1QNBA

Crystal structure of the t(-25) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Tata box-binding protein (tbp)
total genus 46
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qnbA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qnbA02
1VOLB 1D3UA 1R4XA 1KYUA 3VN5A 1NH2A 1NVPA 3ASMA 3HS8A 1QNBA 1YTFA 1QN7A 2D0CA 1YTBA 2IV9A 2IV8A 1VOKA 4ROCB 3HS9A 1QTSA 1RM1A 2Z8UA 1KYDA 5IYDP 3OCIA 5IYBP 1VTOA 1QNAA 1QN6A 1TGHA 1AISA 1W80A 1KYFA 2D0AA 1QN3A 1B9KA 1TBAB 4PY5A 1PZDA 1VTLE 1QN4A 1QN8A 2MJ7A 4ROEB 1QN9A 1NGMA 1C9BB 1JFIC 1CDWA 1QNCA 3OC3C 2G30A 1QN5A 1MP9A 3EIKA 3H1ZA 4RODB 1PCZA 2D0BA 1KY7A 2VJ0A 4B0AA 5IYCP 1QNEA 1KY6A 1E42A 4WZSD 1TBPA 1QTPA
chains in the Genus database with same CATH superfamily
4D7RA 3UW2A 2NOLA 1D3UA 2NOFA 1KYUA 1YTFA 2HZMA 3ASMA 3HS8A 3PDKA 3CWAA 2IV8A 1UL7A 4CFFA 1VOKA 4EJZA 1VKLA 2OOYA 1QTSA 3DPTA 1PCJX 1T6AA 1KYDA 2YA3A 3ENCA 1K2YX 2FKFA 3OCIA 5IYBP 1QNAA 2JHJA 2NLVA 5BMNA 2F7LA 4C7PA 1EUVA 1QN3A 4DULA 2H4LX 4PY5A 1PZDA 3RPJA 3OH6A 4ROEB 3OGDA 4BJUA 1C9BB 1JFIC 1N3AA 1KFIA 1YQMA 4QG5A 1M3HA 1MP9A 3EIKA 2LAEA 3D7QA 1YQRA 2EHBD 5BMPA 3TE5A 2D0BA 2VJ0A 4MRQA 2HL8A 4B0AA 1QNEA 2ZFDB 3EAYA 5JN5A 1E42A 2DKDA 3OH9A 3ENOC 1TBPA 4EAJA 1R4XA 1NH2A 3CWTA 3KTUA 2Y8LA 1YTBA 2IV9A 4WXAA 1EBMA 3PMGA 1MPGA 4ROCB 1HU0A 1RM1A 2Z8UA 2DKCA 4IL8A 3SNSA 3CW7A 5IYDP 2NVMA 1PVSA 4EAKA 2I5WA 1XSZA 2FKMX 3OSTA 5EPCA 5HSHA 1LWYA 1KYFA 4D7QA 1P5GX 1C47A 1B9KA 1TBAB 2DKAA 3C04A 3D4VA 1UT7A 2HKPA 4EAGA 1KO9A 1CDWA 1K35A 1QN5A 3CWUA 3H1ZA 2Y8QA 3OSEA 2V8QA 5IYCP 3CVTA 2NOEA 1PCMX 4WZSD 3BKQX 2OOXA 2MZ8A 3VN5A 2QRDA 1YQKA 1NVPA 1QNBA 1QN7A 1P5DX 2V92A 3CWSA 2JOIA 2R5XA 3F10A 1LWVA 1N3CA 4EALA 2HL9A 3DPUA 1WJWA 2JHNA 1QN6A 1J3MA 1TGHA 2D0AA 2HZSA 2H5AX 1LWWA 4EJYA 1VTLE 1QN4A 2FUVA 1KFQA 1QNCA 1FN7A 2FGTA 2G30A 1UT4A 3RSMA 1Q9UA 1YQLA 2PWWA 2NOBA 3I0XA 2QREA 1VTOA 1QN8A 1QTPA 1VOLB 2NOIA 3OSMA 5F9CA 1TUOA 2D0CA 3NA5A 3T4NA 2QRCA 2QR1A 3HS9A 3OLPA 4HJHA 5AN4A 4EAIA 1N39A 5JMVD 2V9JA 3CVSA 1M5Q1 1JDYA 3KRMA 4TPSA 2Z0FA 2JPIA 2YH5A 1AISA 3N89A 1M3QA 1WQAA 1W80A 3I0WA 1DIZA 1C4GA 3TDHA 1LXTA 2MJ7A 2NWVA 4WX8A 1QN9A 2O3OA 3ULXA 1NGMA 3OC3C 4I8OA 3IH7A 2NOZA 1V5SA 4RODB 2XHIA 1PCZA 1KY7A 2NOHA 3F0ZA 4Q11A 1KY6A 2QLVA 5KL0A 3I3WA
chains in the Genus database with same CATH topology
2NOLA 1D3UA 2NOFA 1KYUA 1YTFA 2HZMA 3ASMA 3HS8A 2IV8A 1VOKA 4EJZA 3DPTA 1QTSA 1KYDA 3OCIA 5IYBP 1QNAA 1QN3A 4DULA 4PY5A 1PZDA 3RPJA 4ROEB 1C9BB 1JFIC 1N3AA 1YQMA 1M3HA 1MP9A 3EIKA 2LAEA 1YQRA 1QNEA 2D0BA 2VJ0A 4B0AA 1E42A 1TBPA 1R4XA 1NH2A 3KTUA 1YTBA 2IV9A 1EBMA 4ROCB 1HU0A 1RM1A 2Z8UA 3SNSA 5IYDP 2I5WA 3OSTA 1LWYA 1KYFA 1B9KA 1TBAB 1UT7A 1CDWA 1KO9A 1QN5A 3H1ZA 5IYCP 2NOEA 4WZSD 2MZ8A 3VN5A 1YQKA 1NVPA 1QNBA 1QN7A 2JOIA 3F10A 1LWVA 1N3CA 3DPUA 1QN6A 1TGHA 2D0AA 2HZSA 4EJYA 1LWWA 1VTLE 1QN4A 1QNCA 1FN7A 2FGTA 2G30A 1UT4A 1YQLA 2NOBA 3I0XA 1VTOA 1QN8A 1QTPA 1VOLB 2NOIA 3OSMA 2D0CA 5AN4A 1N39A 3HS9A 3KRMA 4TPSA 2YH5A 1AISA 3N89A 1M3QA 1W80A 3I0WA 2MJ7A 1QN9A 2O3OA 3ULXA 1NGMA 3OC3C 4I8OA 3IH7A 2NOZA 4RODB 1PCZA 1KY7A 2NOHA 3F0ZA 4Q11A 1KY6A 2XHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VOL B;  1D3U A;  1R4X A;  1KYU A;  3VN5 A;  1NH2 A;  1NVP A;  3ASM A;  3HS8 A;  1QNB A;  1YTF A;  1QN7 A;  2D0C A;  1YTB A;  2IV9 A;  2IV8 A;  1VOK A;  4ROC B;  3HS9 A;  1QTS A;  1RM1 A;  2Z8U A;  1KYD A;  5IYD P;  3OCI A;  5IYB P;  1VTO A;  1QNA A;  1QN6 A;  1TGH A;  1AIS A;  1W80 A;  1KYF A;  2D0A A;  1QN3 A;  1B9K A;  1TBA B;  4PY5 A;  1PZD A;  1VTL E;  1QN4 A;  1QN8 A;  2MJ7 A;  4ROE B;  1QN9 A;  1NGM A;  1C9B B;  1JFI C;  1CDW A;  1QNC A;  3OC3 C;  2G30 A;  1QN5 A;  1MP9 A;  3EIK A;  3H1Z A;  4ROD B;  1PCZ A;  2D0B A;  1KY7 A;  2VJ0 A;  4B0A A;  5IYC P;  1QNE A;  1KY6 A;  1E42 A;  4WZS D;  1TBP A;  1QTP A; 
#chains in the Genus database with same CATH topology
 4D7R A;  3UW2 A;  2NOL A;  1D3U A;  2NOF A;  1KYU A;  1YTF A;  2HZM A;  3ASM A;  3HS8 A;  3PDK A;  3CWA A;  2IV8 A;  1UL7 A;  4CFF A;  1VOK A;  4EJZ A;  1VKL A;  2OOY A;  1QTS A;  3DPT A;  1PCJ X;  1T6A A;  1KYD A;  2YA3 A;  3ENC A;  1K2Y X;  2FKF A;  3OCI A;  5IYB P;  1QNA A;  2JHJ A;  2NLV A;  5BMN A;  2F7L A;  4C7P A;  1EUV A;  1QN3 A;  4DUL A;  2H4L X;  4PY5 A;  1PZD A;  3RPJ A;  3OH6 A;  4ROE B;  3OGD A;  4BJU A;  1C9B B;  1JFI C;  1N3A A;  1KFI A;  1YQM A;  4QG5 A;  1M3H A;  1MP9 A;  3EIK A;  2LAE A;  3D7Q A;  1YQR A;  2EHB D;  5BMP A;  3TE5 A;  2D0B A;  2VJ0 A;  4MRQ A;  2HL8 A;  4B0A A;  1QNE A;  2ZFD B;  3EAY A;  5JN5 A;  1E42 A;  2DKD A;  3OH9 A;  3ENO C;  1TBP A;  4EAJ A;  1R4X A;  1NH2 A;  3CWT A;  3KTU A;  2Y8L A;  1YTB A;  2IV9 A;  4WXA A;  1EBM A;  3PMG A;  1MPG A;  4ROC B;  1HU0 A;  1RM1 A;  2Z8U A;  2DKC A;  4IL8 A;  3SNS A;  3CW7 A;  5IYD P;  2NVM A;  1PVS A;  4EAK A;  2I5W A;  1XSZ A;  2FKM X;  3OST A;  5EPC A;  5HSH A;  1LWY A;  1KYF A;  4D7Q A;  1P5G X;  1C47 A;  1B9K A;  1TBA B;  2DKA A;  3C04 A;  3D4V A;  1UT7 A;  2HKP A;  4EAG A;  1KO9 A;  1CDW A;  1K35 A;  1QN5 A;  3CWU A;  3H1Z A;  2Y8Q A;  3OSE A;  2V8Q A;  5IYC P;  3CVT A;  2NOE A;  1PCM X;  4WZS D;  3BKQ X;  2OOX A;  2MZ8 A;  3VN5 A;  2QRD A;  1YQK A;  1NVP A;  1QNB A;  1QN7 A;  1P5D X;  2V92 A;  3CWS A;  2JOI A;  2R5X A;  3F10 A;  1LWV A;  1N3C A;  4EAL A;  2HL9 A;  3DPU A;  1WJW A;  2JHN A;  1QN6 A;  1J3M A;  1TGH A;  2D0A A;  2HZS A;  2H5A X;  1LWW A;  4EJY A;  1VTL E;  1QN4 A;  2FUV A;  1KFQ A;  1QNC A;  1FN7 A;  2FGT A;  2G30 A;  1UT4 A;  3RSM A;  1Q9U A;  1YQL A;  2PWW A;  2NOB A;  3I0X A;  2QRE A;  1VTO A;  1QN8 A;  1QTP A;  1VOL B;  2NOI A;  3OSM A;  5F9C A;  1TUO A;  2D0C A;  3NA5 A;  3T4N A;  2QRC A;  2QR1 A;  3HS9 A;  3OLP A;  4HJH A;  5AN4 A;  4EAI A;  1N39 A;  5JMV D;  2V9J A;  3CVS A;  1M5Q 1;  1JDY A;  3KRM A;  4TPS A;  2Z0F A;  2JPI A;  2YH5 A;  1AIS A;  3N89 A;  1M3Q A;  1WQA A;  1W80 A;  3I0W A;  1DIZ A;  1C4G A;  3TDH A;  1LXT A;  2MJ7 A;  2NWV A;  4WX8 A;  1QN9 A;  2O3O A;  3ULX A;  1NGM A;  3OC3 C;  4I8O A;  3IH7 A;  2NOZ A;  1V5S A;  4ROD B;  2XHI A;  1PCZ A;  1KY7 A;  2NOH A;  3F0Z A;  4Q11 A;  1KY6 A;  2QLV A;  5KL0 A;  3I3W A; 
#chains in the Genus database with same CATH homology
 2NOL A;  1D3U A;  2NOF A;  1KYU A;  1YTF A;  2HZM A;  3ASM A;  3HS8 A;  2IV8 A;  1VOK A;  4EJZ A;  3DPT A;  1QTS A;  1KYD A;  3OCI A;  5IYB P;  1QNA A;  1QN3 A;  4DUL A;  4PY5 A;  1PZD A;  3RPJ A;  4ROE B;  1C9B B;  1JFI C;  1N3A A;  1YQM A;  1M3H A;  1MP9 A;  3EIK A;  2LAE A;  1YQR A;  1QNE A;  2D0B A;  2VJ0 A;  4B0A A;  1E42 A;  1TBP A;  1R4X A;  1NH2 A;  3KTU A;  1YTB A;  2IV9 A;  1EBM A;  4ROC B;  1HU0 A;  1RM1 A;  2Z8U A;  3SNS A;  5IYD P;  2I5W A;  3OST A;  1LWY A;  1KYF A;  1B9K A;  1TBA B;  1UT7 A;  1CDW A;  1KO9 A;  1QN5 A;  3H1Z A;  5IYC P;  2NOE A;  4WZS D;  2MZ8 A;  3VN5 A;  1YQK A;  1NVP A;  1QNB A;  1QN7 A;  2JOI A;  3F10 A;  1LWV A;  1N3C A;  3DPU A;  1QN6 A;  1TGH A;  2D0A A;  2HZS A;  4EJY A;  1LWW A;  1VTL E;  1QN4 A;  1QNC A;  1FN7 A;  2FGT A;  2G30 A;  1UT4 A;  1YQL A;  2NOB A;  3I0X A;  1VTO A;  1QN8 A;  1QTP A;  1VOL B;  2NOI A;  3OSM A;  2D0C A;  5AN4 A;  1N39 A;  3HS9 A;  3KRM A;  4TPS A;  2YH5 A;  1AIS A;  3N89 A;  1M3Q A;  1W80 A;  3I0W A;  2MJ7 A;  1QN9 A;  2O3O A;  3ULX A;  1NGM A;  3OC3 C;  4I8O A;  3IH7 A;  2NOZ A;  4ROD B;  1PCZ A;  1KY7 A;  2NOH A;  3F0Z A;  4Q11 A;  1KY6 A;  2XHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...