1QNAA

Crystal structure of the t(-30) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
182
Chain Sequence
HPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Tata box-binding protein (tbp)
total genus 47
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qnaA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qnaA02
5IYDP 4PY5A 1QNEA 1W80A 5IYCP 4RODB 2VJ0A 4B0AA 1QN8A 1TBPA 1QN9A 3OCIA 1D3UA 3H1ZA 2G30A 3HS8A 1QN3A 1PCZA 1CDWA 3ASMA 1VTOA 2IV9A 1VOKA 4ROEB 3HS9A 1RM1A 1NH2A 1JFIC 1VOLB 1QN6A 1R4XA 1B9KA 5IYBP 2IV8A 2Z8UA 1KY6A 3VN5A 1VTLE 1QNAA 1QNCA 4ROCB 1QN5A 2MJ7A 2D0CA 1YTFA 1PZDA 1KYDA 3EIKA 1QN4A 1MP9A 1KYFA 1QNBA 1E42A 1QTSA 1NVPA 1QN7A 1KYUA 1QTPA 4WZSD 2D0AA 3OC3C 1C9BB 1KY7A 1NGMA 1TGHA 1TBAB 1YTBA 2D0BA 1AISA
chains in the Genus database with same CATH superfamily
1W80A 3OLPA 5HSHA 2V8QA 3CWSA 4B0AA 1QN9A 3N89A 5BMNA 2NOBA 3C04A 1M3QA 3RSMA 2JOIA 4EALA 1RM1A 1NH2A 2QRCA 4Q11A 5IYBP 5EPCA 1N3AA 2IV8A 1KFQA 2Z8UA 2NOZA 1VTLE 3F0ZA 3T4NA 1QNCA 2DKCA 4ROCB 3CWTA 2MJ7A 2V92A 2DKAA 2QRDA 1KYFA 1E42A 3DPTA 4TPSA 2HZMA 5BMPA 3TE5A 2I5WA 1KY7A 1NGMA 4EJYA 3PMGA 2H5AX 5F9CA 2O3OA 2YA3A 5AN4A 2FKFA 5IYCP 2QLVA 2VJ0A 3I0WA 1QN8A 1JDYA 2HKPA 4I8OA 1D3UA 3CW7A 2JPIA 2Y8LA 3H1ZA 2F7LA 4DULA 1PCZA 1VTOA 3ENOC 2IV9A 3RPJA 1JFIC 1QN6A 1R4XA 2ZFDB 4C7PA 1VKLA 1KY6A 1P5GX 3UW2A 3ENCA 3CWAA 2V9JA 2H4LX 1PZDA 1QN4A 2NOEA 1TUOA 4HJHA 2HL8A 1KFIA 1NVPA 1T6AA 2D0AA 3OC3C 3CWUA 5IYDP 1QNEA 2NLVA 2NOLA 1YQRA 4BJUA 5JN5A 1WQAA 2MZ8A 4QG5A 1TBPA 1LXTA 2NOHA 3F10A 3OCIA 1UT7A 1N39A 2G30A 3DPUA 3HS8A 4EAKA 5JMVD 4EAJA 3BKQX 3ASMA 1K2YX 4WXAA 3SNSA 3OSEA 3PDKA 1LWYA 1DIZA 2PWWA 2JHNA 3HS9A 3CVSA 1VOLB 2R5XA 1PVSA 2NOFA 2FKMX 3TDHA 3NA5A 3D4VA 3OSTA 3KRMA 1P5DX 1QNAA 1C47A 2QR1A 2Y8QA 1LWWA 1QN5A 1HU0A 2D0CA 2QREA 4D7QA 2XHIA 1KYDA 1Q9UA 3EIKA 3ULXA 1QNBA 4MRQA 2OOYA 1QTSA 4CFFA 1KYUA 1QTPA 4D7RA 3OH6A 4EAIA 1C9BB 1TGHA 1KO9A 1TBAB 2YH5A 1YTBA 3CVTA 2D0BA 4WX8A 4PY5A 2NOIA 3OH9A 3EAYA 4RODB 1UT4A 1FN7A 2Z0FA 1YQMA 1QN3A 1CDWA 1K35A 1PCMX 3D7QA 4IL8A 4EAGA 1EBMA 1VOKA 4ROEB 3IH7A 2JHJA 3OSMA 1UL7A 1WJWA 2NVMA 1XSZA 1B9KA 1EUVA 2DKDA 2HZSA 1V5SA 3KTUA 3OGDA 3I3WA 2HL9A 3VN5A 1M5Q1 2LAEA 3I0XA 4EJZA 1LWVA 1AISA 1YTFA 2NWVA 1MP9A 2OOXA 1YQLA 1PCJX 2EHBD 1N3CA 1QN7A 2FGTA 1YQKA 4WZSD 1C4GA 1MPGA 2FUVA 1J3MA 1M3HA 5KL0A
chains in the Genus database with same CATH topology
1W80A 4B0AA 1QN9A 3N89A 2NOBA 1M3QA 2JOIA 1RM1A 1NH2A 4Q11A 5IYBP 1N3AA 2IV8A 2Z8UA 2NOZA 1VTLE 3F0ZA 1QNCA 4ROCB 2MJ7A 1KYFA 1E42A 3DPTA 4TPSA 2HZMA 2I5WA 1KY7A 1NGMA 4EJYA 2O3OA 5AN4A 5IYCP 3I0WA 2VJ0A 1QN8A 4I8OA 1D3UA 3H1ZA 4DULA 1PCZA 1VTOA 2IV9A 3RPJA 1JFIC 1QN6A 1R4XA 1KY6A 1PZDA 1QN4A 2NOEA 1NVPA 2D0AA 3OC3C 5IYDP 1QNEA 2NOLA 1YQRA 2MZ8A 2NOHA 1TBPA 3F10A 3OCIA 1UT7A 1N39A 2G30A 3DPUA 3HS8A 3ASMA 3SNSA 1LWYA 3HS9A 1VOLB 2NOFA 3OSTA 3KRMA 1QNAA 1LWWA 1QN5A 1HU0A 2D0CA 2XHIA 1KYDA 3EIKA 3ULXA 1QNBA 1QTSA 1KYUA 1QTPA 1C9BB 1TGHA 1YTBA 2YH5A 1KO9A 1TBAB 2D0BA 4PY5A 2NOIA 4RODB 1UT4A 1FN7A 1YQMA 1QN3A 1CDWA 1EBMA 1VOKA 4ROEB 3IH7A 3OSMA 1B9KA 2HZSA 3KTUA 3VN5A 2LAEA 3I0XA 4EJZA 1LWVA 1YTFA 1MP9A 1YQLA 1N3CA 1QN7A 2FGTA 1YQKA 4WZSD 1M3HA 1AISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYD P;  4PY5 A;  1QNE A;  1W80 A;  5IYC P;  4ROD B;  2VJ0 A;  4B0A A;  1QN8 A;  1TBP A;  1QN9 A;  3OCI A;  1D3U A;  3H1Z A;  2G30 A;  3HS8 A;  1QN3 A;  1PCZ A;  1CDW A;  3ASM A;  1VTO A;  2IV9 A;  1VOK A;  4ROE B;  3HS9 A;  1RM1 A;  1NH2 A;  1JFI C;  1VOL B;  1QN6 A;  1R4X A;  1B9K A;  5IYB P;  2IV8 A;  2Z8U A;  1KY6 A;  3VN5 A;  1VTL E;  1QNA A;  1QNC A;  4ROC B;  1QN5 A;  2MJ7 A;  2D0C A;  1YTF A;  1PZD A;  1KYD A;  3EIK A;  1QN4 A;  1MP9 A;  1KYF A;  1QNB A;  1E42 A;  1QTS A;  1NVP A;  1QN7 A;  1KYU A;  1QTP A;  4WZS D;  2D0A A;  3OC3 C;  1C9B B;  1KY7 A;  1NGM A;  1TGH A;  1TBA B;  1YTB A;  2D0B A;  1AIS A; 
#chains in the Genus database with same CATH topology
 1W80 A;  3OLP A;  5HSH A;  2V8Q A;  3CWS A;  4B0A A;  1QN9 A;  3N89 A;  5BMN A;  2NOB A;  3C04 A;  1M3Q A;  3RSM A;  2JOI A;  4EAL A;  1RM1 A;  1NH2 A;  2QRC A;  4Q11 A;  5IYB P;  5EPC A;  1N3A A;  2IV8 A;  1KFQ A;  2Z8U A;  2NOZ A;  1VTL E;  3F0Z A;  3T4N A;  1QNC A;  2DKC A;  4ROC B;  3CWT A;  2MJ7 A;  2V92 A;  2DKA A;  2QRD A;  1KYF A;  1E42 A;  3DPT A;  4TPS A;  2HZM A;  5BMP A;  3TE5 A;  2I5W A;  1KY7 A;  1NGM A;  4EJY A;  3PMG A;  2H5A X;  5F9C A;  2O3O A;  2YA3 A;  5AN4 A;  2FKF A;  5IYC P;  2QLV A;  2VJ0 A;  3I0W A;  1QN8 A;  1JDY A;  2HKP A;  4I8O A;  1D3U A;  3CW7 A;  2JPI A;  2Y8L A;  3H1Z A;  2F7L A;  4DUL A;  1PCZ A;  1VTO A;  3ENO C;  2IV9 A;  3RPJ A;  1JFI C;  1QN6 A;  1R4X A;  2ZFD B;  4C7P A;  1VKL A;  1KY6 A;  1P5G X;  3UW2 A;  3ENC A;  3CWA A;  2V9J A;  2H4L X;  1PZD A;  1QN4 A;  2NOE A;  1TUO A;  4HJH A;  2HL8 A;  1KFI A;  1NVP A;  1T6A A;  2D0A A;  3OC3 C;  3CWU A;  5IYD P;  1QNE A;  2NLV A;  2NOL A;  1YQR A;  4BJU A;  5JN5 A;  1WQA A;  2MZ8 A;  4QG5 A;  1TBP A;  1LXT A;  2NOH A;  3F10 A;  3OCI A;  1UT7 A;  1N39 A;  2G30 A;  3DPU A;  3HS8 A;  4EAK A;  5JMV D;  4EAJ A;  3BKQ X;  3ASM A;  1K2Y X;  4WXA A;  3SNS A;  3OSE A;  3PDK A;  1LWY A;  1DIZ A;  2PWW A;  2JHN A;  3HS9 A;  3CVS A;  1VOL B;  2R5X A;  1PVS A;  2NOF A;  2FKM X;  3TDH A;  3NA5 A;  3D4V A;  3OST A;  3KRM A;  1P5D X;  1QNA A;  1C47 A;  2QR1 A;  2Y8Q A;  1LWW A;  1QN5 A;  1HU0 A;  2D0C A;  2QRE A;  4D7Q A;  2XHI A;  1KYD A;  1Q9U A;  3EIK A;  3ULX A;  1QNB A;  4MRQ A;  2OOY A;  1QTS A;  4CFF A;  1KYU A;  1QTP A;  4D7R A;  3OH6 A;  4EAI A;  1C9B B;  1TGH A;  1KO9 A;  1TBA B;  2YH5 A;  1YTB A;  3CVT A;  2D0B A;  4WX8 A;  4PY5 A;  2NOI A;  3OH9 A;  3EAY A;  4ROD B;  1UT4 A;  1FN7 A;  2Z0F A;  1YQM A;  1QN3 A;  1CDW A;  1K35 A;  1PCM X;  3D7Q A;  4IL8 A;  4EAG A;  1EBM A;  1VOK A;  4ROE B;  3IH7 A;  2JHJ A;  3OSM A;  1UL7 A;  1WJW A;  2NVM A;  1XSZ A;  1B9K A;  1EUV A;  2DKD A;  2HZS A;  1V5S A;  3KTU A;  3OGD A;  3I3W A;  2HL9 A;  3VN5 A;  1M5Q 1;  2LAE A;  3I0X A;  4EJZ A;  1LWV A;  1AIS A;  1YTF A;  2NWV A;  1MP9 A;  2OOX A;  1YQL A;  1PCJ X;  2EHB D;  1N3C A;  1QN7 A;  2FGT A;  1YQK A;  4WZS D;  1C4G A;  1MPG A;  2FUV A;  1J3M A;  1M3H A;  5KL0 A; 
#chains in the Genus database with same CATH homology
 1W80 A;  4B0A A;  1QN9 A;  3N89 A;  2NOB A;  1M3Q A;  2JOI A;  1RM1 A;  1NH2 A;  4Q11 A;  5IYB P;  1N3A A;  2IV8 A;  2Z8U A;  2NOZ A;  1VTL E;  3F0Z A;  1QNC A;  4ROC B;  2MJ7 A;  1KYF A;  1E42 A;  3DPT A;  4TPS A;  2HZM A;  2I5W A;  1KY7 A;  1NGM A;  4EJY A;  2O3O A;  5AN4 A;  5IYC P;  3I0W A;  2VJ0 A;  1QN8 A;  4I8O A;  1D3U A;  3H1Z A;  4DUL A;  1PCZ A;  1VTO A;  2IV9 A;  3RPJ A;  1JFI C;  1QN6 A;  1R4X A;  1KY6 A;  1PZD A;  1QN4 A;  2NOE A;  1NVP A;  2D0A A;  3OC3 C;  5IYD P;  1QNE A;  2NOL A;  1YQR A;  2MZ8 A;  2NOH A;  1TBP A;  3F10 A;  3OCI A;  1UT7 A;  1N39 A;  2G30 A;  3DPU A;  3HS8 A;  3ASM A;  3SNS A;  1LWY A;  3HS9 A;  1VOL B;  2NOF A;  3OST A;  3KRM A;  1QNA A;  1LWW A;  1QN5 A;  1HU0 A;  2D0C A;  2XHI A;  1KYD A;  3EIK A;  3ULX A;  1QNB A;  1QTS A;  1KYU A;  1QTP A;  1C9B B;  1TGH A;  1YTB A;  2YH5 A;  1KO9 A;  1TBA B;  2D0B A;  4PY5 A;  2NOI A;  4ROD B;  1UT4 A;  1FN7 A;  1YQM A;  1QN3 A;  1CDW A;  1EBM A;  1VOK A;  4ROE B;  3IH7 A;  3OSM A;  1B9K A;  2HZS A;  3KTU A;  3VN5 A;  2LAE A;  3I0X A;  4EJZ A;  1LWV A;  1YTF A;  1MP9 A;  1YQL A;  1N3C A;  1QN7 A;  2FGT A;  1YQK A;  4WZS D;  1M3H A;  1AIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...