1QMVA

Thioredoxin peroxidase b from red blood cells
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
196
structure length
195
Chain Sequence
SGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN-2
publication title Crystal Structure of Decameric 2-Cys Peroxiredoxin from Human Erythrocytes at 1.7 A Resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 65
structure length 195
sequence length 196
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 1999-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1qmvA00
4K7NA 4PUAA 5CRDA 5D8IA 2WGRA 1V58A 1TRVA 3CSHA 5B6MA 5DALA 3GTUB 4MH3A 4ZB6A 5ECLB 5HR0A 3WD6A 1JZOA 2CA8A 2RIIA 3BCIA 3UVHA 3QOUA 1M7TA 2AAWA 3GURA 5IMVA 4V2MA 1LBKA 1VGLA 1A8LA 2DJKA 4EVMA 2LRNA 4LL4B 5CYYA 2B6MA 3C1RA 3RDWA 2IFQB 1U3IA 4POKA 1GLPA 3GKXA 1IYIA 3A2WA 3I43A 5INYA 3HVSA 2E7PA 18GSA 3HA9A 4HU9A 1PMTA 2M46A 3D22A 4TRXA 2EIOA 3EMPA 1KNGA 1C72A 3GTUA 3FR9A 4HJ2A 4EF0A 3GKNA 1SD8A 1UVZA 3SWLA 5A4VA 1XW9A 2B5XA 3FR3A 3DWVA 4XTSA 2RUEA 1WE0A 2YJHA 3C73A 2IFQA 3KXOA 2XC2A 3TKSA 5IO2A 5KN1A 2I3YA 2AB6A 2JSZA 5JCWA 1DBYA 3LXTA 2CV4A 3ZTLA 7GSSA 2E0QA 3C7MA 4KX4A 1EOHA 5GZZB 19GSA 2L6CA 3R2QA 2P5QA 4GSSA 3HYPA 4OMVA 2B7JA 4WBRD 2FUG2 4GTUA 3CSJA 1DSBA 3QAVA 1FVKA 5B8BA 3VK9A 3DVXA 3F9UA 5H5SA 4IJ3A 1YZXA 1FOVA 1S3DA 1SENA 3IHQA 1ZCPA 5COHA 3ZLPA 2BTOT 2FWEA 1SD9A 3LWAA 4OD7A 3L0HA 4FYCA 3W8JA 1G6YA 1TI3A 1XCCA 4GRFA 2YANA 4K0NA 1K0OA 3M9JA 2CT6A 2FA8A 3V1WA 5JCUA 3EYTA 3GUSA 3F63A 5B7CA 2V41A 2F8AA 2YPMA 3GRXA 3IE3A 2H1GA 2K8VA 1NSWA 3GSTA 4OO5A 3ZL5A 5G5FA 5GSSA 2OACA 4RQXA 4MJEA 4XS1A 2I1UA 4GF0A 2H66A 1JZDA 4RI7A 6GSSA 1ST9A 4G19A 4KSMA 1O73A 1MTCA 3RHCA 1GSYA 1BG5A 4HJMA 5DBQA 4GXZA 1GUMA 4TR4A 2XPEA 1HD2A 2PN8A 3US3A 5CO3A 4Q5QA 2GSRA 4BWSA 1TDIA 2C80A 5D9WA 4Q5FA 2L5LA 3GIXA 3IR4A 3ME8A 5LCZA 2IMEA 5KEJA 5IMFA 2K6VA 2GT6A 1YY7A 3G9BA 2C1YA 4ZILA 4LL1B 2CAIA 4IKHA 16GSA 3GV1A 2MBSA 5IOXA 2YWOA 4JU5A 1M99A 1SYRA 3WGDA 5G1KA 3C8EA 4TOPA 5ELGA 4PQHA 3VWUA 1WJKA 2PUKC 2GZZA 1OC9B 3EC3A 5HR2A 4MF6A 4ECCA 1ZYEA 3I9V2 4WR4A 1RQMA 2PVOC 5ECIB 3PR8A 2LKUA 1GWCA 4G10A 3IK7A 3QAGA 2DMMA 4HU7A 2VL3A 2NDOA 4Z7XA 2GLRA 4HI7A 4IW9A 1I9DA 2FY6A 3VLNA 4JBBA 2E2MA 6GSYA 1J08A 2C3QA 2M72A 1MDIA 1R4WA 1RW1A 5ECRB 2L59A 3ZVJD 1FHEA 3ZRDA 3KH7A 2N5FA 1EGOA 4N11A 3EE2A 4HDEA 4O7HA 3I69A 2A4VA 3VPTA 1XOBA 2GGTA 1GSDA 1X9SB 1Z9HA 1A2JA 2NVLA 5GAND 1PKZA 2OA7A 4KGIA 4MH2A 2HNLA 2XBQA 1X5CA 2TRCP 2HSHA 1PGTA 1OE7A 4DSSA 3TKPA 1ERUA 2GS3A 1EV9A 2LNTA 4YQMA 2OJLA 4N10A 3D0ZA 4IP6A 3GHAA 3LJRA 2B1KA 3DMLA 2L4CA 3TJFA 3KCMA 3DRNA 2EIQA 3LORA 3EWLA 3BJ5A 5J9BA 2VM2A 1BAYA 2REMA 3RPNA 1SJZA 4ACSA 14GSA 1X5DA 2MMOA 3CRUA 5EL8A 3APOA 3UJ1A 6GSUA 1X5EA 1M0UA 4KA0A 2B1LA 5DDLA 1OKTA 2IN3A 5ECHB 1T8EB 3FHKA 1TTZA 4POMA 4IBPA 1WOUA 2KOKA 2X99A 3HCZA 4N0VA 1SJ6A 1T7PB 3A3TA 2DIYA 3EU3A 4J56E 1RK4A 3IXRA 3FZ9A 4JR4A 1SL0B 1FB6A 1Y25A 4K8MA 4QL9A 2IMKA 2VCTA 5CP1A 1X0RA 4IN0A 3FR6A 5ELAA 3TUEA 4IGJA 3LSZA 5G31A 2JU5A 4TW5A 3L9VA 1GTAA 1OC8A 3KMOA 2WRTA 3GL5A 2YV9A 2LJRA 3P7XA 1WWJA 4MDCA 2C4JA 5HQPA 4OO4A 2N5AA 3MAKA 3TCOA 4F0BA 1Q98A 2R6KA 5JWQB 3F3QA 1GRXA 3O6TA 2YOIA 1R26A 2HYXA 4Q5NA 2IPAA 3VWWA 3PGTA 3UAPA 2LNSA 1DUGA 1F3BA 1A24A 1QMVA 4ECJA 2VCVA 1PD21 2F51A 2CX3A 4IP1A 3CXGA 4F2IA 1GNWA 1HNAA 2X8HA 2LQQA 3ZFLA 2LS5A 3IAS2 2CZ3A 3HJMA 5D93A 2L4QA 1K3YA 2H0IA 1CQHA 1T00A 1MEKA 2HXKA 2J9HA 2OE3A 4N0ZA 2X8GA 4PXOA 1WP0A 3CYNA 2OBKA 4Q5RA 3ISOA 3GSSA 2IMIA 2QC7A 1ZYQB 1S3CA 4PX1A 1QUWA 1GTUA 4KNDA 4BWQA 1PL2A 2VD1A 1G6WA 2LUSA 1W4VA 3Q18A 2FCHA 3TKSE 5ABRA 2RM5A 4NPBA 1A23A 3KIJA 3KP8A 2GQKA 1ZOFA 2YZHA 5LD0A 2CZ2A 4JZQA 1N2AA 3DD3A 4ZBDA 1BYEA 1LJRA 6GSWA 4EC0A 2H0GA 2LSTA 1AQVA 5ECSA 1HNBA 4O5RA 3W6GA 3HJPA 1O6JA 3GFKA 4OCFA 1VF4A 3PINA 2LQOA 4ZXGA 3E0UA 5KN0A 2DJJA 1GNEA 4MZWA 1V40A 4NXIA 4IVFA 3TOTA 4V1Ag 3HVVA 1PA3A 1Z7RA 4L5LA 4X0XA 3WGEA 6GSVA 4MF5A 4MZCA 4EE0A 1ACVA 3ZMKA 2IJYA 1SK0A 2C0GA 2GZPA 2YWIA 4X43A 5AISA 3W8SA 3ZVJA 1GL8A 2HSYA 3H1NA 3Q19A 2KUCA 3P90A 3QCPA 1UN2A 4WBJA 3TOUA 1FAAA 3MDKA 1K3LA 2H1DA 4ZIJA 4MPGA 3TRXA 2FWGA 4ILFA 5DJMA 3BCKA 5J41A 1PN9A 5IIZA 1PRXA 2GVPA 1K0DA 2R2JA 1AQXA 4F03A 3KM6A 1DE1A 5AIVA 3J7Yk 2CQ9A 4EDZA 2JZSA 5ECNB 4FYBA 1Z6MA 3F6DA 2I9HA 2WS2A 1B9YC 2VO4A 4YAVA 4XHMA 3U6VA 1U88A 4D73B 2R37A 1A2MA 4JR6A 3D6IA 1F37A 3L9SA 3CMIA 4J57E 2OKAA 2P5RA 5E59A 3GA4A 3D4MA 5A4WA 5HR1A 1EOGA 1XFLA 2VCZA 1XZOA 4ZL7A 2WJUA 4FIWA 2VL2A 3M9KA 4WF4A 3TJKA 5HR3A 4NV5A 3DYRA 1R5PA 2RM6A 1TKDB 3EURA 4IJIA 1HNCA 2F3MA 5KN3A 2C0EA 3WYWA 2H76A 2DJ0A 1F6MC 3F4RA 5DJLA 4ZB9A 2O7KA 2PPTA 2I4AA 3KTBA 2GQMA 2V6OA 1S3AA 3L4NA 1AAZA 3TDGA 1A0FA 4RUVA 3DKSA 1B48A 2VL9A 4WR5A 2FD3A 2DC5A 2YP6A 1TRUA 1KBNA 5H5RA 5HFKA 2WB9A 4ML6A 5CRHA 5J5NA 3TKSC 2AHEA 3H8QA 5FT3A 4K1FA 5DQSA 3K8NA 5GSTA 2VCXA 4LMWA 1OVNA 1R7HA 2LV3A 3D21A 1W89A 4OCEA 4I8BA 1PKWA 4GQFA 3H4KA 4IELA 4F82A 3ERFA 2AUVA 4FO5A 3RHBA 2HZFA 3CSIA 1SK1A 3LG6A 5FHIA 3ZREA 1TU8A 3DGQA 22GSA 2LRTA 2VOCA 1WMJA 1YKCA 3A2VA 2PGTA 4HQSA 3QAWA 4ML1A 1JHBA 1TK8B 4ZL8A 5F05A 2JL4A 4EXJA 4EO3A 1TJDA 1R5AA 4TR3A 1YF0A 1XW5A 2FA4A 2QGVA 4H86A 4KUNA 3WT2A 4AJ6A 3TB2A 3KP9A 4QL7A 4KSOA 2NBSA 4MJCA 5JWRB 4MCUA 4JE1A 1SKRB 3WGXA 2CX4A 3GMFA 4IQ1A 3VWVA 2LEGA 4NHZA 2JACA 2V2GA 4ID0A 3TKQA 3F6FA 3IK9A 2JZRA 5F06A 5IQYA 2ES7A 3KD0A 1QXHA 5ECKB 4XIHA 1ABAA 3Q6OA 4HQZA 1JFUA 1K3OA 3ZMLA 2H1AA 1E2YA 4V2NA 2VCWA 2B3SA 3QPMA 1XWKA 17GSA 3LQ7A 1JZWA 2DBCA 4PQIA 4PURA 1OC9A 4BPYA 1BJXA 1MDKA 2H1BA 5C04A 5LNKe 5CAXA 3IOSA 5IPHA 5A5KA 2H01A 3L78A 5IO0A 1XWGA 1CQGA 2VCQA 3F3RA 1J9BA 5DCGA 2MBTA 4DSRA 2VLVA 3M0FA 4KDUA 3TJGA 1K0NA 6GSXA 2MMZA 1Z7PA 5EVOA 3VURA 4NV2A 3DXBA 1TI1A 1SYXA 4I2UA 4KH7A 4K9ZA 2Z9SA 5ECQB 2DMLA 2H72A 1XW6A 1M2DA 4K6XA 4HUAA 4AGSA 3BBYA 3NIVA 3TRPA 1H75A 1XBSA 1JZRA 3PH9A 1VRSD 3IAM2 3IRAA 4NHWA 4MABA 4GSNA 4N30A 2IMFA 5ECOB 3MNGA 3EVIA 5JCGA 3FZAA 4G9HA 5HFGA 3CTGA 4TKYA 2CAQA 2H70A 1GTIA 1EV4A 4CDOA 1XXUA 2R4VA 3IDVA 4QQ7A 4F9ZA 4WKWA 5AN1A 1AUCA 4AF2A 1NHOA 2CVBA 3TJBA 2HZEB 4V2LA 5IMDA 2VAFA 2WFCA 1HYUA 2FHEA 2DSAA 2EIRA 5CREA 1XPVA 4MZBA 1E6BA 1XVWA 4AJ8A 3HHVA 1M9AA 2D2ZA 2KP1A 2L6DA 1K0MA 1XOAA 2OE1A 3H93A 3H79A 5DQYA 1BEDA 2CVKA 1XWAA 8GSSA 2VIMA 3AY8A 2HI7A 1SKSB 5J4UA 5ENUA 1GSUA 3VI7A 2P31A 2HZEA 4KDXA 1F3AA 4TR1B 1PL1A 4MP4A 2VLTA 2X64A 3HVXA 1KTEA 1SK2A 4MA9A 1SKWB 1G7EA 2EC4A 1TK0B 5IMZA 3A5WA 3HZ4A 3SBCA 1URMA 4IS0A 4WF5A 2FGXA 1ZL9A 4ZBAA 2HT9A 5G5EA 3G7JA 3FYGA 3QDNA 3D4TA 2C8UA 2H0HA 5B6NA 3HJOA 2LJAA 3LYKA 2IWTA 1V2AA 4TR1A 2DLXA 2DJ2A 1AXDA 4OFMA 5B8AA 4GWRA 4BVYA 1G0TA 1XWCA 2DIZA 4MF7A 1ZZYA 4G2EA 4KE3A 4GQCA 2K18A 3N5OA 3GYKA 1YQ1A 3Q74A 3FW2A 3C1SA 3GKMA 1ERVA 2ALBA 5FWGA 5ID2B 4DSQA 1M2AA 1TRWA 2H30A 3VI5A 1TK5B 4V1Ap 3G7IA 3HD5A 5CNWA 3GKKA 5F8BA 3APQA 3ERWA 4TVEA 3RAZA 4OFNA 4I6XA 2KLXA 1TW9A 3VFIA 2A2SA 3HZ8A 4EUYA 2NTOA 2ON5A 1OC3A 1NHYA 4MMMA 2FLSA 4IQAA 5ID2A 5IM9A 4MK3A 3UEMA 4HEA2 5A4UA 2FWHA 1EGRA 2M80A 2O8VB 1GH2A 1HQOA 1V57A 3U5RE 4ZB8A 3RPPA 4HS1A 1DE2A 2HE3A 1EEMA 5D9XA 4L5OA 4RI6A 3IC4A 4PNFA 1SL2B 2YWNA 3JCML 2LJKA 1M9BA 1O7UA 1NW2A 4GCIA 3QFAC 1BQ7A 3ED3A 1AIUA 1EP7A 3APSA 2KHPA 4OWYA 5G30A 2HLSA 2IL3A 3EINA 2GSTA 4LMVA 4WEYA 5H5QA 2YWMA 2F9SA 6GSTA 4OFTA 4KCEA 3DIEA 3E3EA 4EDYA 2R5GA 1SU9A 1Z3EA 4L0UA 3VPQA 4XRAA 3CTFA 2K8SA 4YQUA 3QMXA 2HFDA 3UMAA 5C00A 4L0WA 1B4QA 1O8WA 3BD2A 4PUFC 4F0CA 5IMAA 1B8XA 3KGKA 3P8WA 2BJXA 3CBUA 3GL3A 5G2ZA 1JLWA 3RBTA 5G1LA 4D73A 1GUKA 3EMXA 5E4WA 4I97A 2GDRA 3FRCA 2AJQB 3LGCA 2OBIA 4TN8A 1B4PA 4WETA 2GSSA 12GSA 2BMXA 1J0FA 2G0FA 1ON4A 5EPFA 1O81A 1EWXA 3ZFBA 3KZQA 3S9FA 2MMNA 3P2AA 1ZMAA 3UOMA 3GH6A 4XS6A 3FY7A 3UVTA 4XCSA 2PERA 1WPIA 5J3RA 4K2DA 3LYPA 2HRNA 3F8UA 2V6KA 2TIRA 1YEXA 1XIYA 4X1UA 1PQNA 3J7Yb 3C71A 2WCIA 3QR6A 5CRWA 1OE8A 2LTKA 2GT5A 2O85A 2AYTA 1EEJA 5IPGA 4MPFA 1AW9A 2ZUPA 1U3AA 1X9WB 1U87A 3GX0A 5DCHA 3TGZA 1Q4JA 3IPZA 5D73A 2L5OA 4POLA 4XS4B 3ZIVA 4ZL9A 3G7YA 3QFBC 1V9WA 3IV4A 3D5JA 2O87A 4PGTA 2VL2C 4HOJA 4KAEA 2J23A 1FW1A 2OE0A 2H71A 2R3XA 1SL1B 5J9CA 4MJBA 4ULXA 2E2GA 3MSZA 4ISDA 3KTLA 5CRGA 4DEJA 3ZZXA 5D96A 2ZNMA 4XRDA 4NAXA 2PWJA 1YKAA 4J2FA 1GUHA 1QQ2A 3N9JA 1WIKA 4POBA 4XS4A 1OAZA 1ERTA 5GAPD 2RUFA 3GN3A 2OADA 2XPDA 1YDKA 4K7IA 2AV4A 3I6AA 4EKZA 9GSSA 2JZTA 1YJ6A 2TRXA 3F0IA 2X8CA 1MDJA 3UARA 2CVDA 2JSYA 4E8HA 2C0FA 1OYJA 5AIXA 1ERWA 2C3TA 1YEPA 1KEBA 2WULA 2MYGA 2L57A 2ON7A 1O85A 2RLIA 1XWBA 2KP2A 4KCAA 4KB3A 4RQRA 4CHSA 2DJ1A 3F4TA 1I5GA 3KJYA 5IMCA 5JWOB 3A2XA 4I5QA 5ECMB 4ZBBA 4FYUA 1TRSA 2QKEA 1A2LA 3OR5A 4DSSB 13GSA 3M3MA 3HKRA 3FKFA 2YZUA 2GQLA 3KMNA 1B9XC 4TXOB 1GTBA 3DEXA 2VM1A 3NOFA 4LLRA 1N8JA 5AGYA 1OKDA 4YH2A 2YJ7A 1G7OA 1V98A 1FVJA 1NM3A 4YAPA 5DVBA 5F0GA 3UBKA 1GSSA 1PX6A 5L71A 2QSIA 4BA7A 2WZ9A 2PU9C 1M2BA 1K0CA 3GNJA 1LU4A 4LA1A 4O92A 4KW6A 1TOFA 2C3NA 3IA1A 3E9JB 2H8LA 4TXOA 3KH9A 3TKRA 3ZITA 4JRRA 3M1GA 1QFNA 4GSTA 4HZ4A 3WT1A 1UC7A 2PMTA 3FK8A 1FO5A 1FB0A 1VF2A 2C0DA 2GZYA 3UBLA 5DAKB 5D9TA 2PBJA 1QGVA 3F4SA 2H6ZA 2ZCTA 4EL1A 4BL7A 2H19A 3CRTA 3UL3A 1PX7A 4ECBA 4WXTA 2MMAA 4JEDA 1T4YA 2V1MA 1Z5YE 1U6TA 1T1VA 4AJ7A 2PVQA 3FZ4A 2H74A 3IBHA 2XBIA 1F9MA 2G2QA 2VUPA 3O3TA 4ECIA 1GP1A 4PNGA 4IHUA 1XVQA 2F8FA 1A8YA 2P0GA 3HXSA 1BX9A 1MD4A 2N5BA 1EP8A 5DAKA 1AQWA 2H73A 2GSQA 2YV7A 2VD0A 4I2TA 5F07A 2YNXA 3HY2A 4HZ2A 3GX8A 3VWXA 3TJJA 1H4OA 2IIYA 5HFIA 4BVXA 2LRCA 1ZGNA 1AC1A 1Y6EA 4CW9A 4P3YB 5ECPB 10GSA 1UA5A 1SJIA 1GSQA 3ZYWA 1T4ZA 3HDCA 2O89A 3TRQA 2IMDA 1K0BA 2HRFA 2H6XA 2MZCA 3QD9A 4GLTA 1K0AA 4YQVA 1X9MB 2YCDA 4E8EA 1TP9A 1GLQA 1O8XA 2WDUA 1JLVA 3M8NA 5EY6A 4MLYA 3LEFA 3FEUA 1GULA 2K9FA 3DVWA 5IOWA 3MWHA 1ML6A 3LXZA 1YF1A 2NPBA 1VF1A 1T3BA 4TR0A 2B5YA 4L8EA 3ZIJA 1PSQA 1USBA 3UIWA 4FH8A 3ERGA 4KDYA 11GSA 4PQ1A 3FZ5A 1Z6NA 1THOA 1QK8A 3BOAA 20GSA 4K0GA 1FG4A 4TXVA 1F2EA 4NMUA 1GSFA 1TU7A 1EZKA 1ILOA 1MD3A 3EU4A 1WRYA 5DALB 1VF3A 1GSEA 2JADA 4DVCA 2XHFA 2YN1A 2DJ3A 5D9VA 2FNOA 4MJAA 5KN2A 1TXXA 4O32A 3GH9A 3LFLA 3ME7A 2I81A 2H6YA 2B5EA 3KEBA 1A0RP 4K7OA 2H75A 2GTUA 3O76A 2A2RA 1IYHA 1THXA 2FWFA 2V32A 2B7KA 2VLUA 3L9UA 3NZNA 4NWYA
chains in the Genus database with same CATH superfamily
4K7NA 4PUAA 5CRDA 5D8IA 2WGRA 1V58A 1ZYNA 1TRVA 3CSHA 5B6MA 5DALA 3GTUB 4MH3A 4ZB6A 5ECLB 5HR0A 3WD6A 1JZOA 2CA8A 2RIIA 3BCIA 3UVHA 3QOUA 3R3EA 1M7TA 2AAWA 3GURA 5IMVA 4V2MA 1LBKA 1VGLA 1A8LA 2DJKA 4EVMA 2LRNA 4LL4B 5CYYA 2B6MA 3C1RA 3RDWA 2IFQB 1U3IA 5BMUA 4POKA 1GLPA 3GKXA 1IYIA 3A2WA 3I43A 5INYA 3HVSA 2E7PA 18GSA 3HA9A 4HU9A 1PMTA 2M46A 3D22A 3CQFA 4TRXA 2EIOA 3EMPA 1KNGA 1C72A 3GTUA 3FR9A 4HJ2A 4EF0A 3GKNA 1SD8A 1UVZA 3SWLA 5A4VA 1XW9A 2B5XA 3FR3A 3DWVA 4USSA 4XTSA 2HRKA 2RUEA 1WE0A 2YJHA 3HVNA 3C73A 2IFQA 3KXOA 2XC2A 3TKSA 5IO2A 5KN1A 2I3YA 2AB6A 2JSZA 5JCWA 1DBYA 3LXTA 2CV4A 3ZTLA 7GSSA 2E0QA 3C7MA 4KX4A 4G0LA 1EOHA 5GZZB 19GSA 2L6CA 3MIXA 3R2QA 2P5QA 4GSSA 3HYPA 4OMVA 2B7JA 4WBRD 2FUG2 4GTUA 4Z2TA 3CSJA 1DSBA 1M3JA 3QAVA 1FVKA 5B8BA 3VK9A 3DVXA 3F9UA 5H5SA 4IJ3A 1YZXA 1FOVA 1S3DA 1SENA 3IHQA 1ZCPA 5COHA 3ZLPA 2BTOT 2FWEA 1SD9A 3LWAA 4OD7A 3L0HA 4FYCA 3W8JA 4PTSA 1G6YA 3LW9A 1TI3A 1XCCA 4GRFA 2YANA 2HSMA 4K0NA 1K0OA 3M9JA 2CT6A 2FA8A 3V1WA 5JCUA 3EYTA 3GUSA 3F63A 5B7CA 2V41A 2F8AA 2YPMA 3GRXA 3IE3A 2H1GA 2K8VA 1NSWA 3GSTA 4OO5A 3ZL5A 5G5FA 5GSSA 2OACA 4RQXA 4MJEA 4XS1A 4YKGA 2I1UA 4GF0A 4CY8A 2H66A 1JZDA 4RI7A 6GSSA 1ST9A 4G19A 4KSMA 1O73A 1MTCA 3RHCA 1GSYA 1BG5A 4HJMA 5DBQA 4GXZA 1GUMA 4TR4A 2XPEA 1HD2A 2PN8A 3US3A 5CO3A 4Q5QA 2GSRA 4BWSA 1TDIA 2C80A 5D9WA 4Q5FA 2L5LA 3GIXA 3IR4A 3ME8A 5LCZA 2IMEA 5KEJA 5IMFA 2K6VA 2GT6A 1YY7A 3G9BA 2C1YA 4ZILA 4Z2RA 4LL1B 2CAIA 4IKHA 16GSA 3GV1A 2MBSA 5IOXA 2YWOA 4JU5A 1M99A 1SYRA 3WGDA 5G1KA 3C8EA 4TOPA 5ELGA 4PQHA 3VWUA 1WJKA 2PUKC 2GZZA 1OC9B 3EC3A 5HR2A 4MF6A 4ECCA 1ZYEA 3I9V2 4WR4A 1RQMA 2PVOC 5ECIB 3PR8A 2LKUA 1GWCA 4G10A 3IK7A 3QAGA 2DMMA 4HU7A 2VL3A 2NDOA 4Z7XA 2GLRA 4HI7A 4IW9A 1I9DA 2FY6A 3VLNA 4JBBA 2E2MA 6GSYA 1J08A 2C3QA 2M72A 1MDIA 1R4WA 1RW1A 5ECRB 2L59A 3ZVJD 1FHEA 3ZRDA 3KH7A 2N5FA 1EGOA 4N11A 3EE2A 4HDEA 4O7HA 3I69A 2A4VA 3VPTA 1XOBA 2GGTA 1GSDA 1X9SB 1Z9HA 1A2JA 2NVLA 5GAND 1PKZA 2OA7A 4KGIA 4MH2A 2HNLA 2XBQA 1X5CA 2TRCP 2HSHA 1PGTA 1OE7A 4DSSA 3TKPA 1ERUA 2GS3A 1EV9A 2LNTA 4EIQA 4YQMA 2OJLA 4N10A 3D0ZA 4IP6A 3GHAA 3LJRA 2B1KA 3DMLA 2L4CA 3TJFA 3KCMA 3DRNA 2EIQA 3LORA 3EWLA 3BJ5A 5J9BA 2VM2A 1BAYA 2REMA 3RPNA 1SJZA 4ACSA 14GSA 1X5DA 2MMOA 3CRUA 5EL8A 3APOA 3UJ1A 6GSUA 1X5EA 1M0UA 3PPUA 4KA0A 2B1LA 5DDLA 1OKTA 2IN3A 5ECHB 1T8EB 3FHKA 1TTZA 4POMA 4IBPA 1WOUA 2KOKA 2X99A 3HCZA 4N0VA 1SJ6A 1T7PB 3A3TA 2DIYA 3EU3A 4J56E 1RK4A 3IXRA 3FZ9A 4JR4A 4BIKA 1SL0B 1FB6A 1Y25A 4K8MA 4QL9A 2IMKA 2VCTA 5CP1A 1X0RA 4IN0A 3FR6A 5ELAA 3TUEA 1PN0A 4IGJA 3LSZA 5G31A 2JU5A 4TW5A 3L9VA 1GTAA 1OC8A 3KMOA 2WRTA 3GL5A 2YV9A 2LJRA 3P7XA 1WWJA 4MDCA 2C4JA 5HQPA 4OO4A 2N5AA 3MAKA 2A4HA 3TCOA 4F0BA 1Q98A 2R6KA 5JWQB 3F3QA 1GRXA 3O6TA 2YOIA 1R26A 2HYXA 4Q5NA 2IPAA 4K5SA 3VWWA 3PGTA 3UAPA 2LNSA 1DUGA 1F3BA 1A24A 1QMVA 4ECJA 2VCVA 1PD21 2F51A 2CX3A 4IP1A 3CXGA 4F2IA 1GNWA 1HNAA 4G0IA 2X8HA 2LQQA 3ZFLA 3MYDA 2LS5A 3IAS2 2CZ3A 3HJMA 5D93A 2L4QA 1K3YA 2H0IA 1CQHA 1T00A 1MEKA 2HXKA 2J9HA 2OE3A 4N0ZA 2X8GA 2X4AA 4PXOA 1WP0A 3CYNA 2OBKA 4Q5RA 3ISOA 3GSSA 2IMIA 2QC7A 1ZYQB 1S3CA 4PX1A 1QUWA 1GTUA 4KNDA 4BWQA 1PL2A 2VD1A 1G6WA 2LUSA 1W4VA 3Q18A 2FCHA 3TKSE 5ABRA 2RM5A 4NPBA 1A23A 3KIJA 3KP8A 2GQKA 1ZOFA 2YZHA 5LD0A 2CZ2A 4JZQA 1N2AA 3DD3A 4ZBDA 1BYEA 1LJRA 6GSWA 4EC0A 2H0GA 2LSTA 1AQVA 5ECSA 1HNBA 4O5RA 3W6GA 3HJPA 1O6JA 3GFKA 4OCFA 1VF4A 3PINA 2LQOA 4ZXGA 3E0UA 5KN0A 2DJJA 1GNEA 4MZWA 5KOWA 1V40A 4NXIA 4IVFA 2R0CA 3TOTA 4V1Ag 3HVVA 1PA3A 1Z7RA 4L5LA 4X0XA 3WGEA 6GSVA 4MF5A 4MZCA 4EE0A 1ACVA 3ZMKA 2IJYA 1SK0A 2C0GA 2GZPA 2YWIA 4X43A 5AISA 3W8SA 3ZVJA 1GL8A 2HSYA 3H1NA 3Q19A 2KUCA 3P90A 3QCPA 4FQUA 1UN2A 4WBJA 3TOUA 1FAAA 3MDKA 1K3LA 2H1DA 4ZIJA 4MPGA 5KOXA 3TRXA 2FWGA 4ILFA 5DJMA 3BCKA 5J41A 1PN9A 5IIZA 1PRXA 2GVPA 1K0DA 2R2JA 1AQXA 4F03A 3KM6A 1DE1A 5AIVA 2A2PA 3J7Yk 2CQ9A 4EDZA 2JZSA 5ECNB 4FYBA 1Z6MA 3F6DA 2I9HA 2WS2A 1B9YC 2VO4A 4YAVA 4XHMA 3U6VA 1U88A 4D73B 2R37A 1A2MA 4JR6A 3D6IA 1F37A 3L9SA 3CMIA 4J57E 2OKAA 2P5RA 5E59A 3GA4A 3D4MA 5A4WA 5HR1A 1EOGA 1XFLA 2VCZA 1XZOA 4ZL7A 2WJUA 4FIWA 2VL2A 3M9KA 4WF4A 3TJKA 5HR3A 4NV5A 3DYRA 1R5PA 2RM6A 1TKDB 3EURA 4IJIA 1HNCA 2F3MA 5KN3A 2C0EA 3WYWA 2H76A 2DJ0A 1F6MC 3F4RA 5DJLA 4ZB9A 2O7KA 4O5UA 2PPTA 2I4AA 3KTBA 2GQMA 2V6OA 1S3AA 3L4NA 1AAZA 3TDGA 1A0FA 4RUVA 3DKSA 1B48A 2VL9A 4WR5A 2FD3A 2DC5A 2YP6A 1TRUA 1KBNA 5H5RA 5HFKA 2WB9A 4ML6A 5CRHA 5J5NA 3TKSC 2AHEA 3H8QA 5FT3A 4K1FA 5DQSA 3K8NA 5GSTA 2VCXA 4LMWA 1OVNA 1R7HA 2LV3A 3D21A 1W89A 4OCEA 4I8BA 1PKWA 4GQFA 3H4KA 4IELA 4F82A 4Z2UA 3ERFA 2AUVA 4FO5A 3RHBA 2HZFA 3CSIA 1SK1A 3LG6A 5FHIA 3ZREA 1TU8A 2DKIA 3DGQA 22GSA 2LRTA 2VOCA 1WMJA 1YKCA 3A2VA 2PGTA 4HQSA 3QAWA 4ML1A 1JHBA 2UZ8A 1TK8B 4ZL8A 5F05A 2JL4A 1PFOA 1S3RA 4EXJA 4EO3A 1TJDA 1R5AA 4TR3A 1XW5A 1YF0A 2FA4A 2QGVA 4H86A 4KUNA 3WT2A 4AJ6A 3TB2A 3KP9A 4QL7A 4KSOA 2NBSA 4MJCA 5JWRB 4MCUA 4JE1A 1XG8A 1SKRB 3WGXA 2CX4A 3GMFA 4IQ1A 3VWVA 2LEGA 4NHZA 2JACA 2V2GA 4ID0A 3TKQA 3F6FA 3IK9A 2JZRA 5F06A 5IQYA 2ES7A 4EIPA 3KD0A 1QXHA 5ECKB 4XIHA 1ABAA 3Q6OA 4HQZA 1JFUA 1K3OA 3ZMLA 2H1AA 1E2YA 4V2NA 2VCWA 2B3SA 3QPMA 1XWKA 17GSA 3LQ7A 1JZWA 2DBCA 4PQIA 4PURA 1OC9A 4BPYA 1BJXA 1MDKA 2H1BA 5C04A 5LNKe 5CAXA 3IOSA 5IPHA 5A5KA 2H01A 3L78A 5IO0A 1XWGA 1CQGA 2VCQA 3F3RA 1J9BA 5DCGA 2MBTA 4DSRA 2VLVA 3M0FA 4KDUA 3TJGA 1K0NA 6GSXA 2MMZA 1Z7PA 5EVOA 3VURA 4NV2A 3DXBA 1TI1A 2DKHA 1SYXA 4I2UA 4BL7B 4KH7A 4K9ZA 2Z9SA 5ECQB 2DMLA 2H72A 1XW6A 1M2DA 4K6XA 4HUAA 4AGSA 3A5IA 1ZYPA 3BBYA 3NIVA 3TRPA 1H75A 1XBSA 1JZRA 3PH9A 1VRSD 3IAM2 3IRAA 2R0PA 3IHGA 4NHWA 4MABA 4KF9A 4GSNA 4N30A 2IMFA 5ECOB 3MNGA 3EVIA 5JCGA 3FZAA 4G9HA 5HFGA 3CTGA 4TKYA 2CAQA 2H70A 5BRTA 1GTIA 4K5RA 1EV4A 4CDOA 2QA2A 1XXUA 2R4VA 3IDVA 4QQ7A 4F9ZA 4WKWA 5AN1A 1AUCA 4AF2A 1NHOA 2CVBA 3TJBA 2HZEB 4V2LA 5IMDA 2VAFA 2WFCA 1HYUA 2FHEA 2DSAA 2EIRA 5CREA 1XPVA 4MZBA 1E6BA 1XVWA 4AJ8A 3HHVA 1M9AA 2D2ZA 2KP1A 2L6DA 1K0MA 1XOAA 2OE1A 3H93A 3H79A 5DQYA 1BEDA 2CVKA 1XWAA 8GSSA 2VIMA 3AY8A 2HI7A 1SKSB 5J4UA 5ENUA 1GSUA 3VI7A 2P31A 2HZEA 4KDXA 1F3AA 4TR1B 1PL1A 4MP4A 2VLTA 2X64A 3HVXA 1KTEA 4BVYB 1SK2A 4MA9A 1SKWB 1G7EA 2EC4A 1TK0B 5IMZA 3A5WA 3HZ4A 3SBCA 1URMA 4IS0A 4WF5A 2FGXA 1ZL9A 4ZBAA 2HT9A 5G5EA 3G7JA 3FYGA 3QDNA 3D4TA 2C8UA 2H0HA 5B6NA 3HJOA 2LJAA 3LYKA 2IWTA 1V2AA 4TR1A 2DLXA 2DJ2A 1AXDA 4OFMA 1M3IA 5B8AA 4GWRA 4BVYA 1G0TA 1XWCA 2DIZA 4MF7A 1ZZYA 4G2EA 4KE3A 4GQCA 2K18A 3N5OA 3GYKA 1YQ1A 3Q74A 3FW2A 2X49A 3C1SA 3GKMA 1ERVA 2ALBA 5FWGA 5ID2B 4DSQA 1M2AA 1TRWA 2H30A 3VI5A 1TK5B 4V1Ap 3G7IA 3HD5A 5CNWA 3GKKA 5F8BA 3APQA 3ERWA 4TVEA 3RAZA 4OFNA 4I6XA 2KLXA 1TW9A 4ICYA 3VFIA 2A2SA 3HZ8A 4EUYA 2NTOA 2ON5A 1OC3A 1NHYA 4MMMA 2FLSA 4IQAA 5ID2A 5IM9A 4MK3A 3UEMA 4HEA2 5A4UA 2FWHA 1EGRA 4CY6A 2M80A 2O8VB 1GH2A 1HQOA 1V57A 3U5RE 4ZB8A 3RPPA 4HS1A 1DE2A 2HE3A 1EEMA 5D9XA 4L5OA 4RI6A 3IC4A 4PNFA 1SL2B 2YWNA 3JCML 2LJKA 1M9BA 1O7UA 1NW2A 4GCIA 3QFAC 1BQ7A 3ED3A 4YKFA 1AIUA 1EP7A 3APSA 2KHPA 4OWYA 5G30A 2HLSA 2IL3A 3EINA 2GSTA 4LMVA 4WEYA 5H5QA 2YWMA 2F9SA 6GSTA 4OFTA 3FMWA 4KCEA 3DIEA 3E3EA 4EDYA 2R5GA 1SU9A 1Z3EA 4L0UA 3VPQA 4XRAA 3CTFA 2K8SA 4YQUA 3QMXA 2HFDA 3UMAA 5C00A 4L0WA 1B4QA 1O8WA 3BD2A 4PUFC 4F0CA 5IMAA 1B8XA 3KGKA 3P8WA 2BJXA 3CBUA 3GL3A 5G2ZA 1FOHA 1JLWA 3RBTA 5G1LA 4D73A 1GUKA 3EMXA 5E4WA 4I97A 2GDRA 3FRCA 2AJQB 3LGCA 2OBIA 4TN8A 1B4PA 4WETA 2GSSA 12GSA 2BMXA 1J0FA 2G0FA 1ON4A 5EPFA 1O81A 1EWXA 3ZFBA 3KZQA 3S9FA 2MMNA 3P2AA 1ZMAA 3UOMA 3GH6A 4XS6A 3FY7A 3UVTA 4XCSA 2PERA 1WPIA 5J3RA 4K2DA 3LYPA 2HRNA 3F8UA 2V6KA 2TIRA 1YEXA 1XIYA 4X1UA 1PQNA 3J7Yb 3C71A 2WCIA 3QR6A 5CRWA 1OE8A 2LTKA 2GT5A 2O85A 4MNNA 2AYTA 1EEJA 5IPGA 4MPFA 4X4JA 2R0GA 1AW9A 2ZUPA 1U3AA 1X9WB 1U87A 3GX0A 5DCHA 3TGZA 1Q4JA 3IPZA 5D73A 2L5OA 4POLA 4XS4B 3ZIVA 4ZL9A 3G7YA 3QFBC 1V9WA 3IV4A 3D5JA 2O87A 4PGTA 2VL2C 4HOJA 4G0KA 4KAEA 2J23A 1FW1A 2OE0A 2H71A 4K2XA 2R3XA 1SL1B 5J9CA 4MJBA 4ULXA 2E2GA 3MSZA 4ISDA 3KTLA 5CRGA 4DEJA 3ZZXA 5D96A 2ZNMA 4XRDA 4NAXA 2PWJA 1YKAA 4J2FA 1GUHA 1QQ2A 3N9JA 1WIKA 4POBA 4XS4A 1OAZA 1ERTA 5GAPD 2RUFA 3GN3A 2OADA 2XPDA 1YDKA 4K7IA 2AV4A 3I6AA 4EKZA 9GSSA 2JZTA 1YJ6A 2TRXA 3F0IA 2X8CA 1MDJA 3UARA 2CVDA 2JSYA 4E8HA 2C0FA 1OYJA 5AIXA 1ERWA 2C3TA 1YEPA 1KEBA 2WULA 2MYGA 2L57A 2ON7A 1O85A 2RLIA 1XWBA 2KP2A 4KCAA 4KB3A 4RQRA 4CHSA 2DJ1A 3F4TA 1I5GA 4O5QA 3KJYA 5IMCA 5JWOB 3A2XA 4I5QA 5ECMB 4ZBBA 4FYUA 1TRSA 2QKEA 1A2LA 3OR5A 4DSSB 13GSA 3M3MA 3HKRA 3FKFA 2YZUA 2GQLA 3KMNA 1B9XC 4TXOB 1GTBA 3DEXA 2VM1A 3NOFA 4LLRA 1N8JA 5AGYA 1OKDA 4YH2A 2YJ7A 1G7OA 1V98A 1FVJA 1NM3A 4YAPA 5DVBA 5F0GA 3UBKA 1GSSA 1PX6A 5L71A 2QSIA 4BA7A 2WZ9A 2PU9C 1M2BA 1K0CA 3GNJA 1LU4A 4LA1A 4O92A 4KW6A 1TOFA 2C3NA 3IA1A 3E9JB 2H8LA 4TXOA 3KH9A 3TKRA 3ZITA 4JRRA 3M1GA 1QFNA 4GSTA 4HZ4A 3WT1A 1UC7A 2PMTA 3FK8A 1FO5A 1FB0A 1VF2A 2C0DA 2GZYA 3UBLA 5DAKB 5D9TA 2PBJA 1QGVA 3F4SA 2H6ZA 2ZCTA 4EL1A 4BL7A 2H19A 3CRTA 3UL3A 1PX7A 4ECBA 4WXTA 2MMAA 4BVXB 4JEDA 1T4YA 2V1MA 1Z5YE 1U6TA 1T1VA 4AJ7A 2PVQA 4HSCX 3FZ4A 2H74A 3IBHA 2XBIA 2HRAA 1F9MA 2G2QA 2QA1A 2VUPA 3O3TA 4ECIA 1GP1A 4PNGA 4IHUA 1XVQA 2F8FA 1A8YA 2P0GA 3HXSA 1BX9A 1MD4A 2N5BA 1EP8A 5DAKA 1AQWA 2H73A 2GSQA 2YV7A 2VD0A 4I2TA 5F07A 2YNXA 3HY2A 4HZ2A 3GX8A 3VWXA 3TJJA 1H4OA 2IIYA 5HFIA 4BVXA 2LRCA 1ZGNA 1AC1A 1Y6EA 4CW9A 4P3YB 5ECPB 10GSA 1UA5A 1SJIA 1GSQA 3ZYWA 1T4ZA 3HDCA 2O89A 3TRQA 2IMDA 1K0BA 2HRFA 2H6XA 2MZCA 3QD9A 4GLTA 1K0AA 4YQVA 1X9MB 2YCDA 4E8EA 1TP9A 1GLQA 1O8XA 2WDUA 1JLVA 3M8NA 5EY6A 4MLYA 3LEFA 3FEUA 1GULA 4A5PA 2K9FA 3DVWA 5IOWA 3MWHA 1ML6A 3LXZA 1YF1A 2NPBA 1VF1A 1T3BA 4TR0A 2B5YA 4L8EA 3ZIJA 1PSQA 1USBA 3UIWA 4FH8A 3ERGA 4KDYA 11GSA 4PQ1A 3FZ5A 1Z6NA 3IC8A 1THOA 1QK8A 3BOAA 20GSA 4K0GA 1FG4A 4TXVA 1F2EA 4NMUA 1GSFA 1TU7A 1EZKA 1ILOA 1MD3A 3EU4A 1WRYA 5DALB 1VF3A 1GSEA 2JADA 4DVCA 2XHFA 2YN1A 2DJ3A 5D9VA 2FNOA 4MJAA 5KN2A 1TXXA 4O32A 3GH9A 3LFLA 3ME7A 2I81A 2H6YA 2B5EA 3KEBA 1A0RP 4K7OA 2H75A 2GTUA 3O76A 2A2RA 1IYHA 1THXA 2FWFA 2V32A 2B7KA 3EPTA 2VLUA 3L9UA 3NZNA 4NWYA
chains in the Genus database with same CATH topology
4K7NA 4PUAA 5CRDA 5D8IA 2WGRA 1V58A 1ZYNA 1TRVA 3CSHA 5B6MA 5DALA 3GTUB 4MH3A 4ZB6A 5ECLB 5HR0A 3WD6A 1JZOA 2CA8A 2RIIA 3BCIA 3UVHA 3QOUA 3R3EA 1M7TA 2AAWA 3GURA 5IMVA 4V2MA 1LBKA 1VGLA 1A8LA 2DJKA 4EVMA 2LRNA 4LL4B 5CYYA 2B6MA 3C1RA 3RDWA 2IFQB 1U3IA 5BMUA 4POKA 1GLPA 3GKXA 1IYIA 3A2WA 3I43A 5INYA 3HVSA 2E7PA 18GSA 3HA9A 4HU9A 1PMTA 2M46A 3D22A 4TRXA 2EIOA 3EMPA 1KNGA 1C72A 3GTUA 3FR9A 4HJ2A 4EF0A 3GKNA 1SD8A 1UVZA 3SWLA 5A4VA 1XW9A 2B5XA 3FR3A 3DWVA 4USSA 4XTSA 2HRKA 2RUEA 1WE0A 2YJHA 3C73A 2IFQA 3KXOA 2XC2A 3TKSA 5IO2A 5KN1A 2I3YA 2AB6A 2JSZA 5JCWA 1DBYA 3LXTA 2CV4A 3ZTLA 7GSSA 2E0QA 3C7MA 4KX4A 4G0LA 1EOHA 5GZZB 19GSA 2L6CA 3MIXA 3R2QA 2P5QA 4GSSA 3HYPA 4OMVA 2B7JA 4WBRD 2FUG2 4GTUA 4Z2TA 3CSJA 1DSBA 3QAVA 1FVKA 5B8BA 3VK9A 3DVXA 3F9UA 5H5SA 4IJ3A 1YZXA 1FOVA 1S3DA 1SENA 3IHQA 1ZCPA 5COHA 3ZLPA 2BTOT 2FWEA 1SD9A 3LWAA 4OD7A 3L0HA 4FYCA 3W8JA 4PTSA 1G6YA 3LW9A 1TI3A 1XCCA 4GRFA 2YANA 2HSMA 4K0NA 1K0OA 3M9JA 2CT6A 2FA8A 3V1WA 5JCUA 3EYTA 3GUSA 3F63A 5B7CA 2V41A 2F8AA 2YPMA 3GRXA 3IE3A 2H1GA 2K8VA 1NSWA 3GSTA 4OO5A 3ZL5A 5G5FA 5GSSA 2OACA 4RQXA 4MJEA 4XS1A 4YKGA 2I1UA 4GF0A 4CY8A 2H66A 1JZDA 4RI7A 6GSSA 1ST9A 4G19A 4KSMA 1O73A 1MTCA 3RHCA 1GSYA 1BG5A 4HJMA 5DBQA 4GXZA 1GUMA 4TR4A 2XPEA 1HD2A 2PN8A 3US3A 5CO3A 4Q5QA 2GSRA 4BWSA 1TDIA 2C80A 5D9WA 4Q5FA 2L5LA 3GIXA 3IR4A 3ME8A 5LCZA 2IMEA 5KEJA 5IMFA 2K6VA 2GT6A 1YY7A 3G9BA 2C1YA 4ZILA 4Z2RA 4LL1B 2CAIA 4IKHA 16GSA 3GV1A 2MBSA 5IOXA 2YWOA 4JU5A 1M99A 1SYRA 3WGDA 5G1KA 3C8EA 4TOPA 5ELGA 4PQHA 3VWUA 1WJKA 2PUKC 2GZZA 1OC9B 3EC3A 5HR2A 4MF6A 4ECCA 1ZYEA 3I9V2 4WR4A 1RQMA 2PVOC 5ECIB 3PR8A 2LKUA 1GWCA 4G10A 3IK7A 3QAGA 2DMMA 4HU7A 2VL3A 2NDOA 4Z7XA 2GLRA 4HI7A 4IW9A 1I9DA 2FY6A 3VLNA 4JBBA 2E2MA 6GSYA 1J08A 2C3QA 2M72A 1MDIA 1R4WA 1RW1A 5ECRB 2L59A 3ZVJD 1FHEA 3ZRDA 3KH7A 2N5FA 1EGOA 4N11A 3EE2A 4HDEA 4O7HA 3I69A 2A4VA 3VPTA 1XOBA 2GGTA 1GSDA 1X9SB 1Z9HA 1A2JA 2NVLA 5GAND 1PKZA 2OA7A 4KGIA 4MH2A 2HNLA 2XBQA 1X5CA 2TRCP 2HSHA 1PGTA 1OE7A 4DSSA 3TKPA 1ERUA 2GS3A 1EV9A 2LNTA 4EIQA 4YQMA 2OJLA 4N10A 3D0ZA 4IP6A 3GHAA 3LJRA 2B1KA 3DMLA 2L4CA 3TJFA 3KCMA 3DRNA 2EIQA 3LORA 3EWLA 3BJ5A 5J9BA 2VM2A 1BAYA 2REMA 3RPNA 1SJZA 4ACSA 14GSA 1X5DA 2MMOA 3CRUA 5EL8A 3APOA 3UJ1A 6GSUA 1X5EA 1M0UA 3PPUA 4KA0A 2B1LA 5DDLA 1OKTA 2IN3A 5ECHB 1T8EB 3FHKA 1TTZA 4POMA 4IBPA 1WOUA 2KOKA 2X99A 3HCZA 4N0VA 1SJ6A 1T7PB 3A3TA 2DIYA 3EU3A 4J56E 1RK4A 3IXRA 3FZ9A 4JR4A 1SL0B 1FB6A 1Y25A 4K8MA 4QL9A 2IMKA 2VCTA 5CP1A 1X0RA 4IN0A 3FR6A 5ELAA 3TUEA 1PN0A 4IGJA 3LSZA 5G31A 2JU5A 4TW5A 3L9VA 1GTAA 1OC8A 3KMOA 2WRTA 3GL5A 2YV9A 2LJRA 3P7XA 1WWJA 4MDCA 2C4JA 5HQPA 4OO4A 2N5AA 3MAKA 2A4HA 3TCOA 4F0BA 1Q98A 2R6KA 5JWQB 3F3QA 1GRXA 3O6TA 2YOIA 1R26A 2HYXA 4Q5NA 2IPAA 4K5SA 3VWWA 3PGTA 3UAPA 2LNSA 1DUGA 1F3BA 1A24A 1QMVA 4ECJA 2VCVA 1PD21 2F51A 2CX3A 4IP1A 3CXGA 4F2IA 1GNWA 1HNAA 4G0IA 2X8HA 2LQQA 3ZFLA 3MYDA 2LS5A 3IAS2 2CZ3A 3HJMA 5D93A 2L4QA 1K3YA 2H0IA 1CQHA 1T00A 1MEKA 2HXKA 2J9HA 2OE3A 4N0ZA 2X8GA 2X4AA 4PXOA 1WP0A 3CYNA 2OBKA 4Q5RA 3ISOA 3GSSA 2IMIA 2QC7A 1ZYQB 1S3CA 4PX1A 1QUWA 1GTUA 4KNDA 4BWQA 1PL2A 2VD1A 1G6WA 2LUSA 1W4VA 3Q18A 2FCHA 3TKSE 5ABRA 2RM5A 4NPBA 1A23A 3KIJA 3KP8A 2GQKA 1ZOFA 2YZHA 5LD0A 2CZ2A 4JZQA 1N2AA 3DD3A 4ZBDA 1BYEA 1LJRA 6GSWA 4EC0A 2H0GA 2LSTA 1AQVA 5ECSA 1HNBA 4O5RA 3W6GA 3HJPA 1O6JA 3GFKA 4OCFA 1VF4A 3PINA 2LQOA 4ZXGA 3E0UA 5KN0A 2DJJA 1GNEA 4MZWA 5KOWA 1V40A 4NXIA 4IVFA 2R0CA 3TOTA 4V1Ag 3HVVA 1PA3A 1Z7RA 4L5LA 4X0XA 3WGEA 6GSVA 4MF5A 4MZCA 4EE0A 1ACVA 3ZMKA 2IJYA 1SK0A 2C0GA 2GZPA 2YWIA 4X43A 5AISA 3W8SA 3ZVJA 1GL8A 2HSYA 3H1NA 3Q19A 2KUCA 3P90A 3QCPA 4FQUA 1UN2A 4WBJA 3TOUA 1FAAA 3MDKA 1K3LA 2H1DA 4ZIJA 4MPGA 5KOXA 3TRXA 2FWGA 4ILFA 5DJMA 3BCKA 5J41A 1PN9A 5IIZA 1PRXA 2GVPA 1K0DA 2R2JA 1AQXA 4F03A 3KM6A 1DE1A 5AIVA 2A2PA 3J7Yk 2CQ9A 4EDZA 2JZSA 5ECNB 4FYBA 1Z6MA 3F6DA 2I9HA 2WS2A 1B9YC 2VO4A 4YAVA 4XHMA 3U6VA 1U88A 4D73B 2R37A 1A2MA 4JR6A 3D6IA 1F37A 3L9SA 3CMIA 4J57E 2OKAA 2P5RA 5E59A 3GA4A 3D4MA 5A4WA 5HR1A 1EOGA 1XFLA 2VCZA 1XZOA 4ZL7A 2WJUA 4FIWA 2VL2A 3M9KA 4WF4A 3TJKA 5HR3A 4NV5A 3DYRA 1R5PA 2RM6A 1TKDB 3EURA 4IJIA 1HNCA 2F3MA 5KN3A 2C0EA 3WYWA 2H76A 2DJ0A 1F6MC 3F4RA 5DJLA 4ZB9A 2O7KA 4O5UA 2PPTA 2I4AA 3KTBA 2GQMA 2V6OA 1S3AA 3L4NA 1AAZA 3TDGA 1A0FA 4RUVA 3DKSA 1B48A 2VL9A 4WR5A 2FD3A 2DC5A 2YP6A 1TRUA 1KBNA 5H5RA 5HFKA 2WB9A 4ML6A 5CRHA 5J5NA 3TKSC 2AHEA 3H8QA 5FT3A 4K1FA 5DQSA 3K8NA 5GSTA 2VCXA 4LMWA 1OVNA 1R7HA 2LV3A 3D21A 1W89A 4OCEA 4I8BA 1PKWA 4GQFA 3H4KA 4IELA 4F82A 4Z2UA 3ERFA 2AUVA 4FO5A 3RHBA 2HZFA 3CSIA 1SK1A 3LG6A 5FHIA 3ZREA 1TU8A 2DKIA 3DGQA 22GSA 2LRTA 2VOCA 1WMJA 1YKCA 3A2VA 2PGTA 4HQSA 3QAWA 4ML1A 1JHBA 2UZ8A 1TK8B 4ZL8A 5F05A 2JL4A 4EXJA 4EO3A 1TJDA 1R5AA 4TR3A 1XW5A 1YF0A 2FA4A 2QGVA 4H86A 4KUNA 3WT2A 4AJ6A 3TB2A 3KP9A 4QL7A 4KSOA 2NBSA 4MJCA 5JWRB 4MCUA 4JE1A 1SKRB 3WGXA 2CX4A 3GMFA 4IQ1A 3VWVA 2LEGA 4NHZA 2JACA 2V2GA 4ID0A 3TKQA 3F6FA 3IK9A 2JZRA 5F06A 5IQYA 2ES7A 4EIPA 3KD0A 1QXHA 5ECKB 4XIHA 1ABAA 3Q6OA 4HQZA 1JFUA 1K3OA 3ZMLA 2H1AA 1E2YA 4V2NA 2VCWA 2B3SA 3QPMA 1XWKA 17GSA 3LQ7A 1JZWA 2DBCA 4PQIA 4PURA 1OC9A 4BPYA 1BJXA 1MDKA 2H1BA 5C04A 5LNKe 5CAXA 3IOSA 5IPHA 5A5KA 2H01A 3L78A 5IO0A 1XWGA 1CQGA 2VCQA 3F3RA 1J9BA 5DCGA 2MBTA 4DSRA 2VLVA 3M0FA 4KDUA 3TJGA 1K0NA 6GSXA 2MMZA 1Z7PA 5EVOA 3VURA 4NV2A 3DXBA 1TI1A 2DKHA 1SYXA 4I2UA 4BL7B 4KH7A 4K9ZA 2Z9SA 5ECQB 2DMLA 2H72A 1XW6A 1M2DA 4K6XA 4HUAA 4AGSA 3A5IA 1ZYPA 3BBYA 3NIVA 3TRPA 1H75A 1XBSA 1JZRA 3PH9A 1VRSD 3IAM2 3IRAA 2R0PA 3IHGA 4NHWA 4MABA 4KF9A 4GSNA 4N30A 2IMFA 5ECOB 3MNGA 3EVIA 5JCGA 3FZAA 4G9HA 5HFGA 3CTGA 4TKYA 2CAQA 2H70A 5BRTA 1GTIA 4K5RA 1EV4A 4CDOA 2QA2A 1XXUA 2R4VA 3IDVA 4QQ7A 4F9ZA 4WKWA 5AN1A 1AUCA 4AF2A 1NHOA 2CVBA 3TJBA 2HZEB 4V2LA 5IMDA 2VAFA 2WFCA 1HYUA 2FHEA 2DSAA 2EIRA 5CREA 1XPVA 4MZBA 1E6BA 1XVWA 4AJ8A 3HHVA 1M9AA 2D2ZA 2KP1A 2L6DA 1K0MA 1XOAA 2OE1A 3H93A 3H79A 5DQYA 1BEDA 2CVKA 1XWAA 8GSSA 2VIMA 3AY8A 2HI7A 1SKSB 5J4UA 5ENUA 1GSUA 3VI7A 2P31A 2HZEA 4KDXA 1F3AA 4TR1B 1PL1A 4MP4A 2VLTA 2X64A 3HVXA 1KTEA 4BVYB 1SK2A 4MA9A 1SKWB 1G7EA 2EC4A 1TK0B 5IMZA 3A5WA 3HZ4A 3SBCA 1URMA 4IS0A 4WF5A 2FGXA 1ZL9A 4ZBAA 2HT9A 5G5EA 3G7JA 3FYGA 3QDNA 3D4TA 2C8UA 2H0HA 5B6NA 3HJOA 2LJAA 3LYKA 2IWTA 1V2AA 4TR1A 2DLXA 2DJ2A 1AXDA 4OFMA 5B8AA 4GWRA 4BVYA 1G0TA 1XWCA 2DIZA 4MF7A 1ZZYA 4G2EA 4KE3A 4GQCA 2K18A 3N5OA 3GYKA 1YQ1A 3Q74A 3FW2A 2X49A 3C1SA 3GKMA 1ERVA 2ALBA 5FWGA 5ID2B 4DSQA 1M2AA 1TRWA 2H30A 3VI5A 1TK5B 4V1Ap 3G7IA 3HD5A 5CNWA 3GKKA 5F8BA 3APQA 3ERWA 4TVEA 3RAZA 4OFNA 4I6XA 2KLXA 1TW9A 4ICYA 3VFIA 2A2SA 3HZ8A 4EUYA 2NTOA 2ON5A 1OC3A 1NHYA 4MMMA 2FLSA 4IQAA 5ID2A 5IM9A 4MK3A 3UEMA 4HEA2 5A4UA 2FWHA 1EGRA 4CY6A 2M80A 2O8VB 1GH2A 1HQOA 1V57A 3U5RE 4ZB8A 3RPPA 4HS1A 1DE2A 2HE3A 1EEMA 5D9XA 4L5OA 4RI6A 3IC4A 4PNFA 1SL2B 2YWNA 3JCML 2LJKA 1M9BA 1O7UA 1NW2A 4GCIA 3QFAC 1BQ7A 3ED3A 4YKFA 1AIUA 1EP7A 3APSA 2KHPA 4OWYA 5G30A 2HLSA 2IL3A 3EINA 2GSTA 4LMVA 4WEYA 5H5QA 2YWMA 2F9SA 6GSTA 4OFTA 3FMWA 4KCEA 3DIEA 3E3EA 4EDYA 2R5GA 1SU9A 1Z3EA 4L0UA 3VPQA 4XRAA 3CTFA 2K8SA 4YQUA 3QMXA 2HFDA 3UMAA 5C00A 4L0WA 1B4QA 1O8WA 3BD2A 4PUFC 4F0CA 5IMAA 1B8XA 3KGKA 3P8WA 2BJXA 3CBUA 3GL3A 5G2ZA 1FOHA 1JLWA 3RBTA 5G1LA 4D73A 1GUKA 3EMXA 5E4WA 4I97A 2GDRA 3FRCA 2AJQB 3LGCA 2OBIA 4TN8A 1B4PA 4WETA 2GSSA 12GSA 2BMXA 1J0FA 2G0FA 1ON4A 5EPFA 1O81A 1EWXA 3ZFBA 3KZQA 3S9FA 2MMNA 3P2AA 1ZMAA 3UOMA 3GH6A 4XS6A 3FY7A 3UVTA 4XCSA 2PERA 1WPIA 5J3RA 4K2DA 3LYPA 2HRNA 3F8UA 2V6KA 2TIRA 1YEXA 1XIYA 4X1UA 1PQNA 3J7Yb 3C71A 2WCIA 3QR6A 5CRWA 1OE8A 2LTKA 2GT5A 2O85A 4MNNA 2AYTA 1EEJA 5IPGA 4MPFA 4X4JA 2R0GA 1AW9A 2ZUPA 1U3AA 1X9WB 1U87A 3GX0A 5DCHA 3TGZA 1Q4JA 3IPZA 5D73A 2L5OA 4POLA 4XS4B 3ZIVA 4ZL9A 3G7YA 3QFBC 1V9WA 3IV4A 3D5JA 2O87A 4PGTA 2VL2C 4HOJA 4G0KA 4KAEA 2J23A 1FW1A 2OE0A 2H71A 4K2XA 2R3XA 1SL1B 5J9CA 4MJBA 4ULXA 2E2GA 3MSZA 4ISDA 3KTLA 5CRGA 4DEJA 3ZZXA 5D96A 2ZNMA 4XRDA 4NAXA 2PWJA 1YKAA 4J2FA 1GUHA 1QQ2A 3N9JA 1WIKA 4POBA 4XS4A 1OAZA 1ERTA 5GAPD 2RUFA 3GN3A 2OADA 2XPDA 1YDKA 4K7IA 2AV4A 3I6AA 4EKZA 9GSSA 2JZTA 1YJ6A 2TRXA 3F0IA 2X8CA 1MDJA 3UARA 2CVDA 2JSYA 4E8HA 2C0FA 1OYJA 5AIXA 1ERWA 2C3TA 1YEPA 1KEBA 2WULA 2MYGA 2L57A 2ON7A 1O85A 2RLIA 1XWBA 2KP2A 4KCAA 4KB3A 4RQRA 4CHSA 2DJ1A 3F4TA 1I5GA 4O5QA 3KJYA 5IMCA 5JWOB 3A2XA 4I5QA 5ECMB 4ZBBA 4FYUA 1TRSA 2QKEA 1A2LA 3OR5A 4DSSB 13GSA 3M3MA 3HKRA 3FKFA 2YZUA 2GQLA 3KMNA 1B9XC 4TXOB 1GTBA 3DEXA 2VM1A 3NOFA 4LLRA 1N8JA 5AGYA 1OKDA 4YH2A 2YJ7A 1G7OA 1V98A 1FVJA 1NM3A 4YAPA 5DVBA 5F0GA 3UBKA 1GSSA 1PX6A 5L71A 2QSIA 4BA7A 2WZ9A 2PU9C 1M2BA 1K0CA 3GNJA 1LU4A 4LA1A 4O92A 4KW6A 1TOFA 2C3NA 3IA1A 3E9JB 2H8LA 4TXOA 3KH9A 3TKRA 3ZITA 4JRRA 3M1GA 1QFNA 4GSTA 4HZ4A 3WT1A 1UC7A 2PMTA 3FK8A 1FO5A 1FB0A 1VF2A 2C0DA 2GZYA 3UBLA 5DAKB 5D9TA 2PBJA 1QGVA 3F4SA 2H6ZA 2ZCTA 4EL1A 4BL7A 2H19A 3CRTA 3UL3A 1PX7A 4ECBA 4WXTA 2MMAA 4BVXB 4JEDA 1T4YA 2V1MA 1Z5YE 1U6TA 1T1VA 4AJ7A 2PVQA 3FZ4A 2H74A 3IBHA 2XBIA 2HRAA 1F9MA 2G2QA 2QA1A 2VUPA 3O3TA 4ECIA 1GP1A 4PNGA 4IHUA 1XVQA 2F8FA 1A8YA 2P0GA 3HXSA 1BX9A 1MD4A 2N5BA 1EP8A 5DAKA 1AQWA 2H73A 2GSQA 2YV7A 2VD0A 4I2TA 5F07A 2YNXA 3HY2A 4HZ2A 3GX8A 3VWXA 3TJJA 1H4OA 2IIYA 5HFIA 4BVXA 2LRCA 1ZGNA 1AC1A 1Y6EA 4CW9A 4P3YB 5ECPB 10GSA 1UA5A 1SJIA 1GSQA 3ZYWA 1T4ZA 3HDCA 2O89A 3TRQA 2IMDA 1K0BA 2HRFA 2H6XA 2MZCA 3QD9A 4GLTA 1K0AA 4YQVA 1X9MB 2YCDA 4E8EA 1TP9A 1GLQA 1O8XA 2WDUA 1JLVA 3M8NA 5EY6A 4MLYA 3LEFA 3FEUA 1GULA 4A5PA 2K9FA 3DVWA 5IOWA 3MWHA 1ML6A 3LXZA 1YF1A 2NPBA 1VF1A 1T3BA 4TR0A 2B5YA 4L8EA 3ZIJA 1PSQA 1USBA 3UIWA 4FH8A 3ERGA 4KDYA 11GSA 4PQ1A 3FZ5A 1Z6NA 3IC8A 1THOA 1QK8A 3BOAA 20GSA 4K0GA 1FG4A 4TXVA 1F2EA 4NMUA 1GSFA 1TU7A 1EZKA 1ILOA 1MD3A 3EU4A 1WRYA 5DALB 1VF3A 1GSEA 2JADA 4DVCA 2XHFA 2YN1A 2DJ3A 5D9VA 2FNOA 4MJAA 5KN2A 1TXXA 4O32A 3GH9A 3LFLA 3ME7A 2I81A 2H6YA 2B5EA 3KEBA 1A0RP 4K7OA 2H75A 2GTUA 3O76A 2A2RA 1IYHA 1THXA 2FWFA 2V32A 2B7KA 3EPTA 2VLUA 3L9UA 3NZNA 4NWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7N A;  4PUA A;  5CRD A;  5D8I A;  2WGR A;  1V58 A;  1TRV A;  3CSH A;  5B6M A;  5DAL A;  3GTU B;  4MH3 A;  4ZB6 A;  5ECL B;  5HR0 A;  3WD6 A;  1JZO A;  2CA8 A;  2RII A;  3BCI A;  3UVH A;  3QOU A;  1M7T A;  2AAW A;  3GUR A;  5IMV A;  4V2M A;  1LBK A;  1VGL A;  1A8L A;  2DJK A;  4EVM A;  2LRN A;  4LL4 B;  5CYY A;  2B6M A;  3C1R A;  3RDW A;  2IFQ B;  1U3I A;  4POK A;  1GLP A;  3GKX A;  1IYI A;  3A2W A;  3I43 A;  5INY A;  3HVS A;  2E7P A;  18GS A;  3HA9 A;  4HU9 A;  1PMT A;  2M46 A;  3D22 A;  4TRX A;  2EIO A;  3EMP A;  1KNG A;  1C72 A;  3GTU A;  3FR9 A;  4HJ2 A;  4EF0 A;  3GKN A;  1SD8 A;  1UVZ A;  3SWL A;  5A4V A;  1XW9 A;  2B5X A;  3FR3 A;  3DWV A;  4XTS A;  2RUE A;  1WE0 A;  2YJH A;  3C73 A;  2IFQ A;  3KXO A;  2XC2 A;  3TKS A;  5IO2 A;  5KN1 A;  2I3Y A;  2AB6 A;  2JSZ A;  5JCW A;  1DBY A;  3LXT A;  2CV4 A;  3ZTL A;  7GSS A;  2E0Q A;  3C7M A;  4KX4 A;  1EOH A;  5GZZ B;  19GS A;  2L6C A;  3R2Q A;  2P5Q A;  4GSS A;  3HYP A;  4OMV A;  2B7J A;  4WBR D;  2FUG 2;  4GTU A;  3CSJ A;  1DSB A;  3QAV A;  1FVK A;  5B8B A;  3VK9 A;  3DVX A;  3F9U A;  5H5S A;  4IJ3 A;  1YZX A;  1FOV A;  1S3D A;  1SEN A;  3IHQ A;  1ZCP A;  5COH A;  3ZLP A;  2BTO T;  2FWE A;  1SD9 A;  3LWA A;  4OD7 A;  3L0H A;  4FYC A;  3W8J A;  1G6Y A;  1TI3 A;  1XCC A;  4GRF A;  2YAN A;  4K0N A;  1K0O A;  3M9J A;  2CT6 A;  2FA8 A;  3V1W A;  5JCU A;  3EYT A;  3GUS A;  3F63 A;  5B7C A;  2V41 A;  2F8A A;  2YPM A;  3GRX A;  3IE3 A;  2H1G A;  2K8V A;  1NSW A;  3GST A;  4OO5 A;  3ZL5 A;  5G5F A;  5GSS A;  2OAC A;  4RQX A;  4MJE A;  4XS1 A;  2I1U A;  4GF0 A;  2H66 A;  1JZD A;  4RI7 A;  6GSS A;  1ST9 A;  4G19 A;  4KSM A;  1O73 A;  1MTC A;  3RHC A;  1GSY A;  1BG5 A;  4HJM A;  5DBQ A;  4GXZ A;  1GUM A;  4TR4 A;  2XPE A;  1HD2 A;  2PN8 A;  3US3 A;  5CO3 A;  4Q5Q A;  2GSR A;  4BWS A;  1TDI A;  2C80 A;  5D9W A;  4Q5F A;  2L5L A;  3GIX A;  3IR4 A;  3ME8 A;  5LCZ A;  2IME A;  5KEJ A;  5IMF A;  2K6V A;  2GT6 A;  1YY7 A;  3G9B A;  2C1Y A;  4ZIL A;  4LL1 B;  2CAI A;  4IKH A;  16GS A;  3GV1 A;  2MBS A;  5IOX A;  2YWO A;  4JU5 A;  1M99 A;  1SYR A;  3WGD A;  5G1K A;  3C8E A;  4TOP A;  5ELG A;  4PQH A;  3VWU A;  1WJK A;  2PUK C;  2GZZ A;  1OC9 B;  3EC3 A;  5HR2 A;  4MF6 A;  4ECC A;  1ZYE A;  3I9V 2;  4WR4 A;  1RQM A;  2PVO C;  5ECI B;  3PR8 A;  2LKU A;  1GWC A;  4G10 A;  3IK7 A;  3QAG A;  2DMM A;  4HU7 A;  2VL3 A;  2NDO A;  4Z7X A;  2GLR A;  4HI7 A;  4IW9 A;  1I9D A;  2FY6 A;  3VLN A;  4JBB A;  2E2M A;  6GSY A;  1J08 A;  2C3Q A;  2M72 A;  1MDI A;  1R4W A;  1RW1 A;  5ECR B;  2L59 A;  3ZVJ D;  1FHE A;  3ZRD A;  3KH7 A;  2N5F A;  1EGO A;  4N11 A;  3EE2 A;  4HDE A;  4O7H A;  3I69 A;  2A4V A;  3VPT A;  1XOB A;  2GGT A;  1GSD A;  1X9S B;  1Z9H A;  1A2J A;  2NVL A;  5GAN D;  1PKZ A;  2OA7 A;  4KGI A;  4MH2 A;  2HNL A;  2XBQ A;  1X5C A;  2TRC P;  2HSH A;  1PGT A;  1OE7 A;  4DSS A;  3TKP A;  1ERU A;  2GS3 A;  1EV9 A;  2LNT A;  4YQM A;  2OJL A;  4N10 A;  3D0Z A;  4IP6 A;  3GHA A;  3LJR A;  2B1K A;  3DML A;  2L4C A;  3TJF A;  3KCM A;  3DRN A;  2EIQ A;  3LOR A;  3EWL A;  3BJ5 A;  5J9B A;  2VM2 A;  1BAY A;  2REM A;  3RPN A;  1SJZ A;  4ACS A;  14GS A;  1X5D A;  2MMO A;  3CRU A;  5EL8 A;  3APO A;  3UJ1 A;  6GSU A;  1X5E A;  1M0U A;  4KA0 A;  2B1L A;  5DDL A;  1OKT A;  2IN3 A;  5ECH B;  1T8E B;  3FHK A;  1TTZ A;  4POM A;  4IBP A;  1WOU A;  2KOK A;  2X99 A;  3HCZ A;  4N0V A;  1SJ6 A;  1T7P B;  3A3T A;  2DIY A;  3EU3 A;  4J56 E;  1RK4 A;  3IXR A;  3FZ9 A;  4JR4 A;  1SL0 B;  1FB6 A;  1Y25 A;  4K8M A;  4QL9 A;  2IMK A;  2VCT A;  5CP1 A;  1X0R A;  4IN0 A;  3FR6 A;  5ELA A;  3TUE A;  4IGJ A;  3LSZ A;  5G31 A;  2JU5 A;  4TW5 A;  3L9V A;  1GTA A;  1OC8 A;  3KMO A;  2WRT A;  3GL5 A;  2YV9 A;  2LJR A;  3P7X A;  1WWJ A;  4MDC A;  2C4J A;  5HQP A;  4OO4 A;  2N5A A;  3MAK A;  3TCO A;  4F0B A;  1Q98 A;  2R6K A;  5JWQ B;  3F3Q A;  1GRX A;  3O6T A;  2YOI A;  1R26 A;  2HYX A;  4Q5N A;  2IPA A;  3VWW A;  3PGT A;  3UAP A;  2LNS A;  1DUG A;  1F3B A;  1A24 A;  1QMV A;  4ECJ A;  2VCV A;  1PD2 1;  2F51 A;  2CX3 A;  4IP1 A;  3CXG A;  4F2I A;  1GNW A;  1HNA A;  2X8H A;  2LQQ A;  3ZFL A;  2LS5 A;  3IAS 2;  2CZ3 A;  3HJM A;  5D93 A;  2L4Q A;  1K3Y A;  2H0I A;  1CQH A;  1T00 A;  1MEK A;  2HXK A;  2J9H A;  2OE3 A;  4N0Z A;  2X8G A;  4PXO A;  1WP0 A;  3CYN A;  2OBK A;  4Q5R A;  3ISO A;  3GSS A;  2IMI A;  2QC7 A;  1ZYQ B;  1S3C A;  4PX1 A;  1QUW A;  1GTU A;  4KND A;  4BWQ A;  1PL2 A;  2VD1 A;  1G6W A;  2LUS A;  1W4V A;  3Q18 A;  2FCH A;  3TKS E;  5ABR A;  2RM5 A;  4NPB A;  1A23 A;  3KIJ A;  3KP8 A;  2GQK A;  1ZOF A;  2YZH A;  5LD0 A;  2CZ2 A;  4JZQ A;  1N2A A;  3DD3 A;  4ZBD A;  1BYE A;  1LJR A;  6GSW A;  4EC0 A;  2H0G A;  2LST A;  1AQV A;  5ECS A;  1HNB A;  4O5R A;  3W6G A;  3HJP A;  1O6J A;  3GFK A;  4OCF A;  1VF4 A;  3PIN A;  2LQO A;  4ZXG A;  3E0U A;  5KN0 A;  2DJJ A;  1GNE A;  4MZW A;  1V40 A;  4NXI A;  4IVF A;  3TOT A;  4V1A g;  3HVV A;  1PA3 A;  1Z7R A;  4L5L A;  4X0X A;  3WGE A;  6GSV A;  4MF5 A;  4MZC A;  4EE0 A;  1ACV A;  3ZMK A;  2IJY A;  1SK0 A;  2C0G A;  2GZP A;  2YWI A;  4X43 A;  5AIS A;  3W8S A;  3ZVJ A;  1GL8 A;  2HSY A;  3H1N A;  3Q19 A;  2KUC A;  3P90 A;  3QCP A;  1UN2 A;  4WBJ A;  3TOU A;  1FAA A;  3MDK A;  1K3L A;  2H1D A;  4ZIJ A;  4MPG A;  3TRX A;  2FWG A;  4ILF A;  5DJM A;  3BCK A;  5J41 A;  1PN9 A;  5IIZ A;  1PRX A;  2GVP A;  1K0D A;  2R2J A;  1AQX A;  4F03 A;  3KM6 A;  1DE1 A;  5AIV A;  3J7Y k;  2CQ9 A;  4EDZ A;  2JZS A;  5ECN B;  4FYB A;  1Z6M A;  3F6D A;  2I9H A;  2WS2 A;  1B9Y C;  2VO4 A;  4YAV A;  4XHM A;  3U6V A;  1U88 A;  4D73 B;  2R37 A;  1A2M A;  4JR6 A;  3D6I A;  1F37 A;  3L9S A;  3CMI A;  4J57 E;  2OKA A;  2P5R A;  5E59 A;  3GA4 A;  3D4M A;  5A4W A;  5HR1 A;  1EOG A;  1XFL A;  2VCZ A;  1XZO A;  4ZL7 A;  2WJU A;  4FIW A;  2VL2 A;  3M9K A;  4WF4 A;  3TJK A;  5HR3 A;  4NV5 A;  3DYR A;  1R5P A;  2RM6 A;  1TKD B;  3EUR A;  4IJI A;  1HNC A;  2F3M A;  5KN3 A;  2C0E A;  3WYW A;  2H76 A;  2DJ0 A;  1F6M C;  3F4R A;  5DJL A;  4ZB9 A;  2O7K A;  2PPT A;  2I4A A;  3KTB A;  2GQM A;  2V6O A;  1S3A A;  3L4N A;  1AAZ A;  3TDG A;  1A0F A;  4RUV A;  3DKS A;  1B48 A;  2VL9 A;  4WR5 A;  2FD3 A;  2DC5 A;  2YP6 A;  1TRU A;  1KBN A;  5H5R A;  5HFK A;  2WB9 A;  4ML6 A;  5CRH A;  5J5N A;  3TKS C;  2AHE A;  3H8Q A;  5FT3 A;  4K1F A;  5DQS A;  3K8N A;  5GST A;  2VCX A;  4LMW A;  1OVN A;  1R7H A;  2LV3 A;  3D21 A;  1W89 A;  4OCE A;  4I8B A;  1PKW A;  4GQF A;  3H4K A;  4IEL A;  4F82 A;  3ERF A;  2AUV A;  4FO5 A;  3RHB A;  2HZF A;  3CSI A;  1SK1 A;  3LG6 A;  5FHI A;  3ZRE A;  1TU8 A;  3DGQ A;  22GS A;  2LRT A;  2VOC A;  1WMJ A;  1YKC A;  3A2V A;  2PGT A;  4HQS A;  3QAW A;  4ML1 A;  1JHB A;  1TK8 B;  4ZL8 A;  5F05 A;  2JL4 A;  4EXJ A;  4EO3 A;  1TJD A;  1R5A A;  4TR3 A;  1YF0 A;  1XW5 A;  2FA4 A;  2QGV A;  4H86 A;  4KUN A;  3WT2 A;  4AJ6 A;  3TB2 A;  3KP9 A;  4QL7 A;  4KSO A;  2NBS A;  4MJC A;  5JWR B;  4MCU A;  4JE1 A;  1SKR B;  3WGX A;  2CX4 A;  3GMF A;  4IQ1 A;  3VWV A;  2LEG A;  4NHZ A;  2JAC A;  2V2G A;  4ID0 A;  3TKQ A;  3F6F A;  3IK9 A;  2JZR A;  5F06 A;  5IQY A;  2ES7 A;  3KD0 A;  1QXH A;  5ECK B;  4XIH A;  1ABA A;  3Q6O A;  4HQZ A;  1JFU A;  1K3O A;  3ZML A;  2H1A A;  1E2Y A;  4V2N A;  2VCW A;  2B3S A;  3QPM A;  1XWK A;  17GS A;  3LQ7 A;  1JZW A;  2DBC A;  4PQI A;  4PUR A;  1OC9 A;  4BPY A;  1BJX A;  1MDK A;  2H1B A;  5C04 A;  5LNK e;  5CAX A;  3IOS A;  5IPH A;  5A5K A;  2H01 A;  3L78 A;  5IO0 A;  1XWG A;  1CQG A;  2VCQ A;  3F3R A;  1J9B A;  5DCG A;  2MBT A;  4DSR A;  2VLV A;  3M0F A;  4KDU A;  3TJG A;  1K0N A;  6GSX A;  2MMZ A;  1Z7P A;  5EVO A;  3VUR A;  4NV2 A;  3DXB A;  1TI1 A;  1SYX A;  4I2U A;  4KH7 A;  4K9Z A;  2Z9S A;  5ECQ B;  2DML A;  2H72 A;  1XW6 A;  1M2D A;  4K6X A;  4HUA A;  4AGS A;  3BBY A;  3NIV A;  3TRP A;  1H75 A;  1XBS A;  1JZR A;  3PH9 A;  1VRS D;  3IAM 2;  3IRA A;  4NHW A;  4MAB A;  4GSN A;  4N30 A;  2IMF A;  5ECO B;  3MNG A;  3EVI A;  5JCG A;  3FZA A;  4G9H A;  5HFG A;  3CTG A;  4TKY A;  2CAQ A;  2H70 A;  1GTI A;  1EV4 A;  4CDO A;  1XXU A;  2R4V A;  3IDV A;  4QQ7 A;  4F9Z A;  4WKW A;  5AN1 A;  1AUC A;  4AF2 A;  1NHO A;  2CVB A;  3TJB A;  2HZE B;  4V2L A;  5IMD A;  2VAF A;  2WFC A;  1HYU A;  2FHE A;  2DSA A;  2EIR A;  5CRE A;  1XPV A;  4MZB A;  1E6B A;  1XVW A;  4AJ8 A;  3HHV A;  1M9A A;  2D2Z A;  2KP1 A;  2L6D A;  1K0M A;  1XOA A;  2OE1 A;  3H93 A;  3H79 A;  5DQY A;  1BED A;  2CVK A;  1XWA A;  8GSS A;  2VIM A;  3AY8 A;  2HI7 A;  1SKS B;  5J4U A;  5ENU A;  1GSU A;  3VI7 A;  2P31 A;  2HZE A;  4KDX A;  1F3A A;  4TR1 B;  1PL1 A;  4MP4 A;  2VLT A;  2X64 A;  3HVX A;  1KTE A;  1SK2 A;  4MA9 A;  1SKW B;  1G7E A;  2EC4 A;  1TK0 B;  5IMZ A;  3A5W A;  3HZ4 A;  3SBC A;  1URM A;  4IS0 A;  4WF5 A;  2FGX A;  1ZL9 A;  4ZBA A;  2HT9 A;  5G5E A;  3G7J A;  3FYG A;  3QDN A;  3D4T A;  2C8U A;  2H0H A;  5B6N A;  3HJO A;  2LJA A;  3LYK A;  2IWT A;  1V2A A;  4TR1 A;  2DLX A;  2DJ2 A;  1AXD A;  4OFM A;  5B8A A;  4GWR A;  4BVY A;  1G0T A;  1XWC A;  2DIZ A;  4MF7 A;  1ZZY A;  4G2E A;  4KE3 A;  4GQC A;  2K18 A;  3N5O A;  3GYK A;  1YQ1 A;  3Q74 A;  3FW2 A;  3C1S A;  3GKM A;  1ERV A;  2ALB A;  5FWG A;  5ID2 B;  4DSQ A;  1M2A A;  1TRW A;  2H30 A;  3VI5 A;  1TK5 B;  4V1A p;  3G7I A;  3HD5 A;  5CNW A;  3GKK A;  5F8B A;  3APQ A;  3ERW A;  4TVE A;  3RAZ A;  4OFN A;  4I6X A;  2KLX A;  1TW9 A;  3VFI A;  2A2S A;  3HZ8 A;  4EUY A;  2NTO A;  2ON5 A;  1OC3 A;  1NHY A;  4MMM A;  2FLS A;  4IQA A;  5ID2 A;  5IM9 A;  4MK3 A;  3UEM A;  4HEA 2;  5A4U A;  2FWH A;  1EGR A;  2M80 A;  2O8V B;  1GH2 A;  1HQO A;  1V57 A;  3U5R E;  4ZB8 A;  3RPP A;  4HS1 A;  1DE2 A;  2HE3 A;  1EEM A;  5D9X A;  4L5O A;  4RI6 A;  3IC4 A;  4PNF A;  1SL2 B;  2YWN A;  3JCM L;  2LJK A;  1M9B A;  1O7U A;  1NW2 A;  4GCI A;  3QFA C;  1BQ7 A;  3ED3 A;  1AIU A;  1EP7 A;  3APS A;  2KHP A;  4OWY A;  5G30 A;  2HLS A;  2IL3 A;  3EIN A;  2GST A;  4LMV A;  4WEY A;  5H5Q A;  2YWM A;  2F9S A;  6GST A;  4OFT A;  4KCE A;  3DIE A;  3E3E A;  4EDY A;  2R5G A;  1SU9 A;  1Z3E A;  4L0U A;  3VPQ A;  4XRA A;  3CTF A;  2K8S A;  4YQU A;  3QMX A;  2HFD A;  3UMA A;  5C00 A;  4L0W A;  1B4Q A;  1O8W A;  3BD2 A;  4PUF C;  4F0C A;  5IMA A;  1B8X A;  3KGK A;  3P8W A;  2BJX A;  3CBU A;  3GL3 A;  5G2Z A;  1JLW A;  3RBT A;  5G1L A;  4D73 A;  1GUK A;  3EMX A;  5E4W A;  4I97 A;  2GDR A;  3FRC A;  2AJQ B;  3LGC A;  2OBI A;  4TN8 A;  1B4P A;  4WET A;  2GSS A;  12GS A;  2BMX A;  1J0F A;  2G0F A;  1ON4 A;  5EPF A;  1O81 A;  1EWX A;  3ZFB A;  3KZQ A;  3S9F A;  2MMN A;  3P2A A;  1ZMA A;  3UOM A;  3GH6 A;  4XS6 A;  3FY7 A;  3UVT A;  4XCS A;  2PER A;  1WPI A;  5J3R A;  4K2D A;  3LYP A;  2HRN A;  3F8U A;  2V6K A;  2TIR A;  1YEX A;  1XIY A;  4X1U A;  1PQN A;  3J7Y b;  3C71 A;  2WCI A;  3QR6 A;  5CRW A;  1OE8 A;  2LTK A;  2GT5 A;  2O85 A;  2AYT A;  1EEJ A;  5IPG A;  4MPF A;  1AW9 A;  2ZUP A;  1U3A A;  1X9W B;  1U87 A;  3GX0 A;  5DCH A;  3TGZ A;  1Q4J A;  3IPZ A;  5D73 A;  2L5O A;  4POL A;  4XS4 B;  3ZIV A;  4ZL9 A;  3G7Y A;  3QFB C;  1V9W A;  3IV4 A;  3D5J A;  2O87 A;  4PGT A;  2VL2 C;  4HOJ A;  4KAE A;  2J23 A;  1FW1 A;  2OE0 A;  2H71 A;  2R3X A;  1SL1 B;  5J9C A;  4MJB A;  4ULX A;  2E2G A;  3MSZ A;  4ISD A;  3KTL A;  5CRG A;  4DEJ A;  3ZZX A;  5D96 A;  2ZNM A;  4XRD A;  4NAX A;  2PWJ A;  1YKA A;  4J2F A;  1GUH A;  1QQ2 A;  3N9J A;  1WIK A;  4POB A;  4XS4 A;  1OAZ A;  1ERT A;  5GAP D;  2RUF A;  3GN3 A;  2OAD A;  2XPD A;  1YDK A;  4K7I A;  2AV4 A;  3I6A A;  4EKZ A;  9GSS A;  2JZT A;  1YJ6 A;  2TRX A;  3F0I A;  2X8C A;  1MDJ A;  3UAR A;  2CVD A;  2JSY A;  4E8H A;  2C0F A;  1OYJ A;  5AIX A;  1ERW A;  2C3T A;  1YEP A;  1KEB A;  2WUL A;  2MYG A;  2L57 A;  2ON7 A;  1O85 A;  2RLI A;  1XWB A;  2KP2 A;  4KCA A;  4KB3 A;  4RQR A;  4CHS A;  2DJ1 A;  3F4T A;  1I5G A;  3KJY A;  5IMC A;  5JWO B;  3A2X A;  4I5Q A;  5ECM B;  4ZBB A;  4FYU A;  1TRS A;  2QKE A;  1A2L A;  3OR5 A;  4DSS B;  13GS A;  3M3M A;  3HKR A;  3FKF A;  2YZU A;  2GQL A;  3KMN A;  1B9X C;  4TXO B;  1GTB A;  3DEX A;  2VM1 A;  3NOF A;  4LLR A;  1N8J A;  5AGY A;  1OKD A;  4YH2 A;  2YJ7 A;  1G7O A;  1V98 A;  1FVJ A;  1NM3 A;  4YAP A;  5DVB A;  5F0G A;  3UBK A;  1GSS A;  1PX6 A;  5L71 A;  2QSI A;  4BA7 A;  2WZ9 A;  2PU9 C;  1M2B A;  1K0C A;  3GNJ A;  1LU4 A;  4LA1 A;  4O92 A;  4KW6 A;  1TOF A;  2C3N A;  3IA1 A;  3E9J B;  2H8L A;  4TXO A;  3KH9 A;  3TKR A;  3ZIT A;  4JRR A;  3M1G A;  1QFN A;  4GST A;  4HZ4 A;  3WT1 A;  1UC7 A;  2PMT A;  3FK8 A;  1FO5 A;  1FB0 A;  1VF2 A;  2C0D A;  2GZY A;  3UBL A;  5DAK B;  5D9T A;  2PBJ A;  1QGV A;  3F4S A;  2H6Z A;  2ZCT A;  4EL1 A;  4BL7 A;  2H19 A;  3CRT A;  3UL3 A;  1PX7 A;  4ECB A;  4WXT A;  2MMA A;  4JED A;  1T4Y A;  2V1M A;  1Z5Y E;  1U6T A;  1T1V A;  4AJ7 A;  2PVQ A;  3FZ4 A;  2H74 A;  3IBH A;  2XBI A;  1F9M A;  2G2Q A;  2VUP A;  3O3T A;  4ECI A;  1GP1 A;  4PNG A;  4IHU A;  1XVQ A;  2F8F A;  1A8Y A;  2P0G A;  3HXS A;  1BX9 A;  1MD4 A;  2N5B A;  1EP8 A;  5DAK A;  1AQW A;  2H73 A;  2GSQ A;  2YV7 A;  2VD0 A;  4I2T A;  5F07 A;  2YNX A;  3HY2 A;  4HZ2 A;  3GX8 A;  3VWX A;  3TJJ A;  1H4O A;  2IIY A;  5HFI A;  4BVX A;  2LRC A;  1ZGN A;  1AC1 A;  1Y6E A;  4CW9 A;  4P3Y B;  5ECP B;  10GS A;  1UA5 A;  1SJI A;  1GSQ A;  3ZYW A;  1T4Z A;  3HDC A;  2O89 A;  3TRQ A;  2IMD A;  1K0B A;  2HRF A;  2H6X A;  2MZC A;  3QD9 A;  4GLT A;  1K0A A;  4YQV A;  1X9M B;  2YCD A;  4E8E A;  1TP9 A;  1GLQ A;  1O8X A;  2WDU A;  1JLV A;  3M8N A;  5EY6 A;  4MLY A;  3LEF A;  3FEU A;  1GUL A;  2K9F A;  3DVW A;  5IOW A;  3MWH A;  1ML6 A;  3LXZ A;  1YF1 A;  2NPB A;  1VF1 A;  1T3B A;  4TR0 A;  2B5Y A;  4L8E A;  3ZIJ A;  1PSQ A;  1USB A;  3UIW A;  4FH8 A;  3ERG A;  4KDY A;  11GS A;  4PQ1 A;  3FZ5 A;  1Z6N A;  1THO A;  1QK8 A;  3BOA A;  20GS A;  4K0G A;  1FG4 A;  4TXV A;  1F2E A;  4NMU A;  1GSF A;  1TU7 A;  1EZK A;  1ILO A;  1MD3 A;  3EU4 A;  1WRY A;  5DAL B;  1VF3 A;  1GSE A;  2JAD A;  4DVC A;  2XHF A;  2YN1 A;  2DJ3 A;  5D9V A;  2FNO A;  4MJA A;  5KN2 A;  1TXX A;  4O32 A;  3GH9 A;  3LFL A;  3ME7 A;  2I81 A;  2H6Y A;  2B5E A;  3KEB A;  1A0R P;  4K7O A;  2H75 A;  2GTU A;  3O76 A;  2A2R A;  1IYH A;  1THX A;  2FWF A;  2V32 A;  2B7K A;  2VLU A;  3L9U A;  3NZN A;  4NWY A; 
#chains in the Genus database with same CATH topology
 4K7N A;  4PUA A;  5CRD A;  5D8I A;  2WGR A;  1V58 A;  1ZYN A;  1TRV A;  3CSH A;  5B6M A;  5DAL A;  3GTU B;  4MH3 A;  4ZB6 A;  5ECL B;  5HR0 A;  3WD6 A;  1JZO A;  2CA8 A;  2RII A;  3BCI A;  3UVH A;  3QOU A;  3R3E A;  1M7T A;  2AAW A;  3GUR A;  5IMV A;  4V2M A;  1LBK A;  1VGL A;  1A8L A;  2DJK A;  4EVM A;  2LRN A;  4LL4 B;  5CYY A;  2B6M A;  3C1R A;  3RDW A;  2IFQ B;  1U3I A;  5BMU A;  4POK A;  1GLP A;  3GKX A;  1IYI A;  3A2W A;  3I43 A;  5INY A;  3HVS A;  2E7P A;  18GS A;  3HA9 A;  4HU9 A;  1PMT A;  2M46 A;  3D22 A;  3CQF A;  4TRX A;  2EIO A;  3EMP A;  1KNG A;  1C72 A;  3GTU A;  3FR9 A;  4HJ2 A;  4EF0 A;  3GKN A;  1SD8 A;  1UVZ A;  3SWL A;  5A4V A;  1XW9 A;  2B5X A;  3FR3 A;  3DWV A;  4USS A;  4XTS A;  2HRK A;  2RUE A;  1WE0 A;  2YJH A;  3HVN A;  3C73 A;  2IFQ A;  3KXO A;  2XC2 A;  3TKS A;  5IO2 A;  5KN1 A;  2I3Y A;  2AB6 A;  2JSZ A;  5JCW A;  1DBY A;  3LXT A;  2CV4 A;  3ZTL A;  7GSS A;  2E0Q A;  3C7M A;  4KX4 A;  4G0L A;  1EOH A;  5GZZ B;  19GS A;  2L6C A;  3MIX A;  3R2Q A;  2P5Q A;  4GSS A;  3HYP A;  4OMV A;  2B7J A;  4WBR D;  2FUG 2;  4GTU A;  4Z2T A;  3CSJ A;  1DSB A;  1M3J A;  3QAV A;  1FVK A;  5B8B A;  3VK9 A;  3DVX A;  3F9U A;  5H5S A;  4IJ3 A;  1YZX A;  1FOV A;  1S3D A;  1SEN A;  3IHQ A;  1ZCP A;  5COH A;  3ZLP A;  2BTO T;  2FWE A;  1SD9 A;  3LWA A;  4OD7 A;  3L0H A;  4FYC A;  3W8J A;  4PTS A;  1G6Y A;  3LW9 A;  1TI3 A;  1XCC A;  4GRF A;  2YAN A;  2HSM A;  4K0N A;  1K0O A;  3M9J A;  2CT6 A;  2FA8 A;  3V1W A;  5JCU A;  3EYT A;  3GUS A;  3F63 A;  5B7C A;  2V41 A;  2F8A A;  2YPM A;  3GRX A;  3IE3 A;  2H1G A;  2K8V A;  1NSW A;  3GST A;  4OO5 A;  3ZL5 A;  5G5F A;  5GSS A;  2OAC A;  4RQX A;  4MJE A;  4XS1 A;  4YKG A;  2I1U A;  4GF0 A;  4CY8 A;  2H66 A;  1JZD A;  4RI7 A;  6GSS A;  1ST9 A;  4G19 A;  4KSM A;  1O73 A;  1MTC A;  3RHC A;  1GSY A;  1BG5 A;  4HJM A;  5DBQ A;  4GXZ A;  1GUM A;  4TR4 A;  2XPE A;  1HD2 A;  2PN8 A;  3US3 A;  5CO3 A;  4Q5Q A;  2GSR A;  4BWS A;  1TDI A;  2C80 A;  5D9W A;  4Q5F A;  2L5L A;  3GIX A;  3IR4 A;  3ME8 A;  5LCZ A;  2IME A;  5KEJ A;  5IMF A;  2K6V A;  2GT6 A;  1YY7 A;  3G9B A;  2C1Y A;  4ZIL A;  4Z2R A;  4LL1 B;  2CAI A;  4IKH A;  16GS A;  3GV1 A;  2MBS A;  5IOX A;  2YWO A;  4JU5 A;  1M99 A;  1SYR A;  3WGD A;  5G1K A;  3C8E A;  4TOP A;  5ELG A;  4PQH A;  3VWU A;  1WJK A;  2PUK C;  2GZZ A;  1OC9 B;  3EC3 A;  5HR2 A;  4MF6 A;  4ECC A;  1ZYE A;  3I9V 2;  4WR4 A;  1RQM A;  2PVO C;  5ECI B;  3PR8 A;  2LKU A;  1GWC A;  4G10 A;  3IK7 A;  3QAG A;  2DMM A;  4HU7 A;  2VL3 A;  2NDO A;  4Z7X A;  2GLR A;  4HI7 A;  4IW9 A;  1I9D A;  2FY6 A;  3VLN A;  4JBB A;  2E2M A;  6GSY A;  1J08 A;  2C3Q A;  2M72 A;  1MDI A;  1R4W A;  1RW1 A;  5ECR B;  2L59 A;  3ZVJ D;  1FHE A;  3ZRD A;  3KH7 A;  2N5F A;  1EGO A;  4N11 A;  3EE2 A;  4HDE A;  4O7H A;  3I69 A;  2A4V A;  3VPT A;  1XOB A;  2GGT A;  1GSD A;  1X9S B;  1Z9H A;  1A2J A;  2NVL A;  5GAN D;  1PKZ A;  2OA7 A;  4KGI A;  4MH2 A;  2HNL A;  2XBQ A;  1X5C A;  2TRC P;  2HSH A;  1PGT A;  1OE7 A;  4DSS A;  3TKP A;  1ERU A;  2GS3 A;  1EV9 A;  2LNT A;  4EIQ A;  4YQM A;  2OJL A;  4N10 A;  3D0Z A;  4IP6 A;  3GHA A;  3LJR A;  2B1K A;  3DML A;  2L4C A;  3TJF A;  3KCM A;  3DRN A;  2EIQ A;  3LOR A;  3EWL A;  3BJ5 A;  5J9B A;  2VM2 A;  1BAY A;  2REM A;  3RPN A;  1SJZ A;  4ACS A;  14GS A;  1X5D A;  2MMO A;  3CRU A;  5EL8 A;  3APO A;  3UJ1 A;  6GSU A;  1X5E A;  1M0U A;  3PPU A;  4KA0 A;  2B1L A;  5DDL A;  1OKT A;  2IN3 A;  5ECH B;  1T8E B;  3FHK A;  1TTZ A;  4POM A;  4IBP A;  1WOU A;  2KOK A;  2X99 A;  3HCZ A;  4N0V A;  1SJ6 A;  1T7P B;  3A3T A;  2DIY A;  3EU3 A;  4J56 E;  1RK4 A;  3IXR A;  3FZ9 A;  4JR4 A;  4BIK A;  1SL0 B;  1FB6 A;  1Y25 A;  4K8M A;  4QL9 A;  2IMK A;  2VCT A;  5CP1 A;  1X0R A;  4IN0 A;  3FR6 A;  5ELA A;  3TUE A;  1PN0 A;  4IGJ A;  3LSZ A;  5G31 A;  2JU5 A;  4TW5 A;  3L9V A;  1GTA A;  1OC8 A;  3KMO A;  2WRT A;  3GL5 A;  2YV9 A;  2LJR A;  3P7X A;  1WWJ A;  4MDC A;  2C4J A;  5HQP A;  4OO4 A;  2N5A A;  3MAK A;  2A4H A;  3TCO A;  4F0B A;  1Q98 A;  2R6K A;  5JWQ B;  3F3Q A;  1GRX A;  3O6T A;  2YOI A;  1R26 A;  2HYX A;  4Q5N A;  2IPA A;  4K5S A;  3VWW A;  3PGT A;  3UAP A;  2LNS A;  1DUG A;  1F3B A;  1A24 A;  1QMV A;  4ECJ A;  2VCV A;  1PD2 1;  2F51 A;  2CX3 A;  4IP1 A;  3CXG A;  4F2I A;  1GNW A;  1HNA A;  4G0I A;  2X8H A;  2LQQ A;  3ZFL A;  3MYD A;  2LS5 A;  3IAS 2;  2CZ3 A;  3HJM A;  5D93 A;  2L4Q A;  1K3Y A;  2H0I A;  1CQH A;  1T00 A;  1MEK A;  2HXK A;  2J9H A;  2OE3 A;  4N0Z A;  2X8G A;  2X4A A;  4PXO A;  1WP0 A;  3CYN A;  2OBK A;  4Q5R A;  3ISO A;  3GSS A;  2IMI A;  2QC7 A;  1ZYQ B;  1S3C A;  4PX1 A;  1QUW A;  1GTU A;  4KND A;  4BWQ A;  1PL2 A;  2VD1 A;  1G6W A;  2LUS A;  1W4V A;  3Q18 A;  2FCH A;  3TKS E;  5ABR A;  2RM5 A;  4NPB A;  1A23 A;  3KIJ A;  3KP8 A;  2GQK A;  1ZOF A;  2YZH A;  5LD0 A;  2CZ2 A;  4JZQ A;  1N2A A;  3DD3 A;  4ZBD A;  1BYE A;  1LJR A;  6GSW A;  4EC0 A;  2H0G A;  2LST A;  1AQV A;  5ECS A;  1HNB A;  4O5R A;  3W6G A;  3HJP A;  1O6J A;  3GFK A;  4OCF A;  1VF4 A;  3PIN A;  2LQO A;  4ZXG A;  3E0U A;  5KN0 A;  2DJJ A;  1GNE A;  4MZW A;  5KOW A;  1V40 A;  4NXI A;  4IVF A;  2R0C A;  3TOT A;  4V1A g;  3HVV A;  1PA3 A;  1Z7R A;  4L5L A;  4X0X A;  3WGE A;  6GSV A;  4MF5 A;  4MZC A;  4EE0 A;  1ACV A;  3ZMK A;  2IJY A;  1SK0 A;  2C0G A;  2GZP A;  2YWI A;  4X43 A;  5AIS A;  3W8S A;  3ZVJ A;  1GL8 A;  2HSY A;  3H1N A;  3Q19 A;  2KUC A;  3P90 A;  3QCP A;  4FQU A;  1UN2 A;  4WBJ A;  3TOU A;  1FAA A;  3MDK A;  1K3L A;  2H1D A;  4ZIJ A;  4MPG A;  5KOX A;  3TRX A;  2FWG A;  4ILF A;  5DJM A;  3BCK A;  5J41 A;  1PN9 A;  5IIZ A;  1PRX A;  2GVP A;  1K0D A;  2R2J A;  1AQX A;  4F03 A;  3KM6 A;  1DE1 A;  5AIV A;  2A2P A;  3J7Y k;  2CQ9 A;  4EDZ A;  2JZS A;  5ECN B;  4FYB A;  1Z6M A;  3F6D A;  2I9H A;  2WS2 A;  1B9Y C;  2VO4 A;  4YAV A;  4XHM A;  3U6V A;  1U88 A;  4D73 B;  2R37 A;  1A2M A;  4JR6 A;  3D6I A;  1F37 A;  3L9S A;  3CMI A;  4J57 E;  2OKA A;  2P5R A;  5E59 A;  3GA4 A;  3D4M A;  5A4W A;  5HR1 A;  1EOG A;  1XFL A;  2VCZ A;  1XZO A;  4ZL7 A;  2WJU A;  4FIW A;  2VL2 A;  3M9K A;  4WF4 A;  3TJK A;  5HR3 A;  4NV5 A;  3DYR A;  1R5P A;  2RM6 A;  1TKD B;  3EUR A;  4IJI A;  1HNC A;  2F3M A;  5KN3 A;  2C0E A;  3WYW A;  2H76 A;  2DJ0 A;  1F6M C;  3F4R A;  5DJL A;  4ZB9 A;  2O7K A;  4O5U A;  2PPT A;  2I4A A;  3KTB A;  2GQM A;  2V6O A;  1S3A A;  3L4N A;  1AAZ A;  3TDG A;  1A0F A;  4RUV A;  3DKS A;  1B48 A;  2VL9 A;  4WR5 A;  2FD3 A;  2DC5 A;  2YP6 A;  1TRU A;  1KBN A;  5H5R A;  5HFK A;  2WB9 A;  4ML6 A;  5CRH A;  5J5N A;  3TKS C;  2AHE A;  3H8Q A;  5FT3 A;  4K1F A;  5DQS A;  3K8N A;  5GST A;  2VCX A;  4LMW A;  1OVN A;  1R7H A;  2LV3 A;  3D21 A;  1W89 A;  4OCE A;  4I8B A;  1PKW A;  4GQF A;  3H4K A;  4IEL A;  4F82 A;  4Z2U A;  3ERF A;  2AUV A;  4FO5 A;  3RHB A;  2HZF A;  3CSI A;  1SK1 A;  3LG6 A;  5FHI A;  3ZRE A;  1TU8 A;  2DKI A;  3DGQ A;  22GS A;  2LRT A;  2VOC A;  1WMJ A;  1YKC A;  3A2V A;  2PGT A;  4HQS A;  3QAW A;  4ML1 A;  1JHB A;  2UZ8 A;  1TK8 B;  4ZL8 A;  5F05 A;  2JL4 A;  1PFO A;  1S3R A;  4EXJ A;  4EO3 A;  1TJD A;  1R5A A;  4TR3 A;  1XW5 A;  1YF0 A;  2FA4 A;  2QGV A;  4H86 A;  4KUN A;  3WT2 A;  4AJ6 A;  3TB2 A;  3KP9 A;  4QL7 A;  4KSO A;  2NBS A;  4MJC A;  5JWR B;  4MCU A;  4JE1 A;  1XG8 A;  1SKR B;  3WGX A;  2CX4 A;  3GMF A;  4IQ1 A;  3VWV A;  2LEG A;  4NHZ A;  2JAC A;  2V2G A;  4ID0 A;  3TKQ A;  3F6F A;  3IK9 A;  2JZR A;  5F06 A;  5IQY A;  2ES7 A;  4EIP A;  3KD0 A;  1QXH A;  5ECK B;  4XIH A;  1ABA A;  3Q6O A;  4HQZ A;  1JFU A;  1K3O A;  3ZML A;  2H1A A;  1E2Y A;  4V2N A;  2VCW A;  2B3S A;  3QPM A;  1XWK A;  17GS A;  3LQ7 A;  1JZW A;  2DBC A;  4PQI A;  4PUR A;  1OC9 A;  4BPY A;  1BJX A;  1MDK A;  2H1B A;  5C04 A;  5LNK e;  5CAX A;  3IOS A;  5IPH A;  5A5K A;  2H01 A;  3L78 A;  5IO0 A;  1XWG A;  1CQG A;  2VCQ A;  3F3R A;  1J9B A;  5DCG A;  2MBT A;  4DSR A;  2VLV A;  3M0F A;  4KDU A;  3TJG A;  1K0N A;  6GSX A;  2MMZ A;  1Z7P A;  5EVO A;  3VUR A;  4NV2 A;  3DXB A;  1TI1 A;  2DKH A;  1SYX A;  4I2U A;  4BL7 B;  4KH7 A;  4K9Z A;  2Z9S A;  5ECQ B;  2DML A;  2H72 A;  1XW6 A;  1M2D A;  4K6X A;  4HUA A;  4AGS A;  3A5I A;  1ZYP A;  3BBY A;  3NIV A;  3TRP A;  1H75 A;  1XBS A;  1JZR A;  3PH9 A;  1VRS D;  3IAM 2;  3IRA A;  2R0P A;  3IHG A;  4NHW A;  4MAB A;  4KF9 A;  4GSN A;  4N30 A;  2IMF A;  5ECO B;  3MNG A;  3EVI A;  5JCG A;  3FZA A;  4G9H A;  5HFG A;  3CTG A;  4TKY A;  2CAQ A;  2H70 A;  5BRT A;  1GTI A;  4K5R A;  1EV4 A;  4CDO A;  2QA2 A;  1XXU A;  2R4V A;  3IDV A;  4QQ7 A;  4F9Z A;  4WKW A;  5AN1 A;  1AUC A;  4AF2 A;  1NHO A;  2CVB A;  3TJB A;  2HZE B;  4V2L A;  5IMD A;  2VAF A;  2WFC A;  1HYU A;  2FHE A;  2DSA A;  2EIR A;  5CRE A;  1XPV A;  4MZB A;  1E6B A;  1XVW A;  4AJ8 A;  3HHV A;  1M9A A;  2D2Z A;  2KP1 A;  2L6D A;  1K0M A;  1XOA A;  2OE1 A;  3H93 A;  3H79 A;  5DQY A;  1BED A;  2CVK A;  1XWA A;  8GSS A;  2VIM A;  3AY8 A;  2HI7 A;  1SKS B;  5J4U A;  5ENU A;  1GSU A;  3VI7 A;  2P31 A;  2HZE A;  4KDX A;  1F3A A;  4TR1 B;  1PL1 A;  4MP4 A;  2VLT A;  2X64 A;  3HVX A;  1KTE A;  4BVY B;  1SK2 A;  4MA9 A;  1SKW B;  1G7E A;  2EC4 A;  1TK0 B;  5IMZ A;  3A5W A;  3HZ4 A;  3SBC A;  1URM A;  4IS0 A;  4WF5 A;  2FGX A;  1ZL9 A;  4ZBA A;  2HT9 A;  5G5E A;  3G7J A;  3FYG A;  3QDN A;  3D4T A;  2C8U A;  2H0H A;  5B6N A;  3HJO A;  2LJA A;  3LYK A;  2IWT A;  1V2A A;  4TR1 A;  2DLX A;  2DJ2 A;  1AXD A;  4OFM A;  1M3I A;  5B8A A;  4GWR A;  4BVY A;  1G0T A;  1XWC A;  2DIZ A;  4MF7 A;  1ZZY A;  4G2E A;  4KE3 A;  4GQC A;  2K18 A;  3N5O A;  3GYK A;  1YQ1 A;  3Q74 A;  3FW2 A;  2X49 A;  3C1S A;  3GKM A;  1ERV A;  2ALB A;  5FWG A;  5ID2 B;  4DSQ A;  1M2A A;  1TRW A;  2H30 A;  3VI5 A;  1TK5 B;  4V1A p;  3G7I A;  3HD5 A;  5CNW A;  3GKK A;  5F8B A;  3APQ A;  3ERW A;  4TVE A;  3RAZ A;  4OFN A;  4I6X A;  2KLX A;  1TW9 A;  4ICY A;  3VFI A;  2A2S A;  3HZ8 A;  4EUY A;  2NTO A;  2ON5 A;  1OC3 A;  1NHY A;  4MMM A;  2FLS A;  4IQA A;  5ID2 A;  5IM9 A;  4MK3 A;  3UEM A;  4HEA 2;  5A4U A;  2FWH A;  1EGR A;  4CY6 A;  2M80 A;  2O8V B;  1GH2 A;  1HQO A;  1V57 A;  3U5R E;  4ZB8 A;  3RPP A;  4HS1 A;  1DE2 A;  2HE3 A;  1EEM A;  5D9X A;  4L5O A;  4RI6 A;  3IC4 A;  4PNF A;  1SL2 B;  2YWN A;  3JCM L;  2LJK A;  1M9B A;  1O7U A;  1NW2 A;  4GCI A;  3QFA C;  1BQ7 A;  3ED3 A;  4YKF A;  1AIU A;  1EP7 A;  3APS A;  2KHP A;  4OWY A;  5G30 A;  2HLS A;  2IL3 A;  3EIN A;  2GST A;  4LMV A;  4WEY A;  5H5Q A;  2YWM A;  2F9S A;  6GST A;  4OFT A;  3FMW A;  4KCE A;  3DIE A;  3E3E A;  4EDY A;  2R5G A;  1SU9 A;  1Z3E A;  4L0U A;  3VPQ A;  4XRA A;  3CTF A;  2K8S A;  4YQU A;  3QMX A;  2HFD A;  3UMA A;  5C00 A;  4L0W A;  1B4Q A;  1O8W A;  3BD2 A;  4PUF C;  4F0C A;  5IMA A;  1B8X A;  3KGK A;  3P8W A;  2BJX A;  3CBU A;  3GL3 A;  5G2Z A;  1FOH A;  1JLW A;  3RBT A;  5G1L A;  4D73 A;  1GUK A;  3EMX A;  5E4W A;  4I97 A;  2GDR A;  3FRC A;  2AJQ B;  3LGC A;  2OBI A;  4TN8 A;  1B4P A;  4WET A;  2GSS A;  12GS A;  2BMX A;  1J0F A;  2G0F A;  1ON4 A;  5EPF A;  1O81 A;  1EWX A;  3ZFB A;  3KZQ A;  3S9F A;  2MMN A;  3P2A A;  1ZMA A;  3UOM A;  3GH6 A;  4XS6 A;  3FY7 A;  3UVT A;  4XCS A;  2PER A;  1WPI A;  5J3R A;  4K2D A;  3LYP A;  2HRN A;  3F8U A;  2V6K A;  2TIR A;  1YEX A;  1XIY A;  4X1U A;  1PQN A;  3J7Y b;  3C71 A;  2WCI A;  3QR6 A;  5CRW A;  1OE8 A;  2LTK A;  2GT5 A;  2O85 A;  4MNN A;  2AYT A;  1EEJ A;  5IPG A;  4MPF A;  4X4J A;  2R0G A;  1AW9 A;  2ZUP A;  1U3A A;  1X9W B;  1U87 A;  3GX0 A;  5DCH A;  3TGZ A;  1Q4J A;  3IPZ A;  5D73 A;  2L5O A;  4POL A;  4XS4 B;  3ZIV A;  4ZL9 A;  3G7Y A;  3QFB C;  1V9W A;  3IV4 A;  3D5J A;  2O87 A;  4PGT A;  2VL2 C;  4HOJ A;  4G0K A;  4KAE A;  2J23 A;  1FW1 A;  2OE0 A;  2H71 A;  4K2X A;  2R3X A;  1SL1 B;  5J9C A;  4MJB A;  4ULX A;  2E2G A;  3MSZ A;  4ISD A;  3KTL A;  5CRG A;  4DEJ A;  3ZZX A;  5D96 A;  2ZNM A;  4XRD A;  4NAX A;  2PWJ A;  1YKA A;  4J2F A;  1GUH A;  1QQ2 A;  3N9J A;  1WIK A;  4POB A;  4XS4 A;  1OAZ A;  1ERT A;  5GAP D;  2RUF A;  3GN3 A;  2OAD A;  2XPD A;  1YDK A;  4K7I A;  2AV4 A;  3I6A A;  4EKZ A;  9GSS A;  2JZT A;  1YJ6 A;  2TRX A;  3F0I A;  2X8C A;  1MDJ A;  3UAR A;  2CVD A;  2JSY A;  4E8H A;  2C0F A;  1OYJ A;  5AIX A;  1ERW A;  2C3T A;  1YEP A;  1KEB A;  2WUL A;  2MYG A;  2L57 A;  2ON7 A;  1O85 A;  2RLI A;  1XWB A;  2KP2 A;  4KCA A;  4KB3 A;  4RQR A;  4CHS A;  2DJ1 A;  3F4T A;  1I5G A;  4O5Q A;  3KJY A;  5IMC A;  5JWO B;  3A2X A;  4I5Q A;  5ECM B;  4ZBB A;  4FYU A;  1TRS A;  2QKE A;  1A2L A;  3OR5 A;  4DSS B;  13GS A;  3M3M A;  3HKR A;  3FKF A;  2YZU A;  2GQL A;  3KMN A;  1B9X C;  4TXO B;  1GTB A;  3DEX A;  2VM1 A;  3NOF A;  4LLR A;  1N8J A;  5AGY A;  1OKD A;  4YH2 A;  2YJ7 A;  1G7O A;  1V98 A;  1FVJ A;  1NM3 A;  4YAP A;  5DVB A;  5F0G A;  3UBK A;  1GSS A;  1PX6 A;  5L71 A;  2QSI A;  4BA7 A;  2WZ9 A;  2PU9 C;  1M2B A;  1K0C A;  3GNJ A;  1LU4 A;  4LA1 A;  4O92 A;  4KW6 A;  1TOF A;  2C3N A;  3IA1 A;  3E9J B;  2H8L A;  4TXO A;  3KH9 A;  3TKR A;  3ZIT A;  4JRR A;  3M1G A;  1QFN A;  4GST A;  4HZ4 A;  3WT1 A;  1UC7 A;  2PMT A;  3FK8 A;  1FO5 A;  1FB0 A;  1VF2 A;  2C0D A;  2GZY A;  3UBL A;  5DAK B;  5D9T A;  2PBJ A;  1QGV A;  3F4S A;  2H6Z A;  2ZCT A;  4EL1 A;  4BL7 A;  2H19 A;  3CRT A;  3UL3 A;  1PX7 A;  4ECB A;  4WXT A;  2MMA A;  4BVX B;  4JED A;  1T4Y A;  2V1M A;  1Z5Y E;  1U6T A;  1T1V A;  4AJ7 A;  2PVQ A;  4HSC X;  3FZ4 A;  2H74 A;  3IBH A;  2XBI A;  2HRA A;  1F9M A;  2G2Q A;  2QA1 A;  2VUP A;  3O3T A;  4ECI A;  1GP1 A;  4PNG A;  4IHU A;  1XVQ A;  2F8F A;  1A8Y A;  2P0G A;  3HXS A;  1BX9 A;  1MD4 A;  2N5B A;  1EP8 A;  5DAK A;  1AQW A;  2H73 A;  2GSQ A;  2YV7 A;  2VD0 A;  4I2T A;  5F07 A;  2YNX A;  3HY2 A;  4HZ2 A;  3GX8 A;  3VWX A;  3TJJ A;  1H4O A;  2IIY A;  5HFI A;  4BVX A;  2LRC A;  1ZGN A;  1AC1 A;  1Y6E A;  4CW9 A;  4P3Y B;  5ECP B;  10GS A;  1UA5 A;  1SJI A;  1GSQ A;  3ZYW A;  1T4Z A;  3HDC A;  2O89 A;  3TRQ A;  2IMD A;  1K0B A;  2HRF A;  2H6X A;  2MZC A;  3QD9 A;  4GLT A;  1K0A A;  4YQV A;  1X9M B;  2YCD A;  4E8E A;  1TP9 A;  1GLQ A;  1O8X A;  2WDU A;  1JLV A;  3M8N A;  5EY6 A;  4MLY A;  3LEF A;  3FEU A;  1GUL A;  4A5P A;  2K9F A;  3DVW A;  5IOW A;  3MWH A;  1ML6 A;  3LXZ A;  1YF1 A;  2NPB A;  1VF1 A;  1T3B A;  4TR0 A;  2B5Y A;  4L8E A;  3ZIJ A;  1PSQ A;  1USB A;  3UIW A;  4FH8 A;  3ERG A;  4KDY A;  11GS A;  4PQ1 A;  3FZ5 A;  1Z6N A;  3IC8 A;  1THO A;  1QK8 A;  3BOA A;  20GS A;  4K0G A;  1FG4 A;  4TXV A;  1F2E A;  4NMU A;  1GSF A;  1TU7 A;  1EZK A;  1ILO A;  1MD3 A;  3EU4 A;  1WRY A;  5DAL B;  1VF3 A;  1GSE A;  2JAD A;  4DVC A;  2XHF A;  2YN1 A;  2DJ3 A;  5D9V A;  2FNO A;  4MJA A;  5KN2 A;  1TXX A;  4O32 A;  3GH9 A;  3LFL A;  3ME7 A;  2I81 A;  2H6Y A;  2B5E A;  3KEB A;  1A0R P;  4K7O A;  2H75 A;  2GTU A;  3O76 A;  2A2R A;  1IYH A;  1THX A;  2FWF A;  2V32 A;  2B7K A;  3EPT A;  2VLU A;  3L9U A;  3NZN A;  4NWY A; 
#chains in the Genus database with same CATH homology
 4K7N A;  4PUA A;  5CRD A;  5D8I A;  2WGR A;  1V58 A;  1ZYN A;  1TRV A;  3CSH A;  5B6M A;  5DAL A;  3GTU B;  4MH3 A;  4ZB6 A;  5ECL B;  5HR0 A;  3WD6 A;  1JZO A;  2CA8 A;  2RII A;  3BCI A;  3UVH A;  3QOU A;  3R3E A;  1M7T A;  2AAW A;  3GUR A;  5IMV A;  4V2M A;  1LBK A;  1VGL A;  1A8L A;  2DJK A;  4EVM A;  2LRN A;  4LL4 B;  5CYY A;  2B6M A;  3C1R A;  3RDW A;  2IFQ B;  1U3I A;  5BMU A;  4POK A;  1GLP A;  3GKX A;  1IYI A;  3A2W A;  3I43 A;  5INY A;  3HVS A;  2E7P A;  18GS A;  3HA9 A;  4HU9 A;  1PMT A;  2M46 A;  3D22 A;  4TRX A;  2EIO A;  3EMP A;  1KNG A;  1C72 A;  3GTU A;  3FR9 A;  4HJ2 A;  4EF0 A;  3GKN A;  1SD8 A;  1UVZ A;  3SWL A;  5A4V A;  1XW9 A;  2B5X A;  3FR3 A;  3DWV A;  4USS A;  4XTS A;  2HRK A;  2RUE A;  1WE0 A;  2YJH A;  3C73 A;  2IFQ A;  3KXO A;  2XC2 A;  3TKS A;  5IO2 A;  5KN1 A;  2I3Y A;  2AB6 A;  2JSZ A;  5JCW A;  1DBY A;  3LXT A;  2CV4 A;  3ZTL A;  7GSS A;  2E0Q A;  3C7M A;  4KX4 A;  4G0L A;  1EOH A;  5GZZ B;  19GS A;  2L6C A;  3MIX A;  3R2Q A;  2P5Q A;  4GSS A;  3HYP A;  4OMV A;  2B7J A;  4WBR D;  2FUG 2;  4GTU A;  4Z2T A;  3CSJ A;  1DSB A;  3QAV A;  1FVK A;  5B8B A;  3VK9 A;  3DVX A;  3F9U A;  5H5S A;  4IJ3 A;  1YZX A;  1FOV A;  1S3D A;  1SEN A;  3IHQ A;  1ZCP A;  5COH A;  3ZLP A;  2BTO T;  2FWE A;  1SD9 A;  3LWA A;  4OD7 A;  3L0H A;  4FYC A;  3W8J A;  4PTS A;  1G6Y A;  3LW9 A;  1TI3 A;  1XCC A;  4GRF A;  2YAN A;  2HSM A;  4K0N A;  1K0O A;  3M9J A;  2CT6 A;  2FA8 A;  3V1W A;  5JCU A;  3EYT A;  3GUS A;  3F63 A;  5B7C A;  2V41 A;  2F8A A;  2YPM A;  3GRX A;  3IE3 A;  2H1G A;  2K8V A;  1NSW A;  3GST A;  4OO5 A;  3ZL5 A;  5G5F A;  5GSS A;  2OAC A;  4RQX A;  4MJE A;  4XS1 A;  4YKG A;  2I1U A;  4GF0 A;  4CY8 A;  2H66 A;  1JZD A;  4RI7 A;  6GSS A;  1ST9 A;  4G19 A;  4KSM A;  1O73 A;  1MTC A;  3RHC A;  1GSY A;  1BG5 A;  4HJM A;  5DBQ A;  4GXZ A;  1GUM A;  4TR4 A;  2XPE A;  1HD2 A;  2PN8 A;  3US3 A;  5CO3 A;  4Q5Q A;  2GSR A;  4BWS A;  1TDI A;  2C80 A;  5D9W A;  4Q5F A;  2L5L A;  3GIX A;  3IR4 A;  3ME8 A;  5LCZ A;  2IME A;  5KEJ A;  5IMF A;  2K6V A;  2GT6 A;  1YY7 A;  3G9B A;  2C1Y A;  4ZIL A;  4Z2R A;  4LL1 B;  2CAI A;  4IKH A;  16GS A;  3GV1 A;  2MBS A;  5IOX A;  2YWO A;  4JU5 A;  1M99 A;  1SYR A;  3WGD A;  5G1K A;  3C8E A;  4TOP A;  5ELG A;  4PQH A;  3VWU A;  1WJK A;  2PUK C;  2GZZ A;  1OC9 B;  3EC3 A;  5HR2 A;  4MF6 A;  4ECC A;  1ZYE A;  3I9V 2;  4WR4 A;  1RQM A;  2PVO C;  5ECI B;  3PR8 A;  2LKU A;  1GWC A;  4G10 A;  3IK7 A;  3QAG A;  2DMM A;  4HU7 A;  2VL3 A;  2NDO A;  4Z7X A;  2GLR A;  4HI7 A;  4IW9 A;  1I9D A;  2FY6 A;  3VLN A;  4JBB A;  2E2M A;  6GSY A;  1J08 A;  2C3Q A;  2M72 A;  1MDI A;  1R4W A;  1RW1 A;  5ECR B;  2L59 A;  3ZVJ D;  1FHE A;  3ZRD A;  3KH7 A;  2N5F A;  1EGO A;  4N11 A;  3EE2 A;  4HDE A;  4O7H A;  3I69 A;  2A4V A;  3VPT A;  1XOB A;  2GGT A;  1GSD A;  1X9S B;  1Z9H A;  1A2J A;  2NVL A;  5GAN D;  1PKZ A;  2OA7 A;  4KGI A;  4MH2 A;  2HNL A;  2XBQ A;  1X5C A;  2TRC P;  2HSH A;  1PGT A;  1OE7 A;  4DSS A;  3TKP A;  1ERU A;  2GS3 A;  1EV9 A;  2LNT A;  4EIQ A;  4YQM A;  2OJL A;  4N10 A;  3D0Z A;  4IP6 A;  3GHA A;  3LJR A;  2B1K A;  3DML A;  2L4C A;  3TJF A;  3KCM A;  3DRN A;  2EIQ A;  3LOR A;  3EWL A;  3BJ5 A;  5J9B A;  2VM2 A;  1BAY A;  2REM A;  3RPN A;  1SJZ A;  4ACS A;  14GS A;  1X5D A;  2MMO A;  3CRU A;  5EL8 A;  3APO A;  3UJ1 A;  6GSU A;  1X5E A;  1M0U A;  3PPU A;  4KA0 A;  2B1L A;  5DDL A;  1OKT A;  2IN3 A;  5ECH B;  1T8E B;  3FHK A;  1TTZ A;  4POM A;  4IBP A;  1WOU A;  2KOK A;  2X99 A;  3HCZ A;  4N0V A;  1SJ6 A;  1T7P B;  3A3T A;  2DIY A;  3EU3 A;  4J56 E;  1RK4 A;  3IXR A;  3FZ9 A;  4JR4 A;  1SL0 B;  1FB6 A;  1Y25 A;  4K8M A;  4QL9 A;  2IMK A;  2VCT A;  5CP1 A;  1X0R A;  4IN0 A;  3FR6 A;  5ELA A;  3TUE A;  1PN0 A;  4IGJ A;  3LSZ A;  5G31 A;  2JU5 A;  4TW5 A;  3L9V A;  1GTA A;  1OC8 A;  3KMO A;  2WRT A;  3GL5 A;  2YV9 A;  2LJR A;  3P7X A;  1WWJ A;  4MDC A;  2C4J A;  5HQP A;  4OO4 A;  2N5A A;  3MAK A;  2A4H A;  3TCO A;  4F0B A;  1Q98 A;  2R6K A;  5JWQ B;  3F3Q A;  1GRX A;  3O6T A;  2YOI A;  1R26 A;  2HYX A;  4Q5N A;  2IPA A;  4K5S A;  3VWW A;  3PGT A;  3UAP A;  2LNS A;  1DUG A;  1F3B A;  1A24 A;  1QMV A;  4ECJ A;  2VCV A;  1PD2 1;  2F51 A;  2CX3 A;  4IP1 A;  3CXG A;  4F2I A;  1GNW A;  1HNA A;  4G0I A;  2X8H A;  2LQQ A;  3ZFL A;  3MYD A;  2LS5 A;  3IAS 2;  2CZ3 A;  3HJM A;  5D93 A;  2L4Q A;  1K3Y A;  2H0I A;  1CQH A;  1T00 A;  1MEK A;  2HXK A;  2J9H A;  2OE3 A;  4N0Z A;  2X8G A;  2X4A A;  4PXO A;  1WP0 A;  3CYN A;  2OBK A;  4Q5R A;  3ISO A;  3GSS A;  2IMI A;  2QC7 A;  1ZYQ B;  1S3C A;  4PX1 A;  1QUW A;  1GTU A;  4KND A;  4BWQ A;  1PL2 A;  2VD1 A;  1G6W A;  2LUS A;  1W4V A;  3Q18 A;  2FCH A;  3TKS E;  5ABR A;  2RM5 A;  4NPB A;  1A23 A;  3KIJ A;  3KP8 A;  2GQK A;  1ZOF A;  2YZH A;  5LD0 A;  2CZ2 A;  4JZQ A;  1N2A A;  3DD3 A;  4ZBD A;  1BYE A;  1LJR A;  6GSW A;  4EC0 A;  2H0G A;  2LST A;  1AQV A;  5ECS A;  1HNB A;  4O5R A;  3W6G A;  3HJP A;  1O6J A;  3GFK A;  4OCF A;  1VF4 A;  3PIN A;  2LQO A;  4ZXG A;  3E0U A;  5KN0 A;  2DJJ A;  1GNE A;  4MZW A;  5KOW A;  1V40 A;  4NXI A;  4IVF A;  2R0C A;  3TOT A;  4V1A g;  3HVV A;  1PA3 A;  1Z7R A;  4L5L A;  4X0X A;  3WGE A;  6GSV A;  4MF5 A;  4MZC A;  4EE0 A;  1ACV A;  3ZMK A;  2IJY A;  1SK0 A;  2C0G A;  2GZP A;  2YWI A;  4X43 A;  5AIS A;  3W8S A;  3ZVJ A;  1GL8 A;  2HSY A;  3H1N A;  3Q19 A;  2KUC A;  3P90 A;  3QCP A;  4FQU A;  1UN2 A;  4WBJ A;  3TOU A;  1FAA A;  3MDK A;  1K3L A;  2H1D A;  4ZIJ A;  4MPG A;  5KOX A;  3TRX A;  2FWG A;  4ILF A;  5DJM A;  3BCK A;  5J41 A;  1PN9 A;  5IIZ A;  1PRX A;  2GVP A;  1K0D A;  2R2J A;  1AQX A;  4F03 A;  3KM6 A;  1DE1 A;  5AIV A;  2A2P A;  3J7Y k;  2CQ9 A;  4EDZ A;  2JZS A;  5ECN B;  4FYB A;  1Z6M A;  3F6D A;  2I9H A;  2WS2 A;  1B9Y C;  2VO4 A;  4YAV A;  4XHM A;  3U6V A;  1U88 A;  4D73 B;  2R37 A;  1A2M A;  4JR6 A;  3D6I A;  1F37 A;  3L9S A;  3CMI A;  4J57 E;  2OKA A;  2P5R A;  5E59 A;  3GA4 A;  3D4M A;  5A4W A;  5HR1 A;  1EOG A;  1XFL A;  2VCZ A;  1XZO A;  4ZL7 A;  2WJU A;  4FIW A;  2VL2 A;  3M9K A;  4WF4 A;  3TJK A;  5HR3 A;  4NV5 A;  3DYR A;  1R5P A;  2RM6 A;  1TKD B;  3EUR A;  4IJI A;  1HNC A;  2F3M A;  5KN3 A;  2C0E A;  3WYW A;  2H76 A;  2DJ0 A;  1F6M C;  3F4R A;  5DJL A;  4ZB9 A;  2O7K A;  4O5U A;  2PPT A;  2I4A A;  3KTB A;  2GQM A;  2V6O A;  1S3A A;  3L4N A;  1AAZ A;  3TDG A;  1A0F A;  4RUV A;  3DKS A;  1B48 A;  2VL9 A;  4WR5 A;  2FD3 A;  2DC5 A;  2YP6 A;  1TRU A;  1KBN A;  5H5R A;  5HFK A;  2WB9 A;  4ML6 A;  5CRH A;  5J5N A;  3TKS C;  2AHE A;  3H8Q A;  5FT3 A;  4K1F A;  5DQS A;  3K8N A;  5GST A;  2VCX A;  4LMW A;  1OVN A;  1R7H A;  2LV3 A;  3D21 A;  1W89 A;  4OCE A;  4I8B A;  1PKW A;  4GQF A;  3H4K A;  4IEL A;  4F82 A;  4Z2U A;  3ERF A;  2AUV A;  4FO5 A;  3RHB A;  2HZF A;  3CSI A;  1SK1 A;  3LG6 A;  5FHI A;  3ZRE A;  1TU8 A;  2DKI A;  3DGQ A;  22GS A;  2LRT A;  2VOC A;  1WMJ A;  1YKC A;  3A2V A;  2PGT A;  4HQS A;  3QAW A;  4ML1 A;  1JHB A;  2UZ8 A;  1TK8 B;  4ZL8 A;  5F05 A;  2JL4 A;  4EXJ A;  4EO3 A;  1TJD A;  1R5A A;  4TR3 A;  1XW5 A;  1YF0 A;  2FA4 A;  2QGV A;  4H86 A;  4KUN A;  3WT2 A;  4AJ6 A;  3TB2 A;  3KP9 A;  4QL7 A;  4KSO A;  2NBS A;  4MJC A;  5JWR B;  4MCU A;  4JE1 A;  1SKR B;  3WGX A;  2CX4 A;  3GMF A;  4IQ1 A;  3VWV A;  2LEG A;  4NHZ A;  2JAC A;  2V2G A;  4ID0 A;  3TKQ A;  3F6F A;  3IK9 A;  2JZR A;  5F06 A;  5IQY A;  2ES7 A;  4EIP A;  3KD0 A;  1QXH A;  5ECK B;  4XIH A;  1ABA A;  3Q6O A;  4HQZ A;  1JFU A;  1K3O A;  3ZML A;  2H1A A;  1E2Y A;  4V2N A;  2VCW A;  2B3S A;  3QPM A;  1XWK A;  17GS A;  3LQ7 A;  1JZW A;  2DBC A;  4PQI A;  4PUR A;  1OC9 A;  4BPY A;  1BJX A;  1MDK A;  2H1B A;  5C04 A;  5LNK e;  5CAX A;  3IOS A;  5IPH A;  5A5K A;  2H01 A;  3L78 A;  5IO0 A;  1XWG A;  1CQG A;  2VCQ A;  3F3R A;  1J9B A;  5DCG A;  2MBT A;  4DSR A;  2VLV A;  3M0F A;  4KDU A;  3TJG A;  1K0N A;  6GSX A;  2MMZ A;  1Z7P A;  5EVO A;  3VUR A;  4NV2 A;  3DXB A;  1TI1 A;  2DKH A;  1SYX A;  4I2U A;  4BL7 B;  4KH7 A;  4K9Z A;  2Z9S A;  5ECQ B;  2DML A;  2H72 A;  1XW6 A;  1M2D A;  4K6X A;  4HUA A;  4AGS A;  3A5I A;  1ZYP A;  3BBY A;  3NIV A;  3TRP A;  1H75 A;  1XBS A;  1JZR A;  3PH9 A;  1VRS D;  3IAM 2;  3IRA A;  2R0P A;  3IHG A;  4NHW A;  4MAB A;  4KF9 A;  4GSN A;  4N30 A;  2IMF A;  5ECO B;  3MNG A;  3EVI A;  5JCG A;  3FZA A;  4G9H A;  5HFG A;  3CTG A;  4TKY A;  2CAQ A;  2H70 A;  5BRT A;  1GTI A;  4K5R A;  1EV4 A;  4CDO A;  2QA2 A;  1XXU A;  2R4V A;  3IDV A;  4QQ7 A;  4F9Z A;  4WKW A;  5AN1 A;  1AUC A;  4AF2 A;  1NHO A;  2CVB A;  3TJB A;  2HZE B;  4V2L A;  5IMD A;  2VAF A;  2WFC A;  1HYU A;  2FHE A;  2DSA A;  2EIR A;  5CRE A;  1XPV A;  4MZB A;  1E6B A;  1XVW A;  4AJ8 A;  3HHV A;  1M9A A;  2D2Z A;  2KP1 A;  2L6D A;  1K0M A;  1XOA A;  2OE1 A;  3H93 A;  3H79 A;  5DQY A;  1BED A;  2CVK A;  1XWA A;  8GSS A;  2VIM A;  3AY8 A;  2HI7 A;  1SKS B;  5J4U A;  5ENU A;  1GSU A;  3VI7 A;  2P31 A;  2HZE A;  4KDX A;  1F3A A;  4TR1 B;  1PL1 A;  4MP4 A;  2VLT A;  2X64 A;  3HVX A;  1KTE A;  4BVY B;  1SK2 A;  4MA9 A;  1SKW B;  1G7E A;  2EC4 A;  1TK0 B;  5IMZ A;  3A5W A;  3HZ4 A;  3SBC A;  1URM A;  4IS0 A;  4WF5 A;  2FGX A;  1ZL9 A;  4ZBA A;  2HT9 A;  5G5E A;  3G7J A;  3FYG A;  3QDN A;  3D4T A;  2C8U A;  2H0H A;  5B6N A;  3HJO A;  2LJA A;  3LYK A;  2IWT A;  1V2A A;  4TR1 A;  2DLX A;  2DJ2 A;  1AXD A;  4OFM A;  5B8A A;  4GWR A;  4BVY A;  1G0T A;  1XWC A;  2DIZ A;  4MF7 A;  1ZZY A;  4G2E A;  4KE3 A;  4GQC A;  2K18 A;  3N5O A;  3GYK A;  1YQ1 A;  3Q74 A;  3FW2 A;  2X49 A;  3C1S A;  3GKM A;  1ERV A;  2ALB A;  5FWG A;  5ID2 B;  4DSQ A;  1M2A A;  1TRW A;  2H30 A;  3VI5 A;  1TK5 B;  4V1A p;  3G7I A;  3HD5 A;  5CNW A;  3GKK A;  5F8B A;  3APQ A;  3ERW A;  4TVE A;  3RAZ A;  4OFN A;  4I6X A;  2KLX A;  1TW9 A;  4ICY A;  3VFI A;  2A2S A;  3HZ8 A;  4EUY A;  2NTO A;  2ON5 A;  1OC3 A;  1NHY A;  4MMM A;  2FLS A;  4IQA A;  5ID2 A;  5IM9 A;  4MK3 A;  3UEM A;  4HEA 2;  5A4U A;  2FWH A;  1EGR A;  4CY6 A;  2M80 A;  2O8V B;  1GH2 A;  1HQO A;  1V57 A;  3U5R E;  4ZB8 A;  3RPP A;  4HS1 A;  1DE2 A;  2HE3 A;  1EEM A;  5D9X A;  4L5O A;  4RI6 A;  3IC4 A;  4PNF A;  1SL2 B;  2YWN A;  3JCM L;  2LJK A;  1M9B A;  1O7U A;  1NW2 A;  4GCI A;  3QFA C;  1BQ7 A;  3ED3 A;  4YKF A;  1AIU A;  1EP7 A;  3APS A;  2KHP A;  4OWY A;  5G30 A;  2HLS A;  2IL3 A;  3EIN A;  2GST A;  4LMV A;  4WEY A;  5H5Q A;  2YWM A;  2F9S A;  6GST A;  4OFT A;  3FMW A;  4KCE A;  3DIE A;  3E3E A;  4EDY A;  2R5G A;  1SU9 A;  1Z3E A;  4L0U A;  3VPQ A;  4XRA A;  3CTF A;  2K8S A;  4YQU A;  3QMX A;  2HFD A;  3UMA A;  5C00 A;  4L0W A;  1B4Q A;  1O8W A;  3BD2 A;  4PUF C;  4F0C A;  5IMA A;  1B8X A;  3KGK A;  3P8W A;  2BJX A;  3CBU A;  3GL3 A;  5G2Z A;  1FOH A;  1JLW A;  3RBT A;  5G1L A;  4D73 A;  1GUK A;  3EMX A;  5E4W A;  4I97 A;  2GDR A;  3FRC A;  2AJQ B;  3LGC A;  2OBI A;  4TN8 A;  1B4P A;  4WET A;  2GSS A;  12GS A;  2BMX A;  1J0F A;  2G0F A;  1ON4 A;  5EPF A;  1O81 A;  1EWX A;  3ZFB A;  3KZQ A;  3S9F A;  2MMN A;  3P2A A;  1ZMA A;  3UOM A;  3GH6 A;  4XS6 A;  3FY7 A;  3UVT A;  4XCS A;  2PER A;  1WPI A;  5J3R A;  4K2D A;  3LYP A;  2HRN A;  3F8U A;  2V6K A;  2TIR A;  1YEX A;  1XIY A;  4X1U A;  1PQN A;  3J7Y b;  3C71 A;  2WCI A;  3QR6 A;  5CRW A;  1OE8 A;  2LTK A;  2GT5 A;  2O85 A;  4MNN A;  2AYT A;  1EEJ A;  5IPG A;  4MPF A;  4X4J A;  2R0G A;  1AW9 A;  2ZUP A;  1U3A A;  1X9W B;  1U87 A;  3GX0 A;  5DCH A;  3TGZ A;  1Q4J A;  3IPZ A;  5D73 A;  2L5O A;  4POL A;  4XS4 B;  3ZIV A;  4ZL9 A;  3G7Y A;  3QFB C;  1V9W A;  3IV4 A;  3D5J A;  2O87 A;  4PGT A;  2VL2 C;  4HOJ A;  4G0K A;  4KAE A;  2J23 A;  1FW1 A;  2OE0 A;  2H71 A;  4K2X A;  2R3X A;  1SL1 B;  5J9C A;  4MJB A;  4ULX A;  2E2G A;  3MSZ A;  4ISD A;  3KTL A;  5CRG A;  4DEJ A;  3ZZX A;  5D96 A;  2ZNM A;  4XRD A;  4NAX A;  2PWJ A;  1YKA A;  4J2F A;  1GUH A;  1QQ2 A;  3N9J A;  1WIK A;  4POB A;  4XS4 A;  1OAZ A;  1ERT A;  5GAP D;  2RUF A;  3GN3 A;  2OAD A;  2XPD A;  1YDK A;  4K7I A;  2AV4 A;  3I6A A;  4EKZ A;  9GSS A;  2JZT A;  1YJ6 A;  2TRX A;  3F0I A;  2X8C A;  1MDJ A;  3UAR A;  2CVD A;  2JSY A;  4E8H A;  2C0F A;  1OYJ A;  5AIX A;  1ERW A;  2C3T A;  1YEP A;  1KEB A;  2WUL A;  2MYG A;  2L57 A;  2ON7 A;  1O85 A;  2RLI A;  1XWB A;  2KP2 A;  4KCA A;  4KB3 A;  4RQR A;  4CHS A;  2DJ1 A;  3F4T A;  1I5G A;  4O5Q A;  3KJY A;  5IMC A;  5JWO B;  3A2X A;  4I5Q A;  5ECM B;  4ZBB A;  4FYU A;  1TRS A;  2QKE A;  1A2L A;  3OR5 A;  4DSS B;  13GS A;  3M3M A;  3HKR A;  3FKF A;  2YZU A;  2GQL A;  3KMN A;  1B9X C;  4TXO B;  1GTB A;  3DEX A;  2VM1 A;  3NOF A;  4LLR A;  1N8J A;  5AGY A;  1OKD A;  4YH2 A;  2YJ7 A;  1G7O A;  1V98 A;  1FVJ A;  1NM3 A;  4YAP A;  5DVB A;  5F0G A;  3UBK A;  1GSS A;  1PX6 A;  5L71 A;  2QSI A;  4BA7 A;  2WZ9 A;  2PU9 C;  1M2B A;  1K0C A;  3GNJ A;  1LU4 A;  4LA1 A;  4O92 A;  4KW6 A;  1TOF A;  2C3N A;  3IA1 A;  3E9J B;  2H8L A;  4TXO A;  3KH9 A;  3TKR A;  3ZIT A;  4JRR A;  3M1G A;  1QFN A;  4GST A;  4HZ4 A;  3WT1 A;  1UC7 A;  2PMT A;  3FK8 A;  1FO5 A;  1FB0 A;  1VF2 A;  2C0D A;  2GZY A;  3UBL A;  5DAK B;  5D9T A;  2PBJ A;  1QGV A;  3F4S A;  2H6Z A;  2ZCT A;  4EL1 A;  4BL7 A;  2H19 A;  3CRT A;  3UL3 A;  1PX7 A;  4ECB A;  4WXT A;  2MMA A;  4BVX B;  4JED A;  1T4Y A;  2V1M A;  1Z5Y E;  1U6T A;  1T1V A;  4AJ7 A;  2PVQ A;  3FZ4 A;  2H74 A;  3IBH A;  2XBI A;  2HRA A;  1F9M A;  2G2Q A;  2QA1 A;  2VUP A;  3O3T A;  4ECI A;  1GP1 A;  4PNG A;  4IHU A;  1XVQ A;  2F8F A;  1A8Y A;  2P0G A;  3HXS A;  1BX9 A;  1MD4 A;  2N5B A;  1EP8 A;  5DAK A;  1AQW A;  2H73 A;  2GSQ A;  2YV7 A;  2VD0 A;  4I2T A;  5F07 A;  2YNX A;  3HY2 A;  4HZ2 A;  3GX8 A;  3VWX A;  3TJJ A;  1H4O A;  2IIY A;  5HFI A;  4BVX A;  2LRC A;  1ZGN A;  1AC1 A;  1Y6E A;  4CW9 A;  4P3Y B;  5ECP B;  10GS A;  1UA5 A;  1SJI A;  1GSQ A;  3ZYW A;  1T4Z A;  3HDC A;  2O89 A;  3TRQ A;  2IMD A;  1K0B A;  2HRF A;  2H6X A;  2MZC A;  3QD9 A;  4GLT A;  1K0A A;  4YQV A;  1X9M B;  2YCD A;  4E8E A;  1TP9 A;  1GLQ A;  1O8X A;  2WDU A;  1JLV A;  3M8N A;  5EY6 A;  4MLY A;  3LEF A;  3FEU A;  1GUL A;  4A5P A;  2K9F A;  3DVW A;  5IOW A;  3MWH A;  1ML6 A;  3LXZ A;  1YF1 A;  2NPB A;  1VF1 A;  1T3B A;  4TR0 A;  2B5Y A;  4L8E A;  3ZIJ A;  1PSQ A;  1USB A;  3UIW A;  4FH8 A;  3ERG A;  4KDY A;  11GS A;  4PQ1 A;  3FZ5 A;  1Z6N A;  3IC8 A;  1THO A;  1QK8 A;  3BOA A;  20GS A;  4K0G A;  1FG4 A;  4TXV A;  1F2E A;  4NMU A;  1GSF A;  1TU7 A;  1EZK A;  1ILO A;  1MD3 A;  3EU4 A;  1WRY A;  5DAL B;  1VF3 A;  1GSE A;  2JAD A;  4DVC A;  2XHF A;  2YN1 A;  2DJ3 A;  5D9V A;  2FNO A;  4MJA A;  5KN2 A;  1TXX A;  4O32 A;  3GH9 A;  3LFL A;  3ME7 A;  2I81 A;  2H6Y A;  2B5E A;  3KEB A;  1A0R P;  4K7O A;  2H75 A;  2GTU A;  3O76 A;  2A2R A;  1IYH A;  1THX A;  2FWF A;  2V32 A;  2B7K A;  3EPT A;  2VLU A;  3L9U A;  3NZN A;  4NWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...