2B5YA 2GVPA 3ME7A 1O81A 2IJYA 2J23A 3F0IA 4KX4A 1EGRA 2WS2A 3FR9A 1VF3A 2LJRA 3CBUA 5GSSA 2L59A 3WGDA 3ZMKA 4HI7A 2CVDA 3CSIA 4YQVA 1PKWA 2RM5A 3LXZA 5H5RA 3GYKA 2F8FA 2C80A 1PX7A 1NW2A 2CX4A 2RLIA 2VLTA 2PBJA 3QAGA 1W89A 2L5OA 1T7PB 3NIVA 1J0FA 1X0RA 3UBLA 1WE0A 2H1GA 2VLVA 2HYXA 4LMVA 1GUHA 4MJAA 3A2WA 4L8EA 5ECOB 2YWIA 1X5EA 1TW9A 3EWLA 1HNAA 5F06A 3ZVJD 3GURA 2OE1A 5D73A 2LRCA 5DCHA 2OA7A 3VWWA 4L0WA 2HT9A 3VPQA 2C0EA 3MSZA 4K5SA 3TJJA 3BCKA 2J9HA 1FOHA 1YQ1A 5F07A 4TR1A 2H66A 2C0FA 1GP1A 1K3LA 1FVKA 3TDGA 4Q5FA 4F82A 1N2AA 1S3AA 2FHEA 3GL5A 1XWCA 1O6JA 2K8VA 5J5NA 3DEXA 2FWFA 5HR3A 6GSSA 2GSTA 2NDOA 1ERTA 3HZ8A 1JZDA 1GTAA 9GSSA 5B8BA 4ML1A 4HJ2A 4TOPA 1JZOA 3ED3A 2ES7A 3EURA 1PA3A 1Y25A 1A8YA 1BAYA 1MDIA 5DALB 2DJKA 4JR6A 2FWHA 1TOFA 3A5WA 1THOA 2VO4A 4KDUA 1FOVA 2HZEB 2P5RA 3C7MA 3TOTA 4O5QA 5D9XA 3CSHA 4ML6A 4NHZA 2GDRA 2WDUA 2P5QA 3DVXA 3VK9A 3IRAA 2PUKC 2KP2A 1M99A 1XW6A 2H0IA 2B6MA 2H74A 5HFIA 4Z2RA 1Z7RA 2IFQA 4MDCA 1F3BA 4MNNA 1QFNA 4LA1A 3A5IA 6GSWA 5ECHB 3C8EA 4BL7B 1XWGA 5AIVA 4BL7A 1GNWA 4OCEA 2HRNA 3ZYWA 3LSZA 2A2RA 4ECJA 4IHUA 3V1WA 3VFIA 2R4VA 3F6DA 3KEBA 1SJ6A 1XXUA 3C73A 5L71A 3FZ5A 1B8XA 2YCDA 1K0NA 2B7KA 1XW9A 3IK9A 2ALBA 1AW9A 2I4AA 3US3A 1V58A 5J41A 3UBKA 2EIRA 1IYIA 1Z6NA 2GQLA 4WKWA 1GLPA 3LEFA 2AHEA 1VRSD 1XPVA 2WB9A 1AXDA 5KOWA 3PINA 4USSA 1EOHA 4K1FA 2QGVA 5D9VA 2R0PA 5DBQA 1TXXA 5C04A 4ECIA 1E2YA 1X5CA 3HJOA 3QMXA 5ECSA 1USBA 1VF1A 4JEDA 1QGVA 5IMZA 3L0HA 4L5LA 5BMUA 2H6YA 3GN3A 2N5BA 1MDJA 3F6FA 4BPYA 5ECNB 5A4WA 4K8MA 1GNEA 2H1AA 3IDVA 1SL0B 3PH9A 2L6DA 3D21A 1M3JA 2F3MA 1ST9A 5HFGA 1JHBA 2E0QA 2B5XA 3KXOA 1GSFA 1GUKA 1DE1A 3E0UA 4I6XA 1GSEA 1TK0B 1SD8A 2D2ZA 14GSA 4HJMA 3RPNA 4MJEA 3KTBA 3GRXA 5KOXA 5D93A 4ZL8A 4HUAA 1PFOA 5ECIB 1GL8A 1Z7PA 4ZILA 2QA1A 4ZBBA 2VAFA 4XCSA 1FAAA 5DJLA 1OE7A 1LU4A 1FW1A 4GLTA 3QFAC 1OKTA 18GSA 1B48A 2M72A 4EDYA 3Q6OA 1A2JA 2R37A 5JWRB 5J9CA 1Q4JA 2VCWA 2H70A 1A24A 3GH6A 1U3IA 4N10A 3HY2A 1GSUA 1M2BA 4L0UA 3HJPA 4GXZA 1ZYEA 4NAXA 2K18A 3UEMA 1Z5YE 2YNXA 4POLA 4WR5A 1A0RP 1TRVA 2FGXA 4OCFA 4TR0A 4KF9A 8GSSA 2R2JA 4O92A 4OFTA 2GSSA 3MAKA 1OC9A 1VGLA 2GQMA 4QL7A 1G6WA 1SK1A 4AJ8A 3L4NA 4WF4A 5IMDA 4BIKA 4IJIA 3GMFA 1ZYPA 5IPHA 2C0DA 1JFUA 4GSSA 4N0VA 3A2VA 2GZZA 4MZBA 3L78A 5CP1A 3TKRA 3QFBC 2GT5A 2VLUA 3VWVA 5JCWA 1TTZA 1G7OA 1S3RA 4E8HA 1TK5B 1PN9A 11GSA 1V9WA 3GFKA 1Y6EA 3I6AA 2F8AA 4MJCA 2TRCP 2IMIA 2H1BA 4N11A 4KUNA 4MJBA 2I81A 4MF5A 1THXA 5HR1A 1X9SB 1G6YA 4OWYA 3D4TA 2C1YA 1B9XC 3KMOA 3P8WA 5GZZB 4ID0A 1PGTA 3G7IA 4QL9A 3TKSE 4KE3A 2E7PA 2LKUA 3LORA 4Q5RA 3CRUA 2YOIA 3EMPA 4IKHA 1EV4A 1CQHA 2WJUA 2DSAA 1SJZA 3HVNA 2R0CA 2HSMA 4K9ZA 2G0FA 2IMEA 1YDKA 1XW5A 3KMNA 2V41A 4ZL9A 4MA9A 2H30A 3GKMA 3I43A 3LJRA 4K7NA 1TRSA 5ID2B 1JLWA 5D8IA 2FNOA 1Z3EA 2XBQA 3Q19A 3W8JA 1T3BA 17GSA 1SYXA 4WXTA 3TRXA 3BJ5A 3EYTA 20GSA 3DVWA 2IL3A 3GA4A 1K3OA 5A4UA 5G5EA 1XG8A 3KH7A 1ERWA 3GHAA 1U3AA 1TRWA 1XVQA 1I5GA 1SK2A 5D9TA 2YWMA 5CO3A 3LQ7A 2KP1A 4HQSA 3PGTA 1YKCA 3WD6A 5F8BA 3R3EA 2WULA 4TR4A 4OFMA 1URMA 1R5PA 2FWEA 3RDWA 2VD1A 4IS0A 3MYDA 3VPTA 4V2MA 4WBJA 4JBBA 4EUYA 3DMLA 3IE3A 5LNKe 2FLSA 3EU4A 1FVJA 3VWUA 3KTLA 22GSA 2CZ2A 2L57A 1JZWA 5G30A 2CX3A 2TIRA 3UOMA 1X5DA 3R2QA 5DDLA 1TI3A 5AISA 1UN2A 2X8CA 1BQ7A 5F0GA 2HRAA 5DQSA 4ILFA 4BWQA 2OJLA 4IN0A 2N5AA 5IPGA 1VF4A 1F9MA 4TR1B 5JWOB 3DYRA 2MMAA 2XPEA 5B8AA 4YQMA 3I69A 2V6KA 3P2AA 1QQ2A 3VI5A 4NPBA 2AV4A 4PQHA 4ZB6A 13GSA 3ZVJA 3HHVA 1F2EA 1SKRB 1FB0A 1M2DA 5D9WA 4GSNA 1OC8A 3GTUB 4J2FA 1M3IA 2JZSA 1NHYA 2DIYA 2GGTA 3IAS2 1RQMA 2LJAA 4JU5A 6GSYA 1IYHA 2FUG2 2CAQA 2HFDA 1U88A 3GTUA 4GWRA 4TKYA 4MLYA 1QUWA 2NVLA 2AYTA 5E4WA 3LW9A 1GSSA 2VM2A 2MMZA 19GSA 3H8QA 3IHQA 3A3TA 1PSQA 3TUEA 1LBKA 1A2LA 3WGEA 2BTOT 3ME8A 2H72A 3EPTA 1WJKA 4KSOA 5DVBA 2REMA 2GZYA 5J9BA 2VUPA 1UC7A 5KN1A 1ZOFA 1EOGA 3IBHA 3ZMLA 5LCZA 3ZFBA 4FYBA 4F0CA 2Z9SA 1EZKA 4JR4A 2VD0A 2IFQB 4KDXA 2HLSA 3IOSA 4EXJA 3O3TA 1GTIA 2VM1A 3FW2A 4PURA 4IP6A 2QC7A 2GQKA 1KEBA 5EL8A 2JACA 1SKWB 2LEGA 3DGQA 1B4PA 2OBKA 3PPUA 3TKQA 4MZCA 1FHEA 5ECRB 3DWVA 2XC2A 3VI7A 4HOJA 2A2PA 3E9JB 4KAEA 3D5JA 4OFNA 3O76A 2V32A 3TKSC 2FA8A 2F9SA 2HXKA 2ON5A 3L9UA 3WT1A 2YJHA 1A23A 1XOAA 3HD5A 1EV9A 2X8GA 3IR4A 3O6TA 3FZ9A 3L9VA 1ON4A 2HE3A 3TJKA 4V1Ap 3DRNA 1V57A 2P31A 3ERGA 5BRTA 3IXRA 1MDKA 4MCUA 2IMFA 2CQ9A 1CQGA 2PERA 4Q5NA 5ELGA 2MMNA 3GUSA 2DJ1A 3M9KA 2K6VA 2C3TA 5ABRA 4G9HA 5IMAA 2XBIA 2LQOA 3LWAA 3WGXA 3WT2A 2JSZA 2MZCA 1YJ6A 3D22A 4XIHA 3HXSA 1ERUA 2OKAA 3GL3A 2MBSA 5D96A 1KTEA 5FWGA 2PN8A 4TXVA 3W6GA 1GTUA 2IIYA 1TU8A 4PTSA 4WETA 2VL3A 4IQAA 3CQFA 2L4QA 2ON7A 3GKXA 2BJXA 3F4SA 1V2AA 1ABAA 5KEJA 3FR3A 4V2LA 2YWOA 3E3EA 2ZUPA 3CTGA 5CYYA 2H8LA 3IPZA 1TKDB 1EP8A 1YY7A 1QK8A 3ERWA 2IMKA 2YV7A 1T4YA 1J08A 2N5FA 3SBCA 5DJMA 2PGTA 4DSRA 1VF2A 1O85A 2XPDA 1SL2B 3UVTA 4ZB9A 3G9BA 4FH8A 5HFKA 4KNDA 3ZFLA 4V1Ag 1RK4A 1XFLA 2KOKA 4L5OA 4KW6A 2VCQA 5A5KA 10GSA 2FD3A 2RUFA 1AIUA 1GSDA 3P7XA 1R7HA 4GQCA 5C00A 3HVVA 3KJYA 2OACA 4ZBAA 1XBSA 5E59A 4Z2TA 1M7TA 2H6XA 5B7CA 1XIYA 4I8BA 5F05A 1WOUA 5G31A 4RQXA 3VWXA 3N5OA 4DEJA 3D4MA 3FYGA 4TXOB 3W8SA 4MPGA 3U5RE 3M8NA 4X1UA 4EO3A 2XHFA 4TXOA 2KLXA 1A8LA 1DUGA 2DMMA 1OE8A 2P0GA 5IO2A 2A2SA 2R5GA 4MP4A 5ENUA 2LJKA 4RUVA 4POBA 3KP8A 1ZGNA 3BBYA 1GRXA 1OC9B 5H5QA 4PNGA 1T8EB 2HSHA 2HI7A 1R5AA 3ZZXA 3DXBA 3MIXA 4ULXA 4JE1A 2YANA 4DVCA 2CT6A 5CRWA 3FZ4A 3APOA 4EDZA 4G0IA 4O5UA 2YJ7A 4AJ7A 5IIZA 3BOAA 1SKSB 1BEDA 1BJXA 1WIKA 2H0HA 1WP0A 4LLRA 5IOXA 3DIEA 1PX6A 5FHIA 1TI1A 3UMAA 1QMVA 5J4UA 4Z7XA 5CRGA 1AQVA 2LRNA 3QAVA 4CHSA 5B6NA 3HCZA 4OO5A 4NWYA 1GLQA 1SD9A 5J3RA 1K0AA 3KIJA 1T00A 2O7KA 1AQWA 2DLXA 1QXHA 5B6MA 3HKRA 4WF5A 3KM6A 2I9HA 3TKSA 1HNBA 5KN0A 4BVXB 3I9V2 3CXGA 3GIXA 3TCOA 4ACSA 4HZ4A 2WCIA 2LNSA 4BVXA 2QSIA 3DD3A 1DSBA 3M1GA 3GV1A 6GSTA 1BX9A 3NOFA 1M2AA 4FYCA 4I5QA 1T4ZA 3HVSA 5ECMB 2X99A 1SK0A 6GSUA 3SWLA 2QA2A 5IQYA 4F0BA 2GLRA 1K0DA 1FB6A 5CNWA 1O7UA 3M0FA 4F03A 4GCIA 1WPIA 3EC3A 2PPTA 1DE2A 3LYPA 1R4WA 1HYUA 4FQUA 1V98A 4IJ3A 2C3QA 1S3DA 2B3SA 4TR3A 3ZLPA 3WYWA 6GSXA 3QCPA 1AQXA 3APSA 5INYA 5DCGA 2LRTA 2E2GA 1PL1A 4K0GA 4OD7A 3ZL5A 4E8EA 2L5LA 2DJ3A 2DKHA 2M80A 3U6VA 4EC0A 3KGKA 3VLNA 1WWJA 4CDOA 1B4QA 4MF7A 5EPFA 4POKA 2OBIA 2CZ3A 2MYGA 5G5FA 5G2ZA 4O32A 2EC4A 4NHWA 4AGSA 5COHA 3HZ4A 1PKZA 3C1SA 2MBTA 3C71A 2A4VA 4F9ZA 3FZAA 1TJDA 2RIIA 3FK8A 2JZTA 2RM6A 2F51A 2AJQB 1SU9A 4TN8A 2B1LA 3RHBA 1O8XA 4HDEA 1U6TA 1XCCA 2VIMA 3PR8A 2IPAA 2FA4A 2K8SA 2V2GA 5LD0A 1N8JA 1WMJA 5JWQB 4PUAA 3S9FA 3H4KA 1YEXA 4F2IA 1M9BA 3QDNA 1XOBA 1GH2A 1FG4A 1NM3A 3MWHA 4CY8A 1TK8B 2OADA 2H0GA 4PQIA 2H19A 1Q98A 3BCIA 1GTBA 4LL1B 4RI6A 3QD9A 4WEYA 3LGCA 2C0GA 3CRTA 3LFLA 4MH3A 3MDKA 2R6KA 4EF0A 1Z6MA 2CA8A 1TP9A 4EVMA 2JSYA 5GSTA 1MD4A 4BVYB 3J7Yk 3H79A 4Z2UA 1OC3A 2GSQA 2B1KA 3F3RA 1KBNA 4PX1A 1EEJA 3VURA 2DJ2A 4NV2A 1F37A 4P3YB 4ZB8A 5ECLB 1TRUA 4BVYA 1ERVA 3NZNA 1T1VA 2IN3A 1YKAA 2K9FA 3HYPA 1H75A 3EMXA 3FY7A 3QR6A 1MD3A 2EIOA 2NTOA 4I2TA 4K2DA 2VL9A 4ECBA 4GRFA 4ZL7A 2O85A 5DQYA 3TGZA 1U87A 5IMFA 3RHCA 2YWNA 4IQ1A 2LNTA 3LXTA 4MK3A 4X43A 4JZQA 2WFCA 1R26A 2DKIA 3IC8A 2WRTA 4XS6A 4GSTA 2PU9C 3QPMA 2JU5A 4KB3A 5AN1A 3UAPA 4EIQA 4JRRA 3UJ1A 3F4TA 4G10A 1XWAA 3KP9A 2PVOC 4GF0A 5EVOA 1BYEA 5CRDA 1V40A 2M46A 2VL2C 4K5RA 1C72A 2GTUA 1WRYA 4HU9A 5DALA 4I2UA 2DIZA 2IMDA 4IGJA 5AIXA 5AGYA 3JCML 4Q5QA 1HD2A 2YZUA 4K0NA 3H1NA 3IAM2 5CRHA 4KCAA 5KN2A 2YZHA 3LYKA 2YN1A 2HZEA 5HQPA 4FYUA 3HJMA 1B9YC 3EU3A 4EKZA 2YP6A 1AC1A 1HQOA 4AJ6A 2C3NA 4QQ7A 4TRXA 4ZBDA 1TDIA 3F4RA 3G7YA 1ZYQB 2UZ8A 4WR4A 4IELA 4ECCA 2HRFA 3ZRDA 1ACVA 4TVEA 1YF0A 2H76A 4YQUA 2X49A 5ECKB
chains in the Genus database with same CATH topology
1K3YA 4A5PA 2VOCA 4J56E 2O8VB 4K6XA 1AAZA 4DSSB 4ISDA 4GTUA 4YKGA 2DJJA 2WZ9A 1OYJA 1YF1A 4DSSA 2TRXA 4X4JA 1ZCPA 1G7EA 4BA7A 2HRKA 1ILOA 1TU7A 3GX0A 2VCVA 2YPMA 4FO5A 4EE0A 3M3MA 1XWKA 2QKEA 2X4AA 7GSSA 4PXOA 2DJ0A 2JZRA 1LJRA 2AUVA 4TW5A 5IMCA 3F8UA 2FWGA 5G1KA 1JLVA 3QAWA 5ECQB 3FRCA 4HS1A 3ZTLA 2LQQA 4V2NA 2MMOA 2V6OA 3LG6A 5A4VA 4YH2A 4KCEA 2CAIA 4G0LA 1EWXA 3F9UA 4MABA 4CY6A 2OE3A 4EL1A 1K0CA 1RW1A 3KZQA 4XS1A 1PL2A 2LV3A 1SJIA 2CV4A 2VCTA 2KHPA 2DC5A 2OE0A 1M0UA 2WGRA 2H1DA 3C1RA 1PD21 3P90A 4AF2A 4RI7A 4HU7A 3FHKA 2GSRA 2DMLA 1I9DA 4KH7A 2JADA 4D73B 1PQNA 1X9WB 3FEUA 4NXIA 1EEMA 1KNGA 3APQA 4LMWA 1SENA 4XHMA 4OO4A 1S3CA 4D73A 1GWCA 5H5SA 3HA9A 2LS5A 4ICYA 4GQFA 3G7JA 4G2EA 3CMIA 5GAND 4MMMA 1SYRA 2GS3A 12GSA 1ZZYA 3ZREA 5IO0A 6GSVA 5G1LA 1K0MA 3EE2A 2IWTA 3HDCA 3Q18A 2C4JA 4G19A 2PMTA 2KUCA 4KA0A 1Z9HA 2EIQA 3UVHA 2ZNMA 4CW9A 3D6IA 2CVKA 5IMVA 3RBTA 4DSQA 3F63A 1GULA 3TOUA 1M9AA 3RPPA 3TJBA 5IM9A 2LSTA 1O8WA 1DBYA 3CTFA 1F6MC 1X9MB 2ZCTA 3OR5A 4PQ1A 2H75A 5GAPD 4K7IA 1MEKA 2B7JA 2YV9A 1J9BA 4NV5A 5EY6A 2X64A 1GSYA 1PMTA 2HZFA 4N30A 5CREA 4IVFA 3GX8A 3FMWA 1HNCA 1OKDA 1FO5A 3TKPA 2AB6A 3ISOA 3IV4A 4FIWA 2G2QA 2VL2A 4MPFA 4IW9A 3GSSA 2NBSA 1SL1B 1K0BA 4YAPA 4HQZA 2B5EA 3KH9A 2HNLA 1O73A 4O5RA 3GSTA 2BMXA 4KSMA 3F3QA 4PGTA 5FT3A 1W4VA 2O87A 1K0OA 4J57E 1OAZA 3TB2A 3GKNA 2O89A 1OVNA 4IBPA 4XTSA 2FY6A 3HVXA 5HR2A 5JCGA 3RAZA 1PN0A 3UL3A 1UVZA 1ZL9A 2H01A 3IHGA 3M9JA 4I97A 1JZRA 3UARA 4XS4B 1XWBA 1PRXA 3BD2A 1A0FA 4H86A 5CAXA 3H93A 2AAWA 2GZPA 4XS4A 2H6ZA 3IC4A 1GUMA 3CYNA 4OMVA 5ELAA 2H73A 4KGIA 3QOUA 3D0ZA 1H4OA 2PWJA 2PVQA 4HZ2A 3IK7A 3UIWA 1NSWA 4ZXGA 2E2MA 1GSQA 1EGOA 3KD0A 2R3XA 3FR6A 1AUCA 4ZIJA 3N9JA 4IP1A 2FCHA 2I1UA 3AY8A 1ZMAA 1G0TA 4HEA2 3K8NA 3DKSA 1F3AA 3TJGA 2LTKA 4PNFA 4EIPA 2H71A 1ML6A 1EP7A 4K2XA 4MZWA 1XVWA 4POMA 2V1MA 2L6CA 3L9SA 5KN3A 3KCMA 4XRAA 2VCZA 5ECPB 2LUSA 5DAKB 1XZOA 4YAVA 3EVIA 1BG5A 3CSJA 1UA5A 4WBRD 4NMUA 5JCUA 5DAKA 16GSA 5IOWA 4KDYA 2A4HA 3TRPA 2NPBA 4X0XA 5ID2A 3J7Yb 3Q74A 4G0KA 3MNGA 3ZITA 1MTCA 4RQRA 3GKKA 4O7HA 5HR0A 3TJFA 1A2MA 1ZYNA 2JL4A 4MH2A 4LL4B 1NHOA 1YEPA 3IA1A 3ZIVA 4BWSA 2CVBA 1E6BA 2HSYA 2RUEA 2L4CA 3ERFA 2GT6A 4YKFA 2I3YA 4PUFC 2X8HA 4MF6A 3EINA 2DBCA 3TRQA 4K7OA 3FKFA 1YZXA 4N0ZA 3A2XA 4XRDA 2C8UA 3ZIJA 2VCXA 2R0GA 3GNJA 3GH9A 2B5YA 2GVPA 3ME7A 1O81A 2IJYA 2J23A 3F0IA 4KX4A 1EGRA 2WS2A 3FR9A 1VF3A 2LJRA 3CBUA 5GSSA 2L59A 3WGDA 3ZMKA 4HI7A 2CVDA 3CSIA 4YQVA 1PKWA 2RM5A 3LXZA 5H5RA 3GYKA 2F8FA 2C80A 1PX7A 1NW2A 2CX4A 2RLIA 2VLTA 2PBJA 3QAGA 1W89A 2L5OA 1T7PB 3NIVA 1J0FA 1X0RA 3UBLA 1WE0A 2H1GA 2VLVA 2HYXA 4LMVA 1GUHA 4MJAA 3A2WA 4L8EA 5ECOB 2YWIA 1X5EA 1TW9A 3EWLA 1HNAA 5F06A 3ZVJD 3GURA 2OE1A 5D73A 2LRCA 5DCHA 2OA7A 3VWWA 4L0WA 2HT9A 3VPQA 2C0EA 3MSZA 4K5SA 3TJJA 3BCKA 2J9HA 1FOHA 1YQ1A 5F07A 4TR1A 2H66A 2C0FA 1GP1A 1K3LA 1FVKA 3TDGA 4Q5FA 4F82A 1N2AA 1S3AA 2FHEA 3GL5A 1XWCA 1O6JA 2K8VA 5J5NA 3DEXA 2FWFA 5HR3A 6GSSA 2GSTA 2NDOA 1ERTA 3HZ8A 1JZDA 1GTAA 9GSSA 5B8BA 4ML1A 4HJ2A 4TOPA 1JZOA 3ED3A 2ES7A 3EURA 1PA3A 1Y25A 1A8YA 1BAYA 1MDIA 5DALB 2DJKA 4JR6A 2FWHA 1TOFA 3A5WA 1THOA 2VO4A 4KDUA 1FOVA 2HZEB 2P5RA 3C7MA 3TOTA 4O5QA 5D9XA 3CSHA 4ML6A 4NHZA 2GDRA 2WDUA 2P5QA 3DVXA 3VK9A 3IRAA 2PUKC 2KP2A 1M99A 1XW6A 2H0IA 2B6MA 2H74A 5HFIA 4Z2RA 1Z7RA 2IFQA 4MDCA 1F3BA 4MNNA 1QFNA 4LA1A 3A5IA 6GSWA 5ECHB 3C8EA 4BL7B 1XWGA 5AIVA 4BL7A 1GNWA 4OCEA 2HRNA 3ZYWA 3LSZA 2A2RA 4ECJA 4IHUA 3V1WA 3VFIA 2R4VA 3F6DA 3KEBA 1SJ6A 1XXUA 3C73A 5L71A 3FZ5A 1B8XA 2YCDA 1K0NA 2B7KA 1XW9A 3IK9A 2ALBA 1AW9A 2I4AA 3US3A 1V58A 5J41A 3UBKA 2EIRA 1IYIA 1Z6NA 2GQLA 4WKWA 1GLPA 3LEFA 2AHEA 1VRSD 1XPVA 2WB9A 1AXDA 5KOWA 3PINA 4USSA 1EOHA 4K1FA 2QGVA 5D9VA 2R0PA 5DBQA 1TXXA 5C04A 4ECIA 1E2YA 1X5CA 3HJOA 3QMXA 5ECSA 1USBA 1VF1A 4JEDA 1QGVA 5IMZA 3L0HA 4L5LA 5BMUA 2H6YA 3GN3A 2N5BA 1MDJA 3F6FA 4BPYA 5ECNB 5A4WA 4K8MA 1GNEA 2H1AA 3IDVA 1SL0B 3PH9A 2L6DA 3D21A 2F3MA 1ST9A 5HFGA 1JHBA 2E0QA 2B5XA 3KXOA 1GSFA 1GUKA 1DE1A 3E0UA 4I6XA 1GSEA 1TK0B 1SD8A 2D2ZA 14GSA 4HJMA 3RPNA 4MJEA 3KTBA 3GRXA 5KOXA 5D93A 4ZL8A 4HUAA 5ECIB 1GL8A 1Z7PA 4ZILA 2QA1A 4ZBBA 2VAFA 4XCSA 1FAAA 5DJLA 1OE7A 1LU4A 1FW1A 4GLTA 3QFAC 1OKTA 18GSA 1B48A 2M72A 4EDYA 3Q6OA 1A2JA 2R37A 5JWRB 5J9CA 1Q4JA 2VCWA 2H70A 1A24A 3GH6A 1U3IA 4N10A 3HY2A 1GSUA 1M2BA 4L0UA 3HJPA 4GXZA 1ZYEA 4NAXA 2K18A 3UEMA 1Z5YE 2YNXA 4POLA 4WR5A 1A0RP 1TRVA 2FGXA 4OCFA 4TR0A 4KF9A 8GSSA 2R2JA 4O92A 4OFTA 2GSSA 3MAKA 1OC9A 1VGLA 2GQMA 4QL7A 1G6WA 1SK1A 4AJ8A 3L4NA 4WF4A 5IMDA 4IJIA 3GMFA 1ZYPA 5IPHA 2C0DA 1JFUA 4GSSA 4N0VA 3A2VA 2GZZA 4MZBA 3L78A 5CP1A 3TKRA 3QFBC 2GT5A 2VLUA 3VWVA 5JCWA 1TTZA 1G7OA 4E8HA 1TK5B 1PN9A 11GSA 1V9WA 3GFKA 1Y6EA 3I6AA 2F8AA 4MJCA 2TRCP 2IMIA 2H1BA 4N11A 4KUNA 4MJBA 2I81A 4MF5A 1THXA 5HR1A 1X9SB 1G6YA 4OWYA 3D4TA 2C1YA 1B9XC 3KMOA 3P8WA 5GZZB 4ID0A 1PGTA 3G7IA 4QL9A 3TKSE 4KE3A 2E7PA 2LKUA 3LORA 4Q5RA 3CRUA 2YOIA 3EMPA 4IKHA 1EV4A 1CQHA 2WJUA 2DSAA 1SJZA 2R0CA 2HSMA 4K9ZA 2G0FA 2IMEA 1YDKA 1XW5A 3KMNA 2V41A 4ZL9A 4MA9A 2H30A 3GKMA 3I43A 3LJRA 4K7NA 1TRSA 5ID2B 1JLWA 5D8IA 2FNOA 1Z3EA 2XBQA 3Q19A 3W8JA 1T3BA 17GSA 1SYXA 4WXTA 3TRXA 3BJ5A 3EYTA 20GSA 3DVWA 2IL3A 3GA4A 1K3OA 5A4UA 5G5EA 3KH7A 1ERWA 3GHAA 1U3AA 1TRWA 1XVQA 1I5GA 1SK2A 5D9TA 2YWMA 5CO3A 3LQ7A 2KP1A 4HQSA 3PGTA 1YKCA 3WD6A 5F8BA 3R3EA 2WULA 4TR4A 4OFMA 1URMA 1R5PA 2FWEA 3RDWA 2VD1A 4IS0A 3MYDA 3VPTA 4V2MA 4WBJA 4JBBA 4EUYA 3DMLA 3IE3A 5LNKe 2FLSA 3EU4A 1FVJA 3VWUA 3KTLA 22GSA 2CZ2A 2L57A 1JZWA 5G30A 2CX3A 2TIRA 3UOMA 1X5DA 3R2QA 5DDLA 1TI3A 5AISA 1UN2A 2X8CA 1BQ7A 5F0GA 2HRAA 5DQSA 4ILFA 4BWQA 2OJLA 4IN0A 2N5AA 5IPGA 1VF4A 1F9MA 4TR1B 5JWOB 3DYRA 2MMAA 2XPEA 5B8AA 4YQMA 3I69A 2V6KA 3P2AA 1QQ2A 3VI5A 4NPBA 2AV4A 4PQHA 4ZB6A 13GSA 3ZVJA 3HHVA 1F2EA 1SKRB 1FB0A 1M2DA 5D9WA 4GSNA 1OC8A 3GTUB 4J2FA 2JZSA 1NHYA 2DIYA 2GGTA 3IAS2 1RQMA 2LJAA 4JU5A 6GSYA 1IYHA 2FUG2 2CAQA 2HFDA 1U88A 3GTUA 4GWRA 4TKYA 4MLYA 1QUWA 2NVLA 2AYTA 5E4WA 3LW9A 1GSSA 2VM2A 2MMZA 19GSA 3H8QA 3IHQA 3A3TA 1PSQA 3TUEA 1LBKA 1A2LA 3WGEA 2BTOT 3ME8A 2H72A 3EPTA 1WJKA 4KSOA 5DVBA 2REMA 2GZYA 5J9BA 2VUPA 1UC7A 5KN1A 1ZOFA 1EOGA 3IBHA 3ZMLA 5LCZA 3ZFBA 4FYBA 4F0CA 2Z9SA 1EZKA 4JR4A 2VD0A 2IFQB 4KDXA 2HLSA 3IOSA 4EXJA 3O3TA 1GTIA 2VM1A 3FW2A 4PURA 4IP6A 2QC7A 2GQKA 1KEBA 5EL8A 2JACA 1SKWB 2LEGA 3DGQA 1B4PA 2OBKA 3PPUA 3TKQA 4MZCA 1FHEA 5ECRB 3DWVA 2XC2A 3VI7A 4HOJA 2A2PA 3E9JB 4KAEA 3D5JA 4OFNA 3O76A 2V32A 3TKSC 2FA8A 2F9SA 2HXKA 2ON5A 3L9UA 3WT1A 2YJHA 1A23A 1XOAA 3HD5A 1EV9A 2X8GA 3IR4A 3O6TA 3FZ9A 3L9VA 1ON4A 2HE3A 3TJKA 4V1Ap 3DRNA 1V57A 2P31A 3ERGA 5BRTA 3IXRA 1MDKA 4MCUA 2IMFA 2CQ9A 1CQGA 2PERA 4Q5NA 5ELGA 2MMNA 3GUSA 2DJ1A 3M9KA 2K6VA 2C3TA 5ABRA 4G9HA 5IMAA 2XBIA 2LQOA 3LWAA 3WGXA 3WT2A 2JSZA 2MZCA 1YJ6A 3D22A 4XIHA 3HXSA 1ERUA 2OKAA 3GL3A 2MBSA 5D96A 1KTEA 5FWGA 2PN8A 4TXVA 3W6GA 1GTUA 2IIYA 1TU8A 4PTSA 4WETA 2VL3A 4IQAA 2L4QA 2ON7A 3GKXA 2BJXA 3F4SA 1V2AA 1ABAA 5KEJA 3FR3A 4V2LA 2YWOA 3E3EA 2ZUPA 3CTGA 5CYYA 2H8LA 3IPZA 1TKDB 1EP8A 1YY7A 1QK8A 3ERWA 2IMKA 2YV7A 1T4YA 1J08A 2N5FA 3SBCA 5DJMA 2PGTA 4DSRA 1VF2A 1O85A 2XPDA 1SL2B 3UVTA 4ZB9A 3G9BA 4FH8A 5HFKA 4KNDA 3ZFLA 4V1Ag 1RK4A 1XFLA 2KOKA 4L5OA 4KW6A 2VCQA 5A5KA 10GSA 2FD3A 2RUFA 1AIUA 1GSDA 3P7XA 1R7HA 4GQCA 5C00A 3HVVA 3KJYA 2OACA 4ZBAA 1XBSA 5E59A 4Z2TA 1M7TA 2H6XA 5B7CA 1XIYA 4I8BA 5F05A 1WOUA 5G31A 4RQXA 3VWXA 3N5OA 4DEJA 3D4MA 3FYGA 4TXOB 3W8SA 4MPGA 3U5RE 3M8NA 4X1UA 4EO3A 2XHFA 4TXOA 2KLXA 1A8LA 1DUGA 2DMMA 1OE8A 2P0GA 5IO2A 2A2SA 2R5GA 4MP4A 5ENUA 2LJKA 4RUVA 4POBA 3KP8A 1ZGNA 3BBYA 1GRXA 1OC9B 5H5QA 4PNGA 1T8EB 2HSHA 2HI7A 1R5AA 3ZZXA 3DXBA 3MIXA 4ULXA 4JE1A 2YANA 4DVCA 2CT6A 5CRWA 3FZ4A 3APOA 4EDZA 4G0IA 4O5UA 2YJ7A 4AJ7A 5IIZA 3BOAA 1SKSB 1BEDA 1BJXA 1WIKA 2H0HA 1WP0A 4LLRA 5IOXA 3DIEA 1PX6A 5FHIA 1TI1A 3UMAA 1QMVA 5J4UA 4Z7XA 5CRGA 1AQVA 2LRNA 3QAVA 4CHSA 5B6NA 3HCZA 4OO5A 4NWYA 1GLQA 1SD9A 5J3RA 1K0AA 3KIJA 1T00A 2O7KA 1AQWA 2DLXA 1QXHA 5B6MA 3HKRA 4WF5A 3KM6A 2I9HA 3TKSA 1HNBA 5KN0A 4BVXB 3I9V2 3CXGA 3GIXA 3TCOA 4ACSA 4HZ4A 2WCIA 2LNSA 4BVXA 2QSIA 3DD3A 1DSBA 3M1GA 3GV1A 6GSTA 1BX9A 3NOFA 1M2AA 4FYCA 4I5QA 1T4ZA 3HVSA 5ECMB 2X99A 1SK0A 6GSUA 3SWLA 2QA2A 5IQYA 4F0BA 2GLRA 1K0DA 1FB6A 5CNWA 1O7UA 3M0FA 4F03A 4GCIA 1WPIA 3EC3A 2PPTA 1DE2A 3LYPA 1R4WA 1HYUA 4FQUA 1V98A 4IJ3A 2C3QA 1S3DA 2B3SA 4TR3A 3ZLPA 3WYWA 6GSXA 3QCPA 1AQXA 3APSA 5INYA 5DCGA 2LRTA 2E2GA 1PL1A 4K0GA 4OD7A 3ZL5A 4E8EA 2L5LA 2DJ3A 2DKHA 2M80A 3U6VA 4EC0A 3KGKA 3VLNA 1WWJA 4CDOA 1B4QA 4MF7A 5EPFA 4POKA 2OBIA 2CZ3A 2MYGA 5G5FA 5G2ZA 4O32A 2EC4A 4NHWA 4AGSA 5COHA 3HZ4A 1PKZA 3C1SA 2MBTA 3C71A 2A4VA 4F9ZA 3FZAA 1TJDA 2RIIA 3FK8A 2JZTA 2RM6A 2F51A 2AJQB 1SU9A 4TN8A 2B1LA 3RHBA 1O8XA 1U6TA 4HDEA 1XCCA 2VIMA 3PR8A 2IPAA 2FA4A 2K8SA 2V2GA 5LD0A 1N8JA 1WMJA 5JWQB 4PUAA 3S9FA 3H4KA 1YEXA 4F2IA 1M9BA 3QDNA 1XOBA 1GH2A 1FG4A 1NM3A 3MWHA 4CY8A 1TK8B 2OADA 2H0GA 4PQIA 2H19A 1Q98A 3BCIA 1GTBA 4LL1B 4RI6A 3QD9A 4WEYA 3LGCA 2C0GA 3CRTA 3LFLA 4MH3A 3MDKA 2R6KA 4EF0A 1Z6MA 2CA8A 1TP9A 4EVMA 2JSYA 5GSTA 1MD4A 4BVYB 3J7Yk 3H79A 4Z2UA 1OC3A 2GSQA 2B1KA 3F3RA 1KBNA 4PX1A 1EEJA 3VURA 2DJ2A 4NV2A 1F37A 4P3YB 4ZB8A 5ECLB 1TRUA 4BVYA 1ERVA 3NZNA 1T1VA 2IN3A 1YKAA 2K9FA 3HYPA 1H75A 3EMXA 3FY7A 3QR6A 1MD3A 2EIOA 2NTOA 4I2TA 4K2DA 2VL9A 4ECBA 4GRFA 4ZL7A 2O85A 5DQYA 3TGZA 1U87A 5IMFA 3RHCA 2YWNA 4IQ1A 2LNTA 3LXTA 4MK3A 4X43A 4JZQA 2WFCA 1R26A 2DKIA 3IC8A 2WRTA 4XS6A 4GSTA 2PU9C 3QPMA 2JU5A 4KB3A 5AN1A 3UAPA 4EIQA 4JRRA 3UJ1A 3F4TA 4G10A 1XWAA 3KP9A 2PVOC 4GF0A 5EVOA 1BYEA 5CRDA 1V40A 2M46A 2VL2C 4K5RA 1C72A 2GTUA 1WRYA 4HU9A 5DALA 4I2UA 2DIZA 2IMDA 4IGJA 5AIXA 5AGYA 3JCML 4Q5QA 1HD2A 2YZUA 4K0NA 3H1NA 3IAM2 5CRHA 4KCAA 5KN2A 2YZHA 3LYKA 2YN1A 2HZEA 5HQPA 4FYUA 3HJMA 1B9YC 3EU3A 4EKZA 2YP6A 1AC1A 1HQOA 4AJ6A 2C3NA 4QQ7A 4TRXA 4ZBDA 1TDIA 3F4RA 3G7YA 1ZYQB 2UZ8A 4WR4A 4IELA 4ECCA 2HRFA 3ZRDA 1ACVA 4TVEA 1YF0A 2H76A 4YQUA 2X49A 5ECKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3Y A;  2VOC A;  4J56 E;  2O8V B;  4K6X A;  1AAZ A;  4DSS B;  4ISD A;  4GTU A;  2DJJ A;  2WZ9 A;  1OYJ A;  1YF1 A;  4DSS A;  2TRX A;  1ZCP A;  1G7E A;  4BA7 A;  1ILO A;  1TU7 A;  3GX0 A;  2VCV A;  2YPM A;  4FO5 A;  4EE0 A;  3M3M A;  1XWK A;  2QKE A;  7GSS A;  4PXO A;  2DJ0 A;  2JZR A;  1LJR A;  2AUV A;  4TW5 A;  5IMC A;  3F8U A;  2FWG A;  5G1K A;  1JLV A;  3QAW A;  5ECQ B;  3FRC A;  4HS1 A;  3ZTL A;  2LQQ A;  4V2N A;  2MMO A;  2V6O A;  3LG6 A;  5A4V A;  4YH2 A;  4KCE A;  2CAI A;  1EWX A;  3F9U A;  4MAB A;  2OE3 A;  4EL1 A;  1K0C A;  1RW1 A;  3KZQ A;  4XS1 A;  1PL2 A;  2LV3 A;  1SJI A;  2CV4 A;  2VCT A;  2KHP A;  2DC5 A;  2OE0 A;  1M0U A;  2WGR A;  2H1D A;  3C1R A;  1PD2 1;  3P90 A;  4AF2 A;  4RI7 A;  4HU7 A;  3FHK A;  2GSR A;  2DML A;  1I9D A;  4KH7 A;  2JAD A;  4D73 B;  1PQN A;  1X9W B;  3FEU A;  4NXI A;  1EEM A;  1KNG A;  3APQ A;  4LMW A;  1SEN A;  4XHM A;  4OO4 A;  1S3C A;  4D73 A;  1GWC A;  5H5S A;  3HA9 A;  2LS5 A;  4GQF A;  3G7J A;  4G2E A;  3CMI A;  5GAN D;  4MMM A;  1SYR A;  2GS3 A;  12GS A;  1ZZY A;  3ZRE A;  5IO0 A;  6GSV A;  5G1L A;  1K0M A;  3EE2 A;  2IWT A;  3HDC A;  3Q18 A;  2C4J A;  4G19 A;  2PMT A;  2KUC A;  4KA0 A;  1Z9H A;  2EIQ A;  3UVH A;  2ZNM A;  4CW9 A;  3D6I A;  2CVK A;  5IMV A;  3RBT A;  4DSQ A;  3F63 A;  1GUL A;  3TOU A;  1M9A A;  3RPP A;  3TJB A;  5IM9 A;  2LST A;  1O8W A;  1DBY A;  3CTF A;  1F6M C;  1X9M B;  2ZCT A;  3OR5 A;  4PQ1 A;  2H75 A;  5GAP D;  4K7I A;  1MEK A;  2B7J A;  2YV9 A;  1J9B A;  4NV5 A;  5EY6 A;  2X64 A;  1GSY A;  1PMT A;  2HZF A;  4N30 A;  5CRE A;  4IVF A;  3GX8 A;  1HNC A;  1OKD A;  1FO5 A;  3TKP A;  2AB6 A;  3ISO A;  3IV4 A;  4FIW A;  2G2Q A;  2VL2 A;  4MPF A;  4IW9 A;  3GSS A;  2NBS A;  1SL1 B;  1K0B A;  4YAP A;  4HQZ A;  2B5E A;  3KH9 A;  2HNL A;  1O73 A;  4O5R A;  3GST A;  2BMX A;  4KSM A;  3F3Q A;  4PGT A;  5FT3 A;  1W4V A;  2O87 A;  1K0O A;  4J57 E;  1OAZ A;  3TB2 A;  3GKN A;  2O89 A;  1OVN A;  4IBP A;  4XTS A;  2FY6 A;  3HVX A;  5HR2 A;  5JCG A;  3RAZ A;  3UL3 A;  1UVZ A;  1ZL9 A;  2H01 A;  3M9J A;  4I97 A;  1JZR A;  3UAR A;  4XS4 B;  1XWB A;  1PRX A;  3BD2 A;  1A0F A;  4H86 A;  5CAX A;  3H93 A;  2AAW A;  2GZP A;  4XS4 A;  2H6Z A;  3IC4 A;  1GUM A;  3CYN A;  4OMV A;  5ELA A;  2H73 A;  4KGI A;  3QOU A;  3D0Z A;  1H4O A;  2PWJ A;  2PVQ A;  4HZ2 A;  3IK7 A;  3UIW A;  1NSW A;  4ZXG A;  2E2M A;  1GSQ A;  1EGO A;  3KD0 A;  2R3X A;  3FR6 A;  1AUC A;  4ZIJ A;  3N9J A;  4IP1 A;  2FCH A;  2I1U A;  3AY8 A;  1ZMA A;  1G0T A;  4HEA 2;  3K8N A;  3DKS A;  1F3A A;  3TJG A;  2LTK A;  4PNF A;  2H71 A;  1ML6 A;  1EP7 A;  4MZW A;  1XVW A;  4POM A;  2V1M A;  2L6C A;  3L9S A;  5KN3 A;  3KCM A;  4XRA A;  2VCZ A;  5ECP B;  2LUS A;  5DAK B;  1XZO A;  4YAV A;  3EVI A;  1BG5 A;  3CSJ A;  1UA5 A;  4WBR D;  4NMU A;  5JCU A;  5DAK A;  16GS A;  5IOW A;  4KDY A;  3TRP A;  2NPB A;  4X0X A;  5ID2 A;  3J7Y b;  3Q74 A;  3MNG A;  3ZIT A;  1MTC A;  4RQR A;  3GKK A;  4O7H A;  5HR0 A;  3TJF A;  1A2M A;  2JL4 A;  4MH2 A;  4LL4 B;  1NHO A;  1YEP A;  3IA1 A;  3ZIV A;  4BWS A;  2CVB A;  1E6B A;  2HSY A;  2RUE A;  2L4C A;  3ERF A;  2GT6 A;  2I3Y A;  4PUF C;  2X8H A;  4MF6 A;  3EIN A;  2DBC A;  3TRQ A;  4K7O A;  3FKF A;  1YZX A;  4N0Z A;  3A2X A;  4XRD A;  2C8U A;  3ZIJ A;  2VCX A;  3GNJ A;  3GH9 A;  2B5Y A;  2GVP A;  3ME7 A;  1O81 A;  2IJY A;  2J23 A;  3F0I A;  4KX4 A;  1EGR A;  2WS2 A;  3FR9 A;  1VF3 A;  2LJR A;  3CBU A;  5GSS A;  2L59 A;  3WGD A;  3ZMK A;  4HI7 A;  2CVD A;  3CSI A;  4YQV A;  1PKW A;  2RM5 A;  3LXZ A;  5H5R A;  3GYK A;  2F8F A;  2C80 A;  1PX7 A;  1NW2 A;  2CX4 A;  2RLI A;  2VLT A;  2PBJ A;  3QAG A;  1W89 A;  2L5O A;  1T7P B;  3NIV A;  1J0F A;  1X0R A;  3UBL A;  1WE0 A;  2H1G A;  2VLV A;  2HYX A;  4LMV A;  1GUH A;  4MJA A;  3A2W A;  4L8E A;  5ECO B;  2YWI A;  1X5E A;  1TW9 A;  3EWL A;  1HNA A;  5F06 A;  3ZVJ D;  3GUR A;  2OE1 A;  5D73 A;  2LRC A;  5DCH A;  2OA7 A;  3VWW A;  4L0W A;  2HT9 A;  3VPQ A;  2C0E A;  3MSZ A;  3TJJ A;  3BCK A;  2J9H A;  1YQ1 A;  5F07 A;  4TR1 A;  2H66 A;  2C0F A;  1GP1 A;  1K3L A;  1FVK A;  3TDG A;  4Q5F A;  4F82 A;  1N2A A;  1S3A A;  2FHE A;  3GL5 A;  1XWC A;  1O6J A;  2K8V A;  5J5N A;  3DEX A;  2FWF A;  5HR3 A;  6GSS A;  2GST A;  2NDO A;  1ERT A;  3HZ8 A;  1JZD A;  1GTA A;  9GSS A;  5B8B A;  4ML1 A;  4HJ2 A;  4TOP A;  1JZO A;  3ED3 A;  2ES7 A;  3EUR A;  1PA3 A;  1Y25 A;  1A8Y A;  1BAY A;  1MDI A;  5DAL B;  2DJK A;  4JR6 A;  2FWH A;  1TOF A;  3A5W A;  1THO A;  2VO4 A;  4KDU A;  1FOV A;  2HZE B;  2P5R A;  3C7M A;  3TOT A;  5D9X A;  3CSH A;  4ML6 A;  4NHZ A;  2GDR A;  2WDU A;  2P5Q A;  3DVX A;  3VK9 A;  3IRA A;  2PUK C;  2KP2 A;  1M99 A;  1XW6 A;  2H0I A;  2B6M A;  2H74 A;  5HFI A;  1Z7R A;  2IFQ A;  4MDC A;  1F3B A;  1QFN A;  4LA1 A;  6GSW A;  5ECH B;  3C8E A;  1XWG A;  5AIV A;  4BL7 A;  1GNW A;  4OCE A;  2HRN A;  3ZYW A;  3LSZ A;  2A2R A;  4ECJ A;  4IHU A;  3V1W A;  3VFI A;  2R4V A;  3F6D A;  3KEB A;  1SJ6 A;  1XXU A;  3C73 A;  5L71 A;  3FZ5 A;  1B8X A;  2YCD A;  1K0N A;  2B7K A;  1XW9 A;  3IK9 A;  2ALB A;  1AW9 A;  2I4A A;  3US3 A;  1V58 A;  5J41 A;  3UBK A;  2EIR A;  1IYI A;  1Z6N A;  2GQL A;  4WKW A;  1GLP A;  3LEF A;  2AHE A;  1VRS D;  1XPV A;  2WB9 A;  1AXD A;  3PIN A;  1EOH A;  4K1F A;  2QGV A;  5D9V A;  5DBQ A;  1TXX A;  5C04 A;  4ECI A;  1E2Y A;  1X5C A;  3HJO A;  3QMX A;  5ECS A;  1USB A;  1VF1 A;  4JED A;  1QGV A;  5IMZ A;  3L0H A;  4L5L A;  2H6Y A;  3GN3 A;  2N5B A;  1MDJ A;  3F6F A;  4BPY A;  5ECN B;  5A4W A;  4K8M A;  1GNE A;  2H1A A;  3IDV A;  1SL0 B;  3PH9 A;  2L6D A;  3D21 A;  2F3M A;  1ST9 A;  5HFG A;  1JHB A;  2E0Q A;  2B5X A;  3KXO A;  1GSF A;  1GUK A;  1DE1 A;  3E0U A;  4I6X A;  1GSE A;  1TK0 B;  1SD8 A;  2D2Z A;  14GS A;  4HJM A;  3RPN A;  4MJE A;  3KTB A;  3GRX A;  5D93 A;  4ZL8 A;  4HUA A;  5ECI B;  1GL8 A;  1Z7P A;  4ZIL A;  4ZBB A;  2VAF A;  4XCS A;  5DJL A;  1FAA A;  1OE7 A;  1LU4 A;  1FW1 A;  4GLT A;  3QFA C;  1OKT A;  18GS A;  1B48 A;  2M72 A;  4EDY A;  3Q6O A;  1A2J A;  2R37 A;  5JWR B;  5J9C A;  1Q4J A;  2VCW A;  2H70 A;  1A24 A;  3GH6 A;  1U3I A;  4N10 A;  3HY2 A;  1GSU A;  1M2B A;  4L0U A;  3HJP A;  4GXZ A;  1ZYE A;  4NAX A;  2K18 A;  3UEM A;  1Z5Y E;  2YNX A;  4POL A;  4WR5 A;  1A0R P;  1TRV A;  2FGX A;  4OCF A;  4TR0 A;  8GSS A;  2R2J A;  4O92 A;  4OFT A;  2GSS A;  3MAK A;  1OC9 A;  1VGL A;  2GQM A;  4QL7 A;  1G6W A;  1SK1 A;  4AJ8 A;  3L4N A;  4WF4 A;  5IMD A;  4IJI A;  3GMF A;  5IPH A;  2C0D A;  1JFU A;  4GSS A;  4N0V A;  3A2V A;  2GZZ A;  4MZB A;  3L78 A;  5CP1 A;  3TKR A;  3QFB C;  2GT5 A;  2VLU A;  3VWV A;  5JCW A;  1TTZ A;  1G7O A;  4E8H A;  1TK5 B;  1PN9 A;  11GS A;  1V9W A;  3GFK A;  1Y6E A;  3I6A A;  2F8A A;  4MJC A;  2TRC P;  2IMI A;  2H1B A;  4N11 A;  4KUN A;  4MJB A;  2I81 A;  4MF5 A;  1THX A;  5HR1 A;  1X9S B;  1G6Y A;  4OWY A;  3D4T A;  2C1Y A;  1B9X C;  3KMO A;  3P8W A;  5GZZ B;  4ID0 A;  1PGT A;  3G7I A;  4QL9 A;  3TKS E;  4KE3 A;  2E7P A;  2LKU A;  3LOR A;  4Q5R A;  3CRU A;  2YOI A;  3EMP A;  4IKH A;  1EV4 A;  1CQH A;  2WJU A;  2DSA A;  1SJZ A;  4K9Z A;  2G0F A;  2IME A;  1YDK A;  1XW5 A;  3KMN A;  2V41 A;  4ZL9 A;  4MA9 A;  2H30 A;  3GKM A;  3I43 A;  3LJR A;  4K7N A;  1TRS A;  5ID2 B;  1JLW A;  5D8I A;  2FNO A;  1Z3E A;  2XBQ A;  3Q19 A;  3W8J A;  1T3B A;  17GS A;  1SYX A;  4WXT A;  3TRX A;  3BJ5 A;  3EYT A;  20GS A;  3DVW A;  2IL3 A;  3GA4 A;  1K3O A;  5A4U A;  5G5E A;  3KH7 A;  1ERW A;  3GHA A;  1U3A A;  1TRW A;  1XVQ A;  1I5G A;  1SK2 A;  5D9T A;  2YWM A;  5CO3 A;  3LQ7 A;  2KP1 A;  4HQS A;  3PGT A;  1YKC A;  3WD6 A;  5F8B A;  2WUL A;  4TR4 A;  4OFM A;  1URM A;  1R5P A;  2FWE A;  3RDW A;  2VD1 A;  4IS0 A;  3VPT A;  4V2M A;  4WBJ A;  4JBB A;  4EUY A;  3DML A;  3IE3 A;  5LNK e;  2FLS A;  3EU4 A;  1FVJ A;  3VWU A;  3KTL A;  22GS A;  2CZ2 A;  2L57 A;  1JZW A;  5G30 A;  2CX3 A;  2TIR A;  3UOM A;  1X5D A;  3R2Q A;  5DDL A;  1TI3 A;  5AIS A;  1UN2 A;  2X8C A;  1BQ7 A;  5F0G A;  5DQS A;  4ILF A;  4BWQ A;  2OJL A;  4IN0 A;  2N5A A;  5IPG A;  1VF4 A;  1F9M A;  4TR1 B;  5JWO B;  3DYR A;  2MMA A;  2XPE A;  5B8A A;  4YQM A;  3I69 A;  2V6K A;  3P2A A;  1QQ2 A;  3VI5 A;  4NPB A;  2AV4 A;  4PQH A;  4ZB6 A;  13GS A;  3ZVJ A;  3HHV A;  1F2E A;  1SKR B;  1FB0 A;  1M2D A;  5D9W A;  4GSN A;  1OC8 A;  3GTU B;  4J2F A;  2JZS A;  1NHY A;  2DIY A;  2GGT A;  3IAS 2;  1RQM A;  2LJA A;  4JU5 A;  6GSY A;  1IYH A;  2FUG 2;  2CAQ A;  2HFD A;  1U88 A;  3GTU A;  4GWR A;  4TKY A;  4MLY A;  1QUW A;  2NVL A;  2AYT A;  5E4W A;  1GSS A;  2VM2 A;  2MMZ A;  19GS A;  3H8Q A;  3IHQ A;  3A3T A;  1PSQ A;  3TUE A;  1LBK A;  1A2L A;  3WGE A;  2BTO T;  3ME8 A;  2H72 A;  1WJK A;  4KSO A;  5DVB A;  2REM A;  2GZY A;  5J9B A;  2VUP A;  1UC7 A;  5KN1 A;  1ZOF A;  1EOG A;  3IBH A;  3ZML A;  5LCZ A;  3ZFB A;  4FYB A;  4F0C A;  2Z9S A;  1EZK A;  4JR4 A;  2VD0 A;  2IFQ B;  4KDX A;  2HLS A;  3IOS A;  4EXJ A;  3O3T A;  1GTI A;  2VM1 A;  3FW2 A;  4PUR A;  4IP6 A;  2QC7 A;  2GQK A;  1KEB A;  5EL8 A;  2JAC A;  1SKW B;  2LEG A;  3DGQ A;  1B4P A;  2OBK A;  3TKQ A;  4MZC A;  1FHE A;  5ECR B;  3DWV A;  2XC2 A;  3VI7 A;  4HOJ A;  3E9J B;  4KAE A;  3D5J A;  4OFN A;  3O76 A;  2V32 A;  3TKS C;  2FA8 A;  2F9S A;  2HXK A;  2ON5 A;  3L9U A;  3WT1 A;  2YJH A;  1A23 A;  1XOA A;  3HD5 A;  1EV9 A;  2X8G A;  3IR4 A;  3O6T A;  3FZ9 A;  3L9V A;  1ON4 A;  2HE3 A;  3TJK A;  4V1A p;  3DRN A;  1V57 A;  2P31 A;  3ERG A;  3IXR A;  1MDK A;  4MCU A;  2IMF A;  2CQ9 A;  1CQG A;  2PER A;  4Q5N A;  5ELG A;  2MMN A;  3GUS A;  2DJ1 A;  3M9K A;  2K6V A;  2C3T A;  5ABR A;  4G9H A;  5IMA A;  2XBI A;  2LQO A;  3LWA A;  3WGX A;  3WT2 A;  2JSZ A;  2MZC A;  1YJ6 A;  3D22 A;  4XIH A;  3HXS A;  1ERU A;  2OKA A;  3GL3 A;  2MBS A;  5D96 A;  1KTE A;  5FWG A;  2PN8 A;  4TXV A;  3W6G A;  1GTU A;  2IIY A;  1TU8 A;  4WET A;  2VL3 A;  4IQA A;  2L4Q A;  2ON7 A;  3GKX A;  2BJX A;  3F4S A;  1V2A A;  1ABA A;  5KEJ A;  3FR3 A;  4V2L A;  2YWO A;  3E3E A;  2ZUP A;  3CTG A;  5CYY A;  2H8L A;  3IPZ A;  1TKD B;  1EP8 A;  1YY7 A;  1QK8 A;  3ERW A;  2IMK A;  2YV7 A;  1T4Y A;  1J08 A;  2N5F A;  3SBC A;  5DJM A;  2PGT A;  4DSR A;  1VF2 A;  1O85 A;  2XPD A;  1SL2 B;  3UVT A;  4ZB9 A;  3G9B A;  4FH8 A;  5HFK A;  4KND A;  3ZFL A;  4V1A g;  1RK4 A;  1XFL A;  2KOK A;  4L5O A;  4KW6 A;  2VCQ A;  5A5K A;  10GS A;  2FD3 A;  2RUF A;  1AIU A;  1GSD A;  3P7X A;  1R7H A;  4GQC A;  5C00 A;  3HVV A;  3KJY A;  2OAC A;  4ZBA A;  1XBS A;  5E59 A;  1M7T A;  2H6X A;  5B7C A;  1XIY A;  4I8B A;  5F05 A;  1WOU A;  5G31 A;  4RQX A;  3VWX A;  3N5O A;  4DEJ A;  3D4M A;  3FYG A;  4TXO B;  3W8S A;  4MPG A;  3U5R E;  3M8N A;  4X1U A;  4EO3 A;  2XHF A;  4TXO A;  2KLX A;  1A8L A;  1DUG A;  2DMM A;  1OE8 A;  2P0G A;  5IO2 A;  2A2S A;  2R5G A;  4MP4 A;  5ENU A;  2LJK A;  4RUV A;  4POB A;  3KP8 A;  1ZGN A;  3BBY A;  1GRX A;  1OC9 B;  5H5Q A;  4PNG A;  1T8E B;  2HSH A;  2HI7 A;  1R5A A;  3ZZX A;  3DXB A;  4ULX A;  4JE1 A;  2YAN A;  4DVC A;  2CT6 A;  5CRW A;  3FZ4 A;  3APO A;  4EDZ A;  2YJ7 A;  4AJ7 A;  5IIZ A;  3BOA A;  1SKS B;  1BED A;  1BJX A;  1WIK A;  2H0H A;  1WP0 A;  4LLR A;  5IOX A;  3DIE A;  1PX6 A;  5FHI A;  1TI1 A;  3UMA A;  1QMV A;  5J4U A;  4Z7X A;  5CRG A;  1AQV A;  2LRN A;  3QAV A;  4CHS A;  5B6N A;  3HCZ A;  4OO5 A;  4NWY A;  1GLQ A;  1SD9 A;  5J3R A;  1K0A A;  3KIJ A;  1T00 A;  2O7K A;  1AQW A;  2DLX A;  1QXH A;  5B6M A;  3HKR A;  4WF5 A;  3KM6 A;  2I9H A;  3TKS A;  1HNB A;  5KN0 A;  3I9V 2;  3CXG A;  3GIX A;  3TCO A;  4ACS A;  4HZ4 A;  2WCI A;  2LNS A;  4BVX A;  2QSI A;  3DD3 A;  1DSB A;  3M1G A;  3GV1 A;  6GST A;  1BX9 A;  3NOF A;  1M2A A;  4FYC A;  4I5Q A;  1T4Z A;  3HVS A;  5ECM B;  2X99 A;  1SK0 A;  6GSU A;  3SWL A;  5IQY A;  4F0B A;  2GLR A;  1K0D A;  1FB6 A;  5CNW A;  1O7U A;  3M0F A;  4F03 A;  4GCI A;  1WPI A;  3EC3 A;  2PPT A;  1DE2 A;  3LYP A;  1R4W A;  1HYU A;  1V98 A;  4IJ3 A;  2C3Q A;  1S3D A;  2B3S A;  4TR3 A;  3ZLP A;  3WYW A;  6GSX A;  3QCP A;  1AQX A;  3APS A;  5INY A;  5DCG A;  2LRT A;  2E2G A;  1PL1 A;  4K0G A;  4OD7 A;  3ZL5 A;  4E8E A;  2L5L A;  2DJ3 A;  2M80 A;  4EC0 A;  3U6V A;  3KGK A;  3VLN A;  1WWJ A;  4CDO A;  1B4Q A;  4MF7 A;  5EPF A;  4POK A;  2OBI A;  2CZ3 A;  2MYG A;  5G5F A;  5G2Z A;  4O32 A;  2EC4 A;  4NHW A;  4AGS A;  5COH A;  3HZ4 A;  1PKZ A;  3C1S A;  2MBT A;  3C71 A;  2A4V A;  4F9Z A;  3FZA A;  1TJD A;  2RII A;  3FK8 A;  2JZT A;  2RM6 A;  2F51 A;  2AJQ B;  1SU9 A;  4TN8 A;  2B1L A;  3RHB A;  1O8X A;  1U6T A;  4HDE A;  1XCC A;  2VIM A;  3PR8 A;  2IPA A;  2FA4 A;  2K8S A;  2V2G A;  5LD0 A;  1N8J A;  1WMJ A;  5JWQ B;  4PUA A;  3S9F A;  3H4K A;  1YEX A;  4F2I A;  1M9B A;  3QDN A;  1XOB A;  1GH2 A;  1FG4 A;  1NM3 A;  3MWH A;  1TK8 B;  2OAD A;  2H0G A;  4PQI A;  2H19 A;  1Q98 A;  3BCI A;  1GTB A;  4LL1 B;  4RI6 A;  3QD9 A;  4WEY A;  3LGC A;  2C0G A;  3CRT A;  3LFL A;  4MH3 A;  3MDK A;  2R6K A;  4EF0 A;  1Z6M A;  2CA8 A;  1TP9 A;  4EVM A;  2JSY A;  5GST A;  1MD4 A;  3J7Y k;  3H79 A;  1OC3 A;  2GSQ A;  2B1K A;  3F3R A;  1KBN A;  4PX1 A;  1EEJ A;  3VUR A;  2DJ2 A;  4NV2 A;  1F37 A;  4P3Y B;  4ZB8 A;  5ECL B;  1TRU A;  4BVY A;  1ERV A;  3NZN A;  1T1V A;  2IN3 A;  1YKA A;  2K9F A;  3HYP A;  1H75 A;  3EMX A;  3FY7 A;  3QR6 A;  1MD3 A;  2EIO A;  2NTO A;  4I2T A;  4K2D A;  2VL9 A;  4ECB A;  4GRF A;  4ZL7 A;  2O85 A;  5DQY A;  3TGZ A;  1U87 A;  5IMF A;  3RHC A;  2YWN A;  4IQ1 A;  2LNT A;  3LXT A;  4MK3 A;  4JZQ A;  4X43 A;  2WFC A;  1R26 A;  2WRT A;  4XS6 A;  4GST A;  2PU9 C;  3QPM A;  2JU5 A;  4KB3 A;  5AN1 A;  3UAP A;  4JRR A;  3UJ1 A;  3F4T A;  4G10 A;  1XWA A;  3KP9 A;  2PVO C;  4GF0 A;  5EVO A;  1BYE A;  5CRD A;  1V40 A;  2M46 A;  2VL2 C;  1C72 A;  2GTU A;  1WRY A;  4HU9 A;  5DAL A;  4I2U A;  2DIZ A;  2IMD A;  4IGJ A;  5AIX A;  5AGY A;  3JCM L;  4Q5Q A;  1HD2 A;  2YZU A;  4K0N A;  3H1N A;  3IAM 2;  5CRH A;  4KCA A;  5KN2 A;  2YZH A;  3LYK A;  2YN1 A;  2HZE A;  5HQP A;  4FYU A;  3HJM A;  1B9Y C;  3EU3 A;  4EKZ A;  2YP6 A;  1AC1 A;  1HQO A;  4AJ6 A;  2C3N A;  4QQ7 A;  4TRX A;  4ZBD A;  1TDI A;  3F4R A;  3G7Y A;  1ZYQ B;  4WR4 A;  4IEL A;  4ECC A;  2HRF A;  3ZRD A;  1ACV A;  4TVE A;  1YF0 A;  2H76 A;  4YQU A;  5ECK B; 
#chains in the Genus database with same CATH topology
 1K3Y A;  4A5P A;  2VOC A;  4J56 E;  2O8V B;  4K6X A;  1AAZ A;  4DSS B;  4ISD A;  4GTU A;  4YKG A;  2DJJ A;  2WZ9 A;  1OYJ A;  1YF1 A;  4DSS A;  2TRX A;  4X4J A;  1ZCP A;  1G7E A;  4BA7 A;  2HRK A;  1ILO A;  1TU7 A;  3GX0 A;  2VCV A;  2YPM A;  4FO5 A;  4EE0 A;  3M3M A;  1XWK A;  2QKE A;  2X4A A;  7GSS A;  4PXO A;  2DJ0 A;  2JZR A;  1LJR A;  2AUV A;  4TW5 A;  5IMC A;  3F8U A;  2FWG A;  5G1K A;  1JLV A;  3QAW A;  5ECQ B;  3FRC A;  4HS1 A;  3ZTL A;  2LQQ A;  4V2N A;  2MMO A;  2V6O A;  3LG6 A;  5A4V A;  4YH2 A;  4KCE A;  2CAI A;  4G0L A;  1EWX A;  3F9U A;  4MAB A;  4CY6 A;  2OE3 A;  4EL1 A;  1K0C A;  1RW1 A;  3KZQ A;  4XS1 A;  1PL2 A;  2LV3 A;  1SJI A;  2CV4 A;  2VCT A;  2KHP A;  2DC5 A;  2OE0 A;  1M0U A;  2WGR A;  2H1D A;  3C1R A;  1PD2 1;  3P90 A;  4AF2 A;  4RI7 A;  4HU7 A;  3FHK A;  2GSR A;  2DML A;  1I9D A;  4KH7 A;  2JAD A;  4D73 B;  1PQN A;  1X9W B;  3FEU A;  4NXI A;  1EEM A;  1KNG A;  3APQ A;  4LMW A;  1SEN A;  4XHM A;  4OO4 A;  1S3C A;  4D73 A;  1GWC A;  5H5S A;  3HA9 A;  2LS5 A;  4ICY A;  4GQF A;  3G7J A;  4G2E A;  3CMI A;  5GAN D;  4MMM A;  1SYR A;  2GS3 A;  12GS A;  1ZZY A;  3ZRE A;  5IO0 A;  6GSV A;  5G1L A;  1K0M A;  3EE2 A;  2IWT A;  3HDC A;  3Q18 A;  2C4J A;  4G19 A;  2PMT A;  2KUC A;  4KA0 A;  1Z9H A;  2EIQ A;  3UVH A;  2ZNM A;  4CW9 A;  3D6I A;  2CVK A;  5IMV A;  3RBT A;  4DSQ A;  3F63 A;  1GUL A;  3TOU A;  1M9A A;  3RPP A;  3TJB A;  5IM9 A;  2LST A;  1O8W A;  1DBY A;  3CTF A;  1F6M C;  1X9M B;  2ZCT A;  3OR5 A;  4PQ1 A;  2H75 A;  5GAP D;  4K7I A;  1MEK A;  2B7J A;  2YV9 A;  1J9B A;  4NV5 A;  5EY6 A;  2X64 A;  1GSY A;  1PMT A;  2HZF A;  4N30 A;  5CRE A;  4IVF A;  3GX8 A;  3FMW A;  1HNC A;  1OKD A;  1FO5 A;  3TKP A;  2AB6 A;  3ISO A;  3IV4 A;  4FIW A;  2G2Q A;  2VL2 A;  4MPF A;  4IW9 A;  3GSS A;  2NBS A;  1SL1 B;  1K0B A;  4YAP A;  4HQZ A;  2B5E A;  3KH9 A;  2HNL A;  1O73 A;  4O5R A;  3GST A;  2BMX A;  4KSM A;  3F3Q A;  4PGT A;  5FT3 A;  1W4V A;  2O87 A;  1K0O A;  4J57 E;  1OAZ A;  3TB2 A;  3GKN A;  2O89 A;  1OVN A;  4IBP A;  4XTS A;  2FY6 A;  3HVX A;  5HR2 A;  5JCG A;  3RAZ A;  1PN0 A;  3UL3 A;  1UVZ A;  1ZL9 A;  2H01 A;  3IHG A;  3M9J A;  4I97 A;  1JZR A;  3UAR A;  4XS4 B;  1XWB A;  1PRX A;  3BD2 A;  1A0F A;  4H86 A;  4HSC X;  5CAX A;  3H93 A;  2AAW A;  2GZP A;  4XS4 A;  2H6Z A;  3IC4 A;  1GUM A;  3CYN A;  4OMV A;  5ELA A;  2H73 A;  4KGI A;  3QOU A;  3D0Z A;  1H4O A;  2PWJ A;  2PVQ A;  4HZ2 A;  3IK7 A;  3UIW A;  1NSW A;  4ZXG A;  2E2M A;  1GSQ A;  1EGO A;  3KD0 A;  2R3X A;  3FR6 A;  1AUC A;  4ZIJ A;  3N9J A;  4IP1 A;  2FCH A;  2I1U A;  3AY8 A;  1ZMA A;  1G0T A;  4HEA 2;  3K8N A;  3DKS A;  1F3A A;  3TJG A;  2LTK A;  4PNF A;  4EIP A;  2H71 A;  1ML6 A;  1EP7 A;  4K2X A;  4MZW A;  1XVW A;  4POM A;  2V1M A;  2L6C A;  3L9S A;  5KN3 A;  3KCM A;  4XRA A;  2VCZ A;  5ECP B;  2LUS A;  5DAK B;  1XZO A;  4YAV A;  3EVI A;  1BG5 A;  3CSJ A;  1UA5 A;  4WBR D;  4NMU A;  5JCU A;  5DAK A;  16GS A;  5IOW A;  4KDY A;  2A4H A;  3TRP A;  2NPB A;  4X0X A;  5ID2 A;  3J7Y b;  3Q74 A;  4G0K A;  3MNG A;  3ZIT A;  1MTC A;  4RQR A;  3GKK A;  4O7H A;  5HR0 A;  3TJF A;  1A2M A;  1ZYN A;  2JL4 A;  4MH2 A;  4LL4 B;  1NHO A;  1YEP A;  3IA1 A;  3ZIV A;  4BWS A;  2CVB A;  1E6B A;  2HSY A;  2RUE A;  2L4C A;  3ERF A;  2GT6 A;  4YKF A;  2I3Y A;  4PUF C;  2X8H A;  4MF6 A;  3EIN A;  2DBC A;  3TRQ A;  4K7O A;  3FKF A;  1YZX A;  4N0Z A;  3A2X A;  4XRD A;  2C8U A;  3ZIJ A;  2VCX A;  2R0G A;  3GNJ A;  3GH9 A;  2B5Y A;  2GVP A;  3ME7 A;  1O81 A;  2IJY A;  2J23 A;  3F0I A;  4KX4 A;  1EGR A;  2WS2 A;  3FR9 A;  1VF3 A;  2LJR A;  3CBU A;  5GSS A;  2L59 A;  3WGD A;  3ZMK A;  4HI7 A;  2CVD A;  3CSI A;  4YQV A;  1PKW A;  2RM5 A;  3LXZ A;  5H5R A;  3GYK A;  2F8F A;  2C80 A;  1PX7 A;  1NW2 A;  2CX4 A;  2RLI A;  2VLT A;  2PBJ A;  3QAG A;  1W89 A;  2L5O A;  1T7P B;  3NIV A;  1J0F A;  1X0R A;  3UBL A;  1WE0 A;  2H1G A;  2VLV A;  2HYX A;  4LMV A;  1GUH A;  4MJA A;  3A2W A;  4L8E A;  5ECO B;  2YWI A;  1X5E A;  1TW9 A;  3EWL A;  1HNA A;  5F06 A;  3ZVJ D;  3GUR A;  2OE1 A;  5D73 A;  2LRC A;  5DCH A;  2OA7 A;  3VWW A;  4L0W A;  2HT9 A;  3VPQ A;  2C0E A;  3MSZ A;  4K5S A;  3TJJ A;  3BCK A;  2J9H A;  1FOH A;  1YQ1 A;  5F07 A;  4TR1 A;  2H66 A;  2C0F A;  1GP1 A;  1K3L A;  1FVK A;  3TDG A;  4Q5F A;  4F82 A;  1N2A A;  1S3A A;  2FHE A;  3GL5 A;  1XWC A;  1O6J A;  2K8V A;  5J5N A;  3DEX A;  2FWF A;  5HR3 A;  6GSS A;  2GST A;  2NDO A;  1ERT A;  3HZ8 A;  1JZD A;  1GTA A;  9GSS A;  5B8B A;  4ML1 A;  4HJ2 A;  4TOP A;  1JZO A;  3ED3 A;  2ES7 A;  3EUR A;  1PA3 A;  1Y25 A;  1A8Y A;  1BAY A;  1MDI A;  5DAL B;  2DJK A;  4JR6 A;  2FWH A;  1TOF A;  3A5W A;  1THO A;  2VO4 A;  4KDU A;  1FOV A;  2HZE B;  2P5R A;  3C7M A;  3TOT A;  4O5Q A;  5D9X A;  3CSH A;  4ML6 A;  4NHZ A;  2GDR A;  2WDU A;  2P5Q A;  3DVX A;  3VK9 A;  3IRA A;  2PUK C;  2KP2 A;  1M99 A;  1XW6 A;  2H0I A;  2B6M A;  2H74 A;  5HFI A;  4Z2R A;  1Z7R A;  2IFQ A;  4MDC A;  1F3B A;  4MNN A;  1QFN A;  4LA1 A;  3A5I A;  6GSW A;  5ECH B;  3C8E A;  4BL7 B;  1XWG A;  5AIV A;  4BL7 A;  1GNW A;  4OCE A;  2HRN A;  3ZYW A;  3LSZ A;  2A2R A;  4ECJ A;  4IHU A;  3V1W A;  3VFI A;  2R4V A;  3F6D A;  3KEB A;  1SJ6 A;  1XXU A;  3C73 A;  5L71 A;  3FZ5 A;  1B8X A;  2YCD A;  1K0N A;  2B7K A;  1XW9 A;  3IK9 A;  2ALB A;  1AW9 A;  2I4A A;  3US3 A;  1V58 A;  5J41 A;  3UBK A;  2EIR A;  1IYI A;  1Z6N A;  2GQL A;  4WKW A;  1GLP A;  3LEF A;  2AHE A;  1VRS D;  1XPV A;  2WB9 A;  1AXD A;  5KOW A;  3PIN A;  4USS A;  1EOH A;  4K1F A;  2QGV A;  5D9V A;  2R0P A;  5DBQ A;  1TXX A;  5C04 A;  4ECI A;  1E2Y A;  1X5C A;  3HJO A;  3QMX A;  5ECS A;  1USB A;  1VF1 A;  4JED A;  1QGV A;  5IMZ A;  3L0H A;  4L5L A;  5BMU A;  2H6Y A;  3GN3 A;  2N5B A;  1MDJ A;  3F6F A;  4BPY A;  5ECN B;  5A4W A;  4K8M A;  1GNE A;  2H1A A;  3IDV A;  1SL0 B;  3PH9 A;  2L6D A;  3D21 A;  1M3J A;  2F3M A;  1ST9 A;  5HFG A;  1JHB A;  2E0Q A;  2B5X A;  3KXO A;  1GSF A;  1GUK A;  1DE1 A;  3E0U A;  4I6X A;  1GSE A;  1TK0 B;  1SD8 A;  2D2Z A;  14GS A;  4HJM A;  3RPN A;  4MJE A;  3KTB A;  3GRX A;  5KOX A;  5D93 A;  4ZL8 A;  4HUA A;  1PFO A;  5ECI B;  1GL8 A;  1Z7P A;  4ZIL A;  2QA1 A;  4ZBB A;  2VAF A;  4XCS A;  1FAA A;  5DJL A;  1OE7 A;  1LU4 A;  1FW1 A;  4GLT A;  3QFA C;  1OKT A;  18GS A;  1B48 A;  2M72 A;  4EDY A;  3Q6O A;  1A2J A;  2R37 A;  5JWR B;  5J9C A;  1Q4J A;  2VCW A;  2H70 A;  1A24 A;  3GH6 A;  1U3I A;  4N10 A;  3HY2 A;  1GSU A;  1M2B A;  4L0U A;  3HJP A;  4GXZ A;  1ZYE A;  4NAX A;  2K18 A;  3UEM A;  1Z5Y E;  2YNX A;  4POL A;  4WR5 A;  1A0R P;  1TRV A;  2FGX A;  4OCF A;  4TR0 A;  4KF9 A;  8GSS A;  2R2J A;  4O92 A;  4OFT A;  2GSS A;  3MAK A;  1OC9 A;  1VGL A;  2GQM A;  4QL7 A;  1G6W A;  1SK1 A;  4AJ8 A;  3L4N A;  4WF4 A;  5IMD A;  4BIK A;  4IJI A;  3GMF A;  1ZYP A;  5IPH A;  2C0D A;  1JFU A;  4GSS A;  4N0V A;  3A2V A;  2GZZ A;  4MZB A;  3L78 A;  5CP1 A;  3TKR A;  3QFB C;  2GT5 A;  2VLU A;  3VWV A;  5JCW A;  1TTZ A;  1G7O A;  1S3R A;  4E8H A;  1TK5 B;  1PN9 A;  11GS A;  1V9W A;  3GFK A;  1Y6E A;  3I6A A;  2F8A A;  4MJC A;  2TRC P;  2IMI A;  2H1B A;  4N11 A;  4KUN A;  4MJB A;  2I81 A;  4MF5 A;  1THX A;  5HR1 A;  1X9S B;  1G6Y A;  4OWY A;  3D4T A;  2C1Y A;  1B9X C;  3KMO A;  3P8W A;  5GZZ B;  4ID0 A;  1PGT A;  3G7I A;  4QL9 A;  3TKS E;  4KE3 A;  2E7P A;  2LKU A;  3LOR A;  4Q5R A;  3CRU A;  2YOI A;  3EMP A;  4IKH A;  1EV4 A;  1CQH A;  2WJU A;  2DSA A;  1SJZ A;  3HVN A;  2R0C A;  2HSM A;  4K9Z A;  2G0F A;  2IME A;  1YDK A;  1XW5 A;  3KMN A;  2V41 A;  4ZL9 A;  4MA9 A;  2H30 A;  3GKM A;  3I43 A;  3LJR A;  4K7N A;  1TRS A;  5ID2 B;  1JLW A;  5D8I A;  2FNO A;  1Z3E A;  2XBQ A;  3Q19 A;  3W8J A;  1T3B A;  17GS A;  1SYX A;  4WXT A;  3TRX A;  3BJ5 A;  3EYT A;  20GS A;  3DVW A;  2IL3 A;  3GA4 A;  1K3O A;  5A4U A;  5G5E A;  1XG8 A;  3KH7 A;  1ERW A;  3GHA A;  1U3A A;  1TRW A;  1XVQ A;  1I5G A;  1SK2 A;  5D9T A;  2YWM A;  5CO3 A;  3LQ7 A;  2KP1 A;  4HQS A;  3PGT A;  1YKC A;  3WD6 A;  5F8B A;  3R3E A;  2WUL A;  4TR4 A;  4OFM A;  1URM A;  1R5P A;  2FWE A;  3RDW A;  2VD1 A;  4IS0 A;  3MYD A;  3VPT A;  4V2M A;  4WBJ A;  4JBB A;  4EUY A;  3DML A;  3IE3 A;  5LNK e;  2FLS A;  3EU4 A;  1FVJ A;  3VWU A;  3KTL A;  22GS A;  2CZ2 A;  2L57 A;  1JZW A;  5G30 A;  2CX3 A;  2TIR A;  3UOM A;  1X5D A;  3R2Q A;  5DDL A;  1TI3 A;  5AIS A;  1UN2 A;  2X8C A;  1BQ7 A;  5F0G A;  2HRA A;  5DQS A;  4ILF A;  4BWQ A;  2OJL A;  4IN0 A;  2N5A A;  5IPG A;  1VF4 A;  1F9M A;  4TR1 B;  5JWO B;  3DYR A;  2MMA A;  2XPE A;  5B8A A;  4YQM A;  3I69 A;  2V6K A;  3P2A A;  1QQ2 A;  3VI5 A;  4NPB A;  2AV4 A;  4PQH A;  4ZB6 A;  13GS A;  3ZVJ A;  3HHV A;  1F2E A;  1SKR B;  1FB0 A;  1M2D A;  5D9W A;  4GSN A;  1OC8 A;  3GTU B;  4J2F A;  1M3I A;  2JZS A;  1NHY A;  2DIY A;  2GGT A;  3IAS 2;  1RQM A;  2LJA A;  4JU5 A;  6GSY A;  1IYH A;  2FUG 2;  2CAQ A;  2HFD A;  1U88 A;  3GTU A;  4GWR A;  4TKY A;  4MLY A;  1QUW A;  2NVL A;  2AYT A;  5E4W A;  3LW9 A;  1GSS A;  2VM2 A;  2MMZ A;  19GS A;  3H8Q A;  3IHQ A;  3A3T A;  1PSQ A;  3TUE A;  1LBK A;  1A2L A;  3WGE A;  2BTO T;  3ME8 A;  2H72 A;  3EPT A;  1WJK A;  4KSO A;  5DVB A;  2REM A;  2GZY A;  5J9B A;  2VUP A;  1UC7 A;  5KN1 A;  1ZOF A;  1EOG A;  3IBH A;  3ZML A;  5LCZ A;  3ZFB A;  4FYB A;  4F0C A;  2Z9S A;  1EZK A;  4JR4 A;  2VD0 A;  2IFQ B;  4KDX A;  2HLS A;  3IOS A;  4EXJ A;  3O3T A;  1GTI A;  2VM1 A;  3FW2 A;  4PUR A;  4IP6 A;  2QC7 A;  2GQK A;  1KEB A;  5EL8 A;  2JAC A;  1SKW B;  2LEG A;  3DGQ A;  1B4P A;  2OBK A;  3PPU A;  3TKQ A;  4MZC A;  1FHE A;  5ECR B;  3DWV A;  2XC2 A;  3VI7 A;  4HOJ A;  2A2P A;  3E9J B;  4KAE A;  3D5J A;  4OFN A;  3O76 A;  2V32 A;  3TKS C;  2FA8 A;  2F9S A;  2HXK A;  2ON5 A;  3L9U A;  3WT1 A;  2YJH A;  1A23 A;  1XOA A;  3HD5 A;  1EV9 A;  2X8G A;  3IR4 A;  3O6T A;  3FZ9 A;  3L9V A;  1ON4 A;  2HE3 A;  3TJK A;  4V1A p;  3DRN A;  1V57 A;  2P31 A;  3ERG A;  5BRT A;  3IXR A;  1MDK A;  4MCU A;  2IMF A;  2CQ9 A;  1CQG A;  2PER A;  4Q5N A;  5ELG A;  2MMN A;  3GUS A;  2DJ1 A;  3M9K A;  2K6V A;  2C3T A;  5ABR A;  4G9H A;  5IMA A;  2XBI A;  2LQO A;  3LWA A;  3WGX A;  3WT2 A;  2JSZ A;  2MZC A;  1YJ6 A;  3D22 A;  4XIH A;  3HXS A;  1ERU A;  2OKA A;  3GL3 A;  2MBS A;  5D96 A;  1KTE A;  5FWG A;  2PN8 A;  4TXV A;  3W6G A;  1GTU A;  2IIY A;  1TU8 A;  4PTS A;  4WET A;  2VL3 A;  4IQA A;  3CQF A;  2L4Q A;  2ON7 A;  3GKX A;  2BJX A;  3F4S A;  1V2A A;  1ABA A;  5KEJ A;  3FR3 A;  4V2L A;  2YWO A;  3E3E A;  2ZUP A;  3CTG A;  5CYY A;  2H8L A;  3IPZ A;  1TKD B;  1EP8 A;  1YY7 A;  1QK8 A;  3ERW A;  2IMK A;  2YV7 A;  1T4Y A;  1J08 A;  2N5F A;  3SBC A;  5DJM A;  2PGT A;  4DSR A;  1VF2 A;  1O85 A;  2XPD A;  1SL2 B;  3UVT A;  4ZB9 A;  3G9B A;  4FH8 A;  5HFK A;  4KND A;  3ZFL A;  4V1A g;  1RK4 A;  1XFL A;  2KOK A;  4L5O A;  4KW6 A;  2VCQ A;  5A5K A;  10GS A;  2FD3 A;  2RUF A;  1AIU A;  1GSD A;  3P7X A;  1R7H A;  4GQC A;  5C00 A;  3HVV A;  3KJY A;  2OAC A;  4ZBA A;  1XBS A;  5E59 A;  4Z2T A;  1M7T A;  2H6X A;  5B7C A;  1XIY A;  4I8B A;  5F05 A;  1WOU A;  5G31 A;  4RQX A;  3VWX A;  3N5O A;  4DEJ A;  3D4M A;  3FYG A;  4TXO B;  3W8S A;  4MPG A;  3U5R E;  3M8N A;  4X1U A;  4EO3 A;  2XHF A;  4TXO A;  2KLX A;  1A8L A;  1DUG A;  2DMM A;  1OE8 A;  2P0G A;  5IO2 A;  2A2S A;  2R5G A;  4MP4 A;  5ENU A;  2LJK A;  4RUV A;  4POB A;  3KP8 A;  1ZGN A;  3BBY A;  1GRX A;  1OC9 B;  5H5Q A;  4PNG A;  1T8E B;  2HSH A;  2HI7 A;  1R5A A;  3ZZX A;  3DXB A;  3MIX A;  4ULX A;  4JE1 A;  2YAN A;  4DVC A;  2CT6 A;  5CRW A;  3FZ4 A;  3APO A;  4EDZ A;  4G0I A;  4O5U A;  2YJ7 A;  4AJ7 A;  5IIZ A;  3BOA A;  1SKS B;  1BED A;  1BJX A;  1WIK A;  2H0H A;  1WP0 A;  4LLR A;  5IOX A;  3DIE A;  1PX6 A;  5FHI A;  1TI1 A;  3UMA A;  1QMV A;  5J4U A;  4Z7X A;  5CRG A;  1AQV A;  2LRN A;  3QAV A;  4CHS A;  5B6N A;  3HCZ A;  4OO5 A;  4NWY A;  1GLQ A;  1SD9 A;  5J3R A;  1K0A A;  3KIJ A;  1T00 A;  2O7K A;  1AQW A;  2DLX A;  1QXH A;  5B6M A;  3HKR A;  4WF5 A;  3KM6 A;  2I9H A;  3TKS A;  1HNB A;  5KN0 A;  4BVX B;  3I9V 2;  3CXG A;  3GIX A;  3TCO A;  4ACS A;  4HZ4 A;  2WCI A;  2LNS A;  4BVX A;  2QSI A;  3DD3 A;  1DSB A;  3M1G A;  3GV1 A;  6GST A;  1BX9 A;  3NOF A;  1M2A A;  4FYC A;  4I5Q A;  1T4Z A;  3HVS A;  5ECM B;  2X99 A;  1SK0 A;  6GSU A;  3SWL A;  2QA2 A;  5IQY A;  4F0B A;  2GLR A;  1K0D A;  1FB6 A;  5CNW A;  1O7U A;  3M0F A;  4F03 A;  4GCI A;  1WPI A;  3EC3 A;  2PPT A;  1DE2 A;  3LYP A;  1R4W A;  1HYU A;  4FQU A;  1V98 A;  4IJ3 A;  2C3Q A;  1S3D A;  2B3S A;  4TR3 A;  3ZLP A;  3WYW A;  6GSX A;  3QCP A;  1AQX A;  3APS A;  5INY A;  5DCG A;  2LRT A;  2E2G A;  1PL1 A;  4K0G A;  4OD7 A;  3ZL5 A;  4E8E A;  2L5L A;  2DJ3 A;  2DKH A;  2M80 A;  3U6V A;  4EC0 A;  3KGK A;  3VLN A;  1WWJ A;  4CDO A;  1B4Q A;  4MF7 A;  5EPF A;  4POK A;  2OBI A;  2CZ3 A;  2MYG A;  5G5F A;  5G2Z A;  4O32 A;  2EC4 A;  4NHW A;  4AGS A;  5COH A;  3HZ4 A;  1PKZ A;  3C1S A;  2MBT A;  3C71 A;  2A4V A;  4F9Z A;  3FZA A;  1TJD A;  2RII A;  3FK8 A;  2JZT A;  2RM6 A;  2F51 A;  2AJQ B;  1SU9 A;  4TN8 A;  2B1L A;  3RHB A;  1O8X A;  4HDE A;  1U6T A;  1XCC A;  2VIM A;  3PR8 A;  2IPA A;  2FA4 A;  2K8S A;  2V2G A;  5LD0 A;  1N8J A;  1WMJ A;  5JWQ B;  4PUA A;  3S9F A;  3H4K A;  1YEX A;  4F2I A;  1M9B A;  3QDN A;  1XOB A;  1GH2 A;  1FG4 A;  1NM3 A;  3MWH A;  4CY8 A;  1TK8 B;  2OAD A;  2H0G A;  4PQI A;  2H19 A;  1Q98 A;  3BCI A;  1GTB A;  4LL1 B;  4RI6 A;  3QD9 A;  4WEY A;  3LGC A;  2C0G A;  3CRT A;  3LFL A;  4MH3 A;  3MDK A;  2R6K A;  4EF0 A;  1Z6M A;  2CA8 A;  1TP9 A;  4EVM A;  2JSY A;  5GST A;  1MD4 A;  4BVY B;  3J7Y k;  3H79 A;  4Z2U A;  1OC3 A;  2GSQ A;  2B1K A;  3F3R A;  1KBN A;  4PX1 A;  1EEJ A;  3VUR A;  2DJ2 A;  4NV2 A;  1F37 A;  4P3Y B;  4ZB8 A;  5ECL B;  1TRU A;  4BVY A;  1ERV A;  3NZN A;  1T1V A;  2IN3 A;  1YKA A;  2K9F A;  3HYP A;  1H75 A;  3EMX A;  3FY7 A;  3QR6 A;  1MD3 A;  2EIO A;  2NTO A;  4I2T A;  4K2D A;  2VL9 A;  4ECB A;  4GRF A;  4ZL7 A;  2O85 A;  5DQY A;  3TGZ A;  1U87 A;  5IMF A;  3RHC A;  2YWN A;  4IQ1 A;  2LNT A;  3LXT A;  4MK3 A;  4X43 A;  4JZQ A;  2WFC A;  1R26 A;  2DKI A;  3IC8 A;  2WRT A;  4XS6 A;  4GST A;  2PU9 C;  3QPM A;  2JU5 A;  4KB3 A;  5AN1 A;  3UAP A;  4EIQ A;  4JRR A;  3UJ1 A;  3F4T A;  4G10 A;  1XWA A;  3KP9 A;  2PVO C;  4GF0 A;  5EVO A;  1BYE A;  5CRD A;  1V40 A;  2M46 A;  2VL2 C;  4K5R A;  1C72 A;  2GTU A;  1WRY A;  4HU9 A;  5DAL A;  4I2U A;  2DIZ A;  2IMD A;  4IGJ A;  5AIX A;  5AGY A;  3JCM L;  4Q5Q A;  1HD2 A;  2YZU A;  4K0N A;  3H1N A;  3IAM 2;  5CRH A;  4KCA A;  5KN2 A;  2YZH A;  3LYK A;  2YN1 A;  2HZE A;  5HQP A;  4FYU A;  3HJM A;  1B9Y C;  3EU3 A;  4EKZ A;  2YP6 A;  1AC1 A;  1HQO A;  4AJ6 A;  2C3N A;  4QQ7 A;  4TRX A;  4ZBD A;  1TDI A;  3F4R A;  3G7Y A;  1ZYQ B;  2UZ8 A;  4WR4 A;  4IEL A;  4ECC A;  2HRF A;  3ZRD A;  1ACV A;  4TVE A;  1YF0 A;  2H76 A;  4YQU A;  2X49 A;  5ECK B; 
#chains in the Genus database with same CATH homology
 1K3Y A;  4A5P A;  2VOC A;  4J56 E;  2O8V B;  4K6X A;  1AAZ A;  4DSS B;  4ISD A;  4GTU A;  4YKG A;  2DJJ A;  2WZ9 A;  1OYJ A;  1YF1 A;  4DSS A;  2TRX A;  4X4J A;  1ZCP A;  1G7E A;  4BA7 A;  2HRK A;  1ILO A;  1TU7 A;  3GX0 A;  2VCV A;  2YPM A;  4FO5 A;  4EE0 A;  3M3M A;  1XWK A;  2QKE A;  2X4A A;  7GSS A;  4PXO A;  2DJ0 A;  2JZR A;  1LJR A;  2AUV A;  4TW5 A;  5IMC A;  3F8U A;  2FWG A;  5G1K A;  1JLV A;  3QAW A;  5ECQ B;  3FRC A;  4HS1 A;  3ZTL A;  2LQQ A;  4V2N A;  2MMO A;  2V6O A;  3LG6 A;  5A4V A;  4YH2 A;  4KCE A;  2CAI A;  4G0L A;  1EWX A;  3F9U A;  4MAB A;  4CY6 A;  2OE3 A;  4EL1 A;  1K0C A;  1RW1 A;  3KZQ A;  4XS1 A;  1PL2 A;  2LV3 A;  1SJI A;  2CV4 A;  2VCT A;  2KHP A;  2DC5 A;  2OE0 A;  1M0U A;  2WGR A;  2H1D A;  3C1R A;  1PD2 1;  3P90 A;  4AF2 A;  4RI7 A;  4HU7 A;  3FHK A;  2GSR A;  2DML A;  1I9D A;  4KH7 A;  2JAD A;  4D73 B;  1PQN A;  1X9W B;  3FEU A;  4NXI A;  1EEM A;  1KNG A;  3APQ A;  4LMW A;  1SEN A;  4XHM A;  4OO4 A;  1S3C A;  4D73 A;  1GWC A;  5H5S A;  3HA9 A;  2LS5 A;  4ICY A;  4GQF A;  3G7J A;  4G2E A;  3CMI A;  5GAN D;  4MMM A;  1SYR A;  2GS3 A;  12GS A;  1ZZY A;  3ZRE A;  5IO0 A;  6GSV A;  5G1L A;  1K0M A;  3EE2 A;  2IWT A;  3HDC A;  3Q18 A;  2C4J A;  4G19 A;  2PMT A;  2KUC A;  4KA0 A;  1Z9H A;  2EIQ A;  3UVH A;  2ZNM A;  4CW9 A;  3D6I A;  2CVK A;  5IMV A;  3RBT A;  4DSQ A;  3F63 A;  1GUL A;  3TOU A;  1M9A A;  3RPP A;  3TJB A;  5IM9 A;  2LST A;  1O8W A;  1DBY A;  3CTF A;  1F6M C;  1X9M B;  2ZCT A;  3OR5 A;  4PQ1 A;  2H75 A;  5GAP D;  4K7I A;  1MEK A;  2B7J A;  2YV9 A;  1J9B A;  4NV5 A;  5EY6 A;  2X64 A;  1GSY A;  1PMT A;  2HZF A;  4N30 A;  5CRE A;  4IVF A;  3GX8 A;  3FMW A;  1HNC A;  1OKD A;  1FO5 A;  3TKP A;  2AB6 A;  3ISO A;  3IV4 A;  4FIW A;  2G2Q A;  2VL2 A;  4MPF A;  4IW9 A;  3GSS A;  2NBS A;  1SL1 B;  1K0B A;  4YAP A;  4HQZ A;  2B5E A;  3KH9 A;  2HNL A;  1O73 A;  4O5R A;  3GST A;  2BMX A;  4KSM A;  3F3Q A;  4PGT A;  5FT3 A;  1W4V A;  2O87 A;  1K0O A;  4J57 E;  1OAZ A;  3TB2 A;  3GKN A;  2O89 A;  1OVN A;  4IBP A;  4XTS A;  2FY6 A;  3HVX A;  5HR2 A;  5JCG A;  3RAZ A;  1PN0 A;  3UL3 A;  1UVZ A;  1ZL9 A;  2H01 A;  3IHG A;  3M9J A;  4I97 A;  1JZR A;  3UAR A;  4XS4 B;  1XWB A;  1PRX A;  3BD2 A;  1A0F A;  4H86 A;  5CAX A;  3H93 A;  2AAW A;  2GZP A;  4XS4 A;  2H6Z A;  3IC4 A;  1GUM A;  3CYN A;  4OMV A;  5ELA A;  2H73 A;  4KGI A;  3QOU A;  3D0Z A;  1H4O A;  2PWJ A;  2PVQ A;  4HZ2 A;  3IK7 A;  3UIW A;  1NSW A;  4ZXG A;  2E2M A;  1GSQ A;  1EGO A;  3KD0 A;  2R3X A;  3FR6 A;  1AUC A;  4ZIJ A;  3N9J A;  4IP1 A;  2FCH A;  2I1U A;  3AY8 A;  1ZMA A;  1G0T A;  4HEA 2;  3K8N A;  3DKS A;  1F3A A;  3TJG A;  2LTK A;  4PNF A;  4EIP A;  2H71 A;  1ML6 A;  1EP7 A;  4K2X A;  4MZW A;  1XVW A;  4POM A;  2V1M A;  2L6C A;  3L9S A;  5KN3 A;  3KCM A;  4XRA A;  2VCZ A;  5ECP B;  2LUS A;  5DAK B;  1XZO A;  4YAV A;  3EVI A;  1BG5 A;  3CSJ A;  1UA5 A;  4WBR D;  4NMU A;  5JCU A;  5DAK A;  16GS A;  5IOW A;  4KDY A;  2A4H A;  3TRP A;  2NPB A;  4X0X A;  5ID2 A;  3J7Y b;  3Q74 A;  4G0K A;  3MNG A;  3ZIT A;  1MTC A;  4RQR A;  3GKK A;  4O7H A;  5HR0 A;  3TJF A;  1A2M A;  1ZYN A;  2JL4 A;  4MH2 A;  4LL4 B;  1NHO A;  1YEP A;  3IA1 A;  3ZIV A;  4BWS A;  2CVB A;  1E6B A;  2HSY A;  2RUE A;  2L4C A;  3ERF A;  2GT6 A;  4YKF A;  2I3Y A;  4PUF C;  2X8H A;  4MF6 A;  3EIN A;  2DBC A;  3TRQ A;  4K7O A;  3FKF A;  1YZX A;  4N0Z A;  3A2X A;  4XRD A;  2C8U A;  3ZIJ A;  2VCX A;  2R0G A;  3GNJ A;  3GH9 A;  2B5Y A;  2GVP A;  3ME7 A;  1O81 A;  2IJY A;  2J23 A;  3F0I A;  4KX4 A;  1EGR A;  2WS2 A;  3FR9 A;  1VF3 A;  2LJR A;  3CBU A;  5GSS A;  2L59 A;  3WGD A;  3ZMK A;  4HI7 A;  2CVD A;  3CSI A;  4YQV A;  1PKW A;  2RM5 A;  3LXZ A;  5H5R A;  3GYK A;  2F8F A;  2C80 A;  1PX7 A;  1NW2 A;  2CX4 A;  2RLI A;  2VLT A;  2PBJ A;  3QAG A;  1W89 A;  2L5O A;  1T7P B;  3NIV A;  1J0F A;  1X0R A;  3UBL A;  1WE0 A;  2H1G A;  2VLV A;  2HYX A;  4LMV A;  1GUH A;  4MJA A;  3A2W A;  4L8E A;  5ECO B;  2YWI A;  1X5E A;  1TW9 A;  3EWL A;  1HNA A;  5F06 A;  3ZVJ D;  3GUR A;  2OE1 A;  5D73 A;  2LRC A;  5DCH A;  2OA7 A;  3VWW A;  4L0W A;  2HT9 A;  3VPQ A;  2C0E A;  3MSZ A;  4K5S A;  3TJJ A;  3BCK A;  2J9H A;  1FOH A;  1YQ1 A;  5F07 A;  4TR1 A;  2H66 A;  2C0F A;  1GP1 A;  1K3L A;  1FVK A;  3TDG A;  4Q5F A;  4F82 A;  1N2A A;  1S3A A;  2FHE A;  3GL5 A;  1XWC A;  1O6J A;  2K8V A;  5J5N A;  3DEX A;  2FWF A;  5HR3 A;  6GSS A;  2GST A;  2NDO A;  1ERT A;  3HZ8 A;  1JZD A;  1GTA A;  9GSS A;  5B8B A;  4ML1 A;  4HJ2 A;  4TOP A;  1JZO A;  3ED3 A;  2ES7 A;  3EUR A;  1PA3 A;  1Y25 A;  1A8Y A;  1BAY A;  1MDI A;  5DAL B;  2DJK A;  4JR6 A;  2FWH A;  1TOF A;  3A5W A;  1THO A;  2VO4 A;  4KDU A;  1FOV A;  2HZE B;  2P5R A;  3C7M A;  3TOT A;  4O5Q A;  5D9X A;  3CSH A;  4ML6 A;  4NHZ A;  2GDR A;  2WDU A;  2P5Q A;  3DVX A;  3VK9 A;  3IRA A;  2PUK C;  2KP2 A;  1M99 A;  1XW6 A;  2H0I A;  2B6M A;  2H74 A;  5HFI A;  4Z2R A;  1Z7R A;  2IFQ A;  4MDC A;  1F3B A;  4MNN A;  1QFN A;  4LA1 A;  3A5I A;  6GSW A;  5ECH B;  3C8E A;  4BL7 B;  1XWG A;  5AIV A;  4BL7 A;  1GNW A;  4OCE A;  2HRN A;  3ZYW A;  3LSZ A;  2A2R A;  4ECJ A;  4IHU A;  3V1W A;  3VFI A;  2R4V A;  3F6D A;  3KEB A;  1SJ6 A;  1XXU A;  3C73 A;  5L71 A;  3FZ5 A;  1B8X A;  2YCD A;  1K0N A;  2B7K A;  1XW9 A;  3IK9 A;  2ALB A;  1AW9 A;  2I4A A;  3US3 A;  1V58 A;  5J41 A;  3UBK A;  2EIR A;  1IYI A;  1Z6N A;  2GQL A;  4WKW A;  1GLP A;  3LEF A;  2AHE A;  1VRS D;  1XPV A;  2WB9 A;  1AXD A;  5KOW A;  3PIN A;  4USS A;  1EOH A;  4K1F A;  2QGV A;  5D9V A;  2R0P A;  5DBQ A;  1TXX A;  5C04 A;  4ECI A;  1E2Y A;  1X5C A;  3HJO A;  3QMX A;  5ECS A;  1USB A;  1VF1 A;  4JED A;  1QGV A;  5IMZ A;  3L0H A;  4L5L A;  5BMU A;  2H6Y A;  3GN3 A;  2N5B A;  1MDJ A;  3F6F A;  4BPY A;  5ECN B;  5A4W A;  4K8M A;  1GNE A;  2H1A A;  3IDV A;  1SL0 B;  3PH9 A;  2L6D A;  3D21 A;  2F3M A;  1ST9 A;  5HFG A;  1JHB A;  2E0Q A;  2B5X A;  3KXO A;  1GSF A;  1GUK A;  1DE1 A;  3E0U A;  4I6X A;  1GSE A;  1TK0 B;  1SD8 A;  2D2Z A;  14GS A;  4HJM A;  3RPN A;  4MJE A;  3KTB A;  3GRX A;  5KOX A;  5D93 A;  4ZL8 A;  4HUA A;  5ECI B;  1GL8 A;  1Z7P A;  4ZIL A;  2QA1 A;  4ZBB A;  2VAF A;  4XCS A;  1FAA A;  5DJL A;  1OE7 A;  1LU4 A;  1FW1 A;  4GLT A;  3QFA C;  1OKT A;  18GS A;  1B48 A;  2M72 A;  4EDY A;  3Q6O A;  1A2J A;  2R37 A;  5JWR B;  5J9C A;  1Q4J A;  2VCW A;  2H70 A;  1A24 A;  3GH6 A;  1U3I A;  4N10 A;  3HY2 A;  1GSU A;  1M2B A;  4L0U A;  3HJP A;  4GXZ A;  1ZYE A;  4NAX A;  2K18 A;  3UEM A;  1Z5Y E;  2YNX A;  4POL A;  4WR5 A;  1A0R P;  1TRV A;  2FGX A;  4OCF A;  4TR0 A;  4KF9 A;  8GSS A;  2R2J A;  4O92 A;  4OFT A;  2GSS A;  3MAK A;  1OC9 A;  1VGL A;  2GQM A;  4QL7 A;  1G6W A;  1SK1 A;  4AJ8 A;  3L4N A;  4WF4 A;  5IMD A;  4IJI A;  3GMF A;  1ZYP A;  5IPH A;  2C0D A;  1JFU A;  4GSS A;  4N0V A;  3A2V A;  2GZZ A;  4MZB A;  3L78 A;  5CP1 A;  3TKR A;  3QFB C;  2GT5 A;  2VLU A;  3VWV A;  5JCW A;  1TTZ A;  1G7O A;  4E8H A;  1TK5 B;  1PN9 A;  11GS A;  1V9W A;  3GFK A;  1Y6E A;  3I6A A;  2F8A A;  4MJC A;  2TRC P;  2IMI A;  2H1B A;  4N11 A;  4KUN A;  4MJB A;  2I81 A;  4MF5 A;  1THX A;  5HR1 A;  1X9S B;  1G6Y A;  4OWY A;  3D4T A;  2C1Y A;  1B9X C;  3KMO A;  3P8W A;  5GZZ B;  4ID0 A;  1PGT A;  3G7I A;  4QL9 A;  3TKS E;  4KE3 A;  2E7P A;  2LKU A;  3LOR A;  4Q5R A;  3CRU A;  2YOI A;  3EMP A;  4IKH A;  1EV4 A;  1CQH A;  2WJU A;  2DSA A;  1SJZ A;  2R0C A;  2HSM A;  4K9Z A;  2G0F A;  2IME A;  1YDK A;  1XW5 A;  3KMN A;  2V41 A;  4ZL9 A;  4MA9 A;  2H30 A;  3GKM A;  3I43 A;  3LJR A;  4K7N A;  1TRS A;  5ID2 B;  1JLW A;  5D8I A;  2FNO A;  1Z3E A;  2XBQ A;  3Q19 A;  3W8J A;  1T3B A;  17GS A;  1SYX A;  4WXT A;  3TRX A;  3BJ5 A;  3EYT A;  20GS A;  3DVW A;  2IL3 A;  3GA4 A;  1K3O A;  5A4U A;  5G5E A;  3KH7 A;  1ERW A;  3GHA A;  1U3A A;  1TRW A;  1XVQ A;  1I5G A;  1SK2 A;  5D9T A;  2YWM A;  5CO3 A;  3LQ7 A;  2KP1 A;  4HQS A;  3PGT A;  1YKC A;  3WD6 A;  5F8B A;  3R3E A;  2WUL A;  4TR4 A;  4OFM A;  1URM A;  1R5P A;  2FWE A;  3RDW A;  2VD1 A;  4IS0 A;  3MYD A;  3VPT A;  4V2M A;  4WBJ A;  4JBB A;  4EUY A;  3DML A;  3IE3 A;  5LNK e;  2FLS A;  3EU4 A;  1FVJ A;  3VWU A;  3KTL A;  22GS A;  2CZ2 A;  2L57 A;  1JZW A;  5G30 A;  2CX3 A;  2TIR A;  3UOM A;  1X5D A;  3R2Q A;  5DDL A;  1TI3 A;  5AIS A;  1UN2 A;  2X8C A;  1BQ7 A;  5F0G A;  2HRA A;  5DQS A;  4ILF A;  4BWQ A;  2OJL A;  4IN0 A;  2N5A A;  5IPG A;  1VF4 A;  1F9M A;  4TR1 B;  5JWO B;  3DYR A;  2MMA A;  2XPE A;  5B8A A;  4YQM A;  3I69 A;  2V6K A;  3P2A A;  1QQ2 A;  3VI5 A;  4NPB A;  2AV4 A;  4PQH A;  4ZB6 A;  13GS A;  3ZVJ A;  3HHV A;  1F2E A;  1SKR B;  1FB0 A;  1M2D A;  5D9W A;  4GSN A;  1OC8 A;  3GTU B;  4J2F A;  2JZS A;  1NHY A;  2DIY A;  2GGT A;  3IAS 2;  1RQM A;  2LJA A;  4JU5 A;  6GSY A;  1IYH A;  2FUG 2;  2CAQ A;  2HFD A;  1U88 A;  3GTU A;  4GWR A;  4TKY A;  4MLY A;  1QUW A;  2NVL A;  2AYT A;  5E4W A;  3LW9 A;  1GSS A;  2VM2 A;  2MMZ A;  19GS A;  3H8Q A;  3IHQ A;  3A3T A;  1PSQ A;  3TUE A;  1LBK A;  1A2L A;  3WGE A;  2BTO T;  3ME8 A;  2H72 A;  3EPT A;  1WJK A;  4KSO A;  5DVB A;  2REM A;  2GZY A;  5J9B A;  2VUP A;  1UC7 A;  5KN1 A;  1ZOF A;  1EOG A;  3IBH A;  3ZML A;  5LCZ A;  3ZFB A;  4FYB A;  4F0C A;  2Z9S A;  1EZK A;  4JR4 A;  2VD0 A;  2IFQ B;  4KDX A;  2HLS A;  3IOS A;  4EXJ A;  3O3T A;  1GTI A;  2VM1 A;  3FW2 A;  4PUR A;  4IP6 A;  2QC7 A;  2GQK A;  1KEB A;  5EL8 A;  2JAC A;  1SKW B;  2LEG A;  3DGQ A;  1B4P A;  2OBK A;  3PPU A;  3TKQ A;  4MZC A;  1FHE A;  5ECR B;  3DWV A;  2XC2 A;  3VI7 A;  4HOJ A;  2A2P A;  3E9J B;  4KAE A;  3D5J A;  4OFN A;  3O76 A;  2V32 A;  3TKS C;  2FA8 A;  2F9S A;  2HXK A;  2ON5 A;  3L9U A;  3WT1 A;  2YJH A;  1A23 A;  1XOA A;  3HD5 A;  1EV9 A;  2X8G A;  3IR4 A;  3O6T A;  3FZ9 A;  3L9V A;  1ON4 A;  2HE3 A;  3TJK A;  4V1A p;  3DRN A;  1V57 A;  2P31 A;  3ERG A;  5BRT A;  3IXR A;  1MDK A;  4MCU A;  2IMF A;  2CQ9 A;  1CQG A;  2PER A;  4Q5N A;  5ELG A;  2MMN A;  3GUS A;  2DJ1 A;  3M9K A;  2K6V A;  2C3T A;  5ABR A;  4G9H A;  5IMA A;  2XBI A;  2LQO A;  3LWA A;  3WGX A;  3WT2 A;  2JSZ A;  2MZC A;  1YJ6 A;  3D22 A;  4XIH A;  3HXS A;  1ERU A;  2OKA A;  3GL3 A;  2MBS A;  5D96 A;  1KTE A;  5FWG A;  2PN8 A;  4TXV A;  3W6G A;  1GTU A;  2IIY A;  1TU8 A;  4PTS A;  4WET A;  2VL3 A;  4IQA A;  2L4Q A;  2ON7 A;  3GKX A;  2BJX A;  3F4S A;  1V2A A;  1ABA A;  5KEJ A;  3FR3 A;  4V2L A;  2YWO A;  3E3E A;  2ZUP A;  3CTG A;  5CYY A;  2H8L A;  3IPZ A;  1TKD B;  1EP8 A;  1YY7 A;  1QK8 A;  3ERW A;  2IMK A;  2YV7 A;  1T4Y A;  1J08 A;  2N5F A;  3SBC A;  5DJM A;  2PGT A;  4DSR A;  1VF2 A;  1O85 A;  2XPD A;  1SL2 B;  3UVT A;  4ZB9 A;  3G9B A;  4FH8 A;  5HFK A;  4KND A;  3ZFL A;  4V1A g;  1RK4 A;  1XFL A;  2KOK A;  4L5O A;  4KW6 A;  2VCQ A;  5A5K A;  10GS A;  2FD3 A;  2RUF A;  1AIU A;  1GSD A;  3P7X A;  1R7H A;  4GQC A;  5C00 A;  3HVV A;  3KJY A;  2OAC A;  4ZBA A;  1XBS A;  5E59 A;  4Z2T A;  1M7T A;  2H6X A;  5B7C A;  1XIY A;  4I8B A;  5F05 A;  1WOU A;  5G31 A;  4RQX A;  3VWX A;  3N5O A;  4DEJ A;  3D4M A;  3FYG A;  4TXO B;  3W8S A;  4MPG A;  3U5R E;  3M8N A;  4X1U A;  4EO3 A;  2XHF A;  4TXO A;  2KLX A;  1A8L A;  1DUG A;  2DMM A;  1OE8 A;  2P0G A;  5IO2 A;  2A2S A;  2R5G A;  4MP4 A;  5ENU A;  2LJK A;  4RUV A;  4POB A;  3KP8 A;  1ZGN A;  3BBY A;  1GRX A;  1OC9 B;  5H5Q A;  4PNG A;  1T8E B;  2HSH A;  2HI7 A;  1R5A A;  3ZZX A;  3DXB A;  3MIX A;  4ULX A;  4JE1 A;  2YAN A;  4DVC A;  2CT6 A;  5CRW A;  3FZ4 A;  3APO A;  4EDZ A;  4G0I A;  4O5U A;  2YJ7 A;  4AJ7 A;  5IIZ A;  3BOA A;  1SKS B;  1BED A;  1BJX A;  1WIK A;  2H0H A;  1WP0 A;  4LLR A;  5IOX A;  3DIE A;  1PX6 A;  5FHI A;  1TI1 A;  3UMA A;  1QMV A;  5J4U A;  4Z7X A;  5CRG A;  1AQV A;  2LRN A;  3QAV A;  4CHS A;  5B6N A;  3HCZ A;  4OO5 A;  4NWY A;  1GLQ A;  1SD9 A;  5J3R A;  1K0A A;  3KIJ A;  1T00 A;  2O7K A;  1AQW A;  2DLX A;  1QXH A;  5B6M A;  3HKR A;  4WF5 A;  3KM6 A;  2I9H A;  3TKS A;  1HNB A;  5KN0 A;  4BVX B;  3I9V 2;  3CXG A;  3GIX A;  3TCO A;  4ACS A;  4HZ4 A;  2WCI A;  2LNS A;  4BVX A;  2QSI A;  3DD3 A;  1DSB A;  3M1G A;  3GV1 A;  6GST A;  1BX9 A;  3NOF A;  1M2A A;  4FYC A;  4I5Q A;  1T4Z A;  3HVS A;  5ECM B;  2X99 A;  1SK0 A;  6GSU A;  3SWL A;  2QA2 A;  5IQY A;  4F0B A;  2GLR A;  1K0D A;  1FB6 A;  5CNW A;  1O7U A;  3M0F A;  4F03 A;  4GCI A;  1WPI A;  3EC3 A;  2PPT A;  1DE2 A;  3LYP A;  1R4W A;  1HYU A;  4FQU A;  1V98 A;  4IJ3 A;  2C3Q A;  1S3D A;  2B3S A;  4TR3 A;  3ZLP A;  3WYW A;  6GSX A;  3QCP A;  1AQX A;  3APS A;  5INY A;  5DCG A;  2LRT A;  2E2G A;  1PL1 A;  4K0G A;  4OD7 A;  3ZL5 A;  4E8E A;  2L5L A;  2DJ3 A;  2DKH A;  2M80 A;  3U6V A;  4EC0 A;  3KGK A;  3VLN A;  1WWJ A;  4CDO A;  1B4Q A;  4MF7 A;  5EPF A;  4POK A;  2OBI A;  2CZ3 A;  2MYG A;  5G5F A;  5G2Z A;  4O32 A;  2EC4 A;  4NHW A;  4AGS A;  5COH A;  3HZ4 A;  1PKZ A;  3C1S A;  2MBT A;  3C71 A;  2A4V A;  4F9Z A;  3FZA A;  1TJD A;  2RII A;  3FK8 A;  2JZT A;  2RM6 A;  2F51 A;  2AJQ B;  1SU9 A;  4TN8 A;  2B1L A;  3RHB A;  1O8X A;  1U6T A;  4HDE A;  1XCC A;  2VIM A;  3PR8 A;  2IPA A;  2FA4 A;  2K8S A;  2V2G A;  5LD0 A;  1N8J A;  1WMJ A;  5JWQ B;  4PUA A;  3S9F A;  3H4K A;  1YEX A;  4F2I A;  1M9B A;  3QDN A;  1XOB A;  1GH2 A;  1FG4 A;  1NM3 A;  3MWH A;  4CY8 A;  1TK8 B;  2OAD A;  2H0G A;  4PQI A;  2H19 A;  1Q98 A;  3BCI A;  1GTB A;  4LL1 B;  4RI6 A;  3QD9 A;  4WEY A;  3LGC A;  2C0G A;  3CRT A;  3LFL A;  4MH3 A;  3MDK A;  2R6K A;  4EF0 A;  1Z6M A;  2CA8 A;  1TP9 A;  4EVM A;  2JSY A;  5GST A;  1MD4 A;  4BVY B;  3J7Y k;  3H79 A;  4Z2U A;  1OC3 A;  2GSQ A;  2B1K A;  3F3R A;  1KBN A;  4PX1 A;  1EEJ A;  3VUR A;  2DJ2 A;  4NV2 A;  1F37 A;  4P3Y B;  4ZB8 A;  5ECL B;  1TRU A;  4BVY A;  1ERV A;  3NZN A;  1T1V A;  2IN3 A;  1YKA A;  2K9F A;  3HYP A;  1H75 A;  3EMX A;  3FY7 A;  3QR6 A;  1MD3 A;  2EIO A;  2NTO A;  4I2T A;  4K2D A;  2VL9 A;  4ECB A;  4GRF A;  4ZL7 A;  2O85 A;  5DQY A;  3TGZ A;  1U87 A;  5IMF A;  3RHC A;  2YWN A;  4IQ1 A;  2LNT A;  3LXT A;  4MK3 A;  4X43 A;  4JZQ A;  2WFC A;  1R26 A;  2DKI A;  3IC8 A;  2WRT A;  4XS6 A;  4GST A;  2PU9 C;  3QPM A;  2JU5 A;  4KB3 A;  5AN1 A;  3UAP A;  4EIQ A;  4JRR A;  3UJ1 A;  3F4T A;  4G10 A;  1XWA A;  3KP9 A;  2PVO C;  4GF0 A;  5EVO A;  1BYE A;  5CRD A;  1V40 A;  2M46 A;  2VL2 C;  4K5R A;  1C72 A;  2GTU A;  1WRY A;  4HU9 A;  5DAL A;  4I2U A;  2DIZ A;  2IMD A;  4IGJ A;  5AIX A;  5AGY A;  3JCM L;  4Q5Q A;  1HD2 A;  2YZU A;  4K0N A;  3H1N A;  3IAM 2;  5CRH A;  4KCA A;  5KN2 A;  2YZH A;  3LYK A;  2YN1 A;  2HZE A;  5HQP A;  4FYU A;  3HJM A;  1B9Y C;  3EU3 A;  4EKZ A;  2YP6 A;  1AC1 A;  1HQO A;  4AJ6 A;  2C3N A;  4QQ7 A;  4TRX A;  4ZBD A;  1TDI A;  3F4R A;  3G7Y A;  1ZYQ B;  2UZ8 A;  4WR4 A;  4IEL A;  4ECC A;  2HRF A;  3ZRD A;  1ACV A;  4TVE A;  1YF0 A;  2H76 A;  4YQU A;  2X49 A;  5ECK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...