1QN2A

Cytochrome ch from methylobacterium extorquens
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
EGDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEGADGYAFSDALKKSGLTWDQADLKQWLADPKKKVPGTKMVFPGISDPKKVDDIIAYLKTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME CH
publication title The Molecular Structure of an Unusual Cytochrome C2 Determined at 2.0A; the Cytochrome cH from Methylobacterium Extorquens
pubmed doi rcsb
molecule tags Cytochrome
total genus 25
structure length 99
sequence length 99
chains with identical sequence B, C
ec nomenclature
pdb deposition date 1999-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00034 Cytochrom_C Cytochrome c
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 1qn2A00
1HJ4A 2BH4X 4IL6V 1GQ1A 1P84D 1I8PA 4EIFA 1HZVA 5EXQA 1CC5A 4PWAA 5H2FV 5GTHV 1PP9D 1SQPD 3CYTI 4DY9A 1HJ5A 1IO3A 1DVVA 5DJQC 3L4MA 1JDLA 1CRHA 4FA5A 3O0RC 2D0WA 3L4OA 1YTCA 1CSWA 2N9JA 4U3FD 1I8OA 5B6QA 2YIUB 3ZOWA 1KX7A 2OZ1B 1FI9A 3HQ9A 1CIHA 1ZRTD 1I6EA 2ZBOA 1H32A 1R0QA 1FOCA 4H0KA 3VYMA 1E8EA 3M97X 2FWLA 4XYDB 2YK3A 1S6VB 3CXHD 4GYDA 1B7VA 1CIFA 1RAQA 2LIRA 1N15A 2ZZS1 4PJ0V 3PH2B 2AI5A 4WQAA 5DFSA 5DJQB 3OCDA 5B5EV 4K3IA 2VHDA 4UB8V 1QN2A 1CRYA 5TISV 1VYDA 1RZ5A 1U74B 1I6DA 2CA4B 2A06D 1YICA 1QL4A 1H32B 4YE1A 2C1UA 3RN1A 4AALA 1KV9A 2PCBB 3VRDA 3JBTB 3PXWA 2GB8B 4L3HA 4WQCA 1CHHA 1MG2D 3MK7B 1HCMA 4RSZA 4AAOA 1N9CA 4AANA 1SQQD 2L4DA 2MHMA 1CXAA 1H31A 4J20A 1KB9D 3WFCC 1KYOD 1KYOW 3WFEC 1CIGA 4FANA 1C2NA 3H1JD 1HH7A 1NTKD 3PXTA 3H1HD 5B66V 2N3YA 3CU4A 5C0ZA 3A0BV 4EICA 3O20A 4WQDA 1EB7A 1HROA 1WEJF 5KLVD 3O1YA 5CIBB 2N18B 5KKZB 4JCGA 1SQBD 1H31B 2FYUD 2OZ1A 2DVHA 3HQ6A 1U75B 1W5CT 1CHIA 4PW9B 1C7MA 2IBZD 2QJPB 1QL3A 1SQXD 4V2KA 1C2RA 1N50A 1NMLA 2CXBA 2QJKB 1DT1A 3KZIV 2DGEA 5CIHB 1CXCA 1L9JC 1NTMD 1CSVA 5GTIV 5CIFB 5IY51 3L74D 4XXLA 2BGVX 1PPJD 1NNOA 3BCCD 3L71D 1COTA 1C6RA 2V08A 4PD4D 1DVHA 1CTYA 1DW1A 2LITA 1ZZHA 1S5LV 1DIIC 2MTAC 3VNWA 2AIUA 2FYNB 3C2CA 1NU1D 4KMGA 1BL9A 1CRGA 2JQRA 1CTZA 3OA8A 1N90A 1H9YA 3H1LD 1E2RA 3SWSA 4H0JA 2BPBB 3TYIA 1CEDA 1CYJA 1WVEC 3H1ID 3CP5A 1I55A 1A2SA 5AURA 1J3SA 4L3GA 1C75A 1CYCA 1CTJA 1F1FA 2GC7D 3ORVA 2B10B 1CSUA 5C9MA 2BCCD 1A56A 5CICB 5E79V 1LFMA 4N0KA 3WFBC 1NMIA 3ZIYA 1CIEA 1AKKA 1QYZA 1L0ND 3OA8B 3PXSA 1FI7A 3WC8A 2CE1A 3O5CA 4MU8A 3NWVA 1NIRA 3CX5W 5DF5A 4NFGB 1CO6A 1KB0A 4WQEA 1GJQA 1I54A 3NBTA 4EIEA 1LS9A 3HQ7A 1CNOA 4Y5RA 1MZ4A 1H33A 1HRCA 4UB6V 2BH5X 4FAVA 4WQBA 4D6TD 3L72D 4O1WA 1E29A 1W2LA 1YCCA 2QJYB 2B11B 1SQVD 1CRJA 2YCCA 1BCCD 2AXTV 3ZOYA 3X39A 3SVWA 4AX3A 1HZUA 4LJIA 1YEAA 4WQ8A 2B0ZB 3ZOOA 2C8SA 1H33B 2I8FA 3ZBMA 2ZOOA 1FHBA 3L73D 3SLEA 2YQBA 3RN0A 3WUIA 2B4ZA 1CRIA 2CA3B 4QAOA 5KLIB 1DW2A 4WQ9A 1KX2A 1BGYD 2C9XB 1LC2A 3L70D 1KIBA 351CA 1IZL0 2BCNB 1M6ZA 2V07A 1OCDA 4EIDA 5CIDB 1IRWA 2GC4D 2PACA 3TGUD 1HJ3A 3ZCFA 4FA4A 1QKSA 3A9FA 1CCHA 1OAEA 1CSXA 1YNRA 3WFDC 3A0HV 1M70A 4WQ7A 3DP5A 3MK7C 2ZONG 1CORA 2FRCA 1IQCA 4AAMA 1FI3A 4GEDB 2PCCB 3CXHW 3RMZA 1I5TA 1F1CA 1YIQA 3WU2V 5KAFV 3DR0A 1AYGA 2C1VA 3ZOXA 3HQ8A 1GKSA 4L1QA 3RLMA 4O1QA 1CHJA 1C52A 1CRCA 1EZVD 1C6SA 2D0SA 2ORLA 1GIWA 1K3HA 1L9BC 1FCDC 1LC1A 2CE0A 1CYIA 3CX5D 1DIQC 4FA1A 2C2CA 2HV4A 3H1KD 1K3GA 2N9IA 2N18C 1RAPA 1A8CA 4P4QB 1YFCA 5KAIV 1MG3D 2N3BA 2GIWA 451CA 1BE3D 3OCDB 3CWBD 2C1DA 4FB1A 1GU2A 2EXVA 2BLFB 3SXTA 4FA9A 2XTSB 1YEBA 1DW3A 3L75D 1M60A 1GDVA 1H1OA 1CCRA 5CIGB 1H9XA 3DMIA 3NBSA 2ZXYA 1ETPA 1DW0A 1IRVA 2JTIB 155CA 1AOFA 1NTZD 1C6OA 5CIEB 3SJLA 5CYTR 1LMSA 4Q5PA 1L0LD 1RZ6A 2C1DB 1FJ0A 1AOQA 2B12B
chains in the Genus database with same CATH superfamily
1HJ4A 2BH4X 4IL6V 1GQ1A 1P84D 1I8PA 4EIFA 1HZVA 5EXQA 1CC5A 4PWAA 5H2FV 5GTHV 1PP9D 1SQPD 3CYTI 4DY9A 1HJ5A 1IO3A 1DVVA 5DJQC 3L4MA 1JDLA 1CRHA 4FA5A 3O0RC 2D0WA 3L4OA 1YTCA 1CSWA 2N9JA 4U3FD 1I8OA 5B6QA 2YIUB 3ZOWA 1KX7A 2OZ1B 1FI9A 3HQ9A 1CIHA 1ZRTD 1I6EA 2ZBOA 1H32A 1R0QA 1FOCA 4H0KA 3VYMA 1E8EA 3M97X 2FWLA 4XYDB 2YK3A 1S6VB 3CXHD 4GYDA 1B7VA 1CIFA 1RAQA 2LIRA 1N15A 2ZZS1 4PJ0V 3PH2B 2AI5A 4WQAA 5DFSA 5DJQB 3OCDA 5B5EV 4K3IA 2VHDA 4UB8V 1QN2A 1CRYA 5TISV 1VYDA 1RZ5A 1U74B 1I6DA 2CA4B 2A06D 1YICA 1QL4A 1H32B 4YE1A 2C1UA 3RN1A 4AALA 1KV9A 2PCBB 3VRDA 3JBTB 3PXWA 2GB8B 4L3HA 4WQCA 1CHHA 1MG2D 3MK7B 1HCMA 4RSZA 4AAOA 1N9CA 4AANA 1SQQD 2L4DA 2MHMA 1CXAA 1H31A 4J20A 1KB9D 3WFCC 1KYOD 1KYOW 3WFEC 1CIGA 4FANA 1C2NA 3H1JD 1HH7A 1NTKD 3PXTA 3H1HD 5B66V 2N3YA 3CU4A 5C0ZA 3A0BV 4EICA 3O20A 4WQDA 1EB7A 1HROA 1WEJF 5KLVD 3O1YA 5CIBB 2N18B 5KKZB 4JCGA 1SQBD 1H31B 2FYUD 2OZ1A 2DVHA 3HQ6A 1U75B 1W5CT 1CHIA 4PW9B 1C7MA 2IBZD 2QJPB 1QL3A 1SQXD 4V2KA 1C2RA 1N50A 1NMLA 2CXBA 2QJKB 1DT1A 3KZIV 2DGEA 5CIHB 1CXCA 1L9JC 1NTMD 1CSVA 5GTIV 5CIFB 5IY51 3L74D 4XXLA 2BGVX 1PPJD 1NNOA 3BCCD 3L71D 1COTA 1C6RA 2V08A 4PD4D 1DVHA 1CTYA 1DW1A 2LITA 1ZZHA 1S5LV 1DIIC 2MTAC 3VNWA 2AIUA 3D0WA 2FYNB 3C2CA 1NU1D 4KMGA 1BL9A 1CRGA 2JQRA 1CTZA 3OA8A 1N90A 1H9YA 3H1LD 1E2RA 3SWSA 4H0JA 2BPBB 3TYIA 1CEDA 1CYJA 1WVEC 3H1ID 3CP5A 1I55A 1A2SA 5AURA 1J3SA 4L3GA 1C75A 1CYCA 1CTJA 1F1FA 2GC7D 3ORVA 2B10B 1CSUA 5C9MA 2BCCD 1A56A 5CICB 5E79V 1LFMA 4N0KA 3WFBC 1NMIA 3ZIYA 1CIEA 1AKKA 1QYZA 1L0ND 3OA8B 3PXSA 1FI7A 3WC8A 2CE1A 3O5CA 4MU8A 3NWVA 1NIRA 3CX5W 5DF5A 4NFGB 1CO6A 1KB0A 4WQEA 1GJQA 1I54A 3NBTA 4EIEA 1LS9A 3HQ7A 1CNOA 4Y5RA 1MZ4A 1H33A 1HRCA 4UB6V 2BH5X 4FAVA 4WQBA 4D6TD 3L72D 4O1WA 1E29A 1W2LA 1YCCA 2QJYB 2B11B 1SQVD 1CRJA 2YCCA 1BCCD 2AXTV 3ZOYA 3X39A 3SVWA 4AX3A 1HZUA 4LJIA 1YEAA 4WQ8A 2B0ZB 3ZOOA 2C8SA 1H33B 2I8FA 3ZBMA 2ZOOA 1FHBA 3L73D 3SLEA 2YQBA 3RN0A 3WUIA 2B4ZA 1CRIA 2CA3B 4QAOA 5KLIB 1DW2A 4WQ9A 1KX2A 1BGYD 2C9XB 1LC2A 3L70D 1KIBA 351CA 1IZL0 2BCNB 1M6ZA 2V07A 1OCDA 4EIDA 5CIDB 1IRWA 2GC4D 2PACA 3TGUD 1HJ3A 3ZCFA 4FA4A 1QKSA 3A9FA 1CCHA 1OAEA 1CSXA 1YNRA 3WFDC 3A0HV 1M70A 4WQ7A 3DP5A 3MK7C 2ZONG 1CORA 2FRCA 1IQCA 4AAMA 1FI3A 4GEDB 2PCCB 3CXHW 3RMZA 1I5TA 1F1CA 1YIQA 3WU2V 5KAFV 3DR0A 1AYGA 2C1VA 3ZOXA 3HQ8A 1GKSA 4L1QA 3RLMA 4O1QA 1CHJA 1C52A 1CRCA 1EZVD 1C6SA 2D0SA 2ORLA 1GIWA 1K3HA 1L9BC 1FCDC 1LC1A 2CE0A 1CYIA 3CX5D 1DIQC 4FA1A 2C2CA 2HV4A 3H1KD 1K3GA 2N9IA 2N18C 1RAPA 1A8CA 4P4QB 1YFCA 5KAIV 1MG3D 2N3BA 2GIWA 451CA 1BE3D 3OCDB 3CWBD 2C1DA 4FB1A 1GU2A 2EXVA 2BLFB 3SXTA 4FA9A 2XTSB 1YEBA 1DW3A 3L75D 1M60A 1GDVA 1H1OA 1CCRA 5CIGB 1H9XA 3DMIA 3NBSA 2ZXYA 1ETPA 1DW0A 1IRVA 2JTIB 155CA 1AOFA 1NTZD 1C6OA 5CIEB 3SJLA 5CYTR 1LMSA 4Q5PA 1L0LD 1RZ6A 2C1DB 1FJ0A 1AOQA 2B12B
chains in the Genus database with same CATH topology
1HJ4A 2BH4X 4IL6V 1GQ1A 1P84D 1I8PA 4EIFA 1HZVA 5EXQA 1CC5A 4PWAA 5H2FV 5GTHV 1PP9D 1SQPD 3CYTI 4DY9A 1HJ5A 1IO3A 1DVVA 5DJQC 3L4MA 1JDLA 1CRHA 4FA5A 3O0RC 2D0WA 3L4OA 1YTCA 1CSWA 2N9JA 4U3FD 1I8OA 5B6QA 2YIUB 3ZOWA 1KX7A 2OZ1B 1FI9A 3HQ9A 1CIHA 1ZRTD 1I6EA 2ZBOA 1H32A 1R0QA 1FOCA 4H0KA 3VYMA 1E8EA 3M97X 2FWLA 4XYDB 2YK3A 1S6VB 3CXHD 4GYDA 1B7VA 1CIFA 1RAQA 2LIRA 1N15A 2ZZS1 4PJ0V 3PH2B 2AI5A 4WQAA 5DFSA 5DJQB 3OCDA 5B5EV 4K3IA 2VHDA 4UB8V 1QN2A 1CRYA 5TISV 1VYDA 1RZ5A 1U74B 1I6DA 2CA4B 2A06D 1YICA 1QL4A 1H32B 4YE1A 2C1UA 3RN1A 4AALA 1KV9A 2PCBB 3VRDA 3JBTB 3PXWA 2GB8B 4L3HA 4WQCA 1CHHA 1MG2D 3MK7B 1HCMA 4RSZA 4AAOA 1N9CA 4AANA 1SQQD 2L4DA 2MHMA 1CXAA 1H31A 4J20A 1KB9D 3WFCC 1KYOD 1KYOW 3WFEC 1CIGA 4FANA 1C2NA 3H1JD 1HH7A 1NTKD 3PXTA 3H1HD 5B66V 2N3YA 3CU4A 5C0ZA 3A0BV 4EICA 3O20A 4WQDA 1EB7A 1HROA 1WEJF 5KLVD 3O1YA 5CIBB 2N18B 5KKZB 4JCGA 1SQBD 1H31B 2FYUD 2OZ1A 2DVHA 3HQ6A 1U75B 1W5CT 1CHIA 4PW9B 1C7MA 2IBZD 2QJPB 1QL3A 1SQXD 4V2KA 1C2RA 1N50A 1NMLA 2CXBA 2QJKB 1DT1A 3KZIV 2DGEA 5CIHB 1CXCA 1L9JC 1NTMD 1CSVA 5GTIV 5CIFB 5IY51 3L74D 4XXLA 2BGVX 1PPJD 1NNOA 3BCCD 3L71D 1COTA 1C6RA 2V08A 4PD4D 1DVHA 1CTYA 1DW1A 2LITA 1ZZHA 1S5LV 1DIIC 2MTAC 3VNWA 2AIUA 2FYNB 3C2CA 1NU1D 4KMGA 1BL9A 1CRGA 2JQRA 1CTZA 3OA8A 1N90A 1H9YA 3H1LD 1E2RA 3SWSA 4H0JA 2BPBB 3TYIA 1CEDA 1CYJA 1WVEC 3H1ID 3CP5A 1I55A 1A2SA 5AURA 1J3SA 4L3GA 1C75A 1CYCA 1CTJA 1F1FA 2GC7D 3ORVA 2B10B 1CSUA 5C9MA 2BCCD 1A56A 5CICB 5E79V 1LFMA 4N0KA 3WFBC 1NMIA 3ZIYA 1CIEA 1AKKA 1QYZA 1L0ND 3OA8B 3PXSA 1FI7A 3WC8A 2CE1A 3O5CA 4MU8A 3NWVA 1NIRA 3CX5W 5DF5A 4NFGB 1CO6A 1KB0A 4WQEA 1GJQA 1I54A 3NBTA 4EIEA 1LS9A 3HQ7A 1CNOA 4Y5RA 1MZ4A 1H33A 1HRCA 4UB6V 2BH5X 4FAVA 4WQBA 4D6TD 3L72D 4O1WA 1E29A 1W2LA 1YCCA 2QJYB 2B11B 1SQVD 1CRJA 2YCCA 1BCCD 2AXTV 3ZOYA 3X39A 3SVWA 4AX3A 1HZUA 4LJIA 1YEAA 4WQ8A 2B0ZB 3ZOOA 2C8SA 1H33B 2I8FA 3ZBMA 2ZOOA 1FHBA 3L73D 3SLEA 2YQBA 3RN0A 3WUIA 2B4ZA 1CRIA 2CA3B 4QAOA 5KLIB 1DW2A 4WQ9A 1KX2A 1BGYD 2C9XB 1LC2A 3L70D 1KIBA 351CA 1IZL0 2BCNB 1M6ZA 2V07A 1OCDA 4EIDA 5CIDB 1IRWA 2GC4D 2PACA 3TGUD 1HJ3A 3ZCFA 4FA4A 1QKSA 3A9FA 1CCHA 1OAEA 1CSXA 1YNRA 3WFDC 3A0HV 1M70A 4WQ7A 3DP5A 3MK7C 2ZONG 1CORA 2FRCA 1IQCA 4AAMA 1FI3A 4GEDB 2PCCB 3CXHW 3RMZA 1I5TA 1F1CA 1YIQA 3WU2V 5KAFV 3DR0A 1AYGA 2C1VA 3ZOXA 3HQ8A 1GKSA 4L1QA 3RLMA 4O1QA 1CHJA 1C52A 1CRCA 1EZVD 1C6SA 2D0SA 2ORLA 1GIWA 1K3HA 1L9BC 1FCDC 1LC1A 2CE0A 1CYIA 3CX5D 1DIQC 4FA1A 2C2CA 2HV4A 3H1KD 1K3GA 2N9IA 2N18C 1RAPA 1A8CA 4P4QB 1YFCA 5KAIV 1MG3D 2N3BA 2GIWA 451CA 1BE3D 3OCDB 3CWBD 2C1DA 4FB1A 1GU2A 2EXVA 2BLFB 3SXTA 4FA9A 2XTSB 1YEBA 1DW3A 3L75D 1M60A 1GDVA 1H1OA 1CCRA 5CIGB 1H9XA 3DMIA 3NBSA 2ZXYA 1ETPA 1DW0A 1IRVA 2JTIB 155CA 1AOFA 1NTZD 1C6OA 5CIEB 3SJLA 5CYTR 1LMSA 4Q5PA 1L0LD 1RZ6A 2C1DB 1FJ0A 1AOQA 2B12B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJ4 A;  2BH4 X;  4IL6 V;  1GQ1 A;  1P84 D;  1I8P A;  4EIF A;  1HZV A;  5EXQ A;  1CC5 A;  4PWA A;  5H2F V;  5GTH V;  1PP9 D;  1SQP D;  3CYT I;  4DY9 A;  1HJ5 A;  1IO3 A;  1DVV A;  5DJQ C;  3L4M A;  1JDL A;  1CRH A;  4FA5 A;  3O0R C;  2D0W A;  3L4O A;  1YTC A;  1CSW A;  2N9J A;  4U3F D;  1I8O A;  5B6Q A;  2YIU B;  3ZOW A;  1KX7 A;  2OZ1 B;  1FI9 A;  3HQ9 A;  1CIH A;  1ZRT D;  1I6E A;  2ZBO A;  1H32 A;  1R0Q A;  1FOC A;  4H0K A;  3VYM A;  1E8E A;  3M97 X;  2FWL A;  4XYD B;  2YK3 A;  1S6V B;  3CXH D;  4GYD A;  1B7V A;  1CIF A;  1RAQ A;  2LIR A;  1N15 A;  2ZZS 1;  4PJ0 V;  3PH2 B;  2AI5 A;  4WQA A;  5DFS A;  5DJQ B;  3OCD A;  5B5E V;  4K3I A;  2VHD A;  4UB8 V;  1QN2 A;  1CRY A;  5TIS V;  1VYD A;  1RZ5 A;  1U74 B;  1I6D A;  2CA4 B;  2A06 D;  1YIC A;  1QL4 A;  1H32 B;  4YE1 A;  2C1U A;  3RN1 A;  4AAL A;  1KV9 A;  2PCB B;  3VRD A;  3JBT B;  3PXW A;  2GB8 B;  4L3H A;  4WQC A;  1CHH A;  1MG2 D;  3MK7 B;  1HCM A;  4RSZ A;  4AAO A;  1N9C A;  4AAN A;  1SQQ D;  2L4D A;  2MHM A;  1CXA A;  1H31 A;  4J20 A;  1KB9 D;  3WFC C;  1KYO D;  1KYO W;  3WFE C;  1CIG A;  4FAN A;  1C2N A;  3H1J D;  1HH7 A;  1NTK D;  3PXT A;  3H1H D;  5B66 V;  2N3Y A;  3CU4 A;  5C0Z A;  3A0B V;  4EIC A;  3O20 A;  4WQD A;  1EB7 A;  1HRO A;  1WEJ F;  5KLV D;  3O1Y A;  5CIB B;  2N18 B;  5KKZ B;  4JCG A;  1SQB D;  1H31 B;  2FYU D;  2OZ1 A;  2DVH A;  3HQ6 A;  1U75 B;  1W5C T;  1CHI A;  4PW9 B;  1C7M A;  2IBZ D;  2QJP B;  1QL3 A;  1SQX D;  4V2K A;  1C2R A;  1N50 A;  1NML A;  2CXB A;  2QJK B;  1DT1 A;  3KZI V;  2DGE A;  5CIH B;  1CXC A;  1L9J C;  1NTM D;  1CSV A;  5GTI V;  5CIF B;  5IY5 1;  3L74 D;  4XXL A;  2BGV X;  1PPJ D;  1NNO A;  3BCC D;  3L71 D;  1COT A;  1C6R A;  2V08 A;  4PD4 D;  1DVH A;  1CTY A;  1DW1 A;  2LIT A;  1ZZH A;  1S5L V;  1DII C;  2MTA C;  3VNW A;  2AIU A;  2FYN B;  3C2C A;  1NU1 D;  4KMG A;  1BL9 A;  1CRG A;  2JQR A;  1CTZ A;  3OA8 A;  1N90 A;  1H9Y A;  3H1L D;  1E2R A;  3SWS A;  4H0J A;  2BPB B;  3TYI A;  1CED A;  1CYJ A;  1WVE C;  3H1I D;  3CP5 A;  1I55 A;  1A2S A;  5AUR A;  1J3S A;  4L3G A;  1C75 A;  1CYC A;  1CTJ A;  1F1F A;  2GC7 D;  3ORV A;  2B10 B;  1CSU A;  5C9M A;  2BCC D;  1A56 A;  5CIC B;  5E79 V;  1LFM A;  4N0K A;  3WFB C;  1NMI A;  3ZIY A;  1CIE A;  1AKK A;  1QYZ A;  1L0N D;  3OA8 B;  3PXS A;  1FI7 A;  3WC8 A;  2CE1 A;  3O5C A;  4MU8 A;  3NWV A;  1NIR A;  3CX5 W;  5DF5 A;  4NFG B;  1CO6 A;  1KB0 A;  4WQE A;  1GJQ A;  1I54 A;  3NBT A;  4EIE A;  1LS9 A;  3HQ7 A;  1CNO A;  4Y5R A;  1MZ4 A;  1H33 A;  1HRC A;  4UB6 V;  2BH5 X;  4FAV A;  4WQB A;  4D6T D;  3L72 D;  4O1W A;  1E29 A;  1W2L A;  1YCC A;  2QJY B;  2B11 B;  1SQV D;  1CRJ A;  2YCC A;  1BCC D;  2AXT V;  3ZOY A;  3X39 A;  3SVW A;  4AX3 A;  1HZU A;  4LJI A;  1YEA A;  4WQ8 A;  2B0Z B;  3ZOO A;  2C8S A;  1H33 B;  2I8F A;  3ZBM A;  2ZOO A;  1FHB A;  3L73 D;  3SLE A;  2YQB A;  3RN0 A;  3WUI A;  2B4Z A;  1CRI A;  2CA3 B;  4QAO A;  5KLI B;  1DW2 A;  4WQ9 A;  1KX2 A;  1BGY D;  2C9X B;  1LC2 A;  3L70 D;  1KIB A;  351C A;  1IZL 0;  2BCN B;  1M6Z A;  2V07 A;  1OCD A;  4EID A;  5CID B;  1IRW A;  2GC4 D;  2PAC A;  3TGU D;  1HJ3 A;  3ZCF A;  4FA4 A;  1QKS A;  3A9F A;  1CCH A;  1OAE A;  1CSX A;  1YNR A;  3WFD C;  3A0H V;  1M70 A;  4WQ7 A;  3DP5 A;  3MK7 C;  2ZON G;  1COR A;  2FRC A;  1IQC A;  4AAM A;  1FI3 A;  4GED B;  2PCC B;  3CXH W;  3RMZ A;  1I5T A;  1F1C A;  1YIQ A;  3WU2 V;  5KAF V;  3DR0 A;  1AYG A;  2C1V A;  3ZOX A;  3HQ8 A;  1GKS A;  4L1Q A;  3RLM A;  4O1Q A;  1CHJ A;  1C52 A;  1CRC A;  1EZV D;  1C6S A;  2D0S A;  2ORL A;  1GIW A;  1K3H A;  1L9B C;  1FCD C;  1LC1 A;  2CE0 A;  1CYI A;  3CX5 D;  1DIQ C;  4FA1 A;  2C2C A;  2HV4 A;  3H1K D;  1K3G A;  2N9I A;  2N18 C;  1RAP A;  1A8C A;  4P4Q B;  1YFC A;  5KAI V;  1MG3 D;  2N3B A;  2GIW A;  451C A;  1BE3 D;  3OCD B;  3CWB D;  2C1D A;  4FB1 A;  1GU2 A;  2EXV A;  2BLF B;  3SXT A;  4FA9 A;  2XTS B;  1YEB A;  1DW3 A;  3L75 D;  1M60 A;  1GDV A;  1H1O A;  1CCR A;  5CIG B;  1H9X A;  3DMI A;  3NBS A;  2ZXY A;  1ETP A;  1DW0 A;  1IRV A;  2JTI B;  155C A;  1AOF A;  1NTZ D;  1C6O A;  5CIE B;  3SJL A;  5CYT R;  1LMS A;  4Q5P A;  1L0L D;  1RZ6 A;  2C1D B;  1FJ0 A;  1AOQ A;  2B12 B; 
#chains in the Genus database with same CATH topology
 1HJ4 A;  2BH4 X;  4IL6 V;  1GQ1 A;  1P84 D;  1I8P A;  4EIF A;  1HZV A;  5EXQ A;  1CC5 A;  4PWA A;  5H2F V;  5GTH V;  1PP9 D;  1SQP D;  3CYT I;  4DY9 A;  1HJ5 A;  1IO3 A;  1DVV A;  5DJQ C;  3L4M A;  1JDL A;  1CRH A;  4FA5 A;  3O0R C;  2D0W A;  3L4O A;  1YTC A;  1CSW A;  2N9J A;  4U3F D;  1I8O A;  5B6Q A;  2YIU B;  3ZOW A;  1KX7 A;  2OZ1 B;  1FI9 A;  3HQ9 A;  1CIH A;  1ZRT D;  1I6E A;  2ZBO A;  1H32 A;  1R0Q A;  1FOC A;  4H0K A;  3VYM A;  1E8E A;  3M97 X;  2FWL A;  4XYD B;  2YK3 A;  1S6V B;  3CXH D;  4GYD A;  1B7V A;  1CIF A;  1RAQ A;  2LIR A;  1N15 A;  2ZZS 1;  4PJ0 V;  3PH2 B;  2AI5 A;  4WQA A;  5DFS A;  5DJQ B;  3OCD A;  5B5E V;  4K3I A;  2VHD A;  4UB8 V;  1QN2 A;  1CRY A;  5TIS V;  1VYD A;  1RZ5 A;  1U74 B;  1I6D A;  2CA4 B;  2A06 D;  1YIC A;  1QL4 A;  1H32 B;  4YE1 A;  2C1U A;  3RN1 A;  4AAL A;  1KV9 A;  2PCB B;  3VRD A;  3JBT B;  3PXW A;  2GB8 B;  4L3H A;  4WQC A;  1CHH A;  1MG2 D;  3MK7 B;  1HCM A;  4RSZ A;  4AAO A;  1N9C A;  4AAN A;  1SQQ D;  2L4D A;  2MHM A;  1CXA A;  1H31 A;  4J20 A;  1KB9 D;  3WFC C;  1KYO D;  1KYO W;  3WFE C;  1CIG A;  4FAN A;  1C2N A;  3H1J D;  1HH7 A;  1NTK D;  3PXT A;  3H1H D;  5B66 V;  2N3Y A;  3CU4 A;  5C0Z A;  3A0B V;  4EIC A;  3O20 A;  4WQD A;  1EB7 A;  1HRO A;  1WEJ F;  5KLV D;  3O1Y A;  5CIB B;  2N18 B;  5KKZ B;  4JCG A;  1SQB D;  1H31 B;  2FYU D;  2OZ1 A;  2DVH A;  3HQ6 A;  1U75 B;  1W5C T;  1CHI A;  4PW9 B;  1C7M A;  2IBZ D;  2QJP B;  1QL3 A;  1SQX D;  4V2K A;  1C2R A;  1N50 A;  1NML A;  2CXB A;  2QJK B;  1DT1 A;  3KZI V;  2DGE A;  5CIH B;  1CXC A;  1L9J C;  1NTM D;  1CSV A;  5GTI V;  5CIF B;  5IY5 1;  3L74 D;  4XXL A;  2BGV X;  1PPJ D;  1NNO A;  3BCC D;  3L71 D;  1COT A;  1C6R A;  2V08 A;  4PD4 D;  1DVH A;  1CTY A;  1DW1 A;  2LIT A;  1ZZH A;  1S5L V;  1DII C;  2MTA C;  3VNW A;  2AIU A;  3D0W A;  2FYN B;  3C2C A;  1NU1 D;  4KMG A;  1BL9 A;  1CRG A;  2JQR A;  1CTZ A;  3OA8 A;  1N90 A;  1H9Y A;  3H1L D;  1E2R A;  3SWS A;  4H0J A;  2BPB B;  3TYI A;  1CED A;  1CYJ A;  1WVE C;  3H1I D;  3CP5 A;  1I55 A;  1A2S A;  5AUR A;  1J3S A;  4L3G A;  1C75 A;  1CYC A;  1CTJ A;  1F1F A;  2GC7 D;  3ORV A;  2B10 B;  1CSU A;  5C9M A;  2BCC D;  1A56 A;  5CIC B;  5E79 V;  1LFM A;  4N0K A;  3WFB C;  1NMI A;  3ZIY A;  1CIE A;  1AKK A;  1QYZ A;  1L0N D;  3OA8 B;  3PXS A;  1FI7 A;  3WC8 A;  2CE1 A;  3O5C A;  4MU8 A;  3NWV A;  1NIR A;  3CX5 W;  5DF5 A;  4NFG B;  1CO6 A;  1KB0 A;  4WQE A;  1GJQ A;  1I54 A;  3NBT A;  4EIE A;  1LS9 A;  3HQ7 A;  1CNO A;  4Y5R A;  1MZ4 A;  1H33 A;  1HRC A;  4UB6 V;  2BH5 X;  4FAV A;  4WQB A;  4D6T D;  3L72 D;  4O1W A;  1E29 A;  1W2L A;  1YCC A;  2QJY B;  2B11 B;  1SQV D;  1CRJ A;  2YCC A;  1BCC D;  2AXT V;  3ZOY A;  3X39 A;  3SVW A;  4AX3 A;  1HZU A;  4LJI A;  1YEA A;  4WQ8 A;  2B0Z B;  3ZOO A;  2C8S A;  1H33 B;  2I8F A;  3ZBM A;  2ZOO A;  1FHB A;  3L73 D;  3SLE A;  2YQB A;  3RN0 A;  3WUI A;  2B4Z A;  1CRI A;  2CA3 B;  4QAO A;  5KLI B;  1DW2 A;  4WQ9 A;  1KX2 A;  1BGY D;  2C9X B;  1LC2 A;  3L70 D;  1KIB A;  351C A;  1IZL 0;  2BCN B;  1M6Z A;  2V07 A;  1OCD A;  4EID A;  5CID B;  1IRW A;  2GC4 D;  2PAC A;  3TGU D;  1HJ3 A;  3ZCF A;  4FA4 A;  1QKS A;  3A9F A;  1CCH A;  1OAE A;  1CSX A;  1YNR A;  3WFD C;  3A0H V;  1M70 A;  4WQ7 A;  3DP5 A;  3MK7 C;  2ZON G;  1COR A;  2FRC A;  1IQC A;  4AAM A;  1FI3 A;  4GED B;  2PCC B;  3CXH W;  3RMZ A;  1I5T A;  1F1C A;  1YIQ A;  3WU2 V;  5KAF V;  3DR0 A;  1AYG A;  2C1V A;  3ZOX A;  3HQ8 A;  1GKS A;  4L1Q A;  3RLM A;  4O1Q A;  1CHJ A;  1C52 A;  1CRC A;  1EZV D;  1C6S A;  2D0S A;  2ORL A;  1GIW A;  1K3H A;  1L9B C;  1FCD C;  1LC1 A;  2CE0 A;  1CYI A;  3CX5 D;  1DIQ C;  4FA1 A;  2C2C A;  2HV4 A;  3H1K D;  1K3G A;  2N9I A;  2N18 C;  1RAP A;  1A8C A;  4P4Q B;  1YFC A;  5KAI V;  1MG3 D;  2N3B A;  2GIW A;  451C A;  1BE3 D;  3OCD B;  3CWB D;  2C1D A;  4FB1 A;  1GU2 A;  2EXV A;  2BLF B;  3SXT A;  4FA9 A;  2XTS B;  1YEB A;  1DW3 A;  3L75 D;  1M60 A;  1GDV A;  1H1O A;  1CCR A;  5CIG B;  1H9X A;  3DMI A;  3NBS A;  2ZXY A;  1ETP A;  1DW0 A;  1IRV A;  2JTI B;  155C A;  1AOF A;  1NTZ D;  1C6O A;  5CIE B;  3SJL A;  5CYT R;  1LMS A;  4Q5P A;  1L0L D;  1RZ6 A;  2C1D B;  1FJ0 A;  1AOQ A;  2B12 B; 
#chains in the Genus database with same CATH homology
 1HJ4 A;  2BH4 X;  4IL6 V;  1GQ1 A;  1P84 D;  1I8P A;  4EIF A;  1HZV A;  5EXQ A;  1CC5 A;  4PWA A;  5H2F V;  5GTH V;  1PP9 D;  1SQP D;  3CYT I;  4DY9 A;  1HJ5 A;  1IO3 A;  1DVV A;  5DJQ C;  3L4M A;  1JDL A;  1CRH A;  4FA5 A;  3O0R C;  2D0W A;  3L4O A;  1YTC A;  1CSW A;  2N9J A;  4U3F D;  1I8O A;  5B6Q A;  2YIU B;  3ZOW A;  1KX7 A;  2OZ1 B;  1FI9 A;  3HQ9 A;  1CIH A;  1ZRT D;  1I6E A;  2ZBO A;  1H32 A;  1R0Q A;  1FOC A;  4H0K A;  3VYM A;  1E8E A;  3M97 X;  2FWL A;  4XYD B;  2YK3 A;  1S6V B;  3CXH D;  4GYD A;  1B7V A;  1CIF A;  1RAQ A;  2LIR A;  1N15 A;  2ZZS 1;  4PJ0 V;  3PH2 B;  2AI5 A;  4WQA A;  5DFS A;  5DJQ B;  3OCD A;  5B5E V;  4K3I A;  2VHD A;  4UB8 V;  1QN2 A;  1CRY A;  5TIS V;  1VYD A;  1RZ5 A;  1U74 B;  1I6D A;  2CA4 B;  2A06 D;  1YIC A;  1QL4 A;  1H32 B;  4YE1 A;  2C1U A;  3RN1 A;  4AAL A;  1KV9 A;  2PCB B;  3VRD A;  3JBT B;  3PXW A;  2GB8 B;  4L3H A;  4WQC A;  1CHH A;  1MG2 D;  3MK7 B;  1HCM A;  4RSZ A;  4AAO A;  1N9C A;  4AAN A;  1SQQ D;  2L4D A;  2MHM A;  1CXA A;  1H31 A;  4J20 A;  1KB9 D;  3WFC C;  1KYO D;  1KYO W;  3WFE C;  1CIG A;  4FAN A;  1C2N A;  3H1J D;  1HH7 A;  1NTK D;  3PXT A;  3H1H D;  5B66 V;  2N3Y A;  3CU4 A;  5C0Z A;  3A0B V;  4EIC A;  3O20 A;  4WQD A;  1EB7 A;  1HRO A;  1WEJ F;  5KLV D;  3O1Y A;  5CIB B;  2N18 B;  5KKZ B;  4JCG A;  1SQB D;  1H31 B;  2FYU D;  2OZ1 A;  2DVH A;  3HQ6 A;  1U75 B;  1W5C T;  1CHI A;  4PW9 B;  1C7M A;  2IBZ D;  2QJP B;  1QL3 A;  1SQX D;  4V2K A;  1C2R A;  1N50 A;  1NML A;  2CXB A;  2QJK B;  1DT1 A;  3KZI V;  2DGE A;  5CIH B;  1CXC A;  1L9J C;  1NTM D;  1CSV A;  5GTI V;  5CIF B;  5IY5 1;  3L74 D;  4XXL A;  2BGV X;  1PPJ D;  1NNO A;  3BCC D;  3L71 D;  1COT A;  1C6R A;  2V08 A;  4PD4 D;  1DVH A;  1CTY A;  1DW1 A;  2LIT A;  1ZZH A;  1S5L V;  1DII C;  2MTA C;  3VNW A;  2AIU A;  2FYN B;  3C2C A;  1NU1 D;  4KMG A;  1BL9 A;  1CRG A;  2JQR A;  1CTZ A;  3OA8 A;  1N90 A;  1H9Y A;  3H1L D;  1E2R A;  3SWS A;  4H0J A;  2BPB B;  3TYI A;  1CED A;  1CYJ A;  1WVE C;  3H1I D;  3CP5 A;  1I55 A;  1A2S A;  5AUR A;  1J3S A;  4L3G A;  1C75 A;  1CYC A;  1CTJ A;  1F1F A;  2GC7 D;  3ORV A;  2B10 B;  1CSU A;  5C9M A;  2BCC D;  1A56 A;  5CIC B;  5E79 V;  1LFM A;  4N0K A;  3WFB C;  1NMI A;  3ZIY A;  1CIE A;  1AKK A;  1QYZ A;  1L0N D;  3OA8 B;  3PXS A;  1FI7 A;  3WC8 A;  2CE1 A;  3O5C A;  4MU8 A;  3NWV A;  1NIR A;  3CX5 W;  5DF5 A;  4NFG B;  1CO6 A;  1KB0 A;  4WQE A;  1GJQ A;  1I54 A;  3NBT A;  4EIE A;  1LS9 A;  3HQ7 A;  1CNO A;  4Y5R A;  1MZ4 A;  1H33 A;  1HRC A;  4UB6 V;  2BH5 X;  4FAV A;  4WQB A;  4D6T D;  3L72 D;  4O1W A;  1E29 A;  1W2L A;  1YCC A;  2QJY B;  2B11 B;  1SQV D;  1CRJ A;  2YCC A;  1BCC D;  2AXT V;  3ZOY A;  3X39 A;  3SVW A;  4AX3 A;  1HZU A;  4LJI A;  1YEA A;  4WQ8 A;  2B0Z B;  3ZOO A;  2C8S A;  1H33 B;  2I8F A;  3ZBM A;  2ZOO A;  1FHB A;  3L73 D;  3SLE A;  2YQB A;  3RN0 A;  3WUI A;  2B4Z A;  1CRI A;  2CA3 B;  4QAO A;  5KLI B;  1DW2 A;  4WQ9 A;  1KX2 A;  1BGY D;  2C9X B;  1LC2 A;  3L70 D;  1KIB A;  351C A;  1IZL 0;  2BCN B;  1M6Z A;  2V07 A;  1OCD A;  4EID A;  5CID B;  1IRW A;  2GC4 D;  2PAC A;  3TGU D;  1HJ3 A;  3ZCF A;  4FA4 A;  1QKS A;  3A9F A;  1CCH A;  1OAE A;  1CSX A;  1YNR A;  3WFD C;  3A0H V;  1M70 A;  4WQ7 A;  3DP5 A;  3MK7 C;  2ZON G;  1COR A;  2FRC A;  1IQC A;  4AAM A;  1FI3 A;  4GED B;  2PCC B;  3CXH W;  3RMZ A;  1I5T A;  1F1C A;  1YIQ A;  3WU2 V;  5KAF V;  3DR0 A;  1AYG A;  2C1V A;  3ZOX A;  3HQ8 A;  1GKS A;  4L1Q A;  3RLM A;  4O1Q A;  1CHJ A;  1C52 A;  1CRC A;  1EZV D;  1C6S A;  2D0S A;  2ORL A;  1GIW A;  1K3H A;  1L9B C;  1FCD C;  1LC1 A;  2CE0 A;  1CYI A;  3CX5 D;  1DIQ C;  4FA1 A;  2C2C A;  2HV4 A;  3H1K D;  1K3G A;  2N9I A;  2N18 C;  1RAP A;  1A8C A;  4P4Q B;  1YFC A;  5KAI V;  1MG3 D;  2N3B A;  2GIW A;  451C A;  1BE3 D;  3OCD B;  3CWB D;  2C1D A;  4FB1 A;  1GU2 A;  2EXV A;  2BLF B;  3SXT A;  4FA9 A;  2XTS B;  1YEB A;  1DW3 A;  3L75 D;  1M60 A;  1GDV A;  1H1O A;  1CCR A;  5CIG B;  1H9X A;  3DMI A;  3NBS A;  2ZXY A;  1ETP A;  1DW0 A;  1IRV A;  2JTI B;  155C A;  1AOF A;  1NTZ D;  1C6O A;  5CIE B;  3SJL A;  5CYT R;  1LMS A;  4Q5P A;  1L0L D;  1RZ6 A;  2C1D B;  1FJ0 A;  1AOQ A;  2B12 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...