1QN7A

Crystal structure of the t(-27) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
186
structure length
186
Chain Sequence
DLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Tata box-binding protein (tbp)
total genus 48
structure length 186
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn7A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn7A02
1QN6A 1AISA 1KYFA 1PCZA 1QTSA 3H1ZA 4WZSD 1KY7A 1QNCA 1R4XA 4PY5A 3ASMA 2IV8A 2VJ0A 1D3UA 3EIKA 1PZDA 1TBAB 1KY6A 4B0AA 1NH2A 5IYBP 1QN9A 2G30A 5IYCP 3OC3C 5IYDP 4ROCB 1E42A 1MP9A 2D0BA 3OCIA 1YTBA 1QN5A 1QN8A 1B9KA 1QNBA 1C9BB 3HS8A 1KYUA 2IV9A 1VTOA 1NVPA 1VTLE 1RM1A 1QNEA 2D0CA 1KYDA 1QN4A 1YTFA 1TBPA 1CDWA 1QN7A 1QN3A 4ROEB 1NGMA 4RODB 1W80A 3HS9A 2MJ7A 1VOKA 1QNAA 2Z8UA 3VN5A 1JFIC 1TGHA 2D0AA 1VOLB 1QTPA
chains in the Genus database with same CATH superfamily
2Z0FA 2DKCA 1KYFA 3NA5A 3OSMA 3H1ZA 3ULXA 4WZSD 2FKMX 1QNCA 1D3UA 1KY6A 1PZDA 2OOXA 3KRMA 1EBMA 2R5XA 4B0AA 1QN9A 2I5WA 4C7PA 2G30A 2QLVA 1KO9A 3CWTA 5IYDP 2QREA 3SNSA 1UL7A 1E42A 2D0BA 3D4VA 1M3QA 4DULA 2F7LA 2IV9A 5HSHA 4D7RA 1QTPA 1QN4A 1QN7A 1LWYA 1P5GX 2QRCA 3BKQX 1TUOA 3HS9A 3OH6A 1VOKA 2YA3A 3C04A 3OSTA 2D0AA 1K35A 3I0WA 2V9JA 5BMPA 1AISA 2V92A 3EAYA 4PY5A 5JN5A 4BJUA 2VJ0A 4WX8A 1KFIA 1TBAB 3I3WA 3KTUA 1V5SA 3RSMA 2HL8A 2HL9A 3UW2A 5IYCP 3OGDA 4ROCB 3N89A 2QRDA 3RPJA 1YTBA 5EPCA 1HU0A 1B9KA 1N3AA 1YQRA 1PCJX 3HS8A 2Y8LA 1VTOA 1NVPA 2PWWA 4TPSA 2D0CA 1PCMX 1TBPA 1CDWA 1QN3A 1LWWA 2V8QA 2NWVA 3ENCA 2NOFA 3DPTA 1XSZA 3OSEA 4Q11A 1JFIC 1WQAA 1YQLA 4I8OA 1P5DX 1QTSA 3D7QA 3CWUA 2NOLA 1KY7A 2HZSA 4EJYA 3T4NA 4EAGA 1KFQA 3CVTA 4EJZA 2H4LX 1NH2A 3CWAA 4IL8A 2MZ8A 2NVMA 3CWSA 1MP9A 2QR1A 1VKLA 3OCIA 1M5Q1 1LXTA 2JOIA 3TDHA 1QN5A 1QN8A 3PMGA 1Q9UA 1YQKA 2XHIA 1KYUA 2HZMA 5JMVD 3I0XA 1VTLE 1M3HA 2Y8QA 3OLPA 1KYDA 1C4GA 4CFFA 1N39A 3CW7A 2NOZA 2DKDA 1UT4A 1FN7A 1NGMA 1W80A 2NOHA 2NOIA 5AN4A 1DIZA 4EAKA 2NOBA 3VN5A 1C9BB 1PVSA 2EHBD 4WXAA 1VOLB 1QN6A 5F9CA 1T6AA 1PCZA 1EUVA 2O3OA 1R4XA 1YQMA 3ASMA 2IV8A 3EIKA 4D7QA 3DPUA 1C47A 4QG5A 2DKAA 3PDKA 2FGTA 1K2YX 3ENOC 4MRQA 2OOYA 5IYBP 4EAIA 2FKFA 3OC3C 3F10A 2JHNA 2JPIA 3TE5A 1JDYA 1LWVA 2NOEA 3CVSA 2ZFDB 2YH5A 5KL0A 1QNBA 2JHJA 2LAEA 2NLVA 4EALA 1RM1A 1QNEA 1YTFA 1UT7A 2H5AX 3F0ZA 3OH9A 1MPGA 4HJHA 4ROEB 4RODB 4EAJA 5BMNA 1N3CA 1WJWA 2HKPA 2MJ7A 1QNAA 2Z8UA 1TGHA 1J3MA 3IH7A 2FUVA
chains in the Genus database with same CATH topology
1KYFA 3OSMA 3ULXA 3H1ZA 4WZSD 1QNCA 1D3UA 1PZDA 1KY6A 3KRMA 1EBMA 4B0AA 1QN9A 2I5WA 2G30A 1KO9A 5IYDP 3SNSA 1E42A 2D0BA 1M3QA 4DULA 2IV9A 1QN4A 1QN7A 1LWYA 3HS9A 1VOKA 3OSTA 2D0AA 3I0WA 1AISA 4PY5A 2VJ0A 1TBAB 3KTUA 5IYCP 4ROCB 3N89A 3RPJA 1YTBA 1HU0A 1B9KA 1N3AA 1YQRA 3HS8A 1VTOA 1NVPA 4TPSA 2D0CA 1TBPA 1CDWA 1QN3A 1LWWA 2NOFA 3DPTA 4Q11A 1JFIC 1YQLA 4I8OA 1QTSA 2NOLA 1KY7A 2HZSA 4EJYA 4EJZA 1NH2A 2MZ8A 1MP9A 3OCIA 1QN5A 2JOIA 1QN8A 1YQKA 2XHIA 1KYUA 2HZMA 3I0XA 1VTLE 1M3HA 1KYDA 1N39A 2NOZA 1UT4A 1FN7A 1NGMA 1W80A 2NOHA 2NOIA 5AN4A 2NOBA 3VN5A 1C9BB 1VOLB 1QN6A 1PCZA 2O3OA 1R4XA 1YQMA 3ASMA 2IV8A 3EIKA 3DPUA 2FGTA 5IYBP 3OC3C 3F10A 1LWVA 2NOEA 2YH5A 1QNBA 2LAEA 1RM1A 1QNEA 1YTFA 1UT7A 3F0ZA 4ROEB 4RODB 1N3CA 2MJ7A 1QNAA 1TGHA 2Z8UA 3IH7A 1QTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QN6 A;  1AIS A;  1KYF A;  1PCZ A;  1QTS A;  3H1Z A;  4WZS D;  1KY7 A;  1QNC A;  1R4X A;  4PY5 A;  3ASM A;  2IV8 A;  2VJ0 A;  1D3U A;  3EIK A;  1PZD A;  1TBA B;  1KY6 A;  4B0A A;  1NH2 A;  5IYB P;  1QN9 A;  2G30 A;  5IYC P;  3OC3 C;  5IYD P;  4ROC B;  1E42 A;  1MP9 A;  2D0B A;  3OCI A;  1YTB A;  1QN5 A;  1QN8 A;  1B9K A;  1QNB A;  1C9B B;  3HS8 A;  1KYU A;  2IV9 A;  1VTO A;  1NVP A;  1VTL E;  1RM1 A;  1QNE A;  2D0C A;  1KYD A;  1QN4 A;  1YTF A;  1TBP A;  1CDW A;  1QN7 A;  1QN3 A;  4ROE B;  1NGM A;  4ROD B;  1W80 A;  3HS9 A;  2MJ7 A;  1VOK A;  1QNA A;  2Z8U A;  3VN5 A;  1JFI C;  1TGH A;  2D0A A;  1VOL B;  1QTP A; 
#chains in the Genus database with same CATH topology
 2Z0F A;  2DKC A;  1KYF A;  3NA5 A;  3OSM A;  3H1Z A;  3ULX A;  4WZS D;  2FKM X;  1QNC A;  1D3U A;  1KY6 A;  1PZD A;  2OOX A;  3KRM A;  1EBM A;  2R5X A;  4B0A A;  1QN9 A;  2I5W A;  4C7P A;  2G30 A;  2QLV A;  1KO9 A;  3CWT A;  5IYD P;  2QRE A;  3SNS A;  1UL7 A;  1E42 A;  2D0B A;  3D4V A;  1M3Q A;  4DUL A;  2F7L A;  2IV9 A;  5HSH A;  4D7R A;  1QTP A;  1QN4 A;  1QN7 A;  1LWY A;  1P5G X;  2QRC A;  3BKQ X;  1TUO A;  3HS9 A;  3OH6 A;  1VOK A;  2YA3 A;  3C04 A;  3OST A;  2D0A A;  1K35 A;  3I0W A;  2V9J A;  5BMP A;  1AIS A;  2V92 A;  3EAY A;  4PY5 A;  5JN5 A;  4BJU A;  2VJ0 A;  4WX8 A;  1KFI A;  1TBA B;  3I3W A;  3KTU A;  1V5S A;  3RSM A;  2HL8 A;  2HL9 A;  3UW2 A;  5IYC P;  3OGD A;  4ROC B;  3N89 A;  2QRD A;  3RPJ A;  1YTB A;  5EPC A;  1HU0 A;  1B9K A;  1N3A A;  1YQR A;  1PCJ X;  3HS8 A;  2Y8L A;  1VTO A;  1NVP A;  2PWW A;  4TPS A;  2D0C A;  1PCM X;  1TBP A;  1CDW A;  1QN3 A;  1LWW A;  2V8Q A;  2NWV A;  3ENC A;  2NOF A;  3DPT A;  1XSZ A;  3OSE A;  4Q11 A;  1JFI C;  1WQA A;  1YQL A;  4I8O A;  1P5D X;  1QTS A;  3D7Q A;  3CWU A;  2NOL A;  1KY7 A;  2HZS A;  4EJY A;  3T4N A;  4EAG A;  1KFQ A;  3CVT A;  4EJZ A;  2H4L X;  1NH2 A;  3CWA A;  4IL8 A;  2MZ8 A;  2NVM A;  3CWS A;  1MP9 A;  2QR1 A;  1VKL A;  3OCI A;  1M5Q 1;  1LXT A;  2JOI A;  3TDH A;  1QN5 A;  1QN8 A;  3PMG A;  1Q9U A;  1YQK A;  2XHI A;  1KYU A;  2HZM A;  5JMV D;  3I0X A;  1VTL E;  1M3H A;  2Y8Q A;  3OLP A;  1KYD A;  1C4G A;  4CFF A;  1N39 A;  3CW7 A;  2NOZ A;  2DKD A;  1UT4 A;  1FN7 A;  1NGM A;  1W80 A;  2NOH A;  2NOI A;  5AN4 A;  1DIZ A;  4EAK A;  2NOB A;  3VN5 A;  1C9B B;  1PVS A;  2EHB D;  4WXA A;  1VOL B;  1QN6 A;  5F9C A;  1T6A A;  1PCZ A;  1EUV A;  2O3O A;  1R4X A;  1YQM A;  3ASM A;  2IV8 A;  3EIK A;  4D7Q A;  3DPU A;  1C47 A;  4QG5 A;  2DKA A;  3PDK A;  2FGT A;  1K2Y X;  3ENO C;  4MRQ A;  2OOY A;  5IYB P;  4EAI A;  2FKF A;  3OC3 C;  3F10 A;  2JHN A;  2JPI A;  3TE5 A;  1JDY A;  1LWV A;  2NOE A;  3CVS A;  2ZFD B;  2YH5 A;  5KL0 A;  1QNB A;  2JHJ A;  2LAE A;  2NLV A;  4EAL A;  1RM1 A;  1QNE A;  1YTF A;  1UT7 A;  2H5A X;  3F0Z A;  3OH9 A;  1MPG A;  4HJH A;  4ROE B;  4ROD B;  4EAJ A;  5BMN A;  1N3C A;  1WJW A;  2HKP A;  2MJ7 A;  1QNA A;  2Z8U A;  1TGH A;  1J3M A;  3IH7 A;  2FUV A; 
#chains in the Genus database with same CATH homology
 1KYF A;  3OSM A;  3ULX A;  3H1Z A;  4WZS D;  1QNC A;  1D3U A;  1PZD A;  1KY6 A;  3KRM A;  1EBM A;  4B0A A;  1QN9 A;  2I5W A;  2G30 A;  1KO9 A;  5IYD P;  3SNS A;  1E42 A;  2D0B A;  1M3Q A;  4DUL A;  2IV9 A;  1QN4 A;  1QN7 A;  1LWY A;  3HS9 A;  1VOK A;  3OST A;  2D0A A;  3I0W A;  1AIS A;  4PY5 A;  2VJ0 A;  1TBA B;  3KTU A;  5IYC P;  4ROC B;  3N89 A;  3RPJ A;  1YTB A;  1HU0 A;  1B9K A;  1N3A A;  1YQR A;  3HS8 A;  1VTO A;  1NVP A;  4TPS A;  2D0C A;  1TBP A;  1CDW A;  1QN3 A;  1LWW A;  2NOF A;  3DPT A;  4Q11 A;  1JFI C;  1YQL A;  4I8O A;  1QTS A;  2NOL A;  1KY7 A;  2HZS A;  4EJY A;  4EJZ A;  1NH2 A;  2MZ8 A;  1MP9 A;  3OCI A;  1QN5 A;  2JOI A;  1QN8 A;  1YQK A;  2XHI A;  1KYU A;  2HZM A;  3I0X A;  1VTL E;  1M3H A;  1KYD A;  1N39 A;  2NOZ A;  1UT4 A;  1FN7 A;  1NGM A;  1W80 A;  2NOH A;  2NOI A;  5AN4 A;  2NOB A;  3VN5 A;  1C9B B;  1VOL B;  1QN6 A;  1PCZ A;  2O3O A;  1R4X A;  1YQM A;  3ASM A;  2IV8 A;  3EIK A;  3DPU A;  2FGT A;  5IYB P;  3OC3 C;  3F10 A;  1LWV A;  2NOE A;  2YH5 A;  1QNB A;  2LAE A;  1RM1 A;  1QNE A;  1YTF A;  1UT7 A;  3F0Z A;  4ROE B;  4ROD B;  1N3C A;  2MJ7 A;  1QNA A;  1TGH A;  2Z8U A;  3IH7 A;  1QTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...