1QOBA

Ferredoxin mutation d62k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSKQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qobA00
4YTMB 4YXDB 2CU3A 1FIQA 1ROEA 1WXQA 3LXFA 1FO4A 1ZOYB 4ZHPA 2OHFA 5EE3A 4C7ZA 1E9MA 1J7BA 3ETRA 3AEFB 5G5HA 1DOIA 1I7HA 3NVVA 3AECB 1YQ3B 1YQ4B 1QOFA 2BS4B 2H89B 4YSYB 1OQRA 1PUTA 1AWDA 1N5XA 3W5UB 3NRZA 2M19A 1QOAA 3VR9B 1GPXA 3BIID 4YSZB 1NVID 3SFEB 1RFKA 1AYFA 1YJIA 2MJ3A 1TKYA 2L83A 4YSXB 3P4SB 1E10A 4ZHOA 1NYRA 2K5PA 2FBWB 1JW9D 3RPFC 1TKEA 4IDIA 2HTME 5EE1A 1JQ4A 3DWMA 2EKIA 4C7YA 1FM0D 1NEKB 2PKOA 1XLOA 1FFUA 1FFVA 5C2TB 4FXCA 1CZPA 1TJEA 3AB5A 2W3SA 1DOXA 3AM9A 1NYQA 1FRDA 2MJEA 2Y5CA 1E7PB 1N63A 2WDRB 3CIRB 1XLNA 3P1MA 2BS2B 1F0ZA 3L4PA 1V8CA 3AMZA 2PIAA 3AH7A 3FAHA 2K9XA 5EE9A 2LEKA 4JX1C 1E0ZA 1DOYA 1JRPA 3AEBB 2QIEB 2W55A 1JWAD 3VRAB 1FXAA 1L6UA 2PVGC 3P4PB 1ZP0B 1V97A 4C80A 2KAJA 2CJNA 1OQQA 1L6VA 1R7SA 2B76B 1L0VB 3LB8C 3KWLA 1PDXA 3NVYA 1N60A 2M56B 5MPOA 4US9A 1RYJA 4JWUC 5H8YE 3AE6B 4N6EB 3P4RB 1SB3C 3AV8A 1N61A 3WCQA 1NI3A 1KRHA 1XLQA 1J7CA 2AX5A 1NENB 2BS3B 4YT0B 4ITKA 1L5PA 1N5WA 3W5VB 3NVWA 1B9RA 4LTUA 3SFDB 1YJJA 2WDVB 1KF6B 2QJLA 2E3TA 1GAQB 3AE5B 4P6VF 2JQRB 4A9AA 2DWQA 4WWMA 2PVOD 3AEGB 1WYGA 3PO0A 4JWSC 5AUIA 4US8A 2Q5WD 1JALA 5GXGB 3AE8B 3DWGC 4YTNB 3EUB2 1WRIA 2H88B 3AEEB 2ACZB 3AE3B 1QOGA 1TKGA 1ZUD2 1SF0A 5H92C 1RWSA 1J7AA 1XLPA 1E6EB 3VR8B 2W3RA 3AEAB 2WP9B 3B2GA 1XO3A 2WLBA 3HVZA 1PFDA 1JROA 1KFYB 3AN1A 3P4QB 1FMAD 1WWTA 1T3QA 2K22A 1IUEA 1FXIA 1A70A 1EWYC 1QT9A 2DBYA 1CJEA 4USAA 4ZOHC 5EE0A 1FRRA 1TYGB 1WGKA 1JWBD 5AUKA 1OFFA 3AEDB 3P63A 1QLBB 4N58A 3ZYYX 2G1EA 2CJOA 3B2FA 3VRBB 3FC4A 4HRSA 2WDQB 1VLBA 1QF6A 2L52A 3AE1B 3SR6A 1N62A 1VDVA 1DGJA 4YTPB 5C3JB 3AE7B 2KMMA 1QOBA 1RM6C 3ABVB 2MJDA 2W54A 4WQMA 2WU5B 2JX5A 2WQYB 3AE4B 3AE9B 1UWMA 2WS3B 3HRDD 3NVZA 4HROA 3AE2B 4KX6B 2N0SB 2WU2B 4N59A 1VJKA 1SIJA 3HUIA 2MH7A 5G5GA 3NS1A 2BT6A 3CWIA 1ZXIA 3W9CB 3B9JA
chains in the Genus database with same CATH superfamily
2HTHA 4HK2A 1OEYJ 4B0MA 1BXTA 3ZNZB 1TGZB 1WM2A 2KJRA 1I7HA 3NVVA 1IP9A 2DZMA 2O6VB 4YSYB 2PLPA 2KQ4X 4EOYA 3QARA 4J6IA 3SHQA 2WNMA 1PGAA 3DHIC 2Z8LA 4GDKA 3RPFC 1NBFC 2VZKB 4ANXA 3R8BA 2JU6X 3RT3B 3IFWB 4HXDA 4MGZE 2MJEA 5E6OA 4N9F4 3H8HA 3QA8A 4TKNA 4KDIC 1VZ6A 3R3MA 1PDXA 4US9A 4N6EB 2JPHA 2MRPA 2MHJA 1GNUA 2M17A 2WX0A 1GAQB 2M0XA 2NCNA 2LJ5A 4KDLB 4MGIE 4GOCA 3QWZB 3AE3B 2N7EA 3BVMA 5JZEB 3TBLD 3KUCB 1IUEA 2X8XX 1J19A 2C7HA 4FA6A 2MX2A 4NAWB 5J18A 1D3ZA 4OZAA 3D32A 1R4MI 3B0AA 3AE1B 1N62A 3OWEB 1C78A 2LMCA 5IKCM 2JZ3B 4JE3B 4GDLB 1J7BA 3QQ8B 4RF1A 4XWTA 4KSLC 2XEWA 1OQRA 2TSSA 1UGMA 1ZXHA 4PS3A 1WIAA 4YSXB 3MHSD 2FBWB 2N7JA 3L17A 4A3OA 1HEZE 4PYUA 4C7YA 1D5XC 1QILA 4WIPA 5LXIB 1XLOA 3PTFC 5I4DA 4NJ7A 4MH8A 3FILA 4OVZA 2FCNA 1UBQA 4ZRJA 3PSEB 1GC7A 1TZOA 3RD2A 2SEBD 1IBXB 2KWDA 4MT5A 4BFRA 3AE6B 1HTOA 1XCTL 3X0WA 1F9JA 1N5WA 3RMKC 3BVZA 1GOZA 2E3TA 3DPDA 2KX0A 3X23A 5GXGB 3O13A 2IO2B 3M95A 2KX3A 1ZUD2 2KDBA 2EMSA 1UUPA 3Q8CA 2INPE 4B6WA 1T3QA 4MACA 2WXHA 3RYTA 4RGMA 4NJ6A 2BB6A 3IAS1 3WAMA 1VD2A 5JHBA 2KLGA 2OEDA 3A4RA 2CJOA 2IGGA 1XCQL 1VDVA 3RZFA 4KX6B 1T0RC 1QQRA 1YN4A 3DBHI 3VUYA 1TTNA 4RGNA 2LD9A 5IN7A 3VDZA 1ZOYB 2JUOA 2CKHB 1V2YA 2DYMA 4XWWA 3UIPB 1YQ4B 2QC8A 5D3DA 1AWDA 4I6NB 1T0YA 1WXAA 1IBXA 5LXHA 2UWQA 3PRPB 4IDIA 3DWMA 4XDDA 3NZUA 2RGFA 1FFUA 4AUQC 3Q3NC 2RPQA 2YEPB 4W9FA 3U7DA 1FNUA 3Q3FA 4G3XB 2CS4A 4FADA 4RM8A 3SU8X 2V4IB 1F0ZA 1LO5D 2LEKA 4XYCA 1V5TA 1ZP0B 2JXTA 1OQQA 2GMIC 4TQ0A 1H8CA 5JXVA 1I4XA 5E6PA 3ZW3A 3Q3JA 3WCQA 1WSPA 3RNAC 1J7CA 3DVNU 2LGXA 3M62B 2WXOA 3B1LX 4P6VF 2KDEB 4NJCA 3VUXA 3Q8EA 4PS7A 1KTKA 3UF8A 4E74A 2NTSA 4QAYA 1KLUD 1TKGA 1SGHA 3Q3OC 1SF0A 1RWSA 1E6EB 4C00A 2K1FA 2LHEA 1V86A 2LUEA 4PT5A 2QHOA 3AN1A 3BK2A 4FJZA 1L0XB 2IYDB 1WMHB 2RR9A 2GRIA 1R4NB 1C77A 3W1YA 1K51A 3I3TB 2NPTA 1CK1A 1DGJA 1P9DU 2WU2B 3EC8A 3HUIA 3NS1A 3ONSA 2L32A 2CU3A 2Z0DB 2ZVOA 3BINA 5BO4B 1E8ZA 2O2VA 5G5HA 2ZPYA 3AECB 3BWUD 3N1XC 1WFYA 3WANA 1PUTA 1N5XA 1QOAA 1NVID 2ZPNA 2J52A 2L3ZA 3A9KB 1DYQA 2ICIA 1FCLA 1NEKB 2PKOA 1FPYA 3DDCB 5IA7A 1P0RA 1ACCA 4JX1C 4XX5A 1ZKHA 4W9IA 4KGSA 2KAJA 3UI3A 4W9JA 1MG8A 3HHMA 2G4SA 1UD7A 4W9KA 2BF8B 4LDTD 4ZYSA 3GE3C 4W9DA 3ZJVA 3RFZB 3SD5A 4MEMA 4JWSC 2KDIA 2PE9A 2N4FA 1EU4A 3P42A 1BMLC 2ZNVC 1PGXA 2K8HA 3GZNB 2KTRB 1XQQA 3V61A 3MC8A 2LGDA 1JROA 2D3AA 3IBEA 3HIZA 3L16A 2KD0A 2IO1B 3DBLB 5BYSA 2NBUA 2XK5A 2ZCCA 4WWNA 2XN9C 1I4RA 4TSSA 2JWZA 2KC2A 3EFCA 2AYOB 4JLCA 1BUIC 2WXMA 4AOFA 1T0SC 2KMAA 3A9KA 1Q5WB 3JVZX 4F7ZA 3Q8AA 1L0YB 4C7ZA 2Z59B 3GE8C 2ZZPB 3E56A 1T5XD 2KWVB 2J0JA 2A4ZA 2N9EB 5TSSA 1T0QC 4LNOA 1YJIA 4KZ0A 3H6NA 5C1ZA 2K5PA 2QSDA 1SE3A 1JQ4A 2RMMA 3HM3A 5D3IB 4W9EA 2KDMA 5C2TB 1K8RB 1YMHE 1V81A 3ENEA 3VUWA 1N63A 4J3OD 3VQIA 1E0ZA 2KTRA 2MQJA 1FXAA 1SE2A 4C80A 2B76B 4A6QA 1VCBA 3BVGA 4BKGA 3AV8A 3BZDB 1K52A 3LYYA 2BS3B 4NY0A 3SFDB 3QC8B 2MBEA 3NZ3A 1YN3A 4KGTA 4NZLB 3LJ3A 3H7PB 4MGKE 3EHVA 3AEEB 5HHDG 3K9PB 1IGDA 2D3BA 2RPVA 1XT9B 1PFDA 3P4QB 1WWTA 3VXWA 2VZKD 4HPPA 1A70A 3DBRI 3TCAA 1J8CA 3AEDB 3P63A 1VRAB 1YNTE 2MSED 3U8ZA 2N9XA 3WAOA 3R66C 4URKA 2MJDA 3DBSA 2WU5B 2G9HD 2VRRB 1MPEA 2FE8A 3W9CB 4YTMB 2R61A 1EO6A 3HK0A 4P1CC 1MHXA 2WXQA 2RDBC 1FNVA 1F52A 3A1QB 1ZDXA 2C9WB 3EA6A 4CHKA 3V6EB 2K0PA 2DAJA 5LNK1 3ZUNA 1WJ4A 4IWPA 5AEKB 2L83A 4I6PA 1UNSA 1E10A 1MJDA 1ZE3D 3AXCA 2EKIA 2FNJB 2LGIA 4NQLB 1Q0WB 4UDUC 2BW2A 1E5WA 4FLHA 1DOYA 3PZDA 1H4RA 3TJPA 2AL6A 2KZRA 2JF5A 4BKSA 1R7SA 2YLMA 1V49A 3KWLA 2J4XA 4S0RA 4JWUC 1JCKB 1IYFA 4CYEA 2BB5A 2IY1B 4HDOA 1B9RA 3VAWA 1HA5A 1JALA 4DWFA 1WZ0A 2C7NB 2BYEA 1WRIA 2K8BA 1V5OA 3W1SA 2MBHA 3V60A 3QHTA 2PEAA 1I4HA 3L13A 1WXSA 3PHXB 2KTFA 2N7DA 2IBIB 3RUIB 4YL8A 4OZCA 2JZPA 2BVCA 2PJHA 2PMVA 2WDQB 3ZDTA 1YX5B 5C3JB 2DAFA 3AE4B 2JX5A 3PRMB 3ZJTA 2N1VA 1MVKA 2IZVB 5G2NA 2D07B 2C60A 2LJIA 1YIWA 3C0RB 4LLGM 2LUMA 1UH6A 1WE6A 3BY4B 2PW9A 4ICUA 2LXAA 4X57B 5CHWA 2O6VA 4LNFA 3CSFA 3AU5A 4HKQA 4A8XC 1V6EA 2GLSA 1NYRA 1AN8A 4Q2JA 4REZA 3ZNGC 2XNAC 4G0NB 3T3OA 3MC0B 2JWUA 1FFVA 1RFAA 2FUG1 3W1SC 2KWCA 3RNCC 4JIOU 1LM8B 3CIRB 1IPGA 1FNWA 3L0WB 4HPLB 2EELA 3H7SA 4GLSC 2GBMA 4GB9A 3GB1A 3LB8C 1C4CA 1G6JA 1BT0A 5MPOA 1N60A 1RYJA 2LWPA 4O1NA 4DHZE 1TS5A 3SDLC 4EUTA 2X38A 4WAFA 4LTUA 3N32A 5DCNA 2J53A 2V3SA 1FCCC 4AQ7A 1WXVA 2Y3AA 3EECA 3KW5B 3EUB2 4BKTA 2BYVE 2Y5PA 2A5UA 3ZXVA 2AQ3B 2KJ6A 2W3RA 2KKCA 3ZQ4A 3U2SC 3ZTDA 1FXIA 4IKGA 1C79A 1EWYC 2CHXA 3I57A 1S1QB 3K9OB 1WGKA 4K1RB 2JRIB 2BWES 5AZFA 3OAWA 4NAWA 2KFKB 2Z0EB 2M1MA 1Z5SB 4LK0M 3VRBB 3FC4A 1R4NI 2L1AA 2L52A 3GOEA 4DHJB 2J42A 1RM6C 3PGEA 2KVZA 2YEPF 4II3B 2BTEA 3AE2B 1QKZA 4N59A 3ZGZA 4YXDB 3TEXA 2C5LC 5CX3A 3H1UA 1L4ZB 2QEJC 1P3QU 4WJNA 4KSKC 1E9MA 4GDLA 1P1AA 1WRDB 1S3SG 2WXJA 4EE2A 2IO0B 1M94A 5CHFA 2BYFA 1PYWD 1YJ1A 2WXFA 1HQRD 1MG4A 5BMIA 1EF1A 3PLVA 3ZIMA 2LRWA 4MSMB 2HE7A 3N1ZC 2BPSA 2MP2B 1FRDA 1E7PB 1SE4A 4B95A 2MBBB 3N1YC 4HCNB 2PIAA 5E6NA 1WY8A 2M0AA 4ACFA 2W55A 4L1BA 2PVGC 1L0VB 2MA9B 1STEA 3NS8A 3NVYA 2KHWB 4TV3A 4ARCA 1NENB 1GUAB 3I63C 3PT2B 2GOWA 2BWFA 1YJJA 4WWPA 1WGHA 4XE0A 5D6JB 4MJSB 4WAAA 2MLBA 4WJQA 5C23A 1N6ZA 4P7IA 3WAPA 3QX1A 2ACZB 3RNFC 1I4QA 3J9CA 1SEBD 1XLPA 3TSSA 2EMTA 1C76A 1V1PB 3ZXRA 2WP9B 3ZTCA 3GZNI 4ZRQA 4IM0A 1FMAD 1QZEA 4AP4C 2DBYA 1QT9A 2WHIA 3TUOA 2KLCA 4M8MA 2OJWA 2ZVNA 3R7QA 4FULA 1WX8A 3T8MA 2WXKA 3PPAA 3DQVA 5FK9C 3V62A 1GG3A 1QOBA 1EUVB 2KMMA 3P2BA 3AE9B 1VR9A 1UWMA 4IW0A 1FXTB 2WGSA 2CU1A 1RRBA 1AW7A 4IWOA 2DNFA 2OHFA 5EE3A 4KVGB 3QJZA 4ANWA 1DOIA 4TUUA 2KMCA 3NRZA 1WGRA 3LDZE 3VR9B 1EU3A 3Q69A 5KHQA 3SFEB 2K3UA 2JZZA 3QAQA 5FR6A 1TKYA 3UGBB 3P4SB 4IWQA 4HEA1 1TKEA 3DVNV 2N9PC 4NAMA 3ML8A 4H2AA 3APFA 4S17A 4C4VB 1TJEA 3NY5A 3KLSX 3ZNID 1NYQA 4K3CA 3C8YA 4E71A 2QDFA 1XD3B 3VRAB 1YOVB 2L00B 2DHZA 1C4PA 2INDC 2DYOA 1L4DB 2BKRB 2J7QB 3URYA 4P16A 2HJ1A 1KRHA 4M01A 4JL9A 4GN1A 1Z2MA 4XC2A 4BOZB 4MM3B 2PVOD 4MSQB 1Q1OA 1J0GA 3DBHB 4BOSC 3DVGY 5DPRA 1ET6A 4NQKE 3VFKA 4IM3A 2IGHA 4FJYA 3VR8B 1XEEA 4A3PA 2I1JA 2JYTA 1WMHA 3MFGA 1TT5B 4RH6A 4MELA 1TIFA 3PZ7A 1QLBB 4N58A 2K25A 4DBGA 5JHAA 1GB1A 4ZRPA 1TZ1A 4RM9A 4HRSA 1UWXA 1CQVA 3NG0A 2D11A 2LI5A 3MC9A 2FCMA 3NVZA 2MW5A 3HRDD 3DCGA 1VJKA 4CO7A 3Q2AC 1WJ6A 3MTNB 2NTTA 4RGTA 2GI9A 1WX9A 4AWJA 4D2KA 1SSNA 3TEWA 2LHDA 4K3BA 4HJKA 3VH3B 1MI0A 1MHHE 2BS4B 2WDTB 4FJVB 1E8WA 3MJ5A 4BKSD 1TY2A 2AQ1B 4IM2A 1EM7A 1TY0A 2D3GA 2V4LA 1MFWA 2JT4B 5IOIA 5IP4D 1JWMD 3AM9A 3RNEC 4DXGA 4BBNF 1LQBA 3DHGC 4KKJA 1E8YA 4KV2A 2JRHA 2ZCBA 4M8NA 4WURA 3AI5A 3P4RB 2IY0B 4K7SA 1NI3A 1XLQA 1WGGA 4P1BC 1OEYA 4EZLA 4PK1A 3OG5A 4XZ4A 4K81A 2QJLA 4LJOB 1K50A 2LXCA 3DHHC 3PO0A 5E6JA 3AE8B 4ZYNA 4M02A 2H88B 3CMMB 1P98A 3BYYB 2KNBA 3JSVB 1J7AA 3ALBA 2V1YA 2WLBA 3HVZA 4KIKB 2LVQA 2NMQA 4LDTB 4EZKA 1F77A 4GMVA 4RNAA 4HKZE 4WH4A 3C19A 2V0GA 4HJGE 5AUKA 1UF0A 2J0KA 2DYBA 2XBBC 2M8SA 1UBIA 2QMTA 3RNBC 4BZAA 1JRUA 3QCAA 1VLBA 2JVCA 1V80A 2O6VD 1D6EC 3PZ8A 4WQMA 1F2RI 2N0SB 2NS5A 5G5GA 2JY6A 2G3QB 3MJWA 4M0WB 4ZHPA 3OJ3A 3ECIA 2WXGA 3Q6BA 3NJTA 1LFDA 2K8CA 3Q8FA 4G11A 1D5ZC 2VH1A 1WGDA 4YSZB 1RFKA 5FR3A 1VZ7A 4I6LB 4GDKB 1JW9D 1CMXB 2HTME 5EE1A 3RI7C 4HDQA 3WIMA 3RN9C 4DDGD 2D10A 5CTRC 3VTWA 1SJHD 1UGJA 1WR6E 2UU7A 3OLMD 4K7WA 5CHVC 3Q8BA 1JWAD 1L6UA 3SEBA 2CHZA 3OJ4B 1E7VA 4KKIA 1KLVA 2L8JA 4R3DA 4A90A 1HXYD 1N61A 2WYQA 2JYEA 5BYRA 5T8IA 2NBWB 4ITKA 4EKUA 1WM3A 4LNKA 1WYGA 2KK8A 3H7PA 3NOBA 1KLGD 4LJPB 4MDKE 4JQWC 3S2AA 4HCPB 2IPKD 4OZBA 3TIXA 3R7RA 4M0WA 5EE0A 3V6CB 4LCDE 5EDSA 1JWBD 1WJNA 3W2DA 1HZ5A 1UELA 2G1EA 2KACA 3B2FA 3PLUA 1KJTA 2MCNB 3I5JC 4II2B 4OVUA 3AE7B 5DPTA 3ABVB 2LASA 2LGSA 3T9LA 2WS3B 3APCA 1SIJA 1F1HA 2PTLA 2K22A 1X1MA 2LRUA 1KOTA 3VTVA 5BMHA 2W9NA 2WXIA 3B08A 5BMGA 4L2YA 3A1QA 3ETRA 5JH5C 2AL3A 5AZGA 4AJWA 2FAZA 4L23A 1YQ3B 3T3NA 1QOFA 3ZDMC 4W9HA 1V1OA 1RAXA 1WZ3A 1C9FA 3N3KB 4IC7B 3A4SC 5DPSA 2KDFB 2R2OA 1ZGUB 3PHWB 4FXCA 3AB5A 3IXSA 3FILB 4BBNC 1EWCA 2Y5CA 2WDRB 1EF5A 1ESFA 2K6QA 4RGOS 1C1YB 1JRPA 3ZO5B 4DHJD 5D2MB 3JW0X 1P7FA 2V9HA 4XGAB 4WJOA 1TS3A 3DBRB 2I38A 3IVFA 4GXBA 4YT0B 2OOBB 2JQRB 3UQBA 2INCC 5AUIA 3AEGB 1V9JA 2Q5WD 4YTNB 2B3AA 1YN5A 1HZ6A 4JPSA 2RSUA 2SAKA 5H92C 5HKHA 3AEAB 1XO3A 1WJUA 2ON8A 3IT4B 3ZNHB 1SXTA 2GBJA 3N9YC 3GS2A 1TS4A 4E3CA 4OW0A 1CJEA 1FRRA 3AU4A 3R2TA 1B1ZA 2KQSA 3U4EG 1L2NA 3ZYYX 1I4PA 2FCQA 2LGYA 3FKYA 4RF0A 5IAAC 2ZEQA 4YTPB 3UQAA 1Q10A 2DENB 3H9DA 4GSWA 2KQ7A 1ENFA 1ZXIA 2IO3B 1FO4A 3VTUA 4A55A 5D7GA 5HI1A 2LZ6A 3PVLA 2AQ2B 3HVDA 2D5GA 1XXGA 2MEKA 1GPXA 4HVBA 3PS6A 3QK0A 3KYCD 4WJPA 1WE7A 3PRZA 4AJYB 1FM0D 3U7ZA 5HG2A 1VZ8A 3I9V1 3EGRA 2W3SA 2AWTA 1ISNA 2BYTA 1XLNA 1HE8A 4ASWC 4DQOC 3L4PA 5EE9A 4GIVA 4KGRA 3V05A 4BVUC 3P4PB 2IGDA 2I2YA 2Y5BB 2CJNA 3N30A 3WA0A 4HPMB 3NZSA 1F2RC 4W9GA 1YQBA 2IDYA 3M3JA 1TBEA 4FHJA 4WWMA 1JWSD 2ASQA 2KN4A 2ZW1A 2BGFA 1A5RA 1SJED 2R2QA 3M63B 3B2GA 2FUHB 2DX5B 2V3PA 1WH3A 1WF9A 1UZXB 5L95C 2LVPA 4ZRKA 1R4MB 1OFFA 3TMPB 2IJ0A 2MWSB 2KFKA 4FN2A 3VHTC 3UINB 1D4BA 2NPTB 2EKEC 1WXMA 4RMAA 2D3CA 2MH7A 4PYZA 1E90A 2ZNVB 3A33B 3B9JA 1E8XA 3ZKJC 1P7EA 3RZWC 2E6XA 2KO3A 5GMVA 4ANVA 2O2VB 2HD5B 3ZJUA 1GB4A 1SIFA 5D94A 4NNJB 3DBLI 3N20C 2H89B 1PQSA 1NI2A 1KM7A 1JWUD 4ZHOA 3AULA 2BQQA 2N1WA 2LFIA 3CF6E 1CZPA 2KT7A 2GBRA 2MP2A 1I35A 3AMZA 2K9XA 2DLBA 2QIEB 3KWVA 3Q14C 2PPHA 4ANUA 4EEWA 2KFJA 3KYDD 2KYWA 4WQOB 1TS2A 3KUZA 4PS8A 2CR5A 4ICVA 5IO9A 3W5VB 2WDVB 2WXRA 5HFYA 4W9LA 4KZCA 4A9AA 2DWQA 4US8A 4MJSA 1OTRB 4ARIA 1E7UA 3A9JB 4DDID 2WXNA 3TL5A 4XDCA 2MBQA 1V1PA 5J17A 3R2IA 4EFOA 2UYZB 2ZW0A 4OHJA 3IT6B 1YD8U 4RFBA 2CHWA 2KXJA 3UIOB 4YWGG 1FD6A 2XK5B 4EZJA 4TQ1A 1XF5L 1OGWA 4DXAB 1WI0A 3RULA 2KWUB 1JMLA 3ZRFA 2KOXA 2HJ8A 2BT6A 4ZRIA 3CWIA 5L83A 3SR6A 1WXQA 3LXFA 2NVUI 3TEZA 2BBCA 4AS1A 2JSVX 1K53A 3EFUA 3JYUA 2VH2A 1ZPSA 3NUHB 1WYWB 2J0MA 1C4AA 3BIID 2ONQA 3ZRCA 3PV1A 1ZDVA 5G55A 1KH0A 1SBBB 2M4NA 2V3NA 2WXPA 4C4VA 4WWOA 2K6DB 2FCSA 1DOXA 1FEHA 1AARA 5BYQA 3P1MA 4CQNA 2KC1A 2PE6B 4K7UA 2BS2B 5DPWA 3FAHA 3A9JA 3AEBB 2DZIA 4GU2A 1L6VA 4TMAB 4F1SA 5LLIA 4IG7B 5H8YE 1SB3C 3L54A 2AX5A 4B9KA 3NVWA 2KANA 3AE5B 2L05A 2L76A 4MM3A 2BKFA 4A20A 3APDA 3DWGC 2OJRA 1Y8RC 1D5MC 4HLEA 5KHOA 5J2RA 2NR2A 2YVCA 1M4VA 4JGHB 4W9CA 4DK5A 1L7YA 2N9LA 2RDHA 2KVRA 3L08A 2W82A 2HDEA 2G45B 2GB1A 1TYGB 1YX6B 1ET9A 2WWZA 4B0EA 2WX1A 4FHKA 5TR5A 3DVGX 4BAXA 2JXXA 2REXA 2QCZA 1LXDA 1C3TA 3ZLZA 2QILA 4G50A 2WQYB 4M00A 2AEHA 4HROA 3L10B 1Y56A 1WX7A 2L0TA 1I4GA 3NHEB 1SE9A 1FIQA 1ROEA 3KUDB 1HTQA 2MBOA 3MP9A 2RDGA 3AEFB 1WR1A 2KN5A 3E9SA 2KJHB 4OVVA 3V3XA 2L0FA 3W5UB 3Q3MC 2M19A 2GBNA 2INNE 2N9KA 1RLFA 3BK1A 1AYFA 2C7MB 2MJ3A 3ZVVA 1ZW7A 3VH4B 4RCOA 5AZHA 3CSTA 3O65B 3IHPC 3RCZA 2LVOA 3WALA 1NDDA 1GJZA 3DOWA 1WGYA 1V8CA 3AH7A 3QIJA 4DHZB 2FIFA 2ZJDA 2GBKA 1V97A 4LNIA 1OQYA 2WXLA 2I1KA 1I42A 2M56B 3IAM1 1T6BX 1U4AA 2DZKA 4MGYE 1GC6A 3RNGC 3U52E 1L5PA 1LGRA 1KF6B 2L7RA 2K39A 2RD0A 3GP7A 3VVWB 3KQ4A 3ML9A 2NBVB 3TEYA 3KVFB 4MH0E 1QOGA 1PGBA 3JSVA 4IOIE 4GGQA 3U30A 2D2QA 2G4DB 4KIKA 1KFYB 3PREA 4HWIB 3MHZA 4F8CB 3BYTB 4FBJB 3IG3A 3HM6X 4ZOHC 1IGCA 4ZDVA 3KH0A 4NPNA 2FIDA 4DXFA 1QF6A 2W54A 4LNNA 4USAA 2DZJA 4IUMB 5FKAC 4C56C
chains in the Genus database with same CATH topology
1AW7A 4B0MA 3Q8AA 1FO4A 1L0YB 1BXTA 2OHFA 5EE3A 4C7ZA 4A55A 5D7GA 5HI1A 1DOIA 1I7HA 3NVVA 3E56A 2AQ2B 1T5XD 3HVDA 2D5GA 4YSYB 2PLPA 1XXGA 3NRZA 2MEKA 2KQ4X 3VR9B 1EU3A 5TSSA 3Q69A 1GPXA 3SFEB 2K3UA 1YJIA 1TKYA 3P4SB 2WNMA 1PGAA 2K5PA 2Z8LA 4HEA1 2QSDA 1SE3A 1TKEA 3RPFC 2RMMA 1JQ4A 4NAMA 4H2AA 2VZKB 5D3IB 1FM0D 3U7ZA 5HG2A 3R8BA 1VZ8A 2JU6X 2KDMA 3I9V1 5C2TB 1TJEA 3EGRA 2W3SA 1YMHE 3KLSX 2BYTA 1NYQA 2MJEA 1N63A 3C8YA 3H8HA 1XLNA 4J3OD 3VQIA 4DQOC 3L4PA 5EE9A 1E0ZA 4KGRA 3V05A 1VZ6A 3VRAB 1FXAA 3P4PB 2IGDA 2I2YA 1SE2A 4C80A 2CJNA 2B76B 1C4PA 2DYOA 1L4DB 4A6QA 1PDXA 3BVGA 4US9A 3URYA 4N6EB 3AV8A 4P16A 1KRHA 3BZDB 1K52A 3LYYA 2BS3B 1F2RC 3SFDB 3NZ3A 1GAQB 1YN3A 2IDYA 4MM3B 4KGTA 4NZLB 4WWMA 2PVOD 1JWSD 2KN4A 2ZW1A 3AEEB 5HHDG 3AE3B 3BVMA 1ET6A 1IGDA 2IGHA 3VR8B 1SJED 1XEEA 2RPVA 3B2GA 1PFDA 2V3PA 2JYTA 3P4QB 1WWTA 1IUEA 2VZKD 1A70A 3MFGA 4RH6A 3PZ7A 1OFFA 3AEDB 4NAWB 2IJ0A 3P63A 1QLBB 4N58A 4OZAA 1D4BA 1GB1A 1VRAB 4ZRPA 1YNTE 4HRSA 1UWXA 3AE1B 1CQVA 1N62A 3OWEB 2MJDA 1C78A 2WU5B 3NVZA 2G9HD 2LMCA 3HRDD 1MPEA 1VJKA 2MH7A 2FE8A 3W9CB 3B9JA 2NTTA 4RGTA 4YTMB 2R61A 2GI9A 1P7EA 1MHXA 2WXQA 2E6XA 1FNVA 4JE3B 4D2KA 1SSNA 1J7BA 4GDLB 2LHDA 3TEWA 1ZDXA 4RF1A 4XWTA 3EA6A 1MI0A 3ZJUA 1GB4A 1MHHE 2K0PA 2BS4B 5LNK1 2H89B 1OQRA 2TSSA 1ZXHA 3MJ5A 2L83A 1JWUD 4YSXB 1UNSA 1E10A 4ZHOA 1TY2A 2FBWB 1ZE3D 2N7JA 2AQ1B 1HEZE 2EKIA 4C7YA 1D5XC 1QILA 2LFIA 4WIPA 1XLOA 1EM7A 1TY0A 2LGIA 4UDUC 5I4DA 1CZPA 4MH8A 2BW2A 1JWMD 3FILA 3AM9A 4OVZA 4DXGA 3AMZA 2K9XA 2DLBA 1DOYA 1TZOA 2QIEB 4KKJA 2SEBD 3KWVA 1IBXB 1R7SA 2KWDA 3KWLA 2J4XA 4MT5A 4WURA 4JWUC 1TS2A 1JCKB 3AE6B 3P4RB 1NI3A 1XLQA 2BB5A 1XCTL 1N5WA 3W5VB 1B9RA 3BVZA 2WDVB 2WXRA 5HFYA 2QJLA 1GOZA 2E3TA 4A9AA 1K50A 2DWQA 1HA5A 3PO0A 5E6JA 4US8A 1JALA 5GXGB 3AE8B 4ARIA 3O13A 1WRIA 2H88B 3W1SA 1ZUD2 3BYYB 1J7AA 2WXNA 1UUPA 4XDCA 3Q8CA 1V1PA 2WLBA 3HVZA 3R2IA 1I4HA 2INPE 2ZW0A 2NMQA 4OHJA 1T3QA 3IT6B 4MACA 2WXHA 1F77A 4RGMA 2BB6A 3IAS1 4RNAA 4HKZE 4RFBA 4WH4A 2V0GA 1FD6A 4HJGE 5AUKA 4YWGG 4TQ1A 1XF5L 4OZCA 2JZPA 2OEDA 2QMTA 2CJOA 1JMLA 2IGGA 1XCQL 2PMVA 1VLBA 2WDQB 1VDVA 1D6EC 5C3JB 3PZ8A 4WQMA 3AE4B 2JX5A 4KX6B 1F2RI 1QQRA 1YN4A 2N0SB 5G5GA 2BT6A 3CWIA 3SR6A 3ZJTA 1MVKA 4RGNA 1WXQA 3LXFA 1ZOYB 4ZHPA 3TEZA 2BBCA 4AS1A 2WXGA 2LJIA 2DYMA 2JSVX 4XWWA 1K53A 4LLGM 2LUMA 1YQ4B 1ZPSA 3Q8FA 1D5ZC 2PW9A 3NUHB 5D3DA 1C4AA 1AWDA 3BIID 4YSZB 1RFKA 2ONQA 5FR3A 4HKQA 1IBXA 1VZ7A 4A8XC 1NYRA 1AN8A 4GDKB 1JW9D 1ZDVA 4IDIA 2HTME 4Q2JA 5EE1A 3DWMA 4REZA 2XNAC 4XDDA 3T3OA 1KH0A 1SBBB 2V3NA 2WXPA 3MC0B 1FFUA 2JWUA 1FFVA 2FUG1 2YEPB 1DOXA 1FNUA 1FEHA 1SJHD 5BYQA 3P1MA 3CIRB 4CQNA 1UGJA 1FNWA 2BS2B 2V4IB 1F0ZA 2EELA 3FAHA 1LO5D 2LEKA 4GLSC 3AEBB 3Q8BA 1JWAD 1L6UA 1ZP0B 2JXTA 3SEBA 3GB1A 1OQQA 1L6VA 3LB8C 1C4CA 4KKIA 4TMAB 5MPOA 4TQ0A 1N60A 4R3DA 5JXVA 1RYJA 4O1NA 1I4XA 5H8YE 1TS5A 4A90A 1HXYD 1SB3C 1N61A 3WCQA 1WSPA 2JYEA 2X38A 1J7CA 2AX5A 5BYRA 4WAFA 5T8IA 4ITKA 2WXOA 3NVWA 4LTUA 2J53A 1FCCC 3AE5B 4P6VF 4NJCA 3Q8EA 1WYGA 4AQ7A 1KTKA 3DWGC 2Y3AA 1KLGD 3EUB2 1D5MC 2NTSA 1KLUD 1TKGA 2Y5PA 1SF0A 1RWSA 1E6EB 2IPKD 2AQ3B 2W3RA 4OZBA 3ZQ4A 1M4VA 3U2SC 2LHEA 4PT5A 2N9LA 2RDHA 3AN1A 3BK2A 1L0XB 2W82A 1FXIA 4IKGA 1C79A 2GRIA 1EWYC 3I57A 4M0WA 2HDEA 5EE0A 2GB1A 1TYGB 1WGKA 1JWBD 1C77A 3W2DA 1ET9A 4B0EA 1HZ5A 1K51A 2G1EA 2KACA 4LK0M 3B2FA 3VRBB 3FC4A 1CK1A 2L1AA 2L52A 2QILA 1DGJA 3AE7B 2J42A 3ABVB 1RM6C 2WQYB 2WS3B 3ZGZA 2YEPF 2BTEA 4HROA 3AE2B 1QKZA 1Y56A 2WU2B 4N59A 1SIJA 3HUIA 2PTLA 3NS1A 2K22A 2L32A 4YXDB 2CU3A 1I4GA 3TEXA 1FIQA 1ROEA 5BMHA 2WXIA 1L4ZB 2QEJC 3MP9A 5BMGA 1E9MA 2RDGA 3ETRA 4L2YA 3AEFB 4EE2A 2WXJA 5G5HA 3E9SA 3AECB 4L23A 3V3XA 1YQ3B 3T3NA 1QOFA 3BWUD 1PUTA 1N5XA 3W5UB 2M19A 1QOAA 1PYWD 1V1OA 2INNE 2N9KA 1NVID 3BK1A 1AYFA 2MJ3A 2WXFA 4RCOA 1HQRD 1C9FA 2J52A 5BMIA 1DYQA 2ICIA 1FCLA 1NEKB 2PKOA 4FXCA 3AB5A 3IXSA 3FILB 1FRDA 1EWCA 2Y5CA 1E7PB 1SE4A 2WDRB 1ESFA 4RGOS 1V8CA 2PIAA 3AH7A 1ACCA 4JX1C 1JRPA 2M0AA 2W55A 4L1BA 2PVGC 4KGSA 1V97A 2KAJA 1P7FA 1L0VB 2WXLA 3UI3A 1STEA 3NVYA 2M56B 1TS3A 3IAM1 2I38A 1T6BX 4ARCA 4ZYSA 1NENB 3U52E 4YT0B 1L5PA 3ZJVA 1YJJA 1KF6B 3RFZB 2JQRB 4XE0A 5AUIA 3AEGB 4JWSC 3GP7A 2Q5WD 3KQ4A 4YTNB 3TEYA 1EU4A 3P42A 1BMLC 1YN5A 1PGXA 1HZ6A 2ACZB 4JPSA 1QOGA 2SAKA 1PGBA 5H92C 1I4QA 3J9CA 1SEBD 1XLPA 4IOIE 3TSSA 1C76A 1V1PB 3AEAB 2WP9B 1XO3A 4ZRQA 2ON8A 1JROA 3IT4B 1KFYB 1SXTA 3N9YC 1FMAD 3GS2A 1TS4A 3MHZA 3BYTB 2DBYA 1QT9A 4OW0A 1CJEA 4ZOHC 1IGCA 3TUOA 1FRRA 5BYSA 3R2TA 1B1ZA 3U4EG 2XN9C 3ZYYX 1I4PA 1I4RA 4TSSA 4DXFA 4RF0A 1QF6A 2WXKA 4YTPB 5FK9C 2KMMA 1BUIC 1QOBA 2WXMA 2W54A 1Q10A 3AE9B 1VR9A 1UWMA 4USAA 5FKAC 1ENFA 1ZXIA 4C56C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTM B;  4YXD B;  2CU3 A;  1FIQ A;  1ROE A;  1WXQ A;  3LXF A;  1FO4 A;  1ZOY B;  4ZHP A;  2OHF A;  5EE3 A;  4C7Z A;  1E9M A;  1J7B A;  3ETR A;  3AEF B;  5G5H A;  1DOI A;  1I7H A;  3NVV A;  3AEC B;  1YQ3 B;  1YQ4 B;  1QOF A;  2BS4 B;  2H89 B;  4YSY B;  1OQR A;  1PUT A;  1AWD A;  1N5X A;  3W5U B;  3NRZ A;  2M19 A;  1QOA A;  3VR9 B;  1GPX A;  3BII D;  4YSZ B;  1NVI D;  3SFE B;  1RFK A;  1AYF A;  1YJI A;  2MJ3 A;  1TKY A;  2L83 A;  4YSX B;  3P4S B;  1E10 A;  4ZHO A;  1NYR A;  2K5P A;  2FBW B;  1JW9 D;  3RPF C;  1TKE A;  4IDI A;  2HTM E;  5EE1 A;  1JQ4 A;  3DWM A;  2EKI A;  4C7Y A;  1FM0 D;  1NEK B;  2PKO A;  1XLO A;  1FFU A;  1FFV A;  5C2T B;  4FXC A;  1CZP A;  1TJE A;  3AB5 A;  2W3S A;  1DOX A;  3AM9 A;  1NYQ A;  1FRD A;  2MJE A;  2Y5C A;  1E7P B;  1N63 A;  2WDR B;  3CIR B;  1XLN A;  3P1M A;  2BS2 B;  1F0Z A;  3L4P A;  1V8C A;  3AMZ A;  2PIA A;  3AH7 A;  3FAH A;  2K9X A;  5EE9 A;  2LEK A;  4JX1 C;  1E0Z A;  1DOY A;  1JRP A;  3AEB B;  2QIE B;  2W55 A;  1JWA D;  3VRA B;  1FXA A;  1L6U A;  2PVG C;  3P4P B;  1ZP0 B;  1V97 A;  4C80 A;  2KAJ A;  2CJN A;  1OQQ A;  1L6V A;  1R7S A;  2B76 B;  1L0V B;  3LB8 C;  3KWL A;  1PDX A;  3NVY A;  1N60 A;  2M56 B;  5MPO A;  4US9 A;  1RYJ A;  4JWU C;  5H8Y E;  3AE6 B;  4N6E B;  3P4R B;  1SB3 C;  3AV8 A;  1N61 A;  3WCQ A;  1NI3 A;  1KRH A;  1XLQ A;  1J7C A;  2AX5 A;  1NEN B;  2BS3 B;  4YT0 B;  4ITK A;  1L5P A;  1N5W A;  3W5V B;  3NVW A;  1B9R A;  4LTU A;  3SFD B;  1YJJ A;  2WDV B;  1KF6 B;  2QJL A;  2E3T A;  1GAQ B;  3AE5 B;  4P6V F;  2JQR B;  4A9A A;  2DWQ A;  4WWM A;  2PVO D;  3AEG B;  1WYG A;  3PO0 A;  4JWS C;  5AUI A;  4US8 A;  2Q5W D;  1JAL A;  5GXG B;  3AE8 B;  3DWG C;  4YTN B;  3EUB 2;  1WRI A;  2H88 B;  3AEE B;  2ACZ B;  3AE3 B;  1QOG A;  1TKG A;  1ZUD 2;  1SF0 A;  5H92 C;  1RWS A;  1J7A A;  1XLP A;  1E6E B;  3VR8 B;  2W3R A;  3AEA B;  2WP9 B;  3B2G A;  1XO3 A;  2WLB A;  3HVZ A;  1PFD A;  1JRO A;  1KFY B;  3AN1 A;  3P4Q B;  1FMA D;  1WWT A;  1T3Q A;  2K22 A;  1IUE A;  1FXI A;  1A70 A;  1EWY C;  1QT9 A;  2DBY A;  1CJE A;  4USA A;  4ZOH C;  5EE0 A;  1FRR A;  1TYG B;  1WGK A;  1JWB D;  5AUK A;  1OFF A;  3AED B;  3P63 A;  1QLB B;  4N58 A;  3ZYY X;  2G1E A;  2CJO A;  3B2F A;  3VRB B;  3FC4 A;  4HRS A;  2WDQ B;  1VLB A;  1QF6 A;  2L52 A;  3AE1 B;  3SR6 A;  1N62 A;  1VDV A;  1DGJ A;  4YTP B;  5C3J B;  3AE7 B;  2KMM A;  1QOB A;  1RM6 C;  3ABV B;  2MJD A;  2W54 A;  4WQM A;  2WU5 B;  2JX5 A;  2WQY B;  3AE4 B;  3AE9 B;  1UWM A;  2WS3 B;  3HRD D;  3NVZ A;  4HRO A;  3AE2 B;  4KX6 B;  2N0S B;  2WU2 B;  4N59 A;  1VJK A;  1SIJ A;  3HUI A;  2MH7 A;  5G5G A;  3NS1 A;  2BT6 A;  3CWI A;  1ZXI A;  3W9C B;  3B9J A; 
#chains in the Genus database with same CATH topology
 2HTH A;  4HK2 A;  1OEY J;  4B0M A;  1BXT A;  3ZNZ B;  1TGZ B;  1WM2 A;  2KJR A;  1I7H A;  3NVV A;  1IP9 A;  2DZM A;  2O6V B;  4YSY B;  2PLP A;  2KQ4 X;  4EOY A;  3QAR A;  4J6I A;  3SHQ A;  2WNM A;  1PGA A;  3DHI C;  2Z8L A;  4GDK A;  3RPF C;  1NBF C;  2VZK B;  4ANX A;  3R8B A;  2JU6 X;  3RT3 B;  3IFW B;  4HXD A;  4MGZ E;  2MJE A;  5E6O A;  4N9F 4;  3H8H A;  3QA8 A;  4TKN A;  4KDI C;  1VZ6 A;  3R3M A;  1PDX A;  4US9 A;  4N6E B;  2JPH A;  2MRP A;  2MHJ A;  1GNU A;  2M17 A;  2WX0 A;  1GAQ B;  2M0X A;  2NCN A;  2LJ5 A;  4KDL B;  4MGI E;  4GOC A;  3QWZ B;  3AE3 B;  2N7E A;  3BVM A;  5JZE B;  3TBL D;  3KUC B;  1IUE A;  2X8X X;  1J19 A;  2C7H A;  4FA6 A;  2MX2 A;  4NAW B;  5J18 A;  1D3Z A;  4OZA A;  3D32 A;  1R4M I;  3B0A A;  3AE1 B;  1N62 A;  3OWE B;  1C78 A;  2LMC A;  5IKC M;  2JZ3 B;  4JE3 B;  4GDL B;  1J7B A;  3QQ8 B;  4RF1 A;  4XWT A;  4KSL C;  2XEW A;  1OQR A;  2TSS A;  1UGM A;  1ZXH A;  4PS3 A;  1WIA A;  4YSX B;  3MHS D;  2FBW B;  2N7J A;  3L17 A;  4A3O A;  1HEZ E;  4PYU A;  4C7Y A;  1D5X C;  1QIL A;  4WIP A;  5LXI B;  1XLO A;  3PTF C;  5I4D A;  4NJ7 A;  4MH8 A;  3FIL A;  4OVZ A;  2FCN A;  1UBQ A;  4ZRJ A;  3PSE B;  1GC7 A;  1TZO A;  3RD2 A;  2SEB D;  1IBX B;  2KWD A;  4MT5 A;  4BFR A;  3AE6 B;  1HTO A;  1XCT L;  3X0W A;  1F9J A;  1N5W A;  3RMK C;  3BVZ A;  1GOZ A;  2E3T A;  3DPD A;  2KX0 A;  3X23 A;  5GXG B;  3O13 A;  2IO2 B;  3M95 A;  2KX3 A;  1ZUD 2;  2KDB A;  2EMS A;  1UUP A;  3Q8C A;  2INP E;  4B6W A;  1T3Q A;  4MAC A;  2WXH A;  3RYT A;  4RGM A;  4NJ6 A;  2BB6 A;  3IAS 1;  3WAM A;  1VD2 A;  5JHB A;  2KLG A;  2OED A;  3A4R A;  2CJO A;  2IGG A;  1XCQ L;  1VDV A;  3RZF A;  4KX6 B;  1T0R C;  1QQR A;  1YN4 A;  3DBH I;  3VUY A;  1TTN A;  4RGN A;  2LD9 A;  5IN7 A;  3VDZ A;  1ZOY B;  2JUO A;  2CKH B;  1V2Y A;  2DYM A;  4XWW A;  3UIP B;  1YQ4 B;  2QC8 A;  5D3D A;  1AWD A;  4I6N B;  1T0Y A;  1WXA A;  1IBX A;  5LXH A;  2UWQ A;  3PRP B;  4IDI A;  3DWM A;  4XDD A;  3NZU A;  2RGF A;  1FFU A;  4AUQ C;  3Q3N C;  2RPQ A;  2YEP B;  4W9F A;  3U7D A;  1FNU A;  3Q3F A;  4G3X B;  2CS4 A;  4FAD A;  4RM8 A;  3SU8 X;  2V4I B;  1F0Z A;  1LO5 D;  2LEK A;  4XYC A;  1V5T A;  1ZP0 B;  2JXT A;  1OQQ A;  2GMI C;  4TQ0 A;  1H8C A;  5JXV A;  1I4X A;  5E6P A;  3ZW3 A;  3Q3J A;  3WCQ A;  1WSP A;  3RNA C;  1J7C A;  3DVN U;  2LGX A;  3M62 B;  2WXO A;  3B1L X;  4P6V F;  2KDE B;  4NJC A;  3VUX A;  3Q8E A;  4PS7 A;  1KTK A;  3UF8 A;  4E74 A;  2NTS A;  4QAY A;  1KLU D;  1TKG A;  1SGH A;  3Q3O C;  1SF0 A;  1RWS A;  1E6E B;  4C00 A;  2K1F A;  2LHE A;  1V86 A;  2LUE A;  4PT5 A;  2QHO A;  3AN1 A;  3BK2 A;  4FJZ A;  1L0X B;  2IYD B;  1WMH B;  2RR9 A;  2GRI A;  1R4N B;  1C77 A;  3W1Y A;  1K51 A;  3I3T B;  2NPT A;  1CK1 A;  1DGJ A;  1P9D U;  2WU2 B;  3EC8 A;  3HUI A;  3NS1 A;  3ONS A;  2L32 A;  2CU3 A;  2Z0D B;  2ZVO A;  3BIN A;  5BO4 B;  1E8Z A;  2O2V A;  5G5H A;  2ZPY A;  3AEC B;  3BWU D;  3N1X C;  1WFY A;  3WAN A;  1PUT A;  1N5X A;  1QOA A;  1NVI D;  2ZPN A;  2J52 A;  2L3Z A;  3A9K B;  1DYQ A;  2ICI A;  1FCL A;  1NEK B;  2PKO A;  1FPY A;  3DDC B;  5IA7 A;  1P0R A;  1ACC A;  4JX1 C;  4XX5 A;  1ZKH A;  4W9I A;  4KGS A;  2KAJ A;  3UI3 A;  4W9J A;  1MG8 A;  3HHM A;  2G4S A;  1UD7 A;  4W9K A;  2BF8 B;  4LDT D;  4ZYS A;  3GE3 C;  4W9D A;  3ZJV A;  3RFZ B;  3SD5 A;  4MEM A;  4JWS C;  2KDI A;  2PE9 A;  2N4F A;  1EU4 A;  3P42 A;  1BML C;  2ZNV C;  1PGX A;  2K8H A;  3GZN B;  2KTR B;  1XQQ A;  3V61 A;  3MC8 A;  2LGD A;  1JRO A;  2D3A A;  3IBE A;  3HIZ A;  3L16 A;  2KD0 A;  2IO1 B;  3DBL B;  5BYS A;  2NBU A;  2XK5 A;  2ZCC A;  4WWN A;  2XN9 C;  1I4R A;  4TSS A;  2JWZ A;  2KC2 A;  3EFC A;  2AYO B;  4JLC A;  1BUI C;  2WXM A;  4AOF A;  1T0S C;  2KMA A;  3A9K A;  1Q5W B;  3JVZ X;  4F7Z A;  3Q8A A;  1L0Y B;  4C7Z A;  2Z59 B;  3GE8 C;  2ZZP B;  3E56 A;  1T5X D;  2KWV B;  2J0J A;  2A4Z A;  2N9E B;  5TSS A;  1T0Q C;  4LNO A;  1YJI A;  4KZ0 A;  3H6N A;  5C1Z A;  2K5P A;  2QSD A;  1SE3 A;  1JQ4 A;  2RMM A;  3HM3 A;  5D3I B;  4W9E A;  2KDM A;  5C2T B;  1K8R B;  1YMH E;  1V81 A;  3ENE A;  3VUW A;  1N63 A;  4J3O D;  3VQI A;  1E0Z A;  2KTR A;  2MQJ A;  1FXA A;  1SE2 A;  4C80 A;  2B76 B;  4A6Q A;  1VCB A;  3BVG A;  4BKG A;  3AV8 A;  3BZD B;  1K52 A;  3LYY A;  2BS3 B;  4NY0 A;  3SFD B;  3QC8 B;  2MBE A;  3NZ3 A;  1YN3 A;  4KGT A;  4NZL B;  3LJ3 A;  3H7P B;  4MGK E;  3EHV A;  3AEE B;  5HHD G;  3K9P B;  1IGD A;  2D3B A;  2RPV A;  1XT9 B;  1PFD A;  3P4Q B;  1WWT A;  3VXW A;  2VZK D;  4HPP A;  1A70 A;  3DBR I;  3TCA A;  1J8C A;  3AED B;  3P63 A;  1VRA B;  1YNT E;  2MSE D;  3U8Z A;  2N9X A;  3WAO A;  3R66 C;  4URK A;  2MJD A;  3DBS A;  2WU5 B;  2G9H D;  2VRR B;  1MPE A;  2FE8 A;  3W9C B;  4YTM B;  2R61 A;  1EO6 A;  3HK0 A;  4P1C C;  1MHX A;  2WXQ A;  2RDB C;  1FNV A;  1F52 A;  3A1Q B;  1ZDX A;  2C9W B;  3EA6 A;  4CHK A;  3V6E B;  2K0P A;  2DAJ A;  5LNK 1;  3ZUN A;  1WJ4 A;  4IWP A;  5AEK B;  2L83 A;  4I6P A;  1UNS A;  1E10 A;  1MJD A;  1ZE3 D;  3AXC A;  2EKI A;  2FNJ B;  2LGI A;  4NQL B;  1Q0W B;  4UDU C;  2BW2 A;  1E5W A;  4FLH A;  1DOY A;  3PZD A;  1H4R A;  3TJP A;  2AL6 A;  2KZR A;  2JF5 A;  4BKS A;  1R7S A;  2YLM A;  1V49 A;  3KWL A;  2J4X A;  4S0R A;  4JWU C;  1JCK B;  1IYF A;  4CYE A;  2BB5 A;  2IY1 B;  4HDO A;  1B9R A;  3VAW A;  1HA5 A;  1JAL A;  4DWF A;  1WZ0 A;  2C7N B;  2BYE A;  1WRI A;  2K8B A;  1V5O A;  3W1S A;  2MBH A;  3V60 A;  3QHT A;  2PEA A;  1I4H A;  3L13 A;  1WXS A;  3PHX B;  2KTF A;  2N7D A;  2IBI B;  3RUI B;  4YL8 A;  4OZC A;  2JZP A;  2BVC A;  2PJH A;  2PMV A;  2WDQ B;  3ZDT A;  1YX5 B;  5C3J B;  2DAF A;  3AE4 B;  2JX5 A;  3PRM B;  3ZJT A;  2N1V A;  1MVK A;  2IZV B;  5G2N A;  2D07 B;  2C60 A;  2LJI A;  1YIW A;  3C0R B;  4LLG M;  2LUM A;  1UH6 A;  1WE6 A;  3BY4 B;  2PW9 A;  4ICU A;  2LXA A;  4X57 B;  5CHW A;  2O6V A;  4LNF A;  3CSF A;  3AU5 A;  4HKQ A;  4A8X C;  1V6E A;  2GLS A;  1NYR A;  1AN8 A;  4Q2J A;  4REZ A;  3ZNG C;  2XNA C;  4G0N B;  3T3O A;  3MC0 B;  2JWU A;  1FFV A;  1RFA A;  2FUG 1;  3W1S C;  2KWC A;  3RNC C;  4JIO U;  1LM8 B;  3CIR B;  1IPG A;  1FNW A;  3L0W B;  4HPL B;  2EEL A;  3H7S A;  4GLS C;  2GBM A;  4GB9 A;  3GB1 A;  3LB8 C;  1C4C A;  1G6J A;  1BT0 A;  5MPO A;  1N60 A;  1RYJ A;  2LWP A;  4O1N A;  4DHZ E;  1TS5 A;  3SDL C;  4EUT A;  2X38 A;  4WAF A;  4LTU A;  3N32 A;  5DCN A;  2J53 A;  2V3S A;  1FCC C;  4AQ7 A;  1WXV A;  2Y3A A;  3EEC A;  3KW5 B;  3EUB 2;  4BKT A;  2BYV E;  2Y5P A;  2A5U A;  3ZXV A;  2AQ3 B;  2KJ6 A;  2W3R A;  2KKC A;  3ZQ4 A;  3U2S C;  3ZTD A;  1FXI A;  4IKG A;  1C79 A;  1EWY C;  2CHX A;  3I57 A;  1S1Q B;  3K9O B;  1WGK A;  4K1R B;  2JRI B;  2BWE S;  5AZF A;  3OAW A;  4NAW A;  2KFK B;  2Z0E B;  2M1M A;  1Z5S B;  4LK0 M;  3VRB B;  3FC4 A;  1R4N I;  2L1A A;  2L52 A;  3GOE A;  4DHJ B;  2J42 A;  1RM6 C;  3PGE A;  2KVZ A;  2YEP F;  4II3 B;  2BTE A;  3AE2 B;  1QKZ A;  4N59 A;  3ZGZ A;  4YXD B;  3TEX A;  2C5L C;  5CX3 A;  3H1U A;  1L4Z B;  2QEJ C;  1P3Q U;  4WJN A;  4KSK C;  1E9M A;  4GDL A;  1P1A A;  1WRD B;  1S3S G;  2WXJ A;  4EE2 A;  2IO0 B;  1M94 A;  5CHF A;  2BYF A;  1PYW D;  1YJ1 A;  2WXF A;  1HQR D;  1MG4 A;  5BMI A;  1EF1 A;  3PLV A;  3ZIM A;  2LRW A;  4MSM B;  2HE7 A;  3N1Z C;  2BPS A;  2MP2 B;  1FRD A;  1E7P B;  1SE4 A;  4B95 A;  2MBB B;  3N1Y C;  4HCN B;  2PIA A;  5E6N A;  1WY8 A;  2M0A A;  4ACF A;  2W55 A;  4L1B A;  2PVG C;  1L0V B;  2MA9 B;  1STE A;  3NS8 A;  3NVY A;  2KHW B;  4TV3 A;  4ARC A;  1NEN B;  1GUA B;  3I63 C;  3PT2 B;  2GOW A;  2BWF A;  1YJJ A;  4WWP A;  1WGH A;  4XE0 A;  5D6J B;  4MJS B;  4WAA A;  2MLB A;  4WJQ A;  5C23 A;  1N6Z A;  4P7I A;  3WAP A;  3QX1 A;  2ACZ B;  3RNF C;  1I4Q A;  3J9C A;  1SEB D;  1XLP A;  3TSS A;  2EMT A;  1C76 A;  1V1P B;  3ZXR A;  2WP9 B;  3ZTC A;  3GZN I;  4ZRQ A;  4IM0 A;  1FMA D;  1QZE A;  4AP4 C;  2DBY A;  1QT9 A;  2WHI A;  3TUO A;  2KLC A;  4M8M A;  2OJW A;  2ZVN A;  3R7Q A;  4FUL A;  1WX8 A;  3T8M A;  2WXK A;  3PPA A;  3DQV A;  5FK9 C;  3V62 A;  1GG3 A;  1QOB A;  1EUV B;  2KMM A;  3P2B A;  3AE9 B;  1VR9 A;  1UWM A;  4IW0 A;  1FXT B;  2WGS A;  2CU1 A;  1RRB A;  1AW7 A;  4IWO A;  2DNF A;  2OHF A;  5EE3 A;  4KVG B;  3QJZ A;  4ANW A;  1DOI A;  4TUU A;  2KMC A;  3NRZ A;  1WGR A;  3LDZ E;  3VR9 B;  1EU3 A;  3Q69 A;  5KHQ A;  3SFE B;  2K3U A;  2JZZ A;  3QAQ A;  5FR6 A;  1TKY A;  3UGB B;  3P4S B;  4IWQ A;  4HEA 1;  1TKE A;  3DVN V;  2N9P C;  4NAM A;  3ML8 A;  4H2A A;  3APF A;  4S17 A;  4C4V B;  1TJE A;  3NY5 A;  3KLS X;  3ZNI D;  1NYQ A;  4K3C A;  3C8Y A;  4E71 A;  2QDF A;  1XD3 B;  3VRA B;  1YOV B;  2L00 B;  2DHZ A;  1C4P A;  2IND C;  2DYO A;  1L4D B;  2BKR B;  2J7Q B;  3URY A;  4P16 A;  2HJ1 A;  1KRH A;  4M01 A;  4JL9 A;  4GN1 A;  1Z2M A;  4XC2 A;  4BOZ B;  4MM3 B;  2PVO D;  4MSQ B;  1Q1O A;  1J0G A;  3DBH B;  4BOS C;  3DVG Y;  5DPR A;  1ET6 A;  4NQK E;  3VFK A;  4IM3 A;  2IGH A;  4FJY A;  3VR8 B;  1XEE A;  4A3P A;  2I1J A;  2JYT A;  1WMH A;  3MFG A;  1TT5 B;  4RH6 A;  4MEL A;  1TIF A;  3PZ7 A;  1QLB B;  4N58 A;  2K25 A;  4DBG A;  5JHA A;  1GB1 A;  4ZRP A;  1TZ1 A;  4RM9 A;  4HRS A;  1UWX A;  1CQV A;  3NG0 A;  2D11 A;  2LI5 A;  3MC9 A;  2FCM A;  3NVZ A;  2MW5 A;  3HRD D;  3DCG A;  1VJK A;  4CO7 A;  3Q2A C;  1WJ6 A;  3MTN B;  2NTT A;  4RGT A;  2GI9 A;  1WX9 A;  4AWJ A;  4D2K A;  1SSN A;  3TEW A;  2LHD A;  4K3B A;  4HJK A;  3VH3 B;  1MI0 A;  1MHH E;  2BS4 B;  2WDT B;  4FJV B;  1E8W A;  3MJ5 A;  4BKS D;  1TY2 A;  2AQ1 B;  4IM2 A;  1EM7 A;  1TY0 A;  2D3G A;  2V4L A;  1MFW A;  2JT4 B;  5IOI A;  5IP4 D;  1JWM D;  3AM9 A;  3RNE C;  4DXG A;  4BBN F;  1LQB A;  3DHG C;  4KKJ A;  1E8Y A;  4KV2 A;  2JRH A;  2ZCB A;  4M8N A;  4WUR A;  3AI5 A;  3P4R B;  2IY0 B;  4K7S A;  1NI3 A;  1XLQ A;  1WGG A;  4P1B C;  1OEY A;  4EZL A;  4PK1 A;  3OG5 A;  4XZ4 A;  4K81 A;  2QJL A;  4LJO B;  1K50 A;  2LXC A;  3DHH C;  3PO0 A;  5E6J A;  3AE8 B;  4ZYN A;  4M02 A;  2H88 B;  3CMM B;  1P98 A;  3BYY B;  2KNB A;  3JSV B;  1J7A A;  3ALB A;  2V1Y A;  2WLB A;  3HVZ A;  4KIK B;  2LVQ A;  2NMQ A;  4LDT B;  4EZK A;  1F77 A;  4GMV A;  4RNA A;  4HKZ E;  4WH4 A;  3C19 A;  2V0G A;  4HJG E;  5AUK A;  1UF0 A;  2J0K A;  2DYB A;  2XBB C;  2M8S A;  1UBI A;  2QMT A;  3RNB C;  4BZA A;  1JRU A;  3QCA A;  1VLB A;  2JVC A;  1V80 A;  2O6V D;  1D6E C;  3PZ8 A;  4WQM A;  1F2R I;  2N0S B;  2NS5 A;  5G5G A;  2JY6 A;  2G3Q B;  3MJW A;  4M0W B;  4ZHP A;  3OJ3 A;  3ECI A;  2WXG A;  3Q6B A;  3NJT A;  1LFD A;  2K8C A;  3Q8F A;  4G11 A;  1D5Z C;  2VH1 A;  1WGD A;  4YSZ B;  1RFK A;  5FR3 A;  1VZ7 A;  4I6L B;  4GDK B;  1JW9 D;  1CMX B;  2HTM E;  5EE1 A;  3RI7 C;  4HDQ A;  3WIM A;  3RN9 C;  4DDG D;  2D10 A;  5CTR C;  3VTW A;  1SJH D;  1UGJ A;  1WR6 E;  2UU7 A;  3OLM D;  4K7W A;  5CHV C;  3Q8B A;  1JWA D;  1L6U A;  3SEB A;  2CHZ A;  3OJ4 B;  1E7V A;  4KKI A;  1KLV A;  2L8J A;  4R3D A;  4A90 A;  1HXY D;  1N61 A;  2WYQ A;  2JYE A;  5BYR A;  5T8I A;  2NBW B;  4ITK A;  4EKU A;  1WM3 A;  4LNK A;  1WYG A;  2KK8 A;  3H7P A;  3NOB A;  1KLG D;  4LJP B;  4MDK E;  4JQW C;  3S2A A;  4HCP B;  2IPK D;  4OZB A;  3TIX A;  3R7R A;  4M0W A;  5EE0 A;  3V6C B;  4LCD E;  5EDS A;  1JWB D;  1WJN A;  3W2D A;  1HZ5 A;  1UEL A;  2G1E A;  2KAC A;  3B2F A;  3PLU A;  1KJT A;  2MCN B;  3I5J C;  4II2 B;  4OVU A;  3AE7 B;  5DPT A;  3ABV B;  2LAS A;  2LGS A;  3T9L A;  2WS3 B;  3APC A;  1SIJ A;  1F1H A;  2PTL A;  2K22 A;  1X1M A;  2LRU A;  1KOT A;  3VTV A;  5BMH A;  2W9N A;  2WXI A;  3B08 A;  5BMG A;  4L2Y A;  3A1Q A;  3ETR A;  5JH5 C;  2AL3 A;  5AZG A;  4AJW A;  2FAZ A;  4L23 A;  1YQ3 B;  3T3N A;  1QOF A;  3ZDM C;  4W9H A;  1V1O A;  1RAX A;  1WZ3 A;  1C9F A;  3N3K B;  4IC7 B;  3A4S C;  5DPS A;  2KDF B;  2R2O A;  1ZGU B;  3PHW B;  4FXC A;  3AB5 A;  3IXS A;  3FIL B;  4BBN C;  1EWC A;  2Y5C A;  2WDR B;  1EF5 A;  1ESF A;  2K6Q A;  4RGO S;  1C1Y B;  1JRP A;  3ZO5 B;  4DHJ D;  5D2M B;  3JW0 X;  1P7F A;  2V9H A;  4XGA B;  4WJO A;  1TS3 A;  3DBR B;  2I38 A;  3IVF A;  4GXB A;  4YT0 B;  2OOB B;  2JQR B;  3UQB A;  2INC C;  5AUI A;  3AEG B;  1V9J A;  2Q5W D;  4YTN B;  2B3A A;  1YN5 A;  1HZ6 A;  4JPS A;  2RSU A;  2SAK A;  5H92 C;  5HKH A;  3AEA B;  1XO3 A;  1WJU A;  2ON8 A;  3IT4 B;  3ZNH B;  1SXT A;  2GBJ A;  3N9Y C;  3GS2 A;  1TS4 A;  4E3C A;  4OW0 A;  1CJE A;  1FRR A;  3AU4 A;  3R2T A;  1B1Z A;  2KQS A;  3U4E G;  1L2N A;  3ZYY X;  1I4P A;  2FCQ A;  2LGY A;  3FKY A;  4RF0 A;  5IAA C;  2ZEQ A;  4YTP B;  3UQA A;  1Q10 A;  2DEN B;  3H9D A;  4GSW A;  2KQ7 A;  1ENF A;  1ZXI A;  2IO3 B;  1FO4 A;  3VTU A;  4A55 A;  5D7G A;  5HI1 A;  2LZ6 A;  3PVL A;  2AQ2 B;  3HVD A;  2D5G A;  1XXG A;  2MEK A;  1GPX A;  4HVB A;  3PS6 A;  3QK0 A;  3KYC D;  4WJP A;  1WE7 A;  3PRZ A;  4AJY B;  1FM0 D;  3U7Z A;  5HG2 A;  1VZ8 A;  3I9V 1;  3EGR A;  2W3S A;  2AWT A;  1ISN A;  2BYT A;  1XLN A;  1HE8 A;  4ASW C;  4DQO C;  3L4P A;  5EE9 A;  4GIV A;  4KGR A;  3V05 A;  4BVU C;  3P4P B;  2IGD A;  2I2Y A;  2Y5B B;  2CJN A;  3N30 A;  3WA0 A;  4HPM B;  3NZS A;  1F2R C;  4W9G A;  1YQB A;  2IDY A;  3M3J A;  1TBE A;  4FHJ A;  4WWM A;  1JWS D;  2ASQ A;  2KN4 A;  2ZW1 A;  2BGF A;  1A5R A;  1SJE D;  2R2Q A;  3M63 B;  3B2G A;  2FUH B;  2DX5 B;  2V3P A;  1WH3 A;  1WF9 A;  1UZX B;  5L95 C;  2LVP A;  4ZRK A;  1R4M B;  1OFF A;  3TMP B;  2IJ0 A;  2MWS B;  2KFK A;  4FN2 A;  3VHT C;  3UIN B;  1D4B A;  2NPT B;  2EKE C;  1WXM A;  4RMA A;  2D3C A;  2MH7 A;  4PYZ A;  1E90 A;  2ZNV B;  3A33 B;  3B9J A;  1E8X A;  3ZKJ C;  1P7E A;  3RZW C;  2E6X A;  2KO3 A;  5GMV A;  4ANV A;  2O2V B;  2HD5 B;  3ZJU A;  1GB4 A;  1SIF A;  5D94 A;  4NNJ B;  3DBL I;  3N20 C;  2H89 B;  1PQS A;  1NI2 A;  1KM7 A;  1JWU D;  4ZHO A;  3AUL A;  2BQQ A;  2N1W A;  2LFI A;  3CF6 E;  1CZP A;  2KT7 A;  2GBR A;  2MP2 A;  1I35 A;  3AMZ A;  2K9X A;  2DLB A;  2QIE B;  3KWV A;  3Q14 C;  2PPH A;  4ANU A;  4EEW A;  2KFJ A;  3KYD D;  2KYW A;  4WQO B;  1TS2 A;  3KUZ A;  4PS8 A;  2CR5 A;  4ICV A;  5IO9 A;  3W5V B;  2WDV B;  2WXR A;  5HFY A;  4W9L A;  4KZC A;  4A9A A;  2DWQ A;  4US8 A;  4MJS A;  1OTR B;  4ARI A;  1E7U A;  3A9J B;  4DDI D;  2WXN A;  3TL5 A;  4XDC A;  2MBQ A;  1V1P A;  5J17 A;  3R2I A;  4EFO A;  2UYZ B;  2ZW0 A;  4OHJ A;  3IT6 B;  1YD8 U;  4RFB A;  2CHW A;  2KXJ A;  3UIO B;  4YWG G;  1FD6 A;  2XK5 B;  4EZJ A;  4TQ1 A;  1XF5 L;  1OGW A;  4DXA B;  1WI0 A;  3RUL A;  2KWU B;  1JML A;  3ZRF A;  2KOX A;  2HJ8 A;  2BT6 A;  4ZRI A;  3CWI A;  5L83 A;  3SR6 A;  1WXQ A;  3LXF A;  2NVU I;  3TEZ A;  2BBC A;  4AS1 A;  2JSV X;  1K53 A;  3EFU A;  3JYU A;  2VH2 A;  1ZPS A;  3NUH B;  1WYW B;  2J0M A;  1C4A A;  3BII D;  2ONQ A;  3ZRC A;  3PV1 A;  1ZDV A;  5G55 A;  1KH0 A;  1SBB B;  2M4N A;  2V3N A;  2WXP A;  4C4V A;  4WWO A;  2K6D B;  2FCS A;  1DOX A;  1FEH A;  1AAR A;  5BYQ A;  3P1M A;  4CQN A;  2KC1 A;  2PE6 B;  4K7U A;  2BS2 B;  5DPW A;  3FAH A;  3A9J A;  3AEB B;  2DZI A;  4GU2 A;  1L6V A;  4TMA B;  4F1S A;  5LLI A;  4IG7 B;  5H8Y E;  1SB3 C;  3L54 A;  2AX5 A;  4B9K A;  3NVW A;  2KAN A;  3AE5 B;  2L05 A;  2L76 A;  4MM3 A;  2BKF A;  4A20 A;  3APD A;  3DWG C;  2OJR A;  1Y8R C;  1D5M C;  4HLE A;  5KHO A;  5J2R A;  2NR2 A;  2YVC A;  1M4V A;  4JGH B;  4W9C A;  4DK5 A;  1L7Y A;  2N9L A;  2RDH A;  2KVR A;  3L08 A;  2W82 A;  2HDE A;  2G45 B;  2GB1 A;  1TYG B;  1YX6 B;  1ET9 A;  2WWZ A;  4B0E A;  2WX1 A;  4FHK A;  5TR5 A;  3DVG X;  4BAX A;  2JXX A;  2REX A;  2QCZ A;  1LXD A;  1C3T A;  3ZLZ A;  2QIL A;  4G50 A;  2WQY B;  4M00 A;  2AEH A;  4HRO A;  3L10 B;  1Y56 A;  1WX7 A;  2L0T A;  1I4G A;  3NHE B;  1SE9 A;  1FIQ A;  1ROE A;  3KUD B;  1HTQ A;  2MBO A;  3MP9 A;  2RDG A;  3AEF B;  1WR1 A;  2KN5 A;  3E9S A;  2KJH B;  4OVV A;  3V3X A;  2L0F A;  3W5U B;  3Q3M C;  2M19 A;  2GBN A;  2INN E;  2N9K A;  1RLF A;  3BK1 A;  1AYF A;  2C7M B;  2MJ3 A;  3ZVV A;  1ZW7 A;  3VH4 B;  4RCO A;  5AZH A;  3CST A;  3O65 B;  3IHP C;  3RCZ A;  2LVO A;  3WAL A;  1NDD A;  1GJZ A;  3DOW A;  1WGY A;  1V8C A;  3AH7 A;  3QIJ A;  4DHZ B;  2FIF A;  2ZJD A;  2GBK A;  1V97 A;  4LNI A;  1OQY A;  2WXL A;  2I1K A;  1I42 A;  2M56 B;  3IAM 1;  1T6B X;  1U4A A;  2DZK A;  4MGY E;  1GC6 A;  3RNG C;  3U52 E;  1L5P A;  1LGR A;  1KF6 B;  2L7R A;  2K39 A;  2RD0 A;  3GP7 A;  3VVW B;  3KQ4 A;  3ML9 A;  2NBV B;  3TEY A;  3KVF B;  4MH0 E;  1QOG A;  1PGB A;  3JSV A;  4IOI E;  4GGQ A;  3U30 A;  2D2Q A;  2G4D B;  4KIK A;  1KFY B;  3PRE A;  4HWI B;  3MHZ A;  4F8C B;  3BYT B;  4FBJ B;  3IG3 A;  3HM6 X;  4ZOH C;  1IGC A;  4ZDV A;  3KH0 A;  4NPN A;  2FID A;  4DXF A;  1QF6 A;  2W54 A;  4LNN A;  4USA A;  2DZJ A;  4IUM B;  5FKA C;  4C56 C; 
#chains in the Genus database with same CATH homology
 1AW7 A;  4B0M A;  3Q8A A;  1FO4 A;  1L0Y B;  1BXT A;  2OHF A;  5EE3 A;  4C7Z A;  4A55 A;  5D7G A;  5HI1 A;  1DOI A;  1I7H A;  3NVV A;  3E56 A;  2AQ2 B;  1T5X D;  3HVD A;  2D5G A;  4YSY B;  2PLP A;  1XXG A;  3NRZ A;  2MEK A;  2KQ4 X;  3VR9 B;  1EU3 A;  5TSS A;  3Q69 A;  1GPX A;  3SFE B;  2K3U A;  1YJI A;  1TKY A;  3P4S B;  2WNM A;  1PGA A;  2K5P A;  2Z8L A;  4HEA 1;  2QSD A;  1SE3 A;  1TKE A;  3RPF C;  2RMM A;  1JQ4 A;  4NAM A;  4H2A A;  2VZK B;  5D3I B;  1FM0 D;  3U7Z A;  5HG2 A;  3R8B A;  1VZ8 A;  2JU6 X;  2KDM A;  3I9V 1;  5C2T B;  1TJE A;  3EGR A;  2W3S A;  1YMH E;  3KLS X;  2BYT A;  1NYQ A;  2MJE A;  1N63 A;  3C8Y A;  3H8H A;  1XLN A;  4J3O D;  3VQI A;  4DQO C;  3L4P A;  5EE9 A;  1E0Z A;  4KGR A;  3V05 A;  1VZ6 A;  3VRA B;  1FXA A;  3P4P B;  2IGD A;  2I2Y A;  1SE2 A;  4C80 A;  2CJN A;  2B76 B;  1C4P A;  2DYO A;  1L4D B;  4A6Q A;  1PDX A;  3BVG A;  4US9 A;  3URY A;  4N6E B;  3AV8 A;  4P16 A;  1KRH A;  3BZD B;  1K52 A;  3LYY A;  2BS3 B;  1F2R C;  3SFD B;  3NZ3 A;  1GAQ B;  1YN3 A;  2IDY A;  4MM3 B;  4KGT A;  4NZL B;  4WWM A;  2PVO D;  1JWS D;  2KN4 A;  2ZW1 A;  3AEE B;  5HHD G;  3AE3 B;  3BVM A;  1ET6 A;  1IGD A;  2IGH A;  3VR8 B;  1SJE D;  1XEE A;  2RPV A;  3B2G A;  1PFD A;  2V3P A;  2JYT A;  3P4Q B;  1WWT A;  1IUE A;  2VZK D;  1A70 A;  3MFG A;  4RH6 A;  3PZ7 A;  1OFF A;  3AED B;  4NAW B;  2IJ0 A;  3P63 A;  1QLB B;  4N58 A;  4OZA A;  1D4B A;  1GB1 A;  1VRA B;  4ZRP A;  1YNT E;  4HRS A;  1UWX A;  3AE1 B;  1CQV A;  1N62 A;  3OWE B;  2MJD A;  1C78 A;  2WU5 B;  3NVZ A;  2G9H D;  2LMC A;  3HRD D;  1MPE A;  1VJK A;  2MH7 A;  2FE8 A;  3W9C B;  3B9J A;  2NTT A;  4RGT A;  4YTM B;  2R61 A;  2GI9 A;  1P7E A;  1MHX A;  2WXQ A;  2E6X A;  1FNV A;  4JE3 B;  4D2K A;  1SSN A;  1J7B A;  4GDL B;  2LHD A;  3TEW A;  1ZDX A;  4RF1 A;  4XWT A;  3EA6 A;  1MI0 A;  3ZJU A;  1GB4 A;  1MHH E;  2K0P A;  2BS4 B;  5LNK 1;  2H89 B;  1OQR A;  2TSS A;  1ZXH A;  3MJ5 A;  2L83 A;  1JWU D;  4YSX B;  1UNS A;  1E10 A;  4ZHO A;  1TY2 A;  2FBW B;  1ZE3 D;  2N7J A;  2AQ1 B;  1HEZ E;  2EKI A;  4C7Y A;  1D5X C;  1QIL A;  2LFI A;  4WIP A;  1XLO A;  1EM7 A;  1TY0 A;  2LGI A;  4UDU C;  5I4D A;  1CZP A;  4MH8 A;  2BW2 A;  1JWM D;  3FIL A;  3AM9 A;  4OVZ A;  4DXG A;  3AMZ A;  2K9X A;  2DLB A;  1DOY A;  1TZO A;  2QIE B;  4KKJ A;  2SEB D;  3KWV A;  1IBX B;  1R7S A;  2KWD A;  3KWL A;  2J4X A;  4MT5 A;  4WUR A;  4JWU C;  1TS2 A;  1JCK B;  3AE6 B;  3P4R B;  1NI3 A;  1XLQ A;  2BB5 A;  1XCT L;  1N5W A;  3W5V B;  1B9R A;  3BVZ A;  2WDV B;  2WXR A;  5HFY A;  2QJL A;  1GOZ A;  2E3T A;  4A9A A;  1K50 A;  2DWQ A;  1HA5 A;  3PO0 A;  5E6J A;  4US8 A;  1JAL A;  5GXG B;  3AE8 B;  4ARI A;  3O13 A;  1WRI A;  2H88 B;  3W1S A;  1ZUD 2;  3BYY B;  1J7A A;  2WXN A;  1UUP A;  4XDC A;  3Q8C A;  1V1P A;  2WLB A;  3HVZ A;  3R2I A;  1I4H A;  2INP E;  2ZW0 A;  2NMQ A;  4OHJ A;  1T3Q A;  3IT6 B;  4MAC A;  2WXH A;  1F77 A;  4RGM A;  2BB6 A;  3IAS 1;  4RNA A;  4HKZ E;  4RFB A;  4WH4 A;  2V0G A;  1FD6 A;  4HJG E;  5AUK A;  4YWG G;  4TQ1 A;  1XF5 L;  4OZC A;  2JZP A;  2OED A;  2QMT A;  2CJO A;  1JML A;  2IGG A;  1XCQ L;  2PMV A;  1VLB A;  2WDQ B;  1VDV A;  1D6E C;  5C3J B;  3PZ8 A;  4WQM A;  3AE4 B;  2JX5 A;  4KX6 B;  1F2R I;  1QQR A;  1YN4 A;  2N0S B;  5G5G A;  2BT6 A;  3CWI A;  3SR6 A;  3ZJT A;  1MVK A;  4RGN A;  1WXQ A;  3LXF A;  1ZOY B;  4ZHP A;  3TEZ A;  2BBC A;  4AS1 A;  2WXG A;  2LJI A;  2DYM A;  2JSV X;  4XWW A;  1K53 A;  4LLG M;  2LUM A;  1YQ4 B;  1ZPS A;  3Q8F A;  1D5Z C;  2PW9 A;  3NUH B;  5D3D A;  1C4A A;  1AWD A;  3BII D;  4YSZ B;  1RFK A;  2ONQ A;  5FR3 A;  4HKQ A;  1IBX A;  1VZ7 A;  4A8X C;  1NYR A;  1AN8 A;  4GDK B;  1JW9 D;  1ZDV A;  4IDI A;  2HTM E;  4Q2J A;  5EE1 A;  3DWM A;  4REZ A;  2XNA C;  4XDD A;  3T3O A;  1KH0 A;  1SBB B;  2V3N A;  2WXP A;  3MC0 B;  1FFU A;  2JWU A;  1FFV A;  2FUG 1;  2YEP B;  1DOX A;  1FNU A;  1FEH A;  1SJH D;  5BYQ A;  3P1M A;  3CIR B;  4CQN A;  1UGJ A;  1FNW A;  2BS2 B;  2V4I B;  1F0Z A;  2EEL A;  3FAH A;  1LO5 D;  2LEK A;  4GLS C;  3AEB B;  3Q8B A;  1JWA D;  1L6U A;  1ZP0 B;  2JXT A;  3SEB A;  3GB1 A;  1OQQ A;  1L6V A;  3LB8 C;  1C4C A;  4KKI A;  4TMA B;  5MPO A;  4TQ0 A;  1N60 A;  4R3D A;  5JXV A;  1RYJ A;  4O1N A;  1I4X A;  5H8Y E;  1TS5 A;  4A90 A;  1HXY D;  1SB3 C;  1N61 A;  3WCQ A;  1WSP A;  2JYE A;  2X38 A;  1J7C A;  2AX5 A;  5BYR A;  4WAF A;  5T8I A;  4ITK A;  2WXO A;  3NVW A;  4LTU A;  2J53 A;  1FCC C;  3AE5 B;  4P6V F;  4NJC A;  3Q8E A;  1WYG A;  4AQ7 A;  1KTK A;  3DWG C;  2Y3A A;  1KLG D;  3EUB 2;  1D5M C;  2NTS A;  1KLU D;  1TKG A;  2Y5P A;  1SF0 A;  1RWS A;  1E6E B;  2IPK D;  2AQ3 B;  2W3R A;  4OZB A;  3ZQ4 A;  1M4V A;  3U2S C;  2LHE A;  4PT5 A;  2N9L A;  2RDH A;  3AN1 A;  3BK2 A;  1L0X B;  2W82 A;  1FXI A;  4IKG A;  1C79 A;  2GRI A;  1EWY C;  3I57 A;  4M0W A;  2HDE A;  5EE0 A;  2GB1 A;  1TYG B;  1WGK A;  1JWB D;  1C77 A;  3W2D A;  1ET9 A;  4B0E A;  1HZ5 A;  1K51 A;  2G1E A;  2KAC A;  4LK0 M;  3B2F A;  3VRB B;  3FC4 A;  1CK1 A;  2L1A A;  2L52 A;  2QIL A;  1DGJ A;  3AE7 B;  2J42 A;  3ABV B;  1RM6 C;  2WQY B;  2WS3 B;  3ZGZ A;  2YEP F;  2BTE A;  4HRO A;  3AE2 B;  1QKZ A;  1Y56 A;  2WU2 B;  4N59 A;  1SIJ A;  3HUI A;  2PTL A;  3NS1 A;  2K22 A;  2L32 A;  4YXD B;  2CU3 A;  1I4G A;  3TEX A;  1FIQ A;  1ROE A;  5BMH A;  2WXI A;  1L4Z B;  2QEJ C;  3MP9 A;  5BMG A;  1E9M A;  2RDG A;  3ETR A;  4L2Y A;  3AEF B;  4EE2 A;  2WXJ A;  5G5H A;  3E9S A;  3AEC B;  4L23 A;  3V3X A;  1YQ3 B;  3T3N A;  1QOF A;  3BWU D;  1PUT A;  1N5X A;  3W5U B;  2M19 A;  1QOA A;  1PYW D;  1V1O A;  2INN E;  2N9K A;  1NVI D;  3BK1 A;  1AYF A;  2MJ3 A;  2WXF A;  4RCO A;  1HQR D;  1C9F A;  2J52 A;  5BMI A;  1DYQ A;  2ICI A;  1FCL A;  1NEK B;  2PKO A;  4FXC A;  3AB5 A;  3IXS A;  3FIL B;  1FRD A;  1EWC A;  2Y5C A;  1E7P B;  1SE4 A;  2WDR B;  1ESF A;  4RGO S;  1V8C A;  2PIA A;  3AH7 A;  1ACC A;  4JX1 C;  1JRP A;  2M0A A;  2W55 A;  4L1B A;  2PVG C;  4KGS A;  1V97 A;  2KAJ A;  1P7F A;  1L0V B;  2WXL A;  3UI3 A;  1STE A;  3NVY A;  2M56 B;  1TS3 A;  3IAM 1;  2I38 A;  1T6B X;  4ARC A;  4ZYS A;  1NEN B;  3U52 E;  4YT0 B;  1L5P A;  3ZJV A;  1YJJ A;  1KF6 B;  3RFZ B;  2JQR B;  4XE0 A;  5AUI A;  3AEG B;  4JWS C;  3GP7 A;  2Q5W D;  3KQ4 A;  4YTN B;  3TEY A;  1EU4 A;  3P42 A;  1BML C;  1YN5 A;  1PGX A;  1HZ6 A;  2ACZ B;  4JPS A;  1QOG A;  2SAK A;  1PGB A;  5H92 C;  1I4Q A;  3J9C A;  1SEB D;  1XLP A;  4IOI E;  3TSS A;  1C76 A;  1V1P B;  3AEA B;  2WP9 B;  1XO3 A;  4ZRQ A;  2ON8 A;  1JRO A;  3IT4 B;  1KFY B;  1SXT A;  3N9Y C;  1FMA D;  3GS2 A;  1TS4 A;  3MHZ A;  3BYT B;  2DBY A;  1QT9 A;  4OW0 A;  1CJE A;  4ZOH C;  1IGC A;  3TUO A;  1FRR A;  5BYS A;  3R2T A;  1B1Z A;  3U4E G;  2XN9 C;  3ZYY X;  1I4P A;  1I4R A;  4TSS A;  4DXF A;  4RF0 A;  1QF6 A;  2WXK A;  4YTP B;  5FK9 C;  2KMM A;  1BUI C;  1QOB A;  2WXM A;  2W54 A;  1Q10 A;  3AE9 B;  1VR9 A;  1UWM A;  4USA A;  5FKA C;  1ENF A;  1ZXI A;  4C56 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...