1QO6A

Solution structure of a pair of modules from the gelatin-binding domain of fibronectin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
101
structure length
101
Chain Sequence
YGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN
publication title Solution Structure of a Pair of Modules from the Gelatin-Binding Domain of Fibronectin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
total genus 6
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1999-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1qo6A02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1qo6A01
3OP8A 2YRAA 4AYEA 5HYUB 4IGDA 2V5OA 3ERBA 3R62A 3RJ3D 2FN2A 2XRDA 1H8PA 4C16A 4J38B 3M7PA 1HCCA 4JHSA 4ONTD 3IU3I 5I0QB 4AYIA 1GKGA 2WIIC 1E88A 3O8EB 1HFHA 5HZPB 1OJWA 1TPNA 4ZH1D 2CG7A 1SRZA 1MD7A 2QY0A 1OJVA 1NWVA 4A5WB 5HYPA 3EJHA 1CK7A 1H04P 4F4OC 2EC3A 1VVCA 1QUBA 2CKUA 1TPGA 3T5OA 2RL0A 1Z92B 4PZ5A 1CKLA 3ZD2A 1FBRA 5HYTB 2MCZA 2UWNA 3L89M 2XWBF 1OK3A 2B5ID 1VVDA 1E5GA 2XWJI 1MD8A 1CXWA 1GPZA 2XQWC 2BZMA 3OXUD 2W81A 5FO8C 1E8BA 4AYDA 1L6JA 2LOJA 3NFPI 2G7IA 1EAKA 3KXVA 2KMSA 1H2PP 1OK9A 2IZ4A 2JGXA 1UOTP 1QGBA 1GXDA 1U5MA 1ELVA 1OJYA 3ZD1A 1ZJKA 1QO6A 1HFIA 3OEDC 2V8EA 2XRBA 1SS2A 1G4FA 1J7MA 3GXEA 2RLPA 1GKNA 1G4GA 3CALA 4B2RA 4DJZA 1PDCA 2RLQA 2RKYA 2YBYA 3IX0A 2ERJA 4AYMA 2KRIA 3GOVA 4CSYA 4KKDA 2CG6A 1OK1A 4FXGG 4LOTA 1Q3XA 1LY2A 2A55A 4MUCA 1OK2A 1GHQB 2W80A 1C1ZA 1H2QP 3INBC 3SW0X 2RKZA 4LOSA 2IZ3A 2JGWA 3KZJA 1PPQA 1O9AA 4YNXA 4K12A 1H03P 4B2SA 3TVJA 1KS0A 3MQLA 2EHFA 3ZRZA 2O39C 1TPMA 5JPMG 2JRAA 4WJG2 2MCYA
chains in the Genus database with same CATH superfamily
4NYUA 3OP8A 2YRAA 4AYEA 2X2ZA 5HYUB 4IGDA 2V5OA 4NZ5A 3ERBA 3R62A 3L26A 1AIWA 3RJ3D 2FN2A 2Y2GA 3KS8A 2XRDA 4IBIA 3WSYA 1H8PA 3WD2A 4Z2IA 1ED7A 3M7PA 1HCCA 2Y2MA 4J38B 4NZ1A 4JHSA 1YU0A 1H0GA 4IJFA 4ONTD 3IU3I 5I0QB 4OJOA 4AYIA 1H0IA 4IBFA 2WIIC 2XD5A 4Z2GA 2ZYCA 1E88A 3CI0J 1GKGA 3O8EB 1HFHA 4LG2A 1YU4A 5HZPB 1OJWA 1TPNA 4N7EA 4ZH1D 1OGBA 2CG7A 4TX8A 1MD7A 1SRZA 2QY0A 3F6KA 2Y2HA 1E6ZA 4Z2KA 1NWVA 4NZ4A 1OJVA 4A5WB 5HYPA 4BWCA 3EJHA 2JE5A 1CK7A 1YUEA 2IOUA 1H04P 2EC3A 4F4OC 1QUBA 1VVCA 2CKUA 1TPGA 3T5OA 1W1VA 2RL0A 4IBGA 1Z92B 4GH9A 3L25A 4PZ5A 1CKLA 3WD3A 3ZD2A 1FBRA 5HYTB 3L27A 2RTSA 2MCZA 2Y2NA 4NZ3A 1E6PA 2UWNA 3ZLDA 3WSXA 4APLA 3L89M 2XWBF 4MB4A 1GPFA 5BPVA 3WD1A 2Y2LA 1OK3A 2B5ID 1VVDA 3WD4A 2UWXA 4Z2JA 2XWJI 1MD8A 4OUIA 1E5GA 1CXWA 2XD1A 5DN4A 1GPZA 2XQWC 2BZMA 3OXUD 3WX7A 4NYYA 2W81A 2Y2JA 5FO8C 1E8BA 4AYDA 1L6JA 2Y2QA 1YU2A 4IBDA 3HSHA 1EAKA 4NY2A 2G7IA 2LOJA 3N3FA 4GHAA 3KXVA 4IBBA 2KMSA 1H2PP 1OK9A 2IZ4A 1E6NA 2FFFB 3L2AA 2JGXA 3ZLEA 4IBKA 1UOTP 1QGBA 4OJ5A 1GXDA 1U5MA 1ELVA 2I2LA 1OJYA 2Y2PA 1ZJKA 2Y8SA 1QO6A 3ZD1A 1HFIA 3OEDC 2V8EA 2XRBA 2Y2IA 4OJ6A 1SS2A 1G4FA 1J7MA 2D49A 1OGGA 3GXEA 3WD0A 2RLPA 2Y2OA 1GKNA 1G4GA 1UR8A 3CALA 4MB5A 4B2RA 4IBCA 2JCHA 4DJZA 1PDCA 1O6IA 2Y2KA 2RLQA 2RKYA 2YBYA 3IX0A 1YU1A 2Y8RA 2ERJA 4AYMA 4Z2LA 3NJAA 2KRIA 1W1YA 4MSLA 3GOVA 3L28A 4IBEA 4HMCA 4CSYA 4KKDA 1GOIA 2CG6A 1OK1A 4FXGG 4LOTA 1Q3XA 1LY2A 2A55A 4MUCA 1OK2A 4OJPA 1GHQB 1W1PA 2BG1A 2Y8TA 1W1TA 2W80A 1C1ZA 1E15A 4OJLA 1H2QP 1YU3A 3INBC 3VWOA 2RKZA 4HMDA 4IBJA 3NFPI 4LOSA 3SW0X 3K3TA 2IZ3A 3L29A 2JGWA 3KZJA 1PPQA 1O9AA 1E6RA 4YNXA 4K12A 3KS4A 4YIZA 4MB3A 4GHLA 1H03P 4B2SA 3TVJA 1KS0A 4QNLA 4C16A 3FGRA 4HMEA 3HONA 3MQLA 3FKEA 2EHFA 1UR9A 5DN5A 4IJEA 3ZRZA 2O39C 4PO7A 1TPMA 5JPMG 2JRAA 4Z2HA 1RLHA 3FGTA 4WJG2 2MCYA
chains in the Genus database with same CATH topology
3OP8A 2YRAA 4AYEA 5HYUB 4IGDA 2V5OA 3ERBA 3R62A 3RJ3D 2FN2A 2XRDA 1H8PA 4C16A 4J38B 3M7PA 1HCCA 4JHSA 4ONTD 3IU3I 5I0QB 4AYIA 1GKGA 2WIIC 1E88A 3O8EB 1HFHA 5HZPB 1OJWA 1TPNA 4ZH1D 2CG7A 1SRZA 1MD7A 2QY0A 1OJVA 1NWVA 4A5WB 5HYPA 3EJHA 1CK7A 1H04P 4F4OC 2EC3A 1VVCA 1QUBA 2CKUA 1TPGA 3T5OA 2RL0A 1Z92B 4PZ5A 1CKLA 3ZD2A 1FBRA 5HYTB 2MCZA 2UWNA 3L89M 2XWBF 1OK3A 2B5ID 1VVDA 1E5GA 2XWJI 1MD8A 1CXWA 1GPZA 2XQWC 2BZMA 3OXUD 2W81A 5FO8C 1E8BA 4AYDA 1L6JA 2LOJA 3NFPI 2G7IA 1EAKA 3KXVA 2KMSA 1H2PP 1OK9A 2IZ4A 2JGXA 1UOTP 1QGBA 1GXDA 1U5MA 1ELVA 1OJYA 3ZD1A 1ZJKA 1QO6A 1HFIA 3OEDC 2V8EA 2XRBA 1SS2A 1G4FA 1J7MA 3GXEA 2RLPA 1GKNA 1G4GA 3CALA 4B2RA 4DJZA 1PDCA 2RLQA 2RKYA 2YBYA 3IX0A 2ERJA 4AYMA 2KRIA 3GOVA 4CSYA 4KKDA 2CG6A 1OK1A 4FXGG 4LOTA 1Q3XA 1LY2A 2A55A 4MUCA 1OK2A 1GHQB 2W80A 1C1ZA 1H2QP 3INBC 3SW0X 2RKZA 4LOSA 2IZ3A 2JGWA 3KZJA 1PPQA 1O9AA 4YNXA 4K12A 1H03P 4B2SA 3TVJA 1KS0A 3MQLA 2EHFA 3ZRZA 2O39C 1TPMA 5JPMG 2JRAA 4WJG2 2MCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OP8 A;  2YRA A;  4AYE A;  5HYU B;  4IGD A;  2V5O A;  3ERB A;  3R62 A;  3RJ3 D;  2FN2 A;  2XRD A;  1H8P A;  4C16 A;  4J38 B;  3M7P A;  1HCC A;  4JHS A;  4ONT D;  3IU3 I;  5I0Q B;  4AYI A;  1GKG A;  2WII C;  1E88 A;  3O8E B;  1HFH A;  5HZP B;  1OJW A;  1TPN A;  4ZH1 D;  2CG7 A;  1SRZ A;  1MD7 A;  2QY0 A;  1OJV A;  1NWV A;  4A5W B;  5HYP A;  3EJH A;  1CK7 A;  1H04 P;  4F4O C;  2EC3 A;  1VVC A;  1QUB A;  2CKU A;  1TPG A;  3T5O A;  2RL0 A;  1Z92 B;  4PZ5 A;  1CKL A;  3ZD2 A;  1FBR A;  5HYT B;  2MCZ A;  2UWN A;  3L89 M;  2XWB F;  1OK3 A;  2B5I D;  1VVD A;  1E5G A;  2XWJ I;  1MD8 A;  1CXW A;  1GPZ A;  2XQW C;  2BZM A;  3OXU D;  2W81 A;  5FO8 C;  1E8B A;  4AYD A;  1L6J A;  2LOJ A;  3NFP I;  2G7I A;  1EAK A;  3KXV A;  2KMS A;  1H2P P;  1OK9 A;  2IZ4 A;  2JGX A;  1UOT P;  1QGB A;  1GXD A;  1U5M A;  1ELV A;  1OJY A;  3ZD1 A;  1ZJK A;  1QO6 A;  1HFI A;  3OED C;  2V8E A;  2XRB A;  1SS2 A;  1G4F A;  1J7M A;  3GXE A;  2RLP A;  1GKN A;  1G4G A;  3CAL A;  4B2R A;  4DJZ A;  1PDC A;  2RLQ A;  2RKY A;  2YBY A;  3IX0 A;  2ERJ A;  4AYM A;  2KRI A;  3GOV A;  4CSY A;  4KKD A;  2CG6 A;  1OK1 A;  4FXG G;  4LOT A;  1Q3X A;  1LY2 A;  2A55 A;  4MUC A;  1OK2 A;  1GHQ B;  2W80 A;  1C1Z A;  1H2Q P;  3INB C;  3SW0 X;  2RKZ A;  4LOS A;  2IZ3 A;  2JGW A;  3KZJ A;  1PPQ A;  1O9A A;  4YNX A;  4K12 A;  1H03 P;  4B2S A;  3TVJ A;  1KS0 A;  3MQL A;  2EHF A;  3ZRZ A;  2O39 C;  1TPM A;  5JPM G;  2JRA A;  4WJG 2;  2MCY A; 
#chains in the Genus database with same CATH topology
 4NYU A;  3OP8 A;  2YRA A;  4AYE A;  2X2Z A;  5HYU B;  4IGD A;  2V5O A;  4NZ5 A;  3ERB A;  3R62 A;  3L26 A;  1AIW A;  3RJ3 D;  2FN2 A;  2Y2G A;  3KS8 A;  2XRD A;  4IBI A;  3WSY A;  1H8P A;  3WD2 A;  4Z2I A;  1ED7 A;  3M7P A;  1HCC A;  2Y2M A;  4J38 B;  4NZ1 A;  4JHS A;  1YU0 A;  1H0G A;  4IJF A;  4ONT D;  3IU3 I;  5I0Q B;  4OJO A;  4AYI A;  1H0I A;  4IBF A;  2WII C;  2XD5 A;  4Z2G A;  2ZYC A;  1E88 A;  3CI0 J;  1GKG A;  3O8E B;  1HFH A;  4LG2 A;  1YU4 A;  5HZP B;  1OJW A;  1TPN A;  4N7E A;  4ZH1 D;  1OGB A;  2CG7 A;  4TX8 A;  1MD7 A;  1SRZ A;  2QY0 A;  3F6K A;  2Y2H A;  1E6Z A;  4Z2K A;  1NWV A;  4NZ4 A;  1OJV A;  4A5W B;  5HYP A;  4BWC A;  3EJH A;  2JE5 A;  1CK7 A;  1YUE A;  2IOU A;  1H04 P;  2EC3 A;  4F4O C;  1QUB A;  1VVC A;  2CKU A;  1TPG A;  3T5O A;  1W1V A;  2RL0 A;  4IBG A;  1Z92 B;  4GH9 A;  3L25 A;  4PZ5 A;  1CKL A;  3WD3 A;  3ZD2 A;  1FBR A;  5HYT B;  3L27 A;  2RTS A;  2MCZ A;  2Y2N A;  4NZ3 A;  1E6P A;  2UWN A;  3ZLD A;  3WSX A;  4APL A;  3L89 M;  2XWB F;  4MB4 A;  1GPF A;  5BPV A;  3WD1 A;  2Y2L A;  1OK3 A;  2B5I D;  1VVD A;  3WD4 A;  2UWX A;  4Z2J A;  2XWJ I;  1MD8 A;  4OUI A;  1E5G A;  1CXW A;  2XD1 A;  5DN4 A;  1GPZ A;  2XQW C;  2BZM A;  3OXU D;  3WX7 A;  4NYY A;  2W81 A;  2Y2J A;  5FO8 C;  1E8B A;  4AYD A;  1L6J A;  2Y2Q A;  1YU2 A;  4IBD A;  3HSH A;  1EAK A;  4NY2 A;  2G7I A;  2LOJ A;  3N3F A;  4GHA A;  3KXV A;  4IBB A;  2KMS A;  1H2P P;  1OK9 A;  2IZ4 A;  1E6N A;  2FFF B;  3L2A A;  2JGX A;  3ZLE A;  4IBK A;  1UOT P;  1QGB A;  4OJ5 A;  1GXD A;  1U5M A;  1ELV A;  2I2L A;  1OJY A;  2Y2P A;  1ZJK A;  2Y8S A;  1QO6 A;  3ZD1 A;  1HFI A;  3OED C;  2V8E A;  2XRB A;  2Y2I A;  4OJ6 A;  1SS2 A;  1G4F A;  1J7M A;  2D49 A;  1OGG A;  3GXE A;  3WD0 A;  2RLP A;  2Y2O A;  1GKN A;  1G4G A;  1UR8 A;  3CAL A;  4MB5 A;  4B2R A;  4IBC A;  2JCH A;  4DJZ A;  1PDC A;  1O6I A;  2Y2K A;  2RLQ A;  2RKY A;  2YBY A;  3IX0 A;  1YU1 A;  2Y8R A;  2ERJ A;  4AYM A;  4Z2L A;  3NJA A;  2KRI A;  1W1Y A;  4MSL A;  3GOV A;  3L28 A;  4IBE A;  4HMC A;  4CSY A;  4KKD A;  1GOI A;  2CG6 A;  1OK1 A;  4FXG G;  4LOT A;  1Q3X A;  1LY2 A;  2A55 A;  4MUC A;  1OK2 A;  4OJP A;  1GHQ B;  1W1P A;  2BG1 A;  2Y8T A;  1W1T A;  2W80 A;  1C1Z A;  1E15 A;  4OJL A;  1H2Q P;  1YU3 A;  3INB C;  3VWO A;  2RKZ A;  4HMD A;  4IBJ A;  3NFP I;  4LOS A;  3SW0 X;  3K3T A;  2IZ3 A;  3L29 A;  2JGW A;  3KZJ A;  1PPQ A;  1O9A A;  1E6R A;  4YNX A;  4K12 A;  3KS4 A;  4YIZ A;  4MB3 A;  4GHL A;  1H03 P;  4B2S A;  3TVJ A;  1KS0 A;  4QNL A;  4C16 A;  3FGR A;  4HME A;  3HON A;  3MQL A;  3FKE A;  2EHF A;  1UR9 A;  5DN5 A;  4IJE A;  3ZRZ A;  2O39 C;  4PO7 A;  1TPM A;  5JPM G;  2JRA A;  4Z2H A;  1RLH A;  3FGT A;  4WJG 2;  2MCY A; 
#chains in the Genus database with same CATH homology
 3OP8 A;  2YRA A;  4AYE A;  5HYU B;  4IGD A;  2V5O A;  3ERB A;  3R62 A;  3RJ3 D;  2FN2 A;  2XRD A;  1H8P A;  4C16 A;  4J38 B;  3M7P A;  1HCC A;  4JHS A;  4ONT D;  3IU3 I;  5I0Q B;  4AYI A;  1GKG A;  2WII C;  1E88 A;  3O8E B;  1HFH A;  5HZP B;  1OJW A;  1TPN A;  4ZH1 D;  2CG7 A;  1SRZ A;  1MD7 A;  2QY0 A;  1OJV A;  1NWV A;  4A5W B;  5HYP A;  3EJH A;  1CK7 A;  1H04 P;  4F4O C;  2EC3 A;  1VVC A;  1QUB A;  2CKU A;  1TPG A;  3T5O A;  2RL0 A;  1Z92 B;  4PZ5 A;  1CKL A;  3ZD2 A;  1FBR A;  5HYT B;  2MCZ A;  2UWN A;  3L89 M;  2XWB F;  1OK3 A;  2B5I D;  1VVD A;  1E5G A;  2XWJ I;  1MD8 A;  1CXW A;  1GPZ A;  2XQW C;  2BZM A;  3OXU D;  2W81 A;  5FO8 C;  1E8B A;  4AYD A;  1L6J A;  2LOJ A;  3NFP I;  2G7I A;  1EAK A;  3KXV A;  2KMS A;  1H2P P;  1OK9 A;  2IZ4 A;  2JGX A;  1UOT P;  1QGB A;  1GXD A;  1U5M A;  1ELV A;  1OJY A;  3ZD1 A;  1ZJK A;  1QO6 A;  1HFI A;  3OED C;  2V8E A;  2XRB A;  1SS2 A;  1G4F A;  1J7M A;  3GXE A;  2RLP A;  1GKN A;  1G4G A;  3CAL A;  4B2R A;  4DJZ A;  1PDC A;  2RLQ A;  2RKY A;  2YBY A;  3IX0 A;  2ERJ A;  4AYM A;  2KRI A;  3GOV A;  4CSY A;  4KKD A;  2CG6 A;  1OK1 A;  4FXG G;  4LOT A;  1Q3X A;  1LY2 A;  2A55 A;  4MUC A;  1OK2 A;  1GHQ B;  2W80 A;  1C1Z A;  1H2Q P;  3INB C;  3SW0 X;  2RKZ A;  4LOS A;  2IZ3 A;  2JGW A;  3KZJ A;  1PPQ A;  1O9A A;  4YNX A;  4K12 A;  1H03 P;  4B2S A;  3TVJ A;  1KS0 A;  3MQL A;  2EHF A;  3ZRZ A;  2O39 C;  1TPM A;  5JPM G;  2JRA A;  4WJG 2;  2MCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...