1QN8A

Crystal structure of the t(-28) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Tata box-binding protein (tbp)
total genus 49
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn8A01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qn8A02
1KYDA 1QNBA 3HS9A 1W80A 1D3UA 3ASMA 3HS8A 3OC3C 1KY6A 3H1ZA 4ROCB 4RODB 1QN8A 1PCZA 1VTOA 3VN5A 4B0AA 4WZSD 1R4XA 5IYCP 2D0AA 2Z8UA 4ROEB 1VOKA 3OCIA 1QN6A 2D0BA 1TBPA 1QTSA 1YTFA 1CDWA 1RM1A 1NH2A 1KYUA 1MP9A 2G30A 2D0CA 5IYBP 1QNCA 1JFIC 2IV8A 2IV9A 1QTPA 1TBAB 3EIKA 1AISA 1QNAA 1NVPA 1YTBA 2VJ0A 1TGHA 1QNEA 1QN4A 1QN9A 1KY7A 1QN3A 5IYDP 2MJ7A 4PY5A 1KYFA 1QN7A 1VOLB 1QN5A 1PZDA 1B9KA 1NGMA 1C9BB 1VTLE 1E42A
chains in the Genus database with same CATH superfamily
1MPGA 3EAYA 3HS9A 1W80A 1LWWA 3OSEA 3ASMA 2DKDA 2HKPA 5KL0A 2QLVA 3I0WA 4EAGA 3VN5A 4B0AA 1WQAA 2QREA 3KRMA 4WZSD 4EJZA 4WXAA 2XHIA 2FKMX 3OCIA 3CWUA 4D7QA 2Z0FA 1TBPA 2V92A 1YTFA 1LWVA 5F9CA 1K35A 1MP9A 2G30A 2H5AX 4EALA 1KO9A 2IV8A 2QR1A 1JFIC 1UT7A 4QG5A 2OOYA 4EAKA 3EIKA 2NOEA 1AISA 1NVPA 4C7PA 1Q9UA 1QNEA 1M3HA 1QN4A 3CWTA 1WJWA 3OLPA 2NOHA 1C47A 1KFIA 2V9JA 1PZDA 1JDYA 3IH7A 1QNAA 3OSTA 3C04A 3OH6A 5BMPA 1C4GA 3OC3C 1QN8A 2EHBD 1M5Q1 4BJUA 2R5XA 3UW2A 2FKFA 3SNSA 1R4XA 2D0AA 2QRDA 2Z8UA 1PCJX 1XSZA 5BMNA 1QN6A 2NOLA 1T6AA 4WX8A 1YQRA 1FN7A 1P5GX 1CDWA 1KYUA 4D7RA 1HU0A 1UL7A 2D0CA 4Q11A 3CWSA 3ENCA 3T4NA 1P5DX 5JMVD 1N3AA 2IV9A 1EUVA 2FUVA 3OGDA 1TGHA 2HZMA 1KY7A 3DPTA 2PWWA 1PCMX 4PY5A 3I3WA 3ENOC 1QN5A 1VOLB 2HL8A 1B9KA 2ZFDB 1NGMA 1VTLE 1C9BB 2NOIA 2JOIA 2V8QA 2NLVA 4CFFA 5AN4A 1YQKA 2DKCA 1D3UA 2YA3A 1K2YX 4RODB 3F10A 3PMGA 3CW7A 4EAJA 1LWYA 1EBMA 5IYCP 3D4VA 3CVTA 3BKQX 4I8OA 1VOKA 1KFQA 2HL9A 2Y8LA 3CWAA 2OOXA 5EPCA 3F0ZA 1RM1A 1NH2A 3OSMA 4HJHA 4IL8A 1V5SA 1LXTA 3DPUA 5IYBP 2QRCA 1QNCA 3D7QA 3OH9A 3N89A 3ULXA 2HZSA 1YQLA 1YTBA 1YQMA 2FGTA 4DULA 1KYFA 1QN7A 1N3CA 4TPSA 3TE5A 1QNBA 4EJYA 1KY6A 2NOFA 1KYDA 2H4LX 4MRQA 3RSMA 1M3QA 3HS8A 4ROCB 2YH5A 3H1ZA 2NOZA 2NVMA 1PCZA 1VTOA 1DIZA 1UT4A 1PVSA 5HSHA 5JN5A 3CVSA 2I5WA 3NA5A 4ROEB 2JPIA 1VKLA 2Y8QA 2NOBA 2D0BA 2MZ8A 1QTSA 3PDKA 2JHJA 2DKAA 1N39A 1QTPA 1TBAB 2LAEA 2NWVA 2F7LA 3KTUA 1J3MA 2VJ0A 3RPJA 3TDHA 4EAIA 3I0XA 1QN9A 1QN3A 1TUOA 5IYDP 2MJ7A 2JHNA 2O3OA 1E42A
chains in the Genus database with same CATH topology
3HS9A 1W80A 1LWWA 3ASMA 3I0WA 3VN5A 4B0AA 3KRMA 4WZSD 4EJZA 2XHIA 3OCIA 1TBPA 1YTFA 1LWVA 1MP9A 2G30A 1KO9A 2IV8A 1JFIC 1UT7A 2NOEA 3EIKA 1AISA 1NVPA 1QNEA 1M3HA 1QN4A 2NOHA 1PZDA 3IH7A 1QNAA 3OSTA 3OC3C 1QN8A 3SNSA 1R4XA 2D0AA 2Z8UA 1QN6A 2NOLA 1YQRA 1FN7A 1CDWA 1KYUA 1HU0A 2D0CA 4Q11A 1N3AA 2IV9A 1TGHA 2HZMA 1KY7A 3DPTA 4PY5A 1VOLB 1QN5A 2NOIA 1B9KA 1NGMA 1C9BB 1VTLE 2JOIA 5AN4A 1YQKA 1D3UA 4RODB 3F10A 1LWYA 1EBMA 5IYCP 4I8OA 1VOKA 3F0ZA 1RM1A 1NH2A 3OSMA 3DPUA 5IYBP 1QNCA 3N89A 3ULXA 2HZSA 1YQLA 1YTBA 1YQMA 2FGTA 4DULA 1KYFA 1QN7A 1N3CA 4TPSA 1QNBA 4EJYA 1KY6A 2NOFA 1KYDA 1M3QA 3HS8A 4ROCB 2YH5A 3H1ZA 2NOZA 1PCZA 1VTOA 1UT4A 2I5WA 4ROEB 2NOBA 2D0BA 2MZ8A 1QTSA 1N39A 1QTPA 1TBAB 2LAEA 3KTUA 2VJ0A 3RPJA 3I0XA 1QN9A 1QN3A 5IYDP 2MJ7A 2O3OA 1E42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYD A;  1QNB A;  3HS9 A;  1W80 A;  1D3U A;  3ASM A;  3HS8 A;  3OC3 C;  1KY6 A;  3H1Z A;  4ROC B;  4ROD B;  1QN8 A;  1PCZ A;  1VTO A;  3VN5 A;  4B0A A;  4WZS D;  1R4X A;  5IYC P;  2D0A A;  2Z8U A;  4ROE B;  1VOK A;  3OCI A;  1QN6 A;  2D0B A;  1TBP A;  1QTS A;  1YTF A;  1CDW A;  1RM1 A;  1NH2 A;  1KYU A;  1MP9 A;  2G30 A;  2D0C A;  5IYB P;  1QNC A;  1JFI C;  2IV8 A;  2IV9 A;  1QTP A;  1TBA B;  3EIK A;  1AIS A;  1QNA A;  1NVP A;  1YTB A;  2VJ0 A;  1TGH A;  1QNE A;  1QN4 A;  1QN9 A;  1KY7 A;  1QN3 A;  5IYD P;  2MJ7 A;  4PY5 A;  1KYF A;  1QN7 A;  1VOL B;  1QN5 A;  1PZD A;  1B9K A;  1NGM A;  1C9B B;  1VTL E;  1E42 A; 
#chains in the Genus database with same CATH topology
 1MPG A;  3EAY A;  3HS9 A;  1W80 A;  1LWW A;  3OSE A;  3ASM A;  2DKD A;  2HKP A;  5KL0 A;  2QLV A;  3I0W A;  4EAG A;  3VN5 A;  4B0A A;  1WQA A;  2QRE A;  3KRM A;  4WZS D;  4EJZ A;  4WXA A;  2XHI A;  2FKM X;  3OCI A;  3CWU A;  4D7Q A;  2Z0F A;  1TBP A;  2V92 A;  1YTF A;  1LWV A;  5F9C A;  1K35 A;  1MP9 A;  2G30 A;  2H5A X;  4EAL A;  1KO9 A;  2IV8 A;  2QR1 A;  1JFI C;  1UT7 A;  4QG5 A;  2OOY A;  4EAK A;  3EIK A;  2NOE A;  1AIS A;  1NVP A;  4C7P A;  1Q9U A;  1QNE A;  1M3H A;  1QN4 A;  3CWT A;  1WJW A;  3OLP A;  2NOH A;  1C47 A;  1KFI A;  2V9J A;  1PZD A;  1JDY A;  3IH7 A;  1QNA A;  3OST A;  3C04 A;  3OH6 A;  5BMP A;  1C4G A;  3OC3 C;  1QN8 A;  2EHB D;  1M5Q 1;  4BJU A;  2R5X A;  3UW2 A;  2FKF A;  3SNS A;  1R4X A;  2D0A A;  2QRD A;  2Z8U A;  1PCJ X;  1XSZ A;  5BMN A;  1QN6 A;  2NOL A;  1T6A A;  4WX8 A;  1YQR A;  1FN7 A;  1P5G X;  1CDW A;  1KYU A;  4D7R A;  1HU0 A;  1UL7 A;  2D0C A;  4Q11 A;  3CWS A;  3ENC A;  3T4N A;  1P5D X;  5JMV D;  1N3A A;  2IV9 A;  1EUV A;  2FUV A;  3OGD A;  1TGH A;  2HZM A;  1KY7 A;  3DPT A;  2PWW A;  1PCM X;  4PY5 A;  3I3W A;  3ENO C;  1QN5 A;  1VOL B;  2HL8 A;  1B9K A;  2ZFD B;  1NGM A;  1VTL E;  1C9B B;  2NOI A;  2JOI A;  2V8Q A;  2NLV A;  4CFF A;  5AN4 A;  1YQK A;  2DKC A;  1D3U A;  2YA3 A;  1K2Y X;  4ROD B;  3F10 A;  3PMG A;  3CW7 A;  4EAJ A;  1LWY A;  1EBM A;  5IYC P;  3D4V A;  3CVT A;  3BKQ X;  4I8O A;  1VOK A;  1KFQ A;  2HL9 A;  2Y8L A;  3CWA A;  2OOX A;  5EPC A;  3F0Z A;  1RM1 A;  1NH2 A;  3OSM A;  4HJH A;  4IL8 A;  1V5S A;  1LXT A;  3DPU A;  5IYB P;  2QRC A;  1QNC A;  3D7Q A;  3OH9 A;  3N89 A;  3ULX A;  2HZS A;  1YQL A;  1YTB A;  1YQM A;  2FGT A;  4DUL A;  1KYF A;  1QN7 A;  1N3C A;  4TPS A;  3TE5 A;  1QNB A;  4EJY A;  1KY6 A;  2NOF A;  1KYD A;  2H4L X;  4MRQ A;  3RSM A;  1M3Q A;  3HS8 A;  4ROC B;  2YH5 A;  3H1Z A;  2NOZ A;  2NVM A;  1PCZ A;  1VTO A;  1DIZ A;  1UT4 A;  1PVS A;  5HSH A;  5JN5 A;  3CVS A;  2I5W A;  3NA5 A;  4ROE B;  2JPI A;  1VKL A;  2Y8Q A;  2NOB A;  2D0B A;  2MZ8 A;  1QTS A;  3PDK A;  2JHJ A;  2DKA A;  1N39 A;  1QTP A;  1TBA B;  2LAE A;  2NWV A;  2F7L A;  3KTU A;  1J3M A;  2VJ0 A;  3RPJ A;  3TDH A;  4EAI A;  3I0X A;  1QN9 A;  1QN3 A;  1TUO A;  5IYD P;  2MJ7 A;  2JHN A;  2O3O A;  1E42 A; 
#chains in the Genus database with same CATH homology
 3HS9 A;  1W80 A;  1LWW A;  3ASM A;  3I0W A;  3VN5 A;  4B0A A;  3KRM A;  4WZS D;  4EJZ A;  2XHI A;  3OCI A;  1TBP A;  1YTF A;  1LWV A;  1MP9 A;  2G30 A;  1KO9 A;  2IV8 A;  1JFI C;  1UT7 A;  2NOE A;  3EIK A;  1AIS A;  1NVP A;  1QNE A;  1M3H A;  1QN4 A;  2NOH A;  1PZD A;  3IH7 A;  1QNA A;  3OST A;  3OC3 C;  1QN8 A;  3SNS A;  1R4X A;  2D0A A;  2Z8U A;  1QN6 A;  2NOL A;  1YQR A;  1FN7 A;  1CDW A;  1KYU A;  1HU0 A;  2D0C A;  4Q11 A;  1N3A A;  2IV9 A;  1TGH A;  2HZM A;  1KY7 A;  3DPT A;  4PY5 A;  1VOL B;  1QN5 A;  2NOI A;  1B9K A;  1NGM A;  1C9B B;  1VTL E;  2JOI A;  5AN4 A;  1YQK A;  1D3U A;  4ROD B;  3F10 A;  1LWY A;  1EBM A;  5IYC P;  4I8O A;  1VOK A;  3F0Z A;  1RM1 A;  1NH2 A;  3OSM A;  3DPU A;  5IYB P;  1QNC A;  3N89 A;  3ULX A;  2HZS A;  1YQL A;  1YTB A;  1YQM A;  2FGT A;  4DUL A;  1KYF A;  1QN7 A;  1N3C A;  4TPS A;  1QNB A;  4EJY A;  1KY6 A;  2NOF A;  1KYD A;  1M3Q A;  3HS8 A;  4ROC B;  2YH5 A;  3H1Z A;  2NOZ A;  1PCZ A;  1VTO A;  1UT4 A;  2I5W A;  4ROE B;  2NOB A;  2D0B A;  2MZ8 A;  1QTS A;  1N39 A;  1QTP A;  1TBA B;  2LAE A;  3KTU A;  2VJ0 A;  3RPJ A;  3I0X A;  1QN9 A;  1QN3 A;  5IYD P;  2MJ7 A;  2O3O A;  1E42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...