1QMZB

Phosphorylated cdk2-cyclyin a-substrate peptide complex
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title The Structural Basis for Specificity of Substrate and Recruitment Peptides for Cyclin-Dependent Kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 96
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1qmzB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1qmzB02
4BCQB 2I53A 1N4MA 2UZEB 2WEVB 4EOIB 4BCNB 3BHUB 2WFYB 1OIUB 5FGKB 4I3ZB 5IDNB 4CFUD 4CFWB 2PK2A 1H24B 2WMAB 3QHRB 2UZBB 3K7AM 1C9BA 4BCGB 4EOJB 2C6TB 1H1SB 4CFVB 4YOSA 2WIPB 3EJ1B 2G9XB 1GUXA 3DOGB 2W2HA 3QHWB 1UNHD 1E9HB 2W99A 1F5QB 1URCB 2QDJA 3TN8B 5HBEB 2WMBB 3BHVB 4BCFB 4CFXB 4BCOB 4BCMD 1KXUA 2CJMB 4EOLB 3M03A 4EOQB 4F7SB 4YOZA 3F5XB 5HQ0B 1TFBA 3MY5B 4CFMB 5IDPB 1W98B 3DDQB 4BCJB 1JSUB 3BHTB 1BU2A 1OL1B 5LMKB 4KRDB 1JKWA 2C5XB 2B9RA 1AD6A 1UNLD 4F7NB 2IVXA 1H28B 2W9ZA 4Y72B 4BCQD 2F2CA 1GUXB 4CFUB 2I40B 5HBJB 4BCND 2CCIB 2CCHB 4IMYB 4EOPB 1GH6B 5HBHB 4FX3B 1OIYB 4NSTB 1H27B 2R7GA 2C5VB 2IW6B 2PHGA 1VYWB 2C4GB 3G33B 2W9FA 4TTHA 4BCKB 4ELJA 5CEIB 5IF1B 2WXVB 1QMZB 2UZDB 4YOOA 3EOCB 4BCMB 5ACBA 1OL2B 2C5OB 1H4LD 4BCIB 4F6SB 4RODA 2W96A 2PMIB 4YC3B 1H1PB 2JGZB 4EOOB 1VINA 3TNHB 1FINB 3TNWB 2WPAB 1JSTB 5BNJB 1P5EB 2PK9B 3LQ5B 4CXAB 1FVVB 1O9KA 4UN0A 2BKZB 5EFQB 4BCPB 3MI9B 1VOLA 3TNIB 4OR5B 4OGRB 5LQFB 5HNBB 2X1NB 3MIAB 4EC9B 1ZP2A 1H1QB 4CRLB 4EC8B 4EOSB 3EIDB 4F6WB 4EOKB 2WIHB 4F7JB 5HVYB 2EUFA 1JOWA 1D3UB 1H1RB 4EONB 2V22B 4ROEA 2UUEB 2IW9B 1OKVB 2UZLB 3POMA 1H26B 4ROCA 5CYIB 4F7LB 2BPMB 4BCHB 1OGUB 4EOMB 2WHBB 3MY1B 4G6LB 4F6UB 1H25B 4F70B 4II5B 1PKDB 5I5ZB 5ICPB 1OI9B 1G3NC 2IW8B 1AISB 4CFNB 1UNGD 1O9KB 4KRCB 4ELLA 1GY3B 3BLRB 3BLHB 5L2WB 3H4CA 2C5NB 3DDPB 4EORB 1XO2A 3RGFB 3BLQB 3O0GD 1OKWB
chains in the Genus database with same CATH superfamily
4BCQB 2I53A 4BY1X 4BCNB 3K7AM 4YOSA 3X24B 4OB1B 1E9HB 1F5QB 3A8OB 3TN8B 4BCFB 4BCMD 4EOLB 3M03A 4YOZA 1TD6A 3MY5B 2BS2A 1W98B 5IDPB 3TW6A 1OL1B 4OB0B 2ZCFB 2B9RA 1AD6A 2QF7A 4F7NB 2IVXA 1FKMA 3BG3A 1GUXB 2CCIB 2DD5B 4EOPB 3QZ5B 4JX4A 2R7GA 2IN3A 4BXXX 3VKHA 4BCKB 2WJ9A 4BCMB 4RODA 2ZZDB 2W96A 3VYHB 2JGZB 3TNHB 3TNWB 4AKIA 1JSTB 4OB2B 1O9KA 5HNBB 4EC9B 4CRLB 2CZ6B 1V29B 3GTMS 2WIHB 4AKGA 3HB9A 4OB3B 2G77A 3POMA 4BCHB 1IREB 4EOMB 4F70B 5I5ZB 2CZ1B 3QWLA 1G3NC 2IW8B 4BBRM 4ELLA 3BLRB 3BLHB 2C5NB 3DDPB 4EORB 3BLQB 1OKWB 5FGKB 2PK2A 3QHRB 5EJCA 2QQ8A 2WIPB 3QYHB 2G9XB 2ZPBB 3X20B 3DL1A 3BHVB 4BCOB 4EOQB 3F5XB 5DQVA 3DDQB 2QFZA 2C5XB 3HBLA 4NC6A 1H28B 2KR6A 4IMYB 2D0QB 1H27B 2PHGA 1VYWB 2C4GB 3G33B 3QYEA 4ZGJB 4ELJA 5CEIB 5IF1B 2WXVB 3VKGA 3EOCB 1OL2B 4F6SB 5BNJB 4HL4A 1FVVB 2BKZB 4BCPB 3MI9B 1VOLA 3TNIB 4OGRB 5LQFB 3MIAB 1H1QB 4EOSB 5HVYB 3DJBA 1H1RB 4ROEA 1OKVB 1H26B 1OGUB 3MY1B 2DPPB 1H25B 4II5B 5ICPB 4HLQA 4MFEA 1O9KB 5L2WB 1GY3B 4JX6A 2LW4A 4EOIB 1N4MA 2WEVB 2WFYB 5IDNB 4CFUD 1E7PA 1H24B 4BY7X 2UZBB 4BCGB 4HNTA 2QDYB 4CFVB 3EJ1B 1UGQB 3BG5A 2W2HA 2W99A 1URCB 5HBEB 4CFXB 2ZPIB 2CZ7B 3X25B 1KXUA 3QYGB 2DD4B 5HQ0B 1TFBA 1BU2A 2DMEA 3HHTB 4MIMA 3DTOA 4BCQD 2F2CA 4CFUB 4BCND 5HBJB 2CCHB 4AI6A 2ZPEB 2ZPGB 5HBHB 4ZGDB 2BS4A 2C5VB 4TTHA 4ZGEB 1QMZB 2UZDB 4YOOA 3NDQA 2C5OB 4MFDA 2PMIB 3BG9A 1H1PB 4HNVA 3QXEB 1FINB 1P5EB 2PK9B 3TW7A 2DXCB 4OR5B 2PJQA 2X1NB 3WVDB 4EC8B 3EIDB 4EOKB 1JOWA 1D3UB 3X28B 4EONB 4FM4B 2UZLB 4ROCA 5CYIB 4F7LB 4G6LB 1UGSB 4Z6YA 1PKDB 1AISB 4CFNB 1UNGD 4KRCB 1XO2A 3O0GD 3KHIA 2UZEB 3BHUB 1OIUB 3WVEB 4I3ZB 2WMAB 3A8HB 1C9BA 5DQWA 4EOJB 2C6TB 1H1SB 1GUXA 3DOGB 3QHWB 1UNHD 2QDJA 4M6VA 2WMBB 2CJMB 3VYGB 1AHJB 4F7SB 4CFMB 4BCJB 1JSUB 3BHTB 4AKHA 3B57A 5LMKB 4KRDB 1JKWA 3X26B 1UNLD 2W9ZA 4Y72B 4BBSM 2CYZB 2I40B 1GH6B 2AHJB 4HNUA 4FX3B 1OIYB 4NSTB 2IW6B 2BS3A 2W9FA 2ZPHB 2DXBB 4JX5A 5ACBA 1H4LD 4BCIB 2ZPFB 4YC3B 2QGSA 4EOOB 3A8GB 1VINA 4LOCA 2WPAB 3LQ5B 4CXAB 1UGRB 1UGPB 4UN0A 5EFQB 3QZ9B 3HZJA 1ENWA 4QSHA 1ZP2A 3PO3S 4F6WB 4F7JB 2EUFA 2V22B 2KMGA 2UUEB 2IW9B 2BPMB 3A8LB 5IHYA 1QLBA 2WHBB 4F6UB 3QYBA 1OI9B 3A8MB 3HO8A 3H4CA 2CZ0B 4CFWB 3RGFB
chains in the Genus database with same CATH topology
4BCQB 2I53A 1N4MA 2UZEB 2WEVB 4EOIB 4BCNB 3BHUB 2WFYB 1OIUB 5FGKB 4I3ZB 5IDNB 4CFUD 4CFWB 2PK2A 1H24B 2WMAB 3QHRB 2UZBB 3K7AM 1C9BA 4BCGB 4EOJB 2C6TB 1H1SB 4CFVB 4YOSA 2WIPB 3EJ1B 2G9XB 1GUXA 3DOGB 2W2HA 3QHWB 1UNHD 1E9HB 2W99A 1F5QB 1URCB 2QDJA 3TN8B 5HBEB 2WMBB 3BHVB 4BCFB 4CFXB 4BCOB 4BCMD 1KXUA 2CJMB 4EOLB 3M03A 4EOQB 4F7SB 4YOZA 3F5XB 5HQ0B 1TFBA 3MY5B 4CFMB 5IDPB 1W98B 3DDQB 4BCJB 1JSUB 3BHTB 1BU2A 1OL1B 5LMKB 4KRDB 1JKWA 2C5XB 2B9RA 1AD6A 1UNLD 4F7NB 2IVXA 1H28B 2W9ZA 4Y72B 4BCQD 2F2CA 1GUXB 4CFUB 2I40B 5HBJB 4BCND 2CCIB 2CCHB 4IMYB 4EOPB 1GH6B 5HBHB 4FX3B 1OIYB 4NSTB 1H27B 2R7GA 2C5VB 2IW6B 2PHGA 1VYWB 2C4GB 3G33B 2W9FA 4TTHA 4BCKB 4ELJA 5CEIB 5IF1B 2WXVB 1QMZB 2UZDB 4YOOA 3EOCB 4BCMB 5ACBA 1OL2B 2C5OB 1H4LD 4BCIB 4F6SB 4RODA 2W96A 2PMIB 4YC3B 1H1PB 2JGZB 4EOOB 1VINA 3TNHB 1FINB 3TNWB 2WPAB 1JSTB 5BNJB 1P5EB 2PK9B 3LQ5B 4CXAB 1FVVB 1O9KA 4UN0A 2BKZB 5EFQB 4BCPB 3MI9B 1VOLA 3TNIB 4OR5B 4OGRB 5LQFB 5HNBB 2X1NB 3MIAB 4EC9B 1ZP2A 1H1QB 4CRLB 4EC8B 4EOSB 3EIDB 4F6WB 4EOKB 2WIHB 4F7JB 5HVYB 2EUFA 1JOWA 1D3UB 1H1RB 4EONB 2V22B 4ROEA 2UUEB 2IW9B 1OKVB 2UZLB 3POMA 1H26B 4ROCA 5CYIB 4F7LB 2BPMB 4BCHB 1OGUB 4EOMB 2WHBB 3MY1B 4G6LB 4F6UB 1H25B 4F70B 4II5B 1PKDB 5I5ZB 5ICPB 1OI9B 1G3NC 2IW8B 1AISB 4CFNB 1UNGD 1O9KB 4KRCB 4ELLA 1GY3B 3BLRB 3BLHB 5L2WB 3H4CA 2C5NB 3DDPB 4EORB 1XO2A 3RGFB 3BLQB 3O0GD 1OKWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BCQ B;  2I53 A;  1N4M A;  2UZE B;  2WEV B;  4EOI B;  4BCN B;  3BHU B;  2WFY B;  1OIU B;  5FGK B;  4I3Z B;  5IDN B;  4CFU D;  4CFW B;  2PK2 A;  1H24 B;  2WMA B;  3QHR B;  2UZB B;  3K7A M;  1C9B A;  4BCG B;  4EOJ B;  2C6T B;  1H1S B;  4CFV B;  4YOS A;  2WIP B;  3EJ1 B;  2G9X B;  1GUX A;  3DOG B;  2W2H A;  3QHW B;  1UNH D;  1E9H B;  2W99 A;  1F5Q B;  1URC B;  2QDJ A;  3TN8 B;  5HBE B;  2WMB B;  3BHV B;  4BCF B;  4CFX B;  4BCO B;  4BCM D;  1KXU A;  2CJM B;  4EOL B;  3M03 A;  4EOQ B;  4F7S B;  4YOZ A;  3F5X B;  5HQ0 B;  1TFB A;  3MY5 B;  4CFM B;  5IDP B;  1W98 B;  3DDQ B;  4BCJ B;  1JSU B;  3BHT B;  1BU2 A;  1OL1 B;  5LMK B;  4KRD B;  1JKW A;  2C5X B;  2B9R A;  1AD6 A;  1UNL D;  4F7N B;  2IVX A;  1H28 B;  2W9Z A;  4Y72 B;  4BCQ D;  2F2C A;  1GUX B;  4CFU B;  2I40 B;  5HBJ B;  4BCN D;  2CCI B;  2CCH B;  4IMY B;  4EOP B;  1GH6 B;  5HBH B;  4FX3 B;  1OIY B;  4NST B;  1H27 B;  2R7G A;  2C5V B;  2IW6 B;  2PHG A;  1VYW B;  2C4G B;  3G33 B;  2W9F A;  4TTH A;  4BCK B;  4ELJ A;  5CEI B;  5IF1 B;  2WXV B;  1QMZ B;  2UZD B;  4YOO A;  3EOC B;  4BCM B;  5ACB A;  1OL2 B;  2C5O B;  1H4L D;  4BCI B;  4F6S B;  4ROD A;  2W96 A;  2PMI B;  4YC3 B;  1H1P B;  2JGZ B;  4EOO B;  1VIN A;  3TNH B;  1FIN B;  3TNW B;  2WPA B;  1JST B;  5BNJ B;  1P5E B;  2PK9 B;  3LQ5 B;  4CXA B;  1FVV B;  1O9K A;  4UN0 A;  2BKZ B;  5EFQ B;  4BCP B;  3MI9 B;  1VOL A;  3TNI B;  4OR5 B;  4OGR B;  5LQF B;  5HNB B;  2X1N B;  3MIA B;  4EC9 B;  1ZP2 A;  1H1Q B;  4CRL B;  4EC8 B;  4EOS B;  3EID B;  4F6W B;  4EOK B;  2WIH B;  4F7J B;  5HVY B;  2EUF A;  1JOW A;  1D3U B;  1H1R B;  4EON B;  2V22 B;  4ROE A;  2UUE B;  2IW9 B;  1OKV B;  2UZL B;  3POM A;  1H26 B;  4ROC A;  5CYI B;  4F7L B;  2BPM B;  4BCH B;  1OGU B;  4EOM B;  2WHB B;  3MY1 B;  4G6L B;  4F6U B;  1H25 B;  4F70 B;  4II5 B;  1PKD B;  5I5Z B;  5ICP B;  1OI9 B;  1G3N C;  2IW8 B;  1AIS B;  4CFN B;  1UNG D;  1O9K B;  4KRC B;  4ELL A;  1GY3 B;  3BLR B;  3BLH B;  5L2W B;  3H4C A;  2C5N B;  3DDP B;  4EOR B;  1XO2 A;  3RGF B;  3BLQ B;  3O0G D;  1OKW B; 
#chains in the Genus database with same CATH topology
 4BCQ B;  2I53 A;  4BY1 X;  4BCN B;  3K7A M;  4YOS A;  3X24 B;  4OB1 B;  1E9H B;  1F5Q B;  3A8O B;  3TN8 B;  4BCF B;  4BCM D;  4EOL B;  3M03 A;  4YOZ A;  1TD6 A;  3MY5 B;  2BS2 A;  1W98 B;  5IDP B;  3TW6 A;  1OL1 B;  4OB0 B;  2ZCF B;  2B9R A;  1AD6 A;  2QF7 A;  4F7N B;  2IVX A;  1FKM A;  3BG3 A;  1GUX B;  2CCI B;  2DD5 B;  4EOP B;  3QZ5 B;  4JX4 A;  2R7G A;  2IN3 A;  4BXX X;  3VKH A;  4BCK B;  2WJ9 A;  4BCM B;  4ROD A;  2ZZD B;  2W96 A;  3VYH B;  2JGZ B;  3TNH B;  3TNW B;  4AKI A;  1JST B;  4OB2 B;  1O9K A;  5HNB B;  4EC9 B;  4CRL B;  2CZ6 B;  1V29 B;  3GTM S;  2WIH B;  4AKG A;  3HB9 A;  4OB3 B;  2G77 A;  3POM A;  4BCH B;  1IRE B;  4EOM B;  4F70 B;  5I5Z B;  2CZ1 B;  3QWL A;  1G3N C;  2IW8 B;  4BBR M;  4ELL A;  3BLR B;  3BLH B;  2C5N B;  3DDP B;  4EOR B;  3BLQ B;  1OKW B;  5FGK B;  2PK2 A;  3QHR B;  5EJC A;  2QQ8 A;  2WIP B;  3QYH B;  2G9X B;  2ZPB B;  3X20 B;  3DL1 A;  3BHV B;  4BCO B;  4EOQ B;  3F5X B;  5DQV A;  3DDQ B;  2QFZ A;  2C5X B;  3HBL A;  4NC6 A;  1H28 B;  2KR6 A;  4IMY B;  2D0Q B;  1H27 B;  2PHG A;  1VYW B;  2C4G B;  3G33 B;  3QYE A;  4ZGJ B;  4ELJ A;  5CEI B;  5IF1 B;  2WXV B;  3VKG A;  3EOC B;  1OL2 B;  4F6S B;  5BNJ B;  4HL4 A;  1FVV B;  2BKZ B;  4BCP B;  3MI9 B;  1VOL A;  3TNI B;  4OGR B;  5LQF B;  3MIA B;  1H1Q B;  4EOS B;  5HVY B;  3DJB A;  1H1R B;  4ROE A;  1OKV B;  1H26 B;  1OGU B;  3MY1 B;  2DPP B;  1H25 B;  4II5 B;  5ICP B;  4HLQ A;  4MFE A;  1O9K B;  5L2W B;  1GY3 B;  4JX6 A;  2LW4 A;  4EOI B;  1N4M A;  2WEV B;  2WFY B;  5IDN B;  4CFU D;  1E7P A;  1H24 B;  4BY7 X;  2UZB B;  4BCG B;  4HNT A;  2QDY B;  4CFV B;  3EJ1 B;  1UGQ B;  3BG5 A;  2W2H A;  2W99 A;  1URC B;  5HBE B;  4CFX B;  2ZPI B;  2CZ7 B;  3X25 B;  1KXU A;  3QYG B;  2DD4 B;  5HQ0 B;  1TFB A;  1BU2 A;  2DME A;  3HHT B;  4MIM A;  3DTO A;  4BCQ D;  2F2C A;  4CFU B;  4BCN D;  5HBJ B;  2CCH B;  4AI6 A;  2ZPE B;  2ZPG B;  5HBH B;  4ZGD B;  2BS4 A;  2C5V B;  4TTH A;  4ZGE B;  1QMZ B;  2UZD B;  4YOO A;  3NDQ A;  2C5O B;  4MFD A;  2PMI B;  3BG9 A;  1H1P B;  4HNV A;  3QXE B;  1FIN B;  1P5E B;  2PK9 B;  3TW7 A;  2DXC B;  4OR5 B;  2PJQ A;  2X1N B;  3WVD B;  4EC8 B;  3EID B;  4EOK B;  1JOW A;  1D3U B;  3X28 B;  4EON B;  4FM4 B;  2UZL B;  4ROC A;  5CYI B;  4F7L B;  4G6L B;  1UGS B;  4Z6Y A;  1PKD B;  1AIS B;  4CFN B;  1UNG D;  4KRC B;  1XO2 A;  3O0G D;  3KHI A;  2UZE B;  3BHU B;  1OIU B;  3WVE B;  4I3Z B;  2WMA B;  3A8H B;  1C9B A;  5DQW A;  4EOJ B;  2C6T B;  1H1S B;  1GUX A;  3DOG B;  3QHW B;  1UNH D;  2QDJ A;  4M6V A;  2WMB B;  2CJM B;  3VYG B;  1AHJ B;  4F7S B;  4CFM B;  4BCJ B;  1JSU B;  3BHT B;  4AKH A;  3B57 A;  5LMK B;  4KRD B;  1JKW A;  3X26 B;  1UNL D;  2W9Z A;  4Y72 B;  4BBS M;  2CYZ B;  2I40 B;  1GH6 B;  2AHJ B;  4HNU A;  4FX3 B;  1OIY B;  4NST B;  2IW6 B;  2BS3 A;  2W9F A;  2ZPH B;  2DXB B;  4JX5 A;  5ACB A;  1H4L D;  4BCI B;  2ZPF B;  4YC3 B;  2QGS A;  4EOO B;  3A8G B;  1VIN A;  4LOC A;  2WPA B;  3LQ5 B;  4CXA B;  1UGR B;  1UGP B;  4UN0 A;  5EFQ B;  3QZ9 B;  3HZJ A;  1ENW A;  4QSH A;  1ZP2 A;  3PO3 S;  4F6W B;  4F7J B;  2EUF A;  2V22 B;  2KMG A;  2UUE B;  2IW9 B;  2BPM B;  3A8L B;  5IHY A;  1QLB A;  2WHB B;  4F6U B;  3QYB A;  1OI9 B;  3A8M B;  3HO8 A;  3H4C A;  2CZ0 B;  4CFW B;  3RGF B; 
#chains in the Genus database with same CATH homology
 4BCQ B;  2I53 A;  1N4M A;  2UZE B;  2WEV B;  4EOI B;  4BCN B;  3BHU B;  2WFY B;  1OIU B;  5FGK B;  4I3Z B;  5IDN B;  4CFU D;  4CFW B;  2PK2 A;  1H24 B;  2WMA B;  3QHR B;  2UZB B;  3K7A M;  1C9B A;  4BCG B;  4EOJ B;  2C6T B;  1H1S B;  4CFV B;  4YOS A;  2WIP B;  3EJ1 B;  2G9X B;  1GUX A;  3DOG B;  2W2H A;  3QHW B;  1UNH D;  1E9H B;  2W99 A;  1F5Q B;  1URC B;  2QDJ A;  3TN8 B;  5HBE B;  2WMB B;  3BHV B;  4BCF B;  4CFX B;  4BCO B;  4BCM D;  1KXU A;  2CJM B;  4EOL B;  3M03 A;  4EOQ B;  4F7S B;  4YOZ A;  3F5X B;  5HQ0 B;  1TFB A;  3MY5 B;  4CFM B;  5IDP B;  1W98 B;  3DDQ B;  4BCJ B;  1JSU B;  3BHT B;  1BU2 A;  1OL1 B;  5LMK B;  4KRD B;  1JKW A;  2C5X B;  2B9R A;  1AD6 A;  1UNL D;  4F7N B;  2IVX A;  1H28 B;  2W9Z A;  4Y72 B;  4BCQ D;  2F2C A;  1GUX B;  4CFU B;  2I40 B;  5HBJ B;  4BCN D;  2CCI B;  2CCH B;  4IMY B;  4EOP B;  1GH6 B;  5HBH B;  4FX3 B;  1OIY B;  4NST B;  1H27 B;  2R7G A;  2C5V B;  2IW6 B;  2PHG A;  1VYW B;  2C4G B;  3G33 B;  2W9F A;  4TTH A;  4BCK B;  4ELJ A;  5CEI B;  5IF1 B;  2WXV B;  1QMZ B;  2UZD B;  4YOO A;  3EOC B;  4BCM B;  5ACB A;  1OL2 B;  2C5O B;  1H4L D;  4BCI B;  4F6S B;  4ROD A;  2W96 A;  2PMI B;  4YC3 B;  1H1P B;  2JGZ B;  4EOO B;  1VIN A;  3TNH B;  1FIN B;  3TNW B;  2WPA B;  1JST B;  5BNJ B;  1P5E B;  2PK9 B;  3LQ5 B;  4CXA B;  1FVV B;  1O9K A;  4UN0 A;  2BKZ B;  5EFQ B;  4BCP B;  3MI9 B;  1VOL A;  3TNI B;  4OR5 B;  4OGR B;  5LQF B;  5HNB B;  2X1N B;  3MIA B;  4EC9 B;  1ZP2 A;  1H1Q B;  4CRL B;  4EC8 B;  4EOS B;  3EID B;  4F6W B;  4EOK B;  2WIH B;  4F7J B;  5HVY B;  2EUF A;  1JOW A;  1D3U B;  1H1R B;  4EON B;  2V22 B;  4ROE A;  2UUE B;  2IW9 B;  1OKV B;  2UZL B;  3POM A;  1H26 B;  4ROC A;  5CYI B;  4F7L B;  2BPM B;  4BCH B;  1OGU B;  4EOM B;  2WHB B;  3MY1 B;  4G6L B;  4F6U B;  1H25 B;  4F70 B;  4II5 B;  1PKD B;  5I5Z B;  5ICP B;  1OI9 B;  1G3N C;  2IW8 B;  1AIS B;  4CFN B;  1UNG D;  1O9K B;  4KRC B;  4ELL A;  1GY3 B;  3BLR B;  3BLH B;  5L2W B;  3H4C A;  2C5N B;  3DDP B;  4EOR B;  1XO2 A;  3RGF B;  3BLQ B;  3O0G D;  1OKW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...