1QNCA

Crystal structure of the a(-31) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
molecule tags Tata box-binding protein (tbp)
source organism Arabidopsis thaliana
total genus 47
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qncA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qncA02
1QN8A 1QNAA 1KYUA 1VOLB 1QN6A 1KY7A 1PZDA 1VOKA 3HS8A 1W80A 3VN5A 2D0CA 1VTOA 4RODB 2D0AA 4ROEB 3EIKA 1B9KA 1JFIC 1NH2A 1RM1A 1AISA 2IV8A 1MP9A 2MJ7A 2IV9A 3H1ZA 3OC3C 1QN9A 1YTFA 1NVPA 1QN4A 1QN5A 1TBAB 1KY6A 1PCZA 2Z8UA 2G30A 2VJ0A 1QTPA 1QNCA 5IYBP 1QNEA 3ASMA 1TGHA 1QN3A 1TBPA 1QTSA 3HS9A 4WZSD 1VTLE 1CDWA 1D3UA 1QNBA 1QN7A 5IYDP 1E42A 3OCIA 4B0AA 1KYFA 1KYDA 4ROCB 2D0BA 1NGMA 1R4XA 5IYCP 1YTBA 4PY5A 1C9BB
chains in the Genus database with same CATH superfamily
1QN8A 3RPJA 5JN5A 4Q11A 5EPCA 2H4LX 1VTOA 3F0ZA 2NOLA 1C4GA 1W80A 3C04A 3CVSA 3CWTA 4ROEB 2D0AA 4EJZA 3RSMA 1B9KA 1V5SA 3I0XA 1AISA 4EALA 2NOFA 2IV9A 3H1ZA 3OH9A 3EAYA 2QLVA 1LWVA 1PCZA 2VJ0A 2QR1A 1N3AA 1QNCA 2QREA 2Y8QA 5IYBP 5BMNA 2FKFA 3OSMA 1QNEA 1YQKA 1KO9A 1QTSA 1CDWA 4DULA 1WJWA 4HJHA 3F10A 3NA5A 1E42A 1Q9UA 3OCIA 1KYFA 1KYDA 2D0BA 5IYCP 1TUOA 3CW7A 4CFFA 4PY5A 1XSZA 4EAGA 3SNSA 3ULXA 1UT4A 2FGTA 5JMVD 2XHIA 1KYUA 1VOLB 1EUVA 4WXAA 4WX8A 1LWWA 3KTUA 2DKDA 1NH2A 1MP9A 2HZSA 3OC3C 5F9CA 1PCMX 2NLVA 2OOXA 3OLPA 3N89A 2NOIA 2YA3A 3DPTA 2JHNA 4D7RA 3CVTA 1WQAA 1T6AA 4D7QA 2NVMA 1D3UA 3TDHA 4WZSD 3PMGA 3OH6A 1QNBA 2HZMA 4MRQA 1UT7A 4I8OA 3I3WA 4B0AA 4ROCB 1YQRA 3DPUA 1LWYA 1C9BB 1P5DX 4IL8A 1UL7A 1EBMA 1QN6A 2F7LA 1KY7A 1VOKA 3VN5A 1C47A 2YH5A 2NOZA 4RODB 3CWSA 3EIKA 1M3QA 1JFIC 2NOHA 2V92A 1DIZA 2JHJA 2FKMX 1PCJX 2EHBD 1NVPA 1QN5A 1TBAB 1K2YX 3BKQX 2HL9A 1HU0A 2HKPA 2ZFDB 3ENCA 5HSHA 2V8QA 1QTPA 3CWAA 2MZ8A 1VKLA 2QRDA 3ENOC 4BJUA 1TGHA 3ASMA 2JOIA 3D7QA 1QN3A 5AN4A 1VTLE 1QN7A 1PVSA 4EAKA 5IYDP 2PWWA 1P5GX 2Z0FA 1NGMA 3CWUA 5BMPA 1MPGA 1M5Q1 2R5XA 1YTBA 2HL8A 3I0WA 1KFQA 1YQLA 1QNAA 2OOYA 3D4VA 2NOBA 1JDYA 2O3OA 1FN7A 3OSTA 1PZDA 3HS8A 2D0CA 1N39A 2JPIA 1LXTA 3T4NA 2I5WA 2V9JA 1RM1A 1YQMA 2NOEA 2MJ7A 2IV8A 1J3MA 5KL0A 1QN9A 1YTFA 1M3HA 3OGDA 1QN4A 1KY6A 3IH7A 2Z8UA 2G30A 4EAJA 4TPSA 2LAEA 2NWVA 4QG5A 3PDKA 1KFIA 4EAIA 3OSEA 1TBPA 3HS9A 3UW2A 2Y8LA 2FUVA 1K35A 4EJYA 3TE5A 2DKCA 1R4XA 2DKAA 2H5AX 4C7PA 1N3CA 3KRMA 2QRCA
chains in the Genus database with same CATH topology
1QN8A 3RPJA 4Q11A 1VTOA 3F0ZA 2NOLA 1W80A 4ROEB 2D0AA 4EJZA 1B9KA 3I0XA 1AISA 2NOFA 2IV9A 3H1ZA 1LWVA 1PCZA 2VJ0A 1N3AA 1QNCA 5IYBP 3OSMA 1QNEA 1YQKA 1KO9A 1QTSA 1CDWA 4DULA 3F10A 1E42A 3OCIA 1KYFA 1KYDA 2D0BA 5IYCP 4PY5A 3ULXA 3SNSA 1UT4A 2FGTA 2XHIA 1KYUA 1VOLB 1LWWA 3KTUA 1NH2A 1MP9A 2HZSA 3OC3C 3N89A 2NOIA 3DPTA 1D3UA 4WZSD 1QNBA 2HZMA 1UT7A 4I8OA 4B0AA 4ROCB 1YQRA 3DPUA 1LWYA 1C9BB 1EBMA 1QN6A 1KY7A 1VOKA 3VN5A 2YH5A 2NOZA 4RODB 3EIKA 1M3QA 1JFIC 2NOHA 1NVPA 1QN5A 1TBAB 1HU0A 1QTPA 2MZ8A 1TGHA 3ASMA 2JOIA 1QN3A 5AN4A 1VTLE 1QN7A 5IYDP 1NGMA 1YTBA 3I0WA 1YQLA 1QNAA 2NOBA 2O3OA 1FN7A 3OSTA 1PZDA 3HS8A 2D0CA 1N39A 2I5WA 1RM1A 1YQMA 2NOEA 2IV8A 2MJ7A 1QN9A 1YTFA 1M3HA 1QN4A 1KY6A 3IH7A 2Z8UA 2G30A 4TPSA 2LAEA 1TBPA 3HS9A 4EJYA 1R4XA 1N3CA 3KRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QN8 A;  1QNA A;  1KYU A;  1VOL B;  1QN6 A;  1KY7 A;  1PZD A;  1VOK A;  3HS8 A;  1W80 A;  3VN5 A;  2D0C A;  1VTO A;  4ROD B;  2D0A A;  4ROE B;  3EIK A;  1B9K A;  1JFI C;  1NH2 A;  1RM1 A;  1AIS A;  2IV8 A;  1MP9 A;  2MJ7 A;  2IV9 A;  3H1Z A;  3OC3 C;  1QN9 A;  1YTF A;  1NVP A;  1QN4 A;  1QN5 A;  1TBA B;  1KY6 A;  1PCZ A;  2Z8U A;  2G30 A;  2VJ0 A;  1QTP A;  1QNC A;  5IYB P;  1QNE A;  3ASM A;  1TGH A;  1QN3 A;  1TBP A;  1QTS A;  3HS9 A;  4WZS D;  1VTL E;  1CDW A;  1D3U A;  1QNB A;  1QN7 A;  5IYD P;  1E42 A;  3OCI A;  4B0A A;  1KYF A;  1KYD A;  4ROC B;  2D0B A;  1NGM A;  1R4X A;  5IYC P;  1YTB A;  4PY5 A;  1C9B B; 
#chains in the Genus database with same CATH topology
 1QN8 A;  3RPJ A;  5JN5 A;  4Q11 A;  5EPC A;  2H4L X;  1VTO A;  3F0Z A;  2NOL A;  1C4G A;  1W80 A;  3C04 A;  3CVS A;  3CWT A;  4ROE B;  2D0A A;  4EJZ A;  3RSM A;  1B9K A;  1V5S A;  3I0X A;  1AIS A;  4EAL A;  2NOF A;  2IV9 A;  3H1Z A;  3OH9 A;  3EAY A;  2QLV A;  1LWV A;  1PCZ A;  2VJ0 A;  2QR1 A;  1N3A A;  1QNC A;  2QRE A;  2Y8Q A;  5IYB P;  5BMN A;  2FKF A;  3OSM A;  1QNE A;  1YQK A;  1KO9 A;  1QTS A;  1CDW A;  4DUL A;  1WJW A;  4HJH A;  3F10 A;  3NA5 A;  1E42 A;  1Q9U A;  3OCI A;  1KYF A;  1KYD A;  2D0B A;  5IYC P;  1TUO A;  3CW7 A;  4CFF A;  4PY5 A;  1XSZ A;  4EAG A;  3SNS A;  3ULX A;  1UT4 A;  2FGT A;  5JMV D;  2XHI A;  1KYU A;  1VOL B;  1EUV A;  4WXA A;  4WX8 A;  1LWW A;  3KTU A;  2DKD A;  1NH2 A;  1MP9 A;  2HZS A;  3OC3 C;  5F9C A;  1PCM X;  2NLV A;  2OOX A;  3OLP A;  3N89 A;  2NOI A;  2YA3 A;  3DPT A;  2JHN A;  4D7R A;  3CVT A;  1WQA A;  1T6A A;  4D7Q A;  2NVM A;  1D3U A;  3TDH A;  4WZS D;  3PMG A;  3OH6 A;  1QNB A;  2HZM A;  4MRQ A;  1UT7 A;  4I8O A;  3I3W A;  4B0A A;  4ROC B;  1YQR A;  3DPU A;  1LWY A;  1C9B B;  1P5D X;  4IL8 A;  1UL7 A;  1EBM A;  1QN6 A;  2F7L A;  1KY7 A;  1VOK A;  3VN5 A;  1C47 A;  2YH5 A;  2NOZ A;  4ROD B;  3CWS A;  3EIK A;  1M3Q A;  1JFI C;  2NOH A;  2V92 A;  1DIZ A;  2JHJ A;  2FKM X;  1PCJ X;  2EHB D;  1NVP A;  1QN5 A;  1TBA B;  1K2Y X;  3BKQ X;  2HL9 A;  1HU0 A;  2HKP A;  2ZFD B;  3ENC A;  5HSH A;  2V8Q A;  1QTP A;  3CWA A;  2MZ8 A;  1VKL A;  2QRD A;  3ENO C;  4BJU A;  1TGH A;  3ASM A;  2JOI A;  3D7Q A;  1QN3 A;  5AN4 A;  1VTL E;  1QN7 A;  1PVS A;  4EAK A;  5IYD P;  2PWW A;  1P5G X;  2Z0F A;  1NGM A;  3CWU A;  5BMP A;  1MPG A;  1M5Q 1;  2R5X A;  1YTB A;  2HL8 A;  3I0W A;  1KFQ A;  1YQL A;  1QNA A;  2OOY A;  3D4V A;  2NOB A;  1JDY A;  2O3O A;  1FN7 A;  3OST A;  1PZD A;  3HS8 A;  2D0C A;  1N39 A;  2JPI A;  1LXT A;  3T4N A;  2I5W A;  2V9J A;  1RM1 A;  1YQM A;  2NOE A;  2MJ7 A;  2IV8 A;  1J3M A;  5KL0 A;  1QN9 A;  1YTF A;  1M3H A;  3OGD A;  1QN4 A;  1KY6 A;  3IH7 A;  2Z8U A;  2G30 A;  4EAJ A;  4TPS A;  2LAE A;  2NWV A;  4QG5 A;  3PDK A;  1KFI A;  4EAI A;  3OSE A;  1TBP A;  3HS9 A;  3UW2 A;  2Y8L A;  2FUV A;  1K35 A;  4EJY A;  3TE5 A;  2DKC A;  1R4X A;  2DKA A;  2H5A X;  4C7P A;  1N3C A;  3KRM A;  2QRC A; 
#chains in the Genus database with same CATH homology
 1QN8 A;  3RPJ A;  4Q11 A;  1VTO A;  3F0Z A;  2NOL A;  1W80 A;  4ROE B;  2D0A A;  4EJZ A;  1B9K A;  3I0X A;  1AIS A;  2NOF A;  2IV9 A;  3H1Z A;  1LWV A;  1PCZ A;  2VJ0 A;  1N3A A;  1QNC A;  5IYB P;  3OSM A;  1QNE A;  1YQK A;  1KO9 A;  1QTS A;  1CDW A;  4DUL A;  3F10 A;  1E42 A;  3OCI A;  1KYF A;  1KYD A;  2D0B A;  5IYC P;  4PY5 A;  3ULX A;  3SNS A;  1UT4 A;  2FGT A;  2XHI A;  1KYU A;  1VOL B;  1LWW A;  3KTU A;  1NH2 A;  1MP9 A;  2HZS A;  3OC3 C;  3N89 A;  2NOI A;  3DPT A;  1D3U A;  4WZS D;  1QNB A;  2HZM A;  1UT7 A;  4I8O A;  4B0A A;  4ROC B;  1YQR A;  3DPU A;  1LWY A;  1C9B B;  1EBM A;  1QN6 A;  1KY7 A;  1VOK A;  3VN5 A;  2YH5 A;  2NOZ A;  4ROD B;  3EIK A;  1M3Q A;  1JFI C;  2NOH A;  1NVP A;  1QN5 A;  1TBA B;  1HU0 A;  1QTP A;  2MZ8 A;  1TGH A;  3ASM A;  2JOI A;  1QN3 A;  5AN4 A;  1VTL E;  1QN7 A;  5IYD P;  1NGM A;  1YTB A;  3I0W A;  1YQL A;  1QNA A;  2NOB A;  2O3O A;  1FN7 A;  3OST A;  1PZD A;  3HS8 A;  2D0C A;  1N39 A;  2I5W A;  1RM1 A;  1YQM A;  2NOE A;  2IV8 A;  2MJ7 A;  1QN9 A;  1YTF A;  1M3H A;  1QN4 A;  1KY6 A;  3IH7 A;  2Z8U A;  2G30 A;  4TPS A;  2LAE A;  1TBP A;  3HS9 A;  4EJY A;  1R4X A;  1N3C A;  3KRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...