1QNCA

Crystal structure of the a(-31) adenovirus major late promoter tata box variant bound to wild-type tbp (arabidopsis thaliana tbp isoform 2). tata element recognition by the tata box-binding protein has been conserved throughout evolution.
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
183
structure length
183
Chain Sequence
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION INITIATION FACTOR TFIID-1
publication title TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Tata box-binding protein (tbp)
total genus 47
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qncA01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1qncA02
1B9KA 3ASMA 3HS8A 4B0AA 1YTBA 1PZDA 2MJ7A 3HS9A 1TBAB 2VJ0A 3EIKA 1D3UA 1QNBA 1YTFA 1VTOA 5IYCP 1QN7A 1QN9A 4PY5A 5IYBP 1AISA 1RM1A 2IV9A 3H1ZA 1NH2A 4RODB 1NVPA 4WZSD 1QNEA 2D0BA 1PCZA 5IYDP 1TGHA 1QNCA 1W80A 1JFIC 1E42A 2G30A 3OCIA 1MP9A 1KYDA 2D0AA 4ROEB 1QN4A 1KY7A 1CDWA 1QN6A 1QNAA 1QN3A 3OC3C 1QTSA 2D0CA 1KYUA 4ROCB 1C9BB 1TBPA 1KYFA 1QN8A 1NGMA 1KY6A 1R4XA 2IV8A 1VTLE 3VN5A 1VOKA 1QN5A 1VOLB 1QTPA 2Z8UA
chains in the Genus database with same CATH superfamily
2NOBA 1K2YX 1PVSA 3F0ZA 3HS9A 2I5WA 2HZSA 2VJ0A 3PDKA 1YQRA 3SNSA 2OOXA 5IYCP 4I8OA 1M3HA 1QN9A 4PY5A 3CWSA 2F7LA 2IV9A 3H1ZA 4D7RA 2QR1A 4EAGA 3CVTA 4WZSD 2HL9A 1PCZA 1K35A 3N89A 1PCJX 1LXTA 2XHIA 5BMNA 3PMGA 1MP9A 5EPCA 2EHBD 1CDWA 2FKFA 1V5SA 1N39A 3C04A 1QTSA 1UL7A 4ROCB 2V92A 1UT4A 1KYFA 2HKPA 1KY6A 4QG5A 2QLVA 3BKQX 4BJUA 3ENCA 1QN3A 2Y8LA 3OSEA 3ASMA 2V9JA 2YH5A 2NOHA 3HS8A 1KFIA 1VKLA 5AN4A 4D7QA 5JMVD 2NOIA 1VTOA 2OOYA 2DKAA 1JDYA 1EBMA 1C4GA 3TE5A 4C7PA 3OGDA 5F9CA 2QRCA 1XSZA 3CW7A 2H5AX 1QNEA 1MPGA 2ZFDB 1JFIC 3F10A 3I0WA 1QN4A 1KYDA 3TDHA 1KY7A 1Q9UA 4EALA 2FGTA 1WQAA 2FUVA 2HL8A 3OSTA 1FN7A 4CFFA 3NA5A 3RSMA 5KL0A 1C47A 3ULXA 3VN5A 1VOKA 5JN5A 1QN5A 1QNCA 1VOLB 4EJYA 4MRQA 1T6AA 1YQLA 1B9KA 2HZMA 3OSMA 4B0AA 1YTBA 1PZDA 2O3OA 1TBAB 3EIKA 4EAIA 3KTUA 4EAKA 1QNBA 2H4LX 2QRDA 3T4NA 5IYBP 2JOIA 3I0XA 5HSHA 2NLVA 2PWWA 4RODB 1TUOA 2NWVA 3DPTA 1M3QA 3ENOC 2DKCA 2FKMX 2MZ8A 1WJWA 3RPJA 2R5XA 1E42A 2G30A 4ROEB 1QN6A 3DPUA 3OLPA 1QNAA 1N3CA 3CWTA 4Q11A 3OC3C 2D0CA 1KYUA 2NOFA 1DIZA 1TBPA 2DKDA 1NGMA 1N3AA 2IV8A 1R4XA 4TPSA 1J3MA 3CWAA 1YQMA 3CWUA 2NOZA 2D0AA 1M5Q1 2JHNA 2QREA 3EAYA 3UW2A 2NOEA 3I3WA 2MJ7A 4WXAA 3D4VA 1D3UA 2JPIA 1UT7A 1YTFA 2NVMA 1QN7A 4HJHA 4WX8A 1PCMX 1AISA 3KRMA 1KO9A 1RM1A 1NH2A 5BMPA 1NVPA 1LWVA 2D0BA 3IH7A 5IYDP 1TGHA 1W80A 3OCIA 1LWYA 1P5DX 2Y8QA 2JHJA 3OH6A 1HU0A 2LAEA 4EAJA 1LWWA 2YA3A 1C9BB 1P5GX 1EUVA 2V8QA 3CVSA 3D7QA 4DULA 1QN8A 4EJZA 2NOLA 4IL8A 1VTLE 1KFQA 1YQKA 3OH9A 1QTPA 2Z8UA 2Z0FA
chains in the Genus database with same CATH topology
2NOBA 3F0ZA 3HS9A 2I5WA 2HZSA 2VJ0A 1YQRA 3SNSA 5IYCP 1M3HA 4I8OA 1QN9A 4PY5A 2IV9A 3H1ZA 4WZSD 1PCZA 3N89A 2XHIA 1MP9A 1CDWA 1N39A 1QTSA 4ROCB 1UT4A 1KYFA 1KY6A 1QN3A 3ASMA 2YH5A 2NOHA 3HS8A 5AN4A 2NOIA 1VTOA 1EBMA 1QNEA 1JFIC 3I0WA 3F10A 1QN4A 1KYDA 1KY7A 2FGTA 3OSTA 1FN7A 3ULXA 3VN5A 1VOKA 1QN5A 1QNCA 1VOLB 4EJYA 1YQLA 1B9KA 2HZMA 3OSMA 4B0AA 1YTBA 1PZDA 2O3OA 1TBAB 3EIKA 3KTUA 1QNBA 5IYBP 3I0XA 2JOIA 4RODB 3DPTA 1M3QA 2MZ8A 3RPJA 1E42A 2G30A 4ROEB 1QN6A 3DPUA 1QNAA 1N3CA 4Q11A 3OC3C 2D0CA 1KYUA 2NOFA 1TBPA 1NGMA 1N3AA 2IV8A 1R4XA 4TPSA 1YQMA 2NOZA 2D0AA 2NOEA 2MJ7A 1D3UA 1UT7A 1YTFA 1QN7A 1AISA 3KRMA 1KO9A 1RM1A 1NH2A 1NVPA 1LWVA 2D0BA 3IH7A 5IYDP 1TGHA 1W80A 3OCIA 1LWYA 1HU0A 2LAEA 1LWWA 1C9BB 1QN8A 4DULA 4EJZA 2NOLA 1VTLE 1YQKA 1QTPA 2Z8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9K A;  3ASM A;  3HS8 A;  4B0A A;  1YTB A;  1PZD A;  2MJ7 A;  3HS9 A;  1TBA B;  2VJ0 A;  3EIK A;  1D3U A;  1QNB A;  1YTF A;  1VTO A;  5IYC P;  1QN7 A;  1QN9 A;  4PY5 A;  5IYB P;  1AIS A;  1RM1 A;  2IV9 A;  3H1Z A;  1NH2 A;  4ROD B;  1NVP A;  4WZS D;  1QNE A;  2D0B A;  1PCZ A;  5IYD P;  1TGH A;  1QNC A;  1W80 A;  1JFI C;  1E42 A;  2G30 A;  3OCI A;  1MP9 A;  1KYD A;  2D0A A;  4ROE B;  1QN4 A;  1KY7 A;  1CDW A;  1QN6 A;  1QNA A;  1QN3 A;  3OC3 C;  1QTS A;  2D0C A;  1KYU A;  4ROC B;  1C9B B;  1TBP A;  1KYF A;  1QN8 A;  1NGM A;  1KY6 A;  1R4X A;  2IV8 A;  1VTL E;  3VN5 A;  1VOK A;  1QN5 A;  1VOL B;  1QTP A;  2Z8U A; 
#chains in the Genus database with same CATH topology
 2NOB A;  1K2Y X;  1PVS A;  3F0Z A;  3HS9 A;  2I5W A;  2HZS A;  2VJ0 A;  3PDK A;  1YQR A;  3SNS A;  2OOX A;  5IYC P;  4I8O A;  1M3H A;  1QN9 A;  4PY5 A;  3CWS A;  2F7L A;  2IV9 A;  3H1Z A;  4D7R A;  2QR1 A;  4EAG A;  3CVT A;  4WZS D;  2HL9 A;  1PCZ A;  1K35 A;  3N89 A;  1PCJ X;  1LXT A;  2XHI A;  5BMN A;  3PMG A;  1MP9 A;  5EPC A;  2EHB D;  1CDW A;  2FKF A;  1V5S A;  1N39 A;  3C04 A;  1QTS A;  1UL7 A;  4ROC B;  2V92 A;  1UT4 A;  1KYF A;  2HKP A;  1KY6 A;  4QG5 A;  2QLV A;  3BKQ X;  4BJU A;  3ENC A;  1QN3 A;  2Y8L A;  3OSE A;  3ASM A;  2V9J A;  2YH5 A;  2NOH A;  3HS8 A;  1KFI A;  1VKL A;  5AN4 A;  4D7Q A;  5JMV D;  2NOI A;  1VTO A;  2OOY A;  2DKA A;  1JDY A;  1EBM A;  1C4G A;  3TE5 A;  4C7P A;  3OGD A;  5F9C A;  2QRC A;  1XSZ A;  3CW7 A;  2H5A X;  1QNE A;  1MPG A;  2ZFD B;  1JFI C;  3F10 A;  3I0W A;  1QN4 A;  1KYD A;  3TDH A;  1KY7 A;  1Q9U A;  4EAL A;  2FGT A;  1WQA A;  2FUV A;  2HL8 A;  3OST A;  1FN7 A;  4CFF A;  3NA5 A;  3RSM A;  5KL0 A;  1C47 A;  3ULX A;  3VN5 A;  1VOK A;  5JN5 A;  1QN5 A;  1QNC A;  1VOL B;  4EJY A;  4MRQ A;  1T6A A;  1YQL A;  1B9K A;  2HZM A;  3OSM A;  4B0A A;  1YTB A;  1PZD A;  2O3O A;  1TBA B;  3EIK A;  4EAI A;  3KTU A;  4EAK A;  1QNB A;  2H4L X;  2QRD A;  3T4N A;  5IYB P;  2JOI A;  3I0X A;  5HSH A;  2NLV A;  2PWW A;  4ROD B;  1TUO A;  2NWV A;  3DPT A;  1M3Q A;  3ENO C;  2DKC A;  2FKM X;  2MZ8 A;  1WJW A;  3RPJ A;  2R5X A;  1E42 A;  2G30 A;  4ROE B;  1QN6 A;  3DPU A;  3OLP A;  1QNA A;  1N3C A;  3CWT A;  4Q11 A;  3OC3 C;  2D0C A;  1KYU A;  2NOF A;  1DIZ A;  1TBP A;  2DKD A;  1NGM A;  1N3A A;  2IV8 A;  1R4X A;  4TPS A;  1J3M A;  3CWA A;  1YQM A;  3CWU A;  2NOZ A;  2D0A A;  1M5Q 1;  2JHN A;  2QRE A;  3EAY A;  3UW2 A;  2NOE A;  3I3W A;  2MJ7 A;  4WXA A;  3D4V A;  1D3U A;  2JPI A;  1UT7 A;  1YTF A;  2NVM A;  1QN7 A;  4HJH A;  4WX8 A;  1PCM X;  1AIS A;  3KRM A;  1KO9 A;  1RM1 A;  1NH2 A;  5BMP A;  1NVP A;  1LWV A;  2D0B A;  3IH7 A;  5IYD P;  1TGH A;  1W80 A;  3OCI A;  1LWY A;  1P5D X;  2Y8Q A;  2JHJ A;  3OH6 A;  1HU0 A;  2LAE A;  4EAJ A;  1LWW A;  2YA3 A;  1C9B B;  1P5G X;  1EUV A;  2V8Q A;  3CVS A;  3D7Q A;  4DUL A;  1QN8 A;  4EJZ A;  2NOL A;  4IL8 A;  1VTL E;  1KFQ A;  1YQK A;  3OH9 A;  1QTP A;  2Z8U A;  2Z0F A; 
#chains in the Genus database with same CATH homology
 2NOB A;  3F0Z A;  3HS9 A;  2I5W A;  2HZS A;  2VJ0 A;  1YQR A;  3SNS A;  5IYC P;  1M3H A;  4I8O A;  1QN9 A;  4PY5 A;  2IV9 A;  3H1Z A;  4WZS D;  1PCZ A;  3N89 A;  2XHI A;  1MP9 A;  1CDW A;  1N39 A;  1QTS A;  4ROC B;  1UT4 A;  1KYF A;  1KY6 A;  1QN3 A;  3ASM A;  2YH5 A;  2NOH A;  3HS8 A;  5AN4 A;  2NOI A;  1VTO A;  1EBM A;  1QNE A;  1JFI C;  3I0W A;  3F10 A;  1QN4 A;  1KYD A;  1KY7 A;  2FGT A;  3OST A;  1FN7 A;  3ULX A;  3VN5 A;  1VOK A;  1QN5 A;  1QNC A;  1VOL B;  4EJY A;  1YQL A;  1B9K A;  2HZM A;  3OSM A;  4B0A A;  1YTB A;  1PZD A;  2O3O A;  1TBA B;  3EIK A;  3KTU A;  1QNB A;  5IYB P;  3I0X A;  2JOI A;  4ROD B;  3DPT A;  1M3Q A;  2MZ8 A;  3RPJ A;  1E42 A;  2G30 A;  4ROE B;  1QN6 A;  3DPU A;  1QNA A;  1N3C A;  4Q11 A;  3OC3 C;  2D0C A;  1KYU A;  2NOF A;  1TBP A;  1NGM A;  1N3A A;  2IV8 A;  1R4X A;  4TPS A;  1YQM A;  2NOZ A;  2D0A A;  2NOE A;  2MJ7 A;  1D3U A;  1UT7 A;  1YTF A;  1QN7 A;  1AIS A;  3KRM A;  1KO9 A;  1RM1 A;  1NH2 A;  1NVP A;  1LWV A;  2D0B A;  3IH7 A;  5IYD P;  1TGH A;  1W80 A;  3OCI A;  1LWY A;  1HU0 A;  2LAE A;  1LWW A;  1C9B B;  1QN8 A;  4DUL A;  4EJZ A;  2NOL A;  1VTL E;  1YQK A;  1QTP A;  2Z8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...