1QN4A

Crystal structure of the t(-24) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Tata box-binding protein (tbp)
total genus 48
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn4A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn4A02
1KYFA 2D0CA 1TBAB 1PZDA 3OCIA 1QN8A 1QTSA 1MP9A 1KYUA 4RODB 4B0AA 2IV9A 1QNBA 3OC3C 1B9KA 1QN4A 1QNAA 3HS9A 1KYDA 1VTLE 1JFIC 1D3UA 3HS8A 1VTOA 2G30A 1QN7A 2D0BA 1R4XA 1YTBA 1W80A 2Z8UA 3VN5A 1VOLB 1RM1A 3H1ZA 1QTPA 1NGMA 1QNCA 5IYDP 1KY7A 1NH2A 1AISA 1TGHA 1QN5A 1TBPA 1C9BB 2IV8A 5IYCP 1CDWA 1NVPA 2D0AA 4ROCB 1QN9A 1QN6A 1E42A 3EIKA 4PY5A 4WZSD 1KY6A 5IYBP 1PCZA 2MJ7A 4ROEB 1QN3A 1QNEA 1YTFA 3ASMA 1VOKA 2VJ0A
chains in the Genus database with same CATH superfamily
3F0ZA 1WQAA 3N89A 1QTSA 2QRCA 2HZMA 1KFQA 3CWUA 1LWYA 1YQMA 3KRMA 1JFIC 2JHNA 1D3UA 4C7PA 2G30A 1M3QA 1W80A 5KL0A 3VN5A 2HZSA 3OGDA 1QNCA 1VOLB 1NGMA 3CW7A 3SNSA 3I3WA 3OSMA 1C9BB 1CDWA 4DULA 2FKMX 1NVPA 4EJYA 4ROCB 1E42A 2ZFDB 1K35A 4EAKA 1VKLA 2H5AX 1T6AA 3ASMA 3ENCA 4WX8A 3EAYA 2VJ0A 1KYFA 2D0CA 3DPUA 2I5WA 2O3OA 2Y8LA 1KFIA 1Q9UA 1MP9A 4RODB 1P5GX 1TUOA 1B9KA 3TDHA 2V8QA 3HS9A 1KYDA 4Q11A 3TE5A 4BJUA 3IH7A 1VTLE 1YQLA 1HU0A 2JHJA 2Y8QA 2Z0FA 3OSEA 4HJHA 1R4XA 3KTUA 2FUVA 1C4GA 3D7QA 4WXAA 3ULXA 1JDYA 2OOXA 3D4VA 1PCJX 2NOIA 3ENOC 1TBPA 2EHBD 2HL8A 2R5XA 2NLVA 1XSZA 3UW2A 2D0AA 3RPJA 5BMNA 1YQRA 2F7LA 4CFFA 1KY6A 1P5DX 2MJ7A 3PMGA 1UT7A 3CWAA 1LWVA 1YTFA 2XHIA 4QG5A 4D7QA 1VOKA 1PZDA 2LAEA 4TPSA 3OCIA 1QN8A 2QRDA 1KYUA 4B0AA 2IV9A 1QNBA 1WJWA 1QN4A 2HL9A 3NA5A 1N3CA 1KO9A 2QR1A 1YTBA 5AN4A 5JMVD 5JN5A 1UT4A 3H1ZA 2NOHA 3OLPA 1M3HA 1AISA 4EALA 5HSHA 3I0XA 1LWWA 1C47A 1PCMX 2H4LX 1PVSA 1QN9A 2DKCA 3EIKA 5F9CA 1N39A 2YH5A 3CWSA 1PCZA 2JPIA 4PY5A 3I0WA 1J3MA 4EAGA 4EAIA 1VTOA 1UL7A 1YQKA 1TBAB 2V92A 2NOEA 1DIZA 3CVTA 2DKAA 3OC3C 2QREA 5BMPA 2NOLA 1QNAA 1K2YX 2NVMA 1EUVA 2NOBA 4I8OA 3HS8A 3RSMA 1QN7A 2D0BA 2HKPA 3OH9A 2NWVA 2FKFA 2V9JA 2YA3A 4D7RA 2NOZA 2Z8UA 3CVSA 3C04A 3PDKA 4IL8A 5EPCA 1QTPA 1RM1A 1N3AA 1KY7A 1NH2A 1TGHA 1QN5A 1V5SA 1M5Q1 1FN7A 2QLVA 3F10A 2DKDA 2IV8A 5IYCP 1EBMA 2OOYA 4EJZA 1LXTA 3T4NA 3OSTA 1QN6A 3CWTA 4EAJA 4WZSD 3DPTA 5IYBP 1MPGA 4ROEB 2NOFA 2PWWA 1QN3A 2JOIA 4MRQA 2MZ8A 2FGTA 3BKQX 1QNEA 3OH6A 5IYDP
chains in the Genus database with same CATH topology
3F0ZA 3N89A 1QTSA 2HZMA 1LWYA 1YQMA 3KRMA 1JFIC 1D3UA 2G30A 1M3QA 1W80A 1VOLB 3VN5A 2HZSA 1QNCA 1NGMA 3SNSA 3OSMA 1C9BB 1CDWA 4DULA 1NVPA 4EJYA 4ROCB 1E42A 3ASMA 2VJ0A 1KYFA 2D0CA 3DPUA 2I5WA 2O3OA 1MP9A 4RODB 1B9KA 3HS9A 1KYDA 4Q11A 3IH7A 1VTLE 1YQLA 1HU0A 3KTUA 1R4XA 3ULXA 2NOIA 1TBPA 2D0AA 3RPJA 1YQRA 1KY6A 2MJ7A 1UT7A 1LWVA 1YTFA 2XHIA 1PZDA 1VOKA 2LAEA 4TPSA 3OCIA 1QN8A 1KYUA 4B0AA 2IV9A 1QNBA 1QN4A 1N3CA 1KO9A 1YTBA 5AN4A 1UT4A 3H1ZA 2NOHA 1M3HA 1AISA 3I0XA 1LWWA 1QN9A 3EIKA 4PY5A 1N39A 2YH5A 1PCZA 3I0WA 1VTOA 1YQKA 1TBAB 2NOEA 3OC3C 2NOLA 1QNAA 2NOBA 4I8OA 3HS8A 1QN7A 2D0BA 2NOZA 2Z8UA 1RM1A 1N3AA 1QTPA 1KY7A 1NH2A 1TGHA 1QN5A 1FN7A 3F10A 4EJZA 2IV8A 5IYCP 1EBMA 3OSTA 1QN6A 4WZSD 3DPTA 5IYBP 4ROEB 2NOFA 1QN3A 2JOIA 1QNEA 2MZ8A 2FGTA 5IYDP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYF A;  2D0C A;  1TBA B;  1PZD A;  3OCI A;  1QN8 A;  1QTS A;  1MP9 A;  1KYU A;  4ROD B;  4B0A A;  2IV9 A;  1QNB A;  3OC3 C;  1B9K A;  1QN4 A;  1QNA A;  3HS9 A;  1KYD A;  1VTL E;  1JFI C;  1D3U A;  3HS8 A;  1VTO A;  2G30 A;  1QN7 A;  2D0B A;  1R4X A;  1YTB A;  1W80 A;  2Z8U A;  3VN5 A;  1VOL B;  1RM1 A;  3H1Z A;  1QTP A;  1NGM A;  1QNC A;  5IYD P;  1KY7 A;  1NH2 A;  1AIS A;  1TGH A;  1QN5 A;  1TBP A;  1C9B B;  2IV8 A;  5IYC P;  1CDW A;  1NVP A;  2D0A A;  4ROC B;  1QN9 A;  1QN6 A;  1E42 A;  3EIK A;  4PY5 A;  4WZS D;  1KY6 A;  5IYB P;  1PCZ A;  2MJ7 A;  4ROE B;  1QN3 A;  1QNE A;  1YTF A;  3ASM A;  1VOK A;  2VJ0 A; 
#chains in the Genus database with same CATH topology
 3F0Z A;  1WQA A;  3N89 A;  1QTS A;  2QRC A;  2HZM A;  1KFQ A;  3CWU A;  1LWY A;  1YQM A;  3KRM A;  1JFI C;  2JHN A;  1D3U A;  4C7P A;  2G30 A;  1M3Q A;  1W80 A;  5KL0 A;  3VN5 A;  2HZS A;  3OGD A;  1QNC A;  1VOL B;  1NGM A;  3CW7 A;  3SNS A;  3I3W A;  3OSM A;  1C9B B;  1CDW A;  4DUL A;  2FKM X;  1NVP A;  4EJY A;  4ROC B;  1E42 A;  2ZFD B;  1K35 A;  4EAK A;  1VKL A;  2H5A X;  1T6A A;  3ASM A;  3ENC A;  4WX8 A;  3EAY A;  2VJ0 A;  1KYF A;  2D0C A;  3DPU A;  2I5W A;  2O3O A;  2Y8L A;  1KFI A;  1Q9U A;  1MP9 A;  4ROD B;  1P5G X;  1TUO A;  1B9K A;  3TDH A;  2V8Q A;  3HS9 A;  1KYD A;  4Q11 A;  3TE5 A;  4BJU A;  3IH7 A;  1VTL E;  1YQL A;  1HU0 A;  2JHJ A;  2Y8Q A;  2Z0F A;  3OSE A;  4HJH A;  1R4X A;  3KTU A;  2FUV A;  1C4G A;  3D7Q A;  4WXA A;  3ULX A;  1JDY A;  2OOX A;  3D4V A;  1PCJ X;  2NOI A;  3ENO C;  1TBP A;  2EHB D;  2HL8 A;  2R5X A;  2NLV A;  1XSZ A;  3UW2 A;  2D0A A;  3RPJ A;  5BMN A;  1YQR A;  2F7L A;  4CFF A;  1KY6 A;  1P5D X;  2MJ7 A;  3PMG A;  1UT7 A;  3CWA A;  1LWV A;  1YTF A;  2XHI A;  4QG5 A;  4D7Q A;  1VOK A;  1PZD A;  2LAE A;  4TPS A;  3OCI A;  1QN8 A;  2QRD A;  1KYU A;  4B0A A;  2IV9 A;  1QNB A;  1WJW A;  1QN4 A;  2HL9 A;  3NA5 A;  1N3C A;  1KO9 A;  2QR1 A;  1YTB A;  5AN4 A;  5JMV D;  5JN5 A;  1UT4 A;  3H1Z A;  2NOH A;  3OLP A;  1M3H A;  1AIS A;  4EAL A;  5HSH A;  3I0X A;  1LWW A;  1C47 A;  1PCM X;  2H4L X;  1PVS A;  1QN9 A;  2DKC A;  3EIK A;  5F9C A;  1N39 A;  2YH5 A;  3CWS A;  1PCZ A;  2JPI A;  4PY5 A;  3I0W A;  1J3M A;  4EAG A;  4EAI A;  1VTO A;  1UL7 A;  1YQK A;  1TBA B;  2V92 A;  2NOE A;  1DIZ A;  3CVT A;  2DKA A;  3OC3 C;  2QRE A;  5BMP A;  2NOL A;  1QNA A;  1K2Y X;  2NVM A;  1EUV A;  2NOB A;  4I8O A;  3HS8 A;  3RSM A;  1QN7 A;  2D0B A;  2HKP A;  3OH9 A;  2NWV A;  2FKF A;  2V9J A;  2YA3 A;  4D7R A;  2NOZ A;  2Z8U A;  3CVS A;  3C04 A;  3PDK A;  4IL8 A;  5EPC A;  1QTP A;  1RM1 A;  1N3A A;  1KY7 A;  1NH2 A;  1TGH A;  1QN5 A;  1V5S A;  1M5Q 1;  1FN7 A;  2QLV A;  3F10 A;  2DKD A;  2IV8 A;  5IYC P;  1EBM A;  2OOY A;  4EJZ A;  1LXT A;  3T4N A;  3OST A;  1QN6 A;  3CWT A;  4EAJ A;  4WZS D;  3DPT A;  5IYB P;  1MPG A;  4ROE B;  2NOF A;  2PWW A;  1QN3 A;  2JOI A;  4MRQ A;  2MZ8 A;  2FGT A;  3BKQ X;  1QNE A;  3OH6 A;  5IYD P; 
#chains in the Genus database with same CATH homology
 3F0Z A;  3N89 A;  1QTS A;  2HZM A;  1LWY A;  1YQM A;  3KRM A;  1JFI C;  1D3U A;  2G30 A;  1M3Q A;  1W80 A;  1VOL B;  3VN5 A;  2HZS A;  1QNC A;  1NGM A;  3SNS A;  3OSM A;  1C9B B;  1CDW A;  4DUL A;  1NVP A;  4EJY A;  4ROC B;  1E42 A;  3ASM A;  2VJ0 A;  1KYF A;  2D0C A;  3DPU A;  2I5W A;  2O3O A;  1MP9 A;  4ROD B;  1B9K A;  3HS9 A;  1KYD A;  4Q11 A;  3IH7 A;  1VTL E;  1YQL A;  1HU0 A;  3KTU A;  1R4X A;  3ULX A;  2NOI A;  1TBP A;  2D0A A;  3RPJ A;  1YQR A;  1KY6 A;  2MJ7 A;  1UT7 A;  1LWV A;  1YTF A;  2XHI A;  1PZD A;  1VOK A;  2LAE A;  4TPS A;  3OCI A;  1QN8 A;  1KYU A;  4B0A A;  2IV9 A;  1QNB A;  1QN4 A;  1N3C A;  1KO9 A;  1YTB A;  5AN4 A;  1UT4 A;  3H1Z A;  2NOH A;  1M3H A;  1AIS A;  3I0X A;  1LWW A;  1QN9 A;  3EIK A;  4PY5 A;  1N39 A;  2YH5 A;  1PCZ A;  3I0W A;  1VTO A;  1YQK A;  1TBA B;  2NOE A;  3OC3 C;  2NOL A;  1QNA A;  2NOB A;  4I8O A;  3HS8 A;  1QN7 A;  2D0B A;  2NOZ A;  2Z8U A;  1RM1 A;  1N3A A;  1QTP A;  1KY7 A;  1NH2 A;  1TGH A;  1QN5 A;  1FN7 A;  3F10 A;  4EJZ A;  2IV8 A;  5IYC P;  1EBM A;  3OST A;  1QN6 A;  4WZS D;  3DPT A;  5IYB P;  4ROE B;  2NOF A;  1QN3 A;  2JOI A;  1QNE A;  2MZ8 A;  2FGT A;  5IYD P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...