1QO6A

Solution structure of a pair of modules from the gelatin-binding domain of fibronectin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
101
structure length
101
Chain Sequence
b'YGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN
publication title Solution Structure of a Pair of Modules from the Gelatin-Binding Domain of Fibronectin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
total genus 6
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1999-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
A PF00040 fn2 Fibronectin type II domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.10 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Fibronectin, type II, collagen-binding 1qo6A02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1qo6A01
2EC3A 1C1ZA 1O9AA 1TPGA 2JGWA 1HFIA 4K12A 5JPMG 3ERBA 1VVCA 1OJYA 1GKNA 1H04P 4AYDA 2RKZA 5I0QB 1QGBA 2LOJA 3GXEA 4FXGG 5FO8C 3ZD1A 1KS0A 4B2SA 4AYEA 3MQLA 2W80A 1TPNA 1H8PA 2RKYA 3ZRZA 3INBC 5HYPA 4B2RA 2WIIC 1OK1A 2G7IA 3EJHA 4AYMA 1OJVA 2YRAA 2RLQA 2RL0A 2KRIA 2B5ID 2FN2A 2MCZA 2JGXA 1SRZA 4PZ5A 2RLPA 3KZJA 2V5OA 3NFPI 1PPQA 4AYIA 1J7MA 4ONTD 1OK2A 1QUBA 1MD7A 3ZD2A 1NWVA 1ELVA 2QY0A 2XWJI 2CKUA 3RJ3D 1H03P 1ZJKA 3OEDC 3OXUD 1HFHA 2JRAA 4JHSA 1FBRA 1GKGA 4DJZA 4C16A 1E5GA 1U5MA 2BZMA 1EAKA 3R62A 5HYUB 1QO6A 1LY2A 1PDCA 1UOTP 1Z92B 1L6JA 4YNXA 1CXWA 4J38B 2MCYA 4KKDA 4MUCA 1OK3A 1CK7A 3CALA 3KXVA 1G4FA 2V8EA 1OK9A 2O39C 2XRDA 1GHQB 2ERJA 2YBYA 3L89M 2W81A 1Q3XA 3TVJA 1G4GA 1GPZA 4F4OC 1OJWA 1H2PP 4A5WB 1HCCA 2A55A 4ZH1D 1GXDA 1SS2A 3OP8A 1E88A 2KMSA 4WJG2 2CG6A 1TPMA 3IX0A 4LOSA 1H2QP 2XQWC 5HYTB 2XWBF 2CG7A 2IZ3A 3O8EB 3M7PA 2IZ4A 4LOTA 4IGDA 3IU3I 4CSYA 2UWNA 2EHFA 1MD8A 1E8BA 1CKLA 3GOVA 5HZPB 3SW0X 2XRBA 3T5OA 1VVDA
chains in the Genus database with same CATH superfamily
2EC3A 1C1ZA 1ED7A 1O9AA 4GHLA 1TPGA 1HFIA 2Y2IA 2JGWA 4K12A 5JPMG 4BWCA 3ERBA 1VVCA 2Y8SA 2Y2OA 1AIWA 1OJYA 1H04P 1VVDA 5DN5A 1GKNA 1E6NA 4AYDA 2RKZA 5I0QB 1QGBA 1W1TA 2LOJA 3GXEA 4FXGG 3WD0A 5FO8C 1GPFA 4IBEA 4Z2IA 3CI0J 1KS0A 2Y8RA 3ZD1A 4NZ1A 4B2SA 4Z2GA 4AYEA 3MQLA 2W80A 1TPNA 1H8PA 4Z2LA 4IBDA 1OGBA 1YU3A 2RKYA 3ZRZA 3INBC 5HYPA 4B2RA 2WIIC 1OK1A 2G7IA 1YU2A 3FKEA 3EJHA 4AYMA 1YU1A 4MSLA 3WSXA 1OJVA 2YRAA 4HMCA 2RLQA 2RL0A 2KRIA 4N7EA 2UWXA 1RLHA 2B5ID 2FN2A 2MCZA 2JGXA 2Y2GA 2Y2PA 3NJAA 1YU0A 1SRZA 4PZ5A 2RLPA 2I2LA 2IOUA 4OJOA 1YU4A 3KZJA 3WX7A 2V5OA 2Y2LA 5BPVA 3KS8A 1PPQA 3NFPI 3VWOA 4AYIA 1J7MA 1E6ZA 3L29A 4IBGA 2JCHA 5DN4A 4ONTD 1OK2A 1QUBA 2Y2KA 1MD7A 3ZD2A 1NWVA 1ELVA 2QY0A 2BG1A 4IBKA 2XWJI 3KS4A 4IBBA 2CKUA 3RJ3D 1YUEA 3L27A 1H03P 1ZJKA 3OEDC 2RTSA 4MB5A 2JE5A 3OXUD 1HFHA 2JRAA 4JHSA 1H0IA 1FBRA 1GKGA 3N3FA 4IBCA 4C16A 4DJZA 1E5GA 1U5MA 2BZMA 3L2AA 1E6PA 1EAKA 1E15A 4NZ4A 3R62A 5HYUB 1QO6A 1LY2A 1PDCA 1UOTP 4OUIA 1L6JA 3L25A 1CXWA 1Z92B 4J38B 4YNXA 4APLA 3L28A 4MB4A 2MCYA 4OJ6A 4KKDA 4MUCA 1OK3A 1CK7A 3CALA 3KXVA 1G4FA 2V8EA 1E6RA 3L26A 1OK9A 2O39C 2XRDA 2X2ZA 1GHQB 2ERJA 4IBIA 4OJ5A 4OJLA 2YBYA 3L89M 2W81A 1W1YA 1Q3XA 3TVJA 1G4GA 2Y2HA 1GPZA 3K3TA 3ZLEA 1OJWA 4F4OC 1UR8A 4IBFA 2XD1A 1H2PP 2Y8TA 4A5WB 1UR9A 1HCCA 2A55A 3F6KA 4ZH1D 1GXDA 4NY2A 1SS2A 3OP8A 4Z2HA 1E88A 4NYYA 2KMSA 2CG6A 1TPMA 3IX0A 4WJG2 3ZLDA 4GH9A 2Y2QA 2D49A 4LOSA 4IBJA 4MB3A 4HMDA 4TX8A 3WD3A 1H2QP 3FGRA 4PO7A 2XQWC 5HYTB 1GOIA 2Y2JA 2XWBF 3WD2A 3HSHA 4HMEA 2CG7A 2IZ3A 3O8EB 3M7PA 2IZ4A 2ZYCA 1W1VA 4LOTA 3WSYA 3WD4A 4IJEA 4Z2KA 3WD1A 4LG2A 1W1PA 4IGDA 4YIZA 2FFFB 1OGGA 3IU3I 2Y2MA 4CSYA 1H0GA 2UWNA 2EHFA 3HONA 1MD8A 4NYUA 4OJPA 2XD5A 4NZ5A 1E8BA 1CKLA 3FGTA 4IJFA 4GHAA 3GOVA 5HZPB 4NZ3A 3SW0X 4Z2JA 2XRBA 1O6IA 4QNLA 3T5OA 2Y2NA
chains in the Genus database with same CATH topology
2EC3A 1C1ZA 1O9AA 1TPGA 2JGWA 1HFIA 4K12A 5JPMG 3ERBA 1VVCA 1OJYA 1GKNA 1H04P 4AYDA 2RKZA 5I0QB 1QGBA 2LOJA 3GXEA 4FXGG 5FO8C 3ZD1A 1KS0A 4B2SA 4AYEA 3MQLA 2W80A 1TPNA 1H8PA 2RKYA 3ZRZA 3INBC 5HYPA 4B2RA 2WIIC 1OK1A 2G7IA 3EJHA 4AYMA 1OJVA 2YRAA 2RLQA 2RL0A 2KRIA 2B5ID 2FN2A 2MCZA 2JGXA 1SRZA 4PZ5A 2RLPA 3KZJA 2V5OA 3NFPI 1PPQA 4AYIA 1J7MA 4ONTD 1OK2A 1QUBA 1MD7A 3ZD2A 1NWVA 1ELVA 2QY0A 2XWJI 2CKUA 3RJ3D 1H03P 1ZJKA 3OEDC 3OXUD 1HFHA 2JRAA 4JHSA 1FBRA 1GKGA 4DJZA 4C16A 1E5GA 1U5MA 2BZMA 1EAKA 3R62A 5HYUB 1QO6A 1LY2A 1PDCA 1UOTP 1Z92B 1L6JA 4YNXA 1CXWA 4J38B 2MCYA 4KKDA 4MUCA 1OK3A 1CK7A 3CALA 3KXVA 1G4FA 2V8EA 1OK9A 2O39C 2XRDA 1GHQB 2ERJA 2YBYA 3L89M 2W81A 1Q3XA 3TVJA 1G4GA 1GPZA 4F4OC 1OJWA 1H2PP 4A5WB 1HCCA 2A55A 4ZH1D 1GXDA 1SS2A 3OP8A 1E88A 2KMSA 4WJG2 2CG6A 1TPMA 3IX0A 4LOSA 1H2QP 2XQWC 5HYTB 2XWBF 2CG7A 2IZ3A 3O8EB 3M7PA 2IZ4A 4LOTA 4IGDA 3IU3I 4CSYA 2UWNA 2EHFA 1MD8A 1E8BA 1CKLA 3GOVA 5HZPB 3SW0X 2XRBA 3T5OA 1VVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EC3 A;  1C1Z A;  1O9A A;  1TPG A;  2JGW A;  1HFI A;  4K12 A;  5JPM G;  3ERB A;  1VVC A;  1OJY A;  1GKN A;  1H04 P;  4AYD A;  2RKZ A;  5I0Q B;  1QGB A;  2LOJ A;  3GXE A;  4FXG G;  5FO8 C;  3ZD1 A;  1KS0 A;  4B2S A;  4AYE A;  3MQL A;  2W80 A;  1TPN A;  1H8P A;  2RKY A;  3ZRZ A;  3INB C;  5HYP A;  4B2R A;  2WII C;  1OK1 A;  2G7I A;  3EJH A;  4AYM A;  1OJV A;  2YRA A;  2RLQ A;  2RL0 A;  2KRI A;  2B5I D;  2FN2 A;  2MCZ A;  2JGX A;  1SRZ A;  4PZ5 A;  2RLP A;  3KZJ A;  2V5O A;  3NFP I;  1PPQ A;  4AYI A;  1J7M A;  4ONT D;  1OK2 A;  1QUB A;  1MD7 A;  3ZD2 A;  1NWV A;  1ELV A;  2QY0 A;  2XWJ I;  2CKU A;  3RJ3 D;  1H03 P;  1ZJK A;  3OED C;  3OXU D;  1HFH A;  2JRA A;  4JHS A;  1FBR A;  1GKG A;  4DJZ A;  4C16 A;  1E5G A;  1U5M A;  2BZM A;  1EAK A;  3R62 A;  5HYU B;  1QO6 A;  1LY2 A;  1PDC A;  1UOT P;  1Z92 B;  1L6J A;  4YNX A;  1CXW A;  4J38 B;  2MCY A;  4KKD A;  4MUC A;  1OK3 A;  1CK7 A;  3CAL A;  3KXV A;  1G4F A;  2V8E A;  1OK9 A;  2O39 C;  2XRD A;  1GHQ B;  2ERJ A;  2YBY A;  3L89 M;  2W81 A;  1Q3X A;  3TVJ A;  1G4G A;  1GPZ A;  4F4O C;  1OJW A;  1H2P P;  4A5W B;  1HCC A;  2A55 A;  4ZH1 D;  1GXD A;  1SS2 A;  3OP8 A;  1E88 A;  2KMS A;  4WJG 2;  2CG6 A;  1TPM A;  3IX0 A;  4LOS A;  1H2Q P;  2XQW C;  5HYT B;  2XWB F;  2CG7 A;  2IZ3 A;  3O8E B;  3M7P A;  2IZ4 A;  4LOT A;  4IGD A;  3IU3 I;  4CSY A;  2UWN A;  2EHF A;  1MD8 A;  1E8B A;  1CKL A;  3GOV A;  5HZP B;  3SW0 X;  2XRB A;  3T5O A;  1VVD A; 
#chains in the Genus database with same CATH topology
 2EC3 A;  1C1Z A;  1ED7 A;  1O9A A;  4GHL A;  1TPG A;  1HFI A;  2Y2I A;  2JGW A;  4K12 A;  5JPM G;  4BWC A;  3ERB A;  1VVC A;  2Y8S A;  2Y2O A;  1AIW A;  1OJY A;  1H04 P;  1VVD A;  5DN5 A;  1GKN A;  1E6N A;  4AYD A;  2RKZ A;  5I0Q B;  1QGB A;  1W1T A;  2LOJ A;  3GXE A;  4FXG G;  3WD0 A;  5FO8 C;  1GPF A;  4IBE A;  4Z2I A;  3CI0 J;  1KS0 A;  2Y8R A;  3ZD1 A;  4NZ1 A;  4B2S A;  4Z2G A;  4AYE A;  3MQL A;  2W80 A;  1TPN A;  1H8P A;  4Z2L A;  4IBD A;  1OGB A;  1YU3 A;  2RKY A;  3ZRZ A;  3INB C;  5HYP A;  4B2R A;  2WII C;  1OK1 A;  2G7I A;  1YU2 A;  3FKE A;  3EJH A;  4AYM A;  1YU1 A;  4MSL A;  3WSX A;  1OJV A;  2YRA A;  4HMC A;  2RLQ A;  2RL0 A;  2KRI A;  4N7E A;  2UWX A;  1RLH A;  2B5I D;  2FN2 A;  2MCZ A;  2JGX A;  2Y2G A;  2Y2P A;  3NJA A;  1YU0 A;  1SRZ A;  4PZ5 A;  2RLP A;  2I2L A;  2IOU A;  4OJO A;  1YU4 A;  3KZJ A;  3WX7 A;  2V5O A;  2Y2L A;  5BPV A;  3KS8 A;  1PPQ A;  3NFP I;  3VWO A;  4AYI A;  1J7M A;  1E6Z A;  3L29 A;  4IBG A;  2JCH A;  5DN4 A;  4ONT D;  1OK2 A;  1QUB A;  2Y2K A;  1MD7 A;  3ZD2 A;  1NWV A;  1ELV A;  2QY0 A;  2BG1 A;  4IBK A;  2XWJ I;  3KS4 A;  4IBB A;  2CKU A;  3RJ3 D;  1YUE A;  3L27 A;  1H03 P;  1ZJK A;  3OED C;  2RTS A;  4MB5 A;  2JE5 A;  3OXU D;  1HFH A;  2JRA A;  4JHS A;  1H0I A;  1FBR A;  1GKG A;  3N3F A;  4IBC A;  4C16 A;  4DJZ A;  1E5G A;  1U5M A;  2BZM A;  3L2A A;  1E6P A;  1EAK A;  1E15 A;  4NZ4 A;  3R62 A;  5HYU B;  1QO6 A;  1LY2 A;  1PDC A;  1UOT P;  4OUI A;  1L6J A;  3L25 A;  1CXW A;  1Z92 B;  4J38 B;  4YNX A;  4APL A;  3L28 A;  4MB4 A;  2MCY A;  4OJ6 A;  4KKD A;  4MUC A;  1OK3 A;  1CK7 A;  3CAL A;  3KXV A;  1G4F A;  2V8E A;  1E6R A;  3L26 A;  1OK9 A;  2O39 C;  2XRD A;  2X2Z A;  1GHQ B;  2ERJ A;  4IBI A;  4OJ5 A;  4OJL A;  2YBY A;  3L89 M;  2W81 A;  1W1Y A;  1Q3X A;  3TVJ A;  1G4G A;  2Y2H A;  1GPZ A;  3K3T A;  3ZLE A;  1OJW A;  4F4O C;  1UR8 A;  4IBF A;  2XD1 A;  1H2P P;  2Y8T A;  4A5W B;  1UR9 A;  1HCC A;  2A55 A;  3F6K A;  4ZH1 D;  1GXD A;  4NY2 A;  1SS2 A;  3OP8 A;  4Z2H A;  1E88 A;  4NYY A;  2KMS A;  2CG6 A;  1TPM A;  3IX0 A;  4WJG 2;  3ZLD A;  4GH9 A;  2Y2Q A;  2D49 A;  4LOS A;  4IBJ A;  4MB3 A;  4HMD A;  4TX8 A;  3WD3 A;  1H2Q P;  3FGR A;  4PO7 A;  2XQW C;  5HYT B;  1GOI A;  2Y2J A;  2XWB F;  3WD2 A;  3HSH A;  4HME A;  2CG7 A;  2IZ3 A;  3O8E B;  3M7P A;  2IZ4 A;  2ZYC A;  1W1V A;  4LOT A;  3WSY A;  3WD4 A;  4IJE A;  4Z2K A;  3WD1 A;  4LG2 A;  1W1P A;  4IGD A;  4YIZ A;  2FFF B;  1OGG A;  3IU3 I;  2Y2M A;  4CSY A;  1H0G A;  2UWN A;  2EHF A;  3HON A;  1MD8 A;  4NYU A;  4OJP A;  2XD5 A;  4NZ5 A;  1E8B A;  1CKL A;  3FGT A;  4IJF A;  4GHA A;  3GOV A;  5HZP B;  4NZ3 A;  3SW0 X;  4Z2J A;  2XRB A;  1O6I A;  4QNL A;  3T5O A;  2Y2N A; 
#chains in the Genus database with same CATH homology
 2EC3 A;  1C1Z A;  1O9A A;  1TPG A;  2JGW A;  1HFI A;  4K12 A;  5JPM G;  3ERB A;  1VVC A;  1OJY A;  1GKN A;  1H04 P;  4AYD A;  2RKZ A;  5I0Q B;  1QGB A;  2LOJ A;  3GXE A;  4FXG G;  5FO8 C;  3ZD1 A;  1KS0 A;  4B2S A;  4AYE A;  3MQL A;  2W80 A;  1TPN A;  1H8P A;  2RKY A;  3ZRZ A;  3INB C;  5HYP A;  4B2R A;  2WII C;  1OK1 A;  2G7I A;  3EJH A;  4AYM A;  1OJV A;  2YRA A;  2RLQ A;  2RL0 A;  2KRI A;  2B5I D;  2FN2 A;  2MCZ A;  2JGX A;  1SRZ A;  4PZ5 A;  2RLP A;  3KZJ A;  2V5O A;  3NFP I;  1PPQ A;  4AYI A;  1J7M A;  4ONT D;  1OK2 A;  1QUB A;  1MD7 A;  3ZD2 A;  1NWV A;  1ELV A;  2QY0 A;  2XWJ I;  2CKU A;  3RJ3 D;  1H03 P;  1ZJK A;  3OED C;  3OXU D;  1HFH A;  2JRA A;  4JHS A;  1FBR A;  1GKG A;  4DJZ A;  4C16 A;  1E5G A;  1U5M A;  2BZM A;  1EAK A;  3R62 A;  5HYU B;  1QO6 A;  1LY2 A;  1PDC A;  1UOT P;  1Z92 B;  1L6J A;  4YNX A;  1CXW A;  4J38 B;  2MCY A;  4KKD A;  4MUC A;  1OK3 A;  1CK7 A;  3CAL A;  3KXV A;  1G4F A;  2V8E A;  1OK9 A;  2O39 C;  2XRD A;  1GHQ B;  2ERJ A;  2YBY A;  3L89 M;  2W81 A;  1Q3X A;  3TVJ A;  1G4G A;  1GPZ A;  4F4O C;  1OJW A;  1H2P P;  4A5W B;  1HCC A;  2A55 A;  4ZH1 D;  1GXD A;  1SS2 A;  3OP8 A;  1E88 A;  2KMS A;  4WJG 2;  2CG6 A;  1TPM A;  3IX0 A;  4LOS A;  1H2Q P;  2XQW C;  5HYT B;  2XWB F;  2CG7 A;  2IZ3 A;  3O8E B;  3M7P A;  2IZ4 A;  4LOT A;  4IGD A;  3IU3 I;  4CSY A;  2UWN A;  2EHF A;  1MD8 A;  1E8B A;  1CKL A;  3GOV A;  5HZP B;  3SW0 X;  2XRB A;  3T5O A;  1VVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...