1QOBA

Ferredoxin mutation d62k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
b'ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSKQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qobA00
3AN1A 1I7HA 1XO3A 1N5WA 2H89B 3FAHA 4ZHOA 2BS4B 1XLOA 2KAJA 3AEAB 2PKOA 1ZP0B 1OQQA 2JX5A 5G5HA 3AE7B 2K22A 2WS3B 2CJOA 3NRZA 3AH7A 1YJIA 3AEBB 1E6EB 3ZYYX 1FM0D 2W3SA 1TKGA 1VJKA 2FBWB 3HUIA 2W55A 1N61A 2JQRB 2WDRB 2WQYB 4ITKA 2H88B 1KFYB 1E9MA 2MJEA 4YSXB 3DWMA 3NVYA 5EE9A 3AE1B 1YJJA 3P4SB 2DBYA 4ZHPA 4YT0B 1NYRA 2PVOD 2Y5CA 4C7ZA 2WDVB 3AE3B 4YSZB 1NEKB 4YTMB 5EE3A 2ACZB 5AUKA 4A9AA 3FC4A 3RPFC 4JX1C 1FXAA 3B9JA 3NVVA 1RFKA 1NI3A 3P63A 1WYGA 3P4PB 3AM9A 4FXCA 5G5GA 1XLQA 1XLNA 2CJNA 3B2GA 4KX6B 1OFFA 1T3QA 2BS2B 2W54A 4N58A 2MJDA 1PDXA 1QLBB 1QOAA 3CIRB 1DGJA 4IDIA 1GPXA 2AX5A 3AV8A 2W3RA 3AB5A 3P4QB 1E0ZA 1SF0A 3AE4B 1NENB 3KWLA 3AE6B 1QOGA 2G1EA 1KF6B 3AMZA 4N59A 3WCQA 1DOYA 3AECB 3W5VB 1WRIA 3VR8B 2HTME 3ETRA 3AE2B 2K5PA 1CJEA 5MPOA 1F0ZA 2BT6A 1ZXIA 1FFVA 3P4RB 1NVID 2MJ3A 3HRDD 4HRSA 4USAA 4US9A 2PVGC 1J7BA 1FFUA 1L6VA 1TYGB 4YTNB 1E7PB 1QOFA 1JRPA 2B76B 3AE5B 3DWGC 3SFDB 1QOBA 2L83A 2MH7A 1WGKA 1FO4A 2WDQB 1J7AA 2LEKA 5EE0A 3VRAB 1J7CA 1NYQA 2WU5B 2WLBA 4HROA 2DWQA 1SB3C 1TKYA 1UWMA 2WU2B 1JQ4A 5EE1A 1EWYC 1N5XA 1L0VB 1ZUD2 4WWMA 2K9XA 1FMAD 3ABVB 3EUB2 5GXGB 1AYFA 1PUTA 3SFEB 3AE8B 3PO0A 2E3TA 4US8A 1DOXA 3NVWA 3SR6A 1OQRA 1FRRA 2Q5WD 1YQ3B 3CWIA 5C2TB 3W9CB 1GAQB 2PIAA 3AE9B 3VR9B 1TJEA 1TKEA 2M19A 1CZPA 1WXQA 3HVZA 5H8YE 1L6UA 3NS1A 1JWBD 1QT9A 1R7SA 1QF6A 3NVZA 1JW9D 1N63A 4YXDB 4N6EB 3B2FA 3AEEB 1SIJA 1PFDA 1RWSA 4JWUC 1JALA 3L4PA 1JWAD 1L5PA 4JWSC 4LTUA 1WWTA 3LB8C 2QJLA 3BIID 2OHFA 5C3JB 1YQ4B 2QIEB 1IUEA 4C7YA 2N0SB 3W5UB 4C80A 2M56B 4WQMA 1FXIA 1XLPA 1FIQA 1V97A 1RM6C 1JROA 4ZOHC 1KRHA 1N62A 2CU3A 1VDVA 1E10A 1ROEA 1ZOYB 2L52A 4P6VF 1A70A 2EKIA 1FRDA 5H92C 1RYJA 3LXFA 5AUIA 3AEDB 1VLBA 2WP9B 1B9RA 1AWDA 1DOIA 1V8CA 4YTPB 3VRBB 2BS3B 2KMMA 1N60A 3P1MA 4YSYB 3AEFB 3AEGB
chains in the Genus database with same CATH superfamily
3DBHB 2KOXA 3HM3A 4ITKA 2NMQA 1GUAB 2KZRA 2O6VA 4ZYNA 3A9JB 4MM3A 4ANWA 1K52A 2IGDA 2VZKD 5HG2A 1L2NA 3S2AA 3UF8A 3FC4A 4JX1C 2M17A 5E6JA 2PMVA 3VUXA 3EHVA 3KUZA 2XN9C 1DGJA 2OJWA 1QZEA 5EDSA 3BK2A 3HIZA 1KLVA 1YD8U 4MACA 3N1XC 2KVZA 3H1UA 5BMIA 4OVUA 4QAYA 3NG0A 1WIAA 4US9A 2YEPB 3DWGC 4URKA 1QOBA 1K53A 4C00A 3Q8CA 2EELA 4OHJA 2INNE 4HROA 1T6BX 1E5WA 2E3TA 3U7ZA 4W9DA 2WXOA 4JLCA 2Q5WD 1I4RA 1ZXHA 3QAQA 3N9YC 2NCNA 3BVMA 4RGMA 1GOZA 1JWBD 1OEYJ 3B2FA 1WJUA 4AWJA 4B6WA 4BKTA 1NBFC 1V1OA 2KN5A 2N0SB 4C80A 3K9PB 1WI0A 3IHPC 5D6JB 2LJ5A 1WXVA 4FJZA 1JCKB 1WH3A 3AEDB 1AARA 3VRBB 1EU4A 3P1MA 2LXCA 4DWFA 2CS4A 4MSMB 2M0XA 3GS2A 4HXDA 3QHTA 4EZKA 3I5JC 1YN5A 4MELA 1Q10A 1P9DU 1VZ8A 2J53A 4ZRPA 3NVYA 2OEDA 1SIFA 2W9NA 2LHDA 2AQ3B 3A9KB 2Y5CA 4HJGE 2WXPA 2NBVB 5CHFA 1C4PA 4HWIB 3JSVA 3R2IA 4WJQA 1CJEA 4A8XC 2BT6A 4NPNA 4ACFA 2HTHA 1JRUA 2Y5PA 3C19A 1WYWB 2LHEA 2HJ8A 4MSQB 2KD0A 3FILB 1P7EA 2RDHA 2OJRA 3AULA 1L0VB 1CQVA 1VZ7A 3Q2AC 1L0XB 2O2VB 2YVCA 4ICVA 1ESFA 4KIKA 2Z59B 4FN2A 3OWEB 2V3PA 3R66C 3VTWA 1WGGA 1WRDB 3WAMA 1TY2A 2E6XA 3L16A 2PPHA 3L0WB 1EUVB 4A90A 1WM2A 5BMHA 2D3BA 1FEHA 3DBRB 1V97A 2M4NA 2UWQA 4MGIE 2Y3AA 5T8IA 4K1RB 5HKHA 4P6VF 4W9CA 5DPRA 5BYQA 1V8CA 2G45B 1N60A 4LNNA 1MHHE 4CO7A 4GIVA 4YWGG 5J17A 3AEAB 3UGBB 2J0MA 4NJ6A 5G5HA 3DPDA 3ZYYX 2SAKA 4HEA1 4NJCA 4KSKC 2WDRB 1UH6A 3CMMB 2O6VD 2PEAA 4LCDE 4YT0B 3C8YA 3I57A 1YX5B 4D2KA 4RGNA 3PZ7A 2BYVE 3VH4B 1UUPA 3U7DA 4AQ7A 1I4PA 1XEEA 2JWZA 4IKGA 2JZPA 2MP2B 3EECA 1P98A 3AECB 3W5VB 2N9EB 3VR8B 2K5PA 2KTRB 3PRPB 5MPOA 4A20A 2JYEA 2KWVB 2N1VA 2KTFA 2NBWB 1WR6E 2KN4A 4IWOA 1WGKA 1OGWA 1FXTB 3JVZX 3RULA 1J7CA 3BVZA 3ONSA 4MGYE 3TSSA 1IBXA 3ABVB 3GP7A 1WXMA 3Q3OC 3QWZB 1FRRA 3CWIA 3SDLC 4FHJA 3L08A 4BFRA 4HJKA 5AEKB 1MI0A 2LZ6A 2QJLA 2WHIA 2N7DA 1QKZA 5C3JB 5D7GA 1VRAB 2L32A 3IAS1 5G55A 4A55A 2V4LA 2RGFA 3IT4B 2JT4B 4ZRJA 2WXRA 5BYRA 2N9XA 2FE8A 4HCNB 3VFKA 3URYA 1YQBA 4GDKB 5AZFA 2MBEA 2HJ1A 1XLOA 2A4ZA 3I63C 1B1ZA 3TEZA 2GBMA 1ZDXA 2I2YA 3VUWA 1RLFA 5TR5A 3W1SC 3UQBA 4M00A 2KNBA 3PZDA 1SJED 1YN3A 5FK9C 3TIXA 2BS2B 2KHWB 2W54A 1PDXA 1QLBB 4PS8A 4IDIA 2DHZA 1BT0A 3ML8A 3AMZA 2G4SA 3AI5A 4KGTA 3OJ3A 1E8XA 2JUOA 4K3CA 2RPVA 3Q8EA 3ZXVA 1TS2A 1KLUD 4WJOA 4GLSC 1QILA 4IG7B 2K8BA 1T0YA 1ZUD2 1FMAD 2BYTA 2GMIC 4DDGD 1PGXA 1FCLA 1TZ1A 1ACCA 1JWUD 4MH8A 4YXDB 2INCC 1JALA 2JYTA 4S0RA 4ZDVA 3RCZA 2BPSA 4DQOC 4C4VB 3IG3A 3B0AA 4LDTB 1DYQA 1V1PA 4W9IA 1C3TA 3MJWA 4BOSC 1WX7A 1FRDA 3GE8C 2V4IB 2BS3B 2WLBA 4K7WA 2BS4B 1XF5L 3L10B 2LRUA 1OQQA 2NPTB 4GDLB 4AS1A 2W3SA 4IWPA 2WQYB 5J2RA 2JY6A 2QHOA 2N9LA 2DZJA 2AYOB 4AJWA 2CHWA 2D3GA 2FAZA 1KTKA 4EZLA 1UWXA 3DVGY 2Z0EB 2HD5B 1FCCC 2LWPA 1JMLA 4W9LA 2C7NB 3P63A 1NI3A 1LQBA 3B2GA 1MG4A 4L23A 1JWSD 1VZ6A 1ZE3D 1WE7A 4NAWA 3AE4B 3LYYA 1V49A 4JGHB 5TSSA 4KGSA 3V60A 2WXIA 1WFYA 1HA5A 2LUMA 5IOIA 3MC9A 2L00B 5HI1A 4IW0A 1ET6A 3FKYA 3TCAA 3T3NA 3AE5B 4PYUA 2O2VA 3M63B 4WH4A 1NYQA 4HCPB 1TKYA 2WXJA 2FUG1 4KGRA 3QARA 3APCA 2N4FA 2KQ4X 5FKAC 1WXAA 4DXAB 3I3TB 3ZTDA 3KWVA 5AZHA 3NS1A 1HEZE 1Q0WB 2LVQA 2BF8B 4II3B 4II2B 2V9HA 3R2TA 4UDUC 4PS3A 2G4DB 2WWZA 2PE6B 2JRIB 1A5RA 3VXWA 1WSPA 2K0PA 1E10A 2L52A 1R4NB 2X38A 2C7MB 5H92C 2WXGA 4DHJB 3V6EB 1PGAA 3ZNZB 2DZMA 4WAAA 4CHKA 5C23A 1PGBA 4DDID 2NTSA 4MH0E 1J19A 3ZIMA 3HUIA 2W55A 1N61A 1WX8A 1F1HA 5LXIB 1R4NI 2PTLA 4RH6A 1F52A 4ZHPA 5J18A 1H4RA 2SEBD 4YSZB 2MP2A 1R4MB 3AM9A 3V6CB 1M4VA 3MHSD 4YL8A 2KT7A 3EFCA 3JW0X 4FA6A 2KQ7A 4F8CB 2UU7A 3R7RA 3QJZA 1OTRB 5IP4D 1KF6B 2WX1A 4N59A 3WCQA 1IYFA 3QIJA 2IYDB 2L05A 2ZZPB 1WZ0A 3NOBA 4USAA 1BXTA 4OW0A 1NDDA 1R4MI 1TIFA 2ZJDA 4IM0A 2DZKA 3BYTB 5IN7A 2LGYA 2WXFA 4LJPB 5CHVC 3DCGA 3M62B 5I4DA 1SSNA 3QQ8B 1WGYA 3RNFC 3SFEB 3HK0A 3WANA 2FCNA 3M95A 2JVCA 4WWNA 1LFDA 2JU6X 4G50A 3H7PB 1R7SA 2KWCA 4JPSA 1N63A 4TV3A 1RFAA 4LNFA 4JWSC 1ZDVA 3NHEB 2QC8A 4ASWC 2XK5A 4MJSA 3W5UB 4GN1A 1HTOA 4FJVB 4LNOA 2CKHB 4GDKA 3MHZA 1XCQL 3LJ3A 2WP9B 2J7QB 2QEJC 2LRWA 5D3DA 3L13A 3U2SC 1I7HA 2ZW1A 2H89B 4ARIA 4TQ0A 1ZP0B 3H6NA 1FD6A 3DBLI 1C77A 4WQOB 2KFKB 3RI7C 3P2BA 5IAAC 1LXDA 1JWMD 5EE9A 2KVRA 3RN9C 3RNEC 2RDBC 3RUIB 3DOWA 3RNAC 1TZOA 3E9SA 3C0RB 4YTMB 1D5MC 3N20C 3TUOA 2LXAA 2BGFA 4FXCA 1MJDA 3QK0A 1WM3A 5KHOA 4M01A 4IWQA 2L0TA 2BBCA 2FUHB 1QOGA 4REZA 2IY1B 1D5XC 1ZXIA 4AJYB 3ZNHB 2PVGC 1LGRA 3U4EG 2B76B 5JZEB 4FJYA 3ZJTA 1FO4A 3P42A 1HZ6A 2CR5A 3PGEA 4M0WB 1SJHD 2KDFB 1SB3C 3DVNV 3PREA 5D2MB 2RD0A 1UELA 3DHHC 3AE8B 2REXA 2CHXA 4DHZB 2PIAA 2V3NA 2M19A 5H8YE 2K8CA 1QT9A 1GJZA 2NR2A 1U4AA 4G3XB 5DCNA 3AEEB 1L0YB 1WGDA 3ZLZA 1L5PA 3UIOB 3AU4A 2K6DB 1VR9A 4FHKA 2OHFA 3DDCB 1OEYA 1YJ1A 2KMAA 1C78A 3GZNB 4XE0A 4ANVA 1N62A 2BKFA 3T3OA 3IVFA 1P1AA 1D3ZA 3IXSA 3EC8A 1RYJA 3LXFA 3GB1A 4G11A 2NPTA 2VRRB 4YTPB 4GDLA 1IPGA 1Z5SB 3IAM1 4ZHOA 2LGDA 3EA6A 3SHQA 4H2AA 1D5ZC 2AEHA 3GZNI 3PVLA 4W9FA 1TTNA 4WJPA 2GOWA 3L54A 1E9MA 4N9F4 2MJEA 1WY8A 2WXQA 2MSED 1ZKHA 5C1ZA 4C7ZA 4A9AA 2N9KA 3BYYB 1C4CA 4DXFA 4WWOA 3Q14C 4XWTA 2K25A 3RZWC 1KLGD 2TSSA 1QOAA 3CIRB 3HHMA 4RFBA 2QDFA 4Q2JA 1NENB 2G1EA 1PYWD 2OOBB 4NQKE 2HTME 2RSUA 2AL3A 5E6PA 4K7SA 2MJ3A 1P0RA 2CHZA 3SD5A 2ZVOA 2AL6A 1TYGB 1E7PB 1QOFA 2W82A 2WX0A 3U8ZA 1WX9A 5EE0A 2KJ6A 4A3OA 2L0FA 1C9FA 1TBEA 5DPWA 1MFWA 3KQ4A 4EZJA 1EWYC 4DK5A 1HTQA 4CYEA 1K8RB 3NY5A 3SR6A 2XNAC 3N1ZC 4I6PA 2AQ1B 1CZPA 4J6IA 3ZRFA 2WXMA 2KX0A 3Q3FA 1V2YA 1F77A 2V0GA 1PFDA 1XQQA 3LB8C 1UGMA 3IBEA 2BB5A 4PYZA 2XBBC 4EE2A 1RM6C 1F2RI 5AZGA 2ZNVB 1VDVA 4OZBA 4NJ7A 1A70A 2YLMA 2V1YA 2KMCA 3T8MA 3ZNGC 4HK2A 1EF1A 5DPTA 4YSYB 4EKUA 2KC1A 2DENB 4RF1A 2K22A 4GGQA 1EM7A 4KKJA 2Z0DB 4HPLB 1N6ZA 3BY4B 3HM6X 2DYOA 1C4AA 3OLMD 3TEYA 1YJJA 3Q69A 4LLGM 1NYRA 4WWPA 3Q8AA 4KZ0A 1VCBA 3A4RA 4KX6B 1P7FA 4JE3B 3W1SA 3AV8A 1KOTA 3A9JA 2D10A 1DOYA 4HVBA 5CHWA 3AE2B 2N9PC 1WJNA 1AN8A 3P4RB 4XX5A 4P16A 1EWCA 1UZXB 1Y56A 4XYCA 3VAWA 3Q8FA 1KJTA 2PW9A 2KK8A 2MH7A 2J4XA 4RM9A 3BINA 3R3MA 1J0GA 1STEA 2BYEA 1L4DB 3PT2B 3VQIA 2WU2B 2DYBA 1N5XA 1SEBD 3PHXB 2MRPA 3L17A 1DOXA 2JXTA 2VH2A 1G6JA 2IO0B 2D5GA 1I4XA 1GG3A 1NI2A 3ZTCA 2WDTB 2JRHA 4LDTD 1WWTA 2KC2A 1AW7A 4OVVA 1YQ4B 4K3BA 3GE3C 2M0AA 1UNSA 5LNK1 3QC8B 3VVWB 3N30A 3KH0A 1DOIA 1SGHA 1E7UA 2FIFA 1UGJA 2KAJA 3MTNB 3PTFC 3MP9A 1TT5B 1YJIA 2R61A 2PE9A 1TKGA 2FBWB 3MC8A 2ZPNA 4WAFA 2RMMA 2H88B 5IA7A 1KFYB 4FULA 1I35A 2DYMA 3JSVB 3NZUA 4W9KA 4R3DA 2D2QA 4HLEA 1TS3A 2PVOD 4M8MA 3UINB 4KVGB 2D3CA 4EEWA 1TY0A 2N1WA 3H9DA 4XGAB 5E6NA 3R7QA 2I1KA 4BVUC 1KM7A 2AX5A 1PQSA 1SF0A 2MX2A 3KWLA 1WJ6A 1SE4A 1UBIA 4W9JA 3A9KA 4KKIA 2IDYA 2KO3A 3A1QB 5L95C 2IZVB 1NVID 4M0WA 4F7ZA 2KFJA 5JXVA 2MBBB 1Q1OA 2WDQB 1BUIC 2LEKA 2DX5B 1IP9A 4GXBA 3KUCB 4XZ4A 4IM2A 4IM3A 3MJ5A 1PUTA 2C9WB 3UI3A 4G0NB 3WA0A 4X57B 3VR9B 2KDEB 4TQ1A 3FILA 1QF6A 2J42A 4RGOS 1SIJA 1ZGUB 2JF5A 5LXHA 2QIEB 1Z2MA 4PS7A 2MWSB 1FIQA 3ZJUA 4MGZE 2CU3A 1GB4A 2LJIA 2KWUB 1E8ZA 1MVKA 5AUIA 3NJTA 1VLBA 4JIOU 3N32A 4ZRQA 2KMMA 2C7HA 2ZEQA 1ZW7A 4E3CA 2ZCCA 3AN1A 4OVZA 1ISNA 3PZ8A 3J9CA 3TL5A 3R8BA 3AE7B 2WS3B 3NRZA 3VHTC 1J8CA 3N1YC 4MDKE 1FM0D 3Q6BA 1WR1A 3MFGA 4DXGA 4P1BC 3AE1B 3P4SB 2DBYA 4MGKE 4IC7B 2RR9A 3AE3B 2N7JA 1HZ5A 1WYGA 3DQVA 1T3QA 4PT5A 3AB5A 4XDDA 3CSTA 4NAMA 4EUTA 3AE6B 3LDZE 5BYSA 1M94A 4W9HA 1T0QC 1HE8A 2FCQA 1P3QU 4XWWA 2K1FA 5BO4B 4A6QA 3VTUA 3PLVA 2IGHA 1IBXB 4HRSA 1J7BA 1WGRA 4A3PA 3ZJVA 1XT9B 2L83A 4NNJB 2K8HA 2LMCA 4ZYSA 5KHQA 1L4ZB 2KTRA 1JQ4A 3TEXA 1WMHB 4WWMA 2BQQA 3EUB2 1ENFA 1K51A 2KANA 2KXJA 2JZ3B 3NVWA 1F2RC 4BBNF 2MBQA 3W1YA 1YN4A 2WXKA 4E74A 3KLSX 3ECIA 4JWUC 5D3IB 2I1JA 2KDMA 3BIID 1FXIA 2Z8LA 2KDIA 3UQAA 1JROA 2QCZA 1K50A 2ZNVC 3QCAA 3WALA 1FNUA 3DBHI 3H8HA 2JX5A 1WZ3A 4FBJB 4PK1A 1WJ4A 3DHIC 3AEBB 2JWUA 4AUQC 1FNWA 3DBLB 3W2DA 2GBNA 4FLHA 4LNKA 4B0EA 3ZXRA 3ZW3A 1V6EA 2FIDA 5JH5C 1I42A 2KWDA 5AUKA 3T9LA 1FXAA 2MA9B 4ANUA 2G3QB 2DAJA 4GU2A 4TKNA 3RFZB 1LM8B 3JYUA 2VZKB 4OZAA 3WIMA 1E0ZA 1V5OA 1WGHA 2BKRB 4XC2A 1F0ZA 1QQRA 4IUMB 2D07B 1SXTA 2LVPA 1JRPA 4K7UA 3PRMB 3V62A 3NS8A 2WXHA 3N3KB 5HHDG 1MHXA 2WU5B 5GMVA 3OG5A 1E90A 2M1MA 3EFUA 4GB9A 4US8A 3Q3MC 1FPYA 1S1QB 3HVDA 2INPE 3W9CB 4DHZE 1TJEA 1L6UA 2IGGA 1V1PB 3ZUNA 4KSLC 3WAOA 1JWAD 1EO6A 1T5XD 2WXLA 1I4GA 3KVFB 3DHGC 4S17A 3BK1A 2R2QA 3TBLD 3CSFA 4L1BA 2J0KA 2WGSA 1KRHA 3V05A 2QMTA 4JQWC 4ANXA 4ZRKA 2EKIA 2ONQA 5CX3A 3DVGX 2GBKA 4C4VA 4EFOA 1XO3A 1E7VA 1N5WA 2GB1A 2MHJA 2WYQA 3ALBA 3FAHA 1V9JA 2JZZA 4DBGA 4RGTA 2LVOA 2L1AA 2JQRB 1HXYD 2M8SA 4YSXB 2MBOA 3PSEB 4NAWB 3B1LX 4NY0A 3X23A 4P7IA 1I4HA 3PV1A 4P1CC 5EE3A 3RPFC 3MC0B 2UYZB 3PHWB 2GBJA 5G5GA 1OFFA 3Q8BA 1CK1A 3A1QA 3EGRA 3TEWA 1MPEA 1EF5A 1UF0A 2NVUI 1C76A 4AOFA 1BMLC 2MCNB 4GMVA 1FFVA 4HDQA 2Y5BB 1ZPSA 3HRDD 2KKCA 2ZW0A 1FFUA 3DBSA 1L6VA 2IPKD 1S3SG 2GLSA 4J3OD 2ZVNA 2EKEC 4K81A 4W9EA 1WXSA 4KDIC 5EE1A 2ON8A 2JPHA 2LGIA 4BOZB 1YOVB 2K9XA 3KW5B 2MW5A 1SE2A 5CTRC 1YQ3B 3K9OB 5C2TB 1GAQB 2JXXA 3APDA 3HVZA 4RM8A 3O13A 2R2OA 3ML9A 2IJ0A 5L83A 4NQLB 3ZKJC 4LTUA 5DPSA 1GB1A 3DBRI 2BWES 1X1MA 4C7YA 2M56B 2FCMA 2GBRA 1Q5WB 4EOYA 4CQNA 1XLPA 3NUHB 5IKCM 2AQ2B 2G9HD 3A4SC 2KX3A 1SE9A 5BMGA 4B95A 5LLIA 2NBUA 3IFWB 2PKOA 3DVNU 2HE7A 3BZDB 3E56A 1SBBB 2BYFA 1D4BA 1D6EC 2MLBA 2LD9A 3DWMA 3ZVVA 3VH3B 2KLGA 4W9GA 1I4QA 2WDVB 2DZIA 3RZFA 2ACZB 2INDC 3AU5A 2O6VB 3NZ3A 5HFYA 1GNUA 1TGZB 3NVVA 4B0MA 1F9JA 2ICIA 1XLQA 4C56C 4MM3B 2MJDA 4N58A 2LGXA 2EMTA 2W3RA 3P4QB 3SU8X 3TJPA 1C1YB 4BKGA 3UIPB 1XXGA 5FR6A 1WMHA 3KUDB 3V3XA 1Y8RC 3PS6A 2J0JA 4BKSA 4LK0M 2V3SA 4MEMA 1LO5D 3WAPA 5GXGB 3RNCC 1IGCA 3B08A 2XK5B 4MJSB 2LUEA 1WXQA 3NVZA 1JW9D 4F1SA 5E6OA 1T0RC 2KQSA 4M8NA 5JHAA 2JSVX 5FR3A 4TMAB 4OZCA 1RRBA 2MQJA 4GSWA 1IUEA 2MEKA 2WXNA 2CU1A 3IT6B 3H7PA 3ZO5B 2RPQA 2DNFA 4L2YA 1ROEA 1ZOYB 1VD2A 1CMXB 2KDBA 3OAWA 4KDLB 3M3JA 3D32A 4I6NB 1E8YA 2IO2B 2CJOA 3AH7A 1E6EB 2ASQA 4FADA 2K6QA 1GC7A 1IGDA 2BVCA 3NZSA 4ICUA 1YMHE 4XDCA 4HKZE 1NEKB 3B9JA 5D94A 2HDEA 1YX6B 2RDGA 1XLNA 2C60A 2KFKA 2K39A 2L76A 2K3UA 3RMKC 1GPXA 2VH1A 2DLBA 1WRIA 1C79A 1L7YA 2PJHA 3ETRA 1H8CA 2D3AA 4RCOA 4WJNA 3ZDMC 4M02A 3U52E 3SFDB 2IO1B 2KYWA 2IBIB 4ARCA 1EU3A 4MT5A 3A33B 3GOEA 2GI9A 1UWMA 4HPPA 4WIPA 2BWFA 2B3AA 3QX1A 1AYFA 1WE6A 3PO0A 3Q3NC 1OQRA 3PLUA 4RNAA 2NS5A 3AE9B 3RNBC 2AWTA 3Q3JA 5G2NA 2GRIA 4N6EB 4KIKB 1RWSA 4BZAA 1GC6A 2J52A 2XEWA 4HDOA 2EMSA 4NZLB 4LJOB 3KYDD 4WQMA 2A5UA 4TUUA 4ZOHC 2YEPF 2IO3B 4I6LB 2KLCA 1B9RA 1AWDA 1V5TA 1SE3A 3AEFB 1V86A 4E71A 1T0SC 2MBHA 2LFIA 2PLPA 4HKQA 2LGSA 3BVGA 2KJHB 2I38A 3VTVA 1VJKA 3RNGC 1TS5A 2D11A 1OQYA 2C5LC 1V81A 2IY0B 4DHJD 2KACA 3KYCD 2ZCBA 2LI5A 2L8JA 4WURA 4BBNC 3ENEA 3OJ4B 1RFKA 3P4PB 4O1NA 2BTEA 2L7RA 2CJNA 1TS4A 4BAXA 1UD7A 2WNMA 1HQRD 1UBQA 1YIWA 3I9V1 1WF9A 3ZNID 4IOIE 2KJRA 2LASA 3SEBA 4GOCA 4LNIA 1V80A 4B9KA 1YNTE 4JL9A 2NTTA 3ZRCA 2FCSA 2X8XX 3RT3B 3X0WA 5JHBA 4YTNB 3V61A 3H7SA 3ZDTA 3RYTA 1J7AA 4HPMB 3VRAB 3AXCA 3RD2A 3O65B 2QSDA 3TMPB 2DWQA 1E8WA 3CF6E 1MG8A 3BWUD 3PPAA 4BKSD 4ZRIA 2DAFA 2FNJB 2L3ZA 1KH0A 3APFA 2QILA 1TKEA 1ET9A 1RAXA 2BB6A 5IO9A 3U30A 3PRZA 3L4PA 4KV2A 4TSSA 1XD3B 1FNVA 2BW2A 3VUYA 4AP4C 2ZPYA 1XCTL 4RF0A 4KZCA 2N7EA 3ZGZA 3VDZA 4RMAA 3ZQ4A 3QA8A 3AEGB
chains in the Genus database with same CATH topology
1XO3A 1N5WA 2GB1A 3FAHA 2BS4B 1XF5L 4RF1A 1OQQA 2K22A 4GDLB 4AS1A 4RGTA 1EM7A 4KKJA 2W3SA 2L1AA 2JQRB 2WQYB 1HXYD 4ITKA 2NMQA 2N9LA 2DYOA 4YSXB 1C4AA 4NAWB 3TEYA 1YJJA 3Q69A 4LLGM 1KTKA 1NYRA 1I4HA 1UWXA 3Q8AA 1K52A 2IGDA 2VZKD 5HG2A 5EE3A 1FCCC 1JMLA 3FC4A 3RPFC 4JX1C 3MC0B 5E6JA 3P63A 1NI3A 2PMVA 5G5GA 3B2GA 4KX6B 1OFFA 4L23A 3Q8BA 1CK1A 1JWSD 1P7FA 1VZ6A 3EGRA 4JE3B 2XN9C 1DGJA 1ZE3D 3TEWA 3W1SA 3AV8A 1MPEA 3AE4B 3LYYA 1DOYA 3BK2A 1C76A 1BMLC 4MACA 5TSSA 3AE2B 4KGSA 2WXIA 5BMIA 1HA5A 1FFVA 2LUMA 1AN8A 3P4RB 1ZPSA 3HRDD 4P16A 1EWCA 4US9A 1Y56A 5HI1A 1ET6A 2ZW0A 1FFUA 3Q8FA 3T3NA 1L6VA 2IPKD 2YEPB 3DWGC 3AE5B 2PW9A 4J3OD 1QOBA 1K53A 2MH7A 2J4XA 3Q8CA 1STEA 2EELA 4WH4A 1L4DB 1NYQA 3VQIA 4OHJA 2INNE 4HROA 1TKYA 2WU2B 2WXJA 1T6BX 5EE1A 2ON8A 2FUG1 1N5XA 2LGIA 4KGRA 1SEBD 2K9XA 2KQ4X 1SE2A 2E3TA 3U7ZA 5FKAC 1DOXA 2JXTA 2WXOA 2Q5WD 1YQ3B 5C2TB 1I4RA 1ZXHA 1GAQB 3N9YC 3KWVA 2D5GA 3BVMA 3HVZA 4RGMA 3NS1A 1GOZA 1I4XA 1JWBD 3O13A 1HEZE 3B2FA 2IJ0A 3R2TA 4UDUC 4LTUA 1WWTA 1GB1A 1AW7A 1V1OA 1YQ4B 4C7YA 2N0SB 4C80A 2M56B 4CQNA 1XLPA 2M0AA 1UNSA 1WSPA 3NUHB 2K0PA 5LNK1 1E10A 2L52A 1JCKB 2AQ2B 2G9HD 2X38A 5H92C 3AEDB 2WXGA 1DOIA 3VRBB 1EU4A 5BMGA 3P1MA 1PGAA 1UGJA 2KAJA 3GS2A 2PKOA 3MP9A 1PGBA 2NTSA 1YJIA 1YN5A 2R61A 3BZDB 3E56A 1TKGA 1SBBB 2FBWB 3HUIA 2W55A 1N61A 1D4BA 1D6EC 1Q10A 2RMMA 2H88B 4WAFA 1KFYB 1VZ8A 2J53A 2DYMA 3DWMA 4ZRPA 3NVYA 2PTLA 2OEDA 4RH6A 4R3DA 4ZHPA 2LHDA 2AQ3B 1TS3A 2PVOD 2Y5CA 1I4QA 2SEBD 2WDVB 4YSZB 4HJGE 2ACZB 3NZ3A 2WXPA 5HFYA 3NVVA 1TY0A 4B0MA 2ICIA 3AM9A 1C4PA 1XLQA 1M4VA 4C56C 4MM3B 2MJDA 4N58A 3R2IA 2AX5A 2W3RA 3P4QB 1SF0A 3KWLA 1KF6B 1SE4A 4N59A 3WCQA 4KKIA 2IDYA 1CJEA 4A8XC 2BT6A 1NVID 4M0WA 4USAA 1BXTA 4OW0A 5JXVA 2Y5PA 2LHEA 1XXGA 3V3XA 2WDQB 3BYTB 1BUIC 2LEKA 2WXFA 3FILB 1P7EA 2RDHA 4LK0M 5I4DA 1L0VB 1SSNA 1CQVA 1VZ7A 1LO5D 5GXGB 1IGCA 1L0XB 1PUTA 3MJ5A 3SFEB 1ESFA 3UI3A 2JU6X 3VR9B 3OWEB 2V3PA 1WXQA 4TQ1A 4JPSA 1R7SA 3FILA 1QF6A 3NVZA 1JW9D 1N63A 2J42A 4RGOS 1SIJA 1TY2A 2E6XA 2JSVX 5FR3A 4JWSC 1ZDVA 4TMAB 4A90A 4OZCA 5BMHA 2QIEB 1IUEA 1FEHA 2MEKA 2WXNA 3W5UB 1FIQA 1V97A 3ZJUA 3IT6B 2Y3AA 4L2YA 2CU3A 5T8IA 1ROEA 1XCQL 1ZOYB 3MHZA 4P6VF 1GB4A 2LJIA 5AUIA 1MVKA 5BYQA 1VLBA 2WP9B 1V8CA 2QEJC 5D3DA 4ZRQA 2KMMA 1N60A 3U2SC 1MHHE 3AN1A 1I7HA 2ZW1A 2H89B 4OVZA 4YWGG 4ARIA 3AEAB 3PZ8A 4TQ0A 1ZP0B 3J9CA 5G5HA 3R8BA 3AE7B 2WS3B 3NRZA 2CJOA 3AH7A 3ZYYX 1E6EB 1FM0D 1FD6A 1C77A 2SAKA 4HEA1 4NJCA 2WDRB 3MFGA 4DXGA 1IGDA 1JWMD 5EE9A 3AE1B 3P4SB 2DBYA 4YT0B 3C8YA 3I57A 4D2KA 4RGNA 1TZOA 1YMHE 3AE3B 3E9SA 3PZ7A 4HKZE 4XDCA 1NEKB 4YTMB 1D5MC 3B9JA 2N7JA 1UUPA 2HDEA 3TUOA 1HZ5A 1WYGA 4FXCA 4AQ7A 1I4PA 1XEEA 1XLNA 2RDGA 1T3QA 4IKGA 4PT5A 2K3UA 2JZPA 1GPXA 2BBCA 3AB5A 4XDDA 4NAMA 3AE6B 1QOGA 4REZA 2DLBA 3AECB 3W5VB 5BYSA 1WRIA 1C79A 3VR8B 3ETRA 2K5PA 5MPOA 4XWWA 1D5XC 1ZXIA 2JYEA 4A6QA 2IGHA 1IBXB 4RCOA 4HRSA 2PVGC 1J7BA 3ZJVA 3U4EG 2B76B 3U52E 3SFDB 2KN4A 2L83A 1WGKA 2LMCA 3ZJTA 1EU3A 1FO4A 3P42A 4ZYSA 1HZ6A 4ARCA 1L4ZB 1J7CA 4MT5A 1SJHD 2GI9A 3BVZA 1SB3C 1UWMA 1JQ4A 3TEXA 4WIPA 3TSSA 4WWMA 1IBXA 3ABVB 3EUB2 1AYFA 1ENFA 3GP7A 1K51A 3AE8B 3PO0A 3NVWA 1F2RC 1OQRA 1FRRA 3CWIA 4RNAA 3AE9B 2PIAA 2V3NA 1YN4A 2M19A 2WXKA 5H8YE 3KLSX 1QT9A 2GRIA 4N6EB 3AEEB 1MI0A 1L0YB 4JWUC 1RWSA 5D3IB 1L5PA 2KDMA 2QJLA 1VR9A 2J52A 3BIID 2OHFA 1QKZA 5C3JB 5D7GA 1VRAB 4NZLB 2L32A 4WQMA 1FXIA 3IAS1 1C78A 2Z8LA 4A55A 4XE0A 1JROA 4ZOHC 3IT4B 1N62A 3T3OA 1K50A 2YEPF 2WXRA 3IXSA 5BYRA 1RYJA 3LXFA 3GB1A 1B9RA 1AWDA 2FE8A 4YTPB 1FNUA 3URYA 1SE3A 3AEFB 3H8HA 4GDKB 2LFIA 3IAM1 4ZHOA 1XLOA 2PLPA 4HKQA 3EA6A 1B1ZA 2JX5A 3BVGA 3AEBB 4H2AA 2I38A 2JWUA 1D5ZC 3TEZA 1FNWA 1VJKA 1ZDXA 1TS5A 2I2YA 3W2DA 1E9MA 4B0EA 2MJEA 2WXQA 2KACA 4C7ZA 2KWDA 4A9AA 5AUKA 4WURA 2N9KA 3BYYB 1FXAA 1C4CA 4DXFA 1SJED 3P4PB 1RFKA 1YN3A 4O1NA 2BTEA 5FK9C 4XWTA 2CJNA 3RFZB 1TS4A 2BS2B 2W54A 1KLGD 1PDXA 2TSSA 1QLBB 2VZKB 4OZAA 1QOAA 3CIRB 4IDIA 4RFBA 4Q2JA 1E0ZA 2WNMA 1NENB 1HQRD 2G1EA 3AMZA 1PYWD 3I9V1 4IOIE 2HTME 4KGTA 1F0ZA 3SEBA 1QQRA 2RPVA 1YNTE 2MJ3A 2NTTA 1SXTA 3Q8EA 1TS2A 4YTNB 1TYGB 1E7PB 1JRPA 1QOFA 2W82A 1KLUD 2WXHA 5EE0A 1J7AA 4GLSC 5HHDG 1MHXA 3VRAB 1C9FA 2WU5B 1QILA 2QSDA 2DWQA 3KQ4A 1EWYC 3BWUD 1ZUD2 1FMAD 2BYTA 4US8A 3SR6A 3HVDA 1KH0A 2INPE 3W9CB 2QILA 1PGXA 2XNAC 1TJEA 1TKEA 1FCLA 2AQ1B 1CZPA 1ACCA 1L6UA 2IGGA 1ET9A 1V1PB 2BB6A 1JWUD 2WXMA 4MH8A 4YXDB 1F77A 2V0GA 1PFDA 1JALA 2JYTA 3L4PA 1JWAD 4TSSA 2WXLA 1T5XD 3LB8C 1I4GA 3BK1A 1FNVA 4DQOC 2BB5A 2BW2A 4L1BA 4EE2A 1DYQA 1F2RI 1RM6C 1V1PA 1KRHA 3V05A 1VDVA 4OZBA 2QMTA 1XCTL 1A70A 4RF0A 2EKIA 1FRDA 2ONQA 3ZGZA 2V4IB 2BS3B 2WLBA 3ZQ4A 4YSYB 3AEGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN1 A;  1I7H A;  1XO3 A;  1N5W A;  2H89 B;  3FAH A;  4ZHO A;  2BS4 B;  1XLO A;  2KAJ A;  3AEA B;  2PKO A;  1ZP0 B;  1OQQ A;  2JX5 A;  5G5H A;  3AE7 B;  2K22 A;  2WS3 B;  2CJO A;  3NRZ A;  3AH7 A;  1YJI A;  3AEB B;  1E6E B;  3ZYY X;  1FM0 D;  2W3S A;  1TKG A;  1VJK A;  2FBW B;  3HUI A;  2W55 A;  1N61 A;  2JQR B;  2WDR B;  2WQY B;  4ITK A;  2H88 B;  1KFY B;  1E9M A;  2MJE A;  4YSX B;  3DWM A;  3NVY A;  5EE9 A;  3AE1 B;  1YJJ A;  3P4S B;  2DBY A;  4ZHP A;  4YT0 B;  1NYR A;  2PVO D;  2Y5C A;  4C7Z A;  2WDV B;  3AE3 B;  4YSZ B;  1NEK B;  4YTM B;  5EE3 A;  2ACZ B;  5AUK A;  4A9A A;  3FC4 A;  3RPF C;  4JX1 C;  1FXA A;  3B9J A;  3NVV A;  1RFK A;  1NI3 A;  3P63 A;  1WYG A;  3P4P B;  3AM9 A;  4FXC A;  5G5G A;  1XLQ A;  1XLN A;  2CJN A;  3B2G A;  4KX6 B;  1OFF A;  1T3Q A;  2BS2 B;  2W54 A;  4N58 A;  2MJD A;  1PDX A;  1QLB B;  1QOA A;  3CIR B;  1DGJ A;  4IDI A;  1GPX A;  2AX5 A;  3AV8 A;  2W3R A;  3AB5 A;  3P4Q B;  1E0Z A;  1SF0 A;  3AE4 B;  1NEN B;  3KWL A;  3AE6 B;  1QOG A;  2G1E A;  1KF6 B;  3AMZ A;  4N59 A;  3WCQ A;  1DOY A;  3AEC B;  3W5V B;  1WRI A;  3VR8 B;  2HTM E;  3ETR A;  3AE2 B;  2K5P A;  1CJE A;  5MPO A;  1F0Z A;  2BT6 A;  1ZXI A;  1FFV A;  3P4R B;  1NVI D;  2MJ3 A;  3HRD D;  4HRS A;  4USA A;  4US9 A;  2PVG C;  1J7B A;  1FFU A;  1L6V A;  1TYG B;  4YTN B;  1E7P B;  1QOF A;  1JRP A;  2B76 B;  3AE5 B;  3DWG C;  3SFD B;  1QOB A;  2L83 A;  2MH7 A;  1WGK A;  1FO4 A;  2WDQ B;  1J7A A;  2LEK A;  5EE0 A;  3VRA B;  1J7C A;  1NYQ A;  2WU5 B;  2WLB A;  4HRO A;  2DWQ A;  1SB3 C;  1TKY A;  1UWM A;  2WU2 B;  1JQ4 A;  5EE1 A;  1EWY C;  1N5X A;  1L0V B;  1ZUD 2;  4WWM A;  2K9X A;  1FMA D;  3ABV B;  3EUB 2;  5GXG B;  1AYF A;  1PUT A;  3SFE B;  3AE8 B;  3PO0 A;  2E3T A;  4US8 A;  1DOX A;  3NVW A;  3SR6 A;  1OQR A;  1FRR A;  2Q5W D;  1YQ3 B;  3CWI A;  5C2T B;  3W9C B;  1GAQ B;  2PIA A;  3AE9 B;  3VR9 B;  1TJE A;  1TKE A;  2M19 A;  1CZP A;  1WXQ A;  3HVZ A;  5H8Y E;  1L6U A;  3NS1 A;  1JWB D;  1QT9 A;  1R7S A;  1QF6 A;  3NVZ A;  1JW9 D;  1N63 A;  4YXD B;  4N6E B;  3B2F A;  3AEE B;  1SIJ A;  1PFD A;  1RWS A;  4JWU C;  1JAL A;  3L4P A;  1JWA D;  1L5P A;  4JWS C;  4LTU A;  1WWT A;  3LB8 C;  2QJL A;  3BII D;  2OHF A;  5C3J B;  1YQ4 B;  2QIE B;  1IUE A;  4C7Y A;  2N0S B;  3W5U B;  4C80 A;  2M56 B;  4WQM A;  1FXI A;  1XLP A;  1FIQ A;  1V97 A;  1RM6 C;  1JRO A;  4ZOH C;  1KRH A;  1N62 A;  2CU3 A;  1VDV A;  1E10 A;  1ROE A;  1ZOY B;  2L52 A;  4P6V F;  1A70 A;  2EKI A;  1FRD A;  5H92 C;  1RYJ A;  3LXF A;  5AUI A;  3AED B;  1VLB A;  2WP9 B;  1B9R A;  1AWD A;  1DOI A;  1V8C A;  4YTP B;  3VRB B;  2BS3 B;  2KMM A;  1N60 A;  3P1M A;  4YSY B;  3AEF B;  3AEG B; 
#chains in the Genus database with same CATH topology
 3DBH B;  2KOX A;  3HM3 A;  4ITK A;  2NMQ A;  1GUA B;  2KZR A;  2O6V A;  4ZYN A;  3A9J B;  4MM3 A;  4ANW A;  1K52 A;  2IGD A;  2VZK D;  5HG2 A;  1L2N A;  3S2A A;  3UF8 A;  3FC4 A;  4JX1 C;  2M17 A;  5E6J A;  2PMV A;  3VUX A;  3EHV A;  3KUZ A;  2XN9 C;  1DGJ A;  2OJW A;  1QZE A;  5EDS A;  3BK2 A;  3HIZ A;  1KLV A;  1YD8 U;  4MAC A;  3N1X C;  2KVZ A;  3H1U A;  5BMI A;  4OVU A;  4QAY A;  3NG0 A;  1WIA A;  4US9 A;  2YEP B;  3DWG C;  4URK A;  1QOB A;  1K53 A;  4C00 A;  3Q8C A;  2EEL A;  4OHJ A;  2INN E;  4HRO A;  1T6B X;  1E5W A;  2E3T A;  3U7Z A;  4W9D A;  2WXO A;  4JLC A;  2Q5W D;  1I4R A;  1ZXH A;  3QAQ A;  3N9Y C;  2NCN A;  3BVM A;  4RGM A;  1GOZ A;  1JWB D;  1OEY J;  3B2F A;  1WJU A;  4AWJ A;  4B6W A;  4BKT A;  1NBF C;  1V1O A;  2KN5 A;  2N0S B;  4C80 A;  3K9P B;  1WI0 A;  3IHP C;  5D6J B;  2LJ5 A;  1WXV A;  4FJZ A;  1JCK B;  1WH3 A;  3AED B;  1AAR A;  3VRB B;  1EU4 A;  3P1M A;  2LXC A;  4DWF A;  2CS4 A;  4MSM B;  2M0X A;  3GS2 A;  4HXD A;  3QHT A;  4EZK A;  3I5J C;  1YN5 A;  4MEL A;  1Q10 A;  1P9D U;  1VZ8 A;  2J53 A;  4ZRP A;  3NVY A;  2OED A;  1SIF A;  2W9N A;  2LHD A;  2AQ3 B;  3A9K B;  2Y5C A;  4HJG E;  2WXP A;  2NBV B;  5CHF A;  1C4P A;  4HWI B;  3JSV A;  3R2I A;  4WJQ A;  1CJE A;  4A8X C;  2BT6 A;  4NPN A;  4ACF A;  2HTH A;  1JRU A;  2Y5P A;  3C19 A;  1WYW B;  2LHE A;  2HJ8 A;  4MSQ B;  2KD0 A;  3FIL B;  1P7E A;  2RDH A;  2OJR A;  3AUL A;  1L0V B;  1CQV A;  1VZ7 A;  3Q2A C;  1L0X B;  2O2V B;  2YVC A;  4ICV A;  1ESF A;  4KIK A;  2Z59 B;  4FN2 A;  3OWE B;  2V3P A;  3R66 C;  3VTW A;  1WGG A;  1WRD B;  3WAM A;  1TY2 A;  2E6X A;  3L16 A;  2PPH A;  3L0W B;  1EUV B;  4A90 A;  1WM2 A;  5BMH A;  2D3B A;  1FEH A;  3DBR B;  1V97 A;  2M4N A;  2UWQ A;  4MGI E;  2Y3A A;  5T8I A;  4K1R B;  5HKH A;  4P6V F;  4W9C A;  5DPR A;  5BYQ A;  1V8C A;  2G45 B;  1N60 A;  4LNN A;  1MHH E;  4CO7 A;  4GIV A;  4YWG G;  5J17 A;  3AEA B;  3UGB B;  2J0M A;  4NJ6 A;  5G5H A;  3DPD A;  3ZYY X;  2SAK A;  4HEA 1;  4NJC A;  4KSK C;  2WDR B;  1UH6 A;  3CMM B;  2O6V D;  2PEA A;  4LCD E;  4YT0 B;  3C8Y A;  3I57 A;  1YX5 B;  4D2K A;  4RGN A;  3PZ7 A;  2BYV E;  3VH4 B;  1UUP A;  3U7D A;  4AQ7 A;  1I4P A;  1XEE A;  2JWZ A;  4IKG A;  2JZP A;  2MP2 B;  3EEC A;  1P98 A;  3AEC B;  3W5V B;  2N9E B;  3VR8 B;  2K5P A;  2KTR B;  3PRP B;  5MPO A;  4A20 A;  2JYE A;  2KWV B;  2N1V A;  2KTF A;  2NBW B;  1WR6 E;  2KN4 A;  4IWO A;  1WGK A;  1OGW A;  1FXT B;  3JVZ X;  3RUL A;  1J7C A;  3BVZ A;  3ONS A;  4MGY E;  3TSS A;  1IBX A;  3ABV B;  3GP7 A;  1WXM A;  3Q3O C;  3QWZ B;  1FRR A;  3CWI A;  3SDL C;  4FHJ A;  3L08 A;  4BFR A;  4HJK A;  5AEK B;  1MI0 A;  2LZ6 A;  2QJL A;  2WHI A;  2N7D A;  1QKZ A;  5C3J B;  5D7G A;  1VRA B;  2L32 A;  3IAS 1;  5G55 A;  4A55 A;  2V4L A;  2RGF A;  3IT4 B;  2JT4 B;  4ZRJ A;  2WXR A;  5BYR A;  2N9X A;  2FE8 A;  4HCN B;  3VFK A;  3URY A;  1YQB A;  4GDK B;  5AZF A;  2MBE A;  2HJ1 A;  1XLO A;  2A4Z A;  3I63 C;  1B1Z A;  3TEZ A;  2GBM A;  1ZDX A;  2I2Y A;  3VUW A;  1RLF A;  5TR5 A;  3W1S C;  3UQB A;  4M00 A;  2KNB A;  3PZD A;  1SJE D;  1YN3 A;  5FK9 C;  3TIX A;  2BS2 B;  2KHW B;  2W54 A;  1PDX A;  1QLB B;  4PS8 A;  4IDI A;  2DHZ A;  1BT0 A;  3ML8 A;  3AMZ A;  2G4S A;  3AI5 A;  4KGT A;  3OJ3 A;  1E8X A;  2JUO A;  4K3C A;  2RPV A;  3Q8E A;  3ZXV A;  1TS2 A;  1KLU D;  4WJO A;  4GLS C;  1QIL A;  4IG7 B;  2K8B A;  1T0Y A;  1ZUD 2;  1FMA D;  2BYT A;  2GMI C;  4DDG D;  1PGX A;  1FCL A;  1TZ1 A;  1ACC A;  1JWU D;  4MH8 A;  4YXD B;  2INC C;  1JAL A;  2JYT A;  4S0R A;  4ZDV A;  3RCZ A;  2BPS A;  4DQO C;  4C4V B;  3IG3 A;  3B0A A;  4LDT B;  1DYQ A;  1V1P A;  4W9I A;  1C3T A;  3MJW A;  4BOS C;  1WX7 A;  1FRD A;  3GE8 C;  2V4I B;  2BS3 B;  2WLB A;  4K7W A;  2BS4 B;  1XF5 L;  3L10 B;  2LRU A;  1OQQ A;  2NPT B;  4GDL B;  4AS1 A;  2W3S A;  4IWP A;  2WQY B;  5J2R A;  2JY6 A;  2QHO A;  2N9L A;  2DZJ A;  2AYO B;  4AJW A;  2CHW A;  2D3G A;  2FAZ A;  1KTK A;  4EZL A;  1UWX A;  3DVG Y;  2Z0E B;  2HD5 B;  1FCC C;  2LWP A;  1JML A;  4W9L A;  2C7N B;  3P63 A;  1NI3 A;  1LQB A;  3B2G A;  1MG4 A;  4L23 A;  1JWS D;  1VZ6 A;  1ZE3 D;  1WE7 A;  4NAW A;  3AE4 B;  3LYY A;  1V49 A;  4JGH B;  5TSS A;  4KGS A;  3V60 A;  2WXI A;  1WFY A;  1HA5 A;  2LUM A;  5IOI A;  3MC9 A;  2L00 B;  5HI1 A;  4IW0 A;  1ET6 A;  3FKY A;  3TCA A;  3T3N A;  3AE5 B;  4PYU A;  2O2V A;  3M63 B;  4WH4 A;  1NYQ A;  4HCP B;  1TKY A;  2WXJ A;  2FUG 1;  4KGR A;  3QAR A;  3APC A;  2N4F A;  2KQ4 X;  5FKA C;  1WXA A;  4DXA B;  3I3T B;  3ZTD A;  3KWV A;  5AZH A;  3NS1 A;  1HEZ E;  1Q0W B;  2LVQ A;  2BF8 B;  4II3 B;  4II2 B;  2V9H A;  3R2T A;  4UDU C;  4PS3 A;  2G4D B;  2WWZ A;  2PE6 B;  2JRI B;  1A5R A;  3VXW A;  1WSP A;  2K0P A;  1E10 A;  2L52 A;  1R4N B;  2X38 A;  2C7M B;  5H92 C;  2WXG A;  4DHJ B;  3V6E B;  1PGA A;  3ZNZ B;  2DZM A;  4WAA A;  4CHK A;  5C23 A;  1PGB A;  4DDI D;  2NTS A;  4MH0 E;  1J19 A;  3ZIM A;  3HUI A;  2W55 A;  1N61 A;  1WX8 A;  1F1H A;  5LXI B;  1R4N I;  2PTL A;  4RH6 A;  1F52 A;  4ZHP A;  5J18 A;  1H4R A;  2SEB D;  4YSZ B;  2MP2 A;  1R4M B;  3AM9 A;  3V6C B;  1M4V A;  3MHS D;  4YL8 A;  2KT7 A;  3EFC A;  3JW0 X;  4FA6 A;  2KQ7 A;  4F8C B;  2UU7 A;  3R7R A;  3QJZ A;  1OTR B;  5IP4 D;  1KF6 B;  2WX1 A;  4N59 A;  3WCQ A;  1IYF A;  3QIJ A;  2IYD B;  2L05 A;  2ZZP B;  1WZ0 A;  3NOB A;  4USA A;  1BXT A;  4OW0 A;  1NDD A;  1R4M I;  1TIF A;  2ZJD A;  4IM0 A;  2DZK A;  3BYT B;  5IN7 A;  2LGY A;  2WXF A;  4LJP B;  5CHV C;  3DCG A;  3M62 B;  5I4D A;  1SSN A;  3QQ8 B;  1WGY A;  3RNF C;  3SFE B;  3HK0 A;  3WAN A;  2FCN A;  3M95 A;  2JVC A;  4WWN A;  1LFD A;  2JU6 X;  4G50 A;  3H7P B;  1R7S A;  2KWC A;  4JPS A;  1N63 A;  4TV3 A;  1RFA A;  4LNF A;  4JWS C;  1ZDV A;  3NHE B;  2QC8 A;  4ASW C;  2XK5 A;  4MJS A;  3W5U B;  4GN1 A;  1HTO A;  4FJV B;  4LNO A;  2CKH B;  4GDK A;  3MHZ A;  1XCQ L;  3LJ3 A;  2WP9 B;  2J7Q B;  2QEJ C;  2LRW A;  5D3D A;  3L13 A;  3U2S C;  1I7H A;  2ZW1 A;  2H89 B;  4ARI A;  4TQ0 A;  1ZP0 B;  3H6N A;  1FD6 A;  3DBL I;  1C77 A;  4WQO B;  2KFK B;  3RI7 C;  3P2B A;  5IAA C;  1LXD A;  1JWM D;  5EE9 A;  2KVR A;  3RN9 C;  3RNE C;  2RDB C;  3RUI B;  3DOW A;  3RNA C;  1TZO A;  3E9S A;  3C0R B;  4YTM B;  1D5M C;  3N20 C;  3TUO A;  2LXA A;  2BGF A;  4FXC A;  1MJD A;  3QK0 A;  1WM3 A;  5KHO A;  4M01 A;  4IWQ A;  2L0T A;  2BBC A;  2FUH B;  1QOG A;  4REZ A;  2IY1 B;  1D5X C;  1ZXI A;  4AJY B;  3ZNH B;  2PVG C;  1LGR A;  3U4E G;  2B76 B;  5JZE B;  4FJY A;  3ZJT A;  1FO4 A;  3P42 A;  1HZ6 A;  2CR5 A;  3PGE A;  4M0W B;  1SJH D;  2KDF B;  1SB3 C;  3DVN V;  3PRE A;  5D2M B;  2RD0 A;  1UEL A;  3DHH C;  3AE8 B;  2REX A;  2CHX A;  4DHZ B;  2PIA A;  2V3N A;  2M19 A;  5H8Y E;  2K8C A;  1QT9 A;  1GJZ A;  2NR2 A;  1U4A A;  4G3X B;  5DCN A;  3AEE B;  1L0Y B;  1WGD A;  3ZLZ A;  1L5P A;  3UIO B;  3AU4 A;  2K6D B;  1VR9 A;  4FHK A;  2OHF A;  3DDC B;  1OEY A;  1YJ1 A;  2KMA A;  1C78 A;  3GZN B;  4XE0 A;  4ANV A;  1N62 A;  2BKF A;  3T3O A;  3IVF A;  1P1A A;  1D3Z A;  3IXS A;  3EC8 A;  1RYJ A;  3LXF A;  3GB1 A;  4G11 A;  2NPT A;  2VRR B;  4YTP B;  4GDL A;  1IPG A;  1Z5S B;  3IAM 1;  4ZHO A;  2LGD A;  3EA6 A;  3SHQ A;  4H2A A;  1D5Z C;  2AEH A;  3GZN I;  3PVL A;  4W9F A;  1TTN A;  4WJP A;  2GOW A;  3L54 A;  1E9M A;  4N9F 4;  2MJE A;  1WY8 A;  2WXQ A;  2MSE D;  1ZKH A;  5C1Z A;  4C7Z A;  4A9A A;  2N9K A;  3BYY B;  1C4C A;  4DXF A;  4WWO A;  3Q14 C;  4XWT A;  2K25 A;  3RZW C;  1KLG D;  2TSS A;  1QOA A;  3CIR B;  3HHM A;  4RFB A;  2QDF A;  4Q2J A;  1NEN B;  2G1E A;  1PYW D;  2OOB B;  4NQK E;  2HTM E;  2RSU A;  2AL3 A;  5E6P A;  4K7S A;  2MJ3 A;  1P0R A;  2CHZ A;  3SD5 A;  2ZVO A;  2AL6 A;  1TYG B;  1E7P B;  1QOF A;  2W82 A;  2WX0 A;  3U8Z A;  1WX9 A;  5EE0 A;  2KJ6 A;  4A3O A;  2L0F A;  1C9F A;  1TBE A;  5DPW A;  1MFW A;  3KQ4 A;  4EZJ A;  1EWY C;  4DK5 A;  1HTQ A;  4CYE A;  1K8R B;  3NY5 A;  3SR6 A;  2XNA C;  3N1Z C;  4I6P A;  2AQ1 B;  1CZP A;  4J6I A;  3ZRF A;  2WXM A;  2KX0 A;  3Q3F A;  1V2Y A;  1F77 A;  2V0G A;  1PFD A;  1XQQ A;  3LB8 C;  1UGM A;  3IBE A;  2BB5 A;  4PYZ A;  2XBB C;  4EE2 A;  1RM6 C;  1F2R I;  5AZG A;  2ZNV B;  1VDV A;  4OZB A;  4NJ7 A;  1A70 A;  2YLM A;  2V1Y A;  2KMC A;  3T8M A;  3ZNG C;  4HK2 A;  1EF1 A;  5DPT A;  4YSY B;  4EKU A;  2KC1 A;  2DEN B;  4RF1 A;  2K22 A;  4GGQ A;  1EM7 A;  4KKJ A;  2Z0D B;  4HPL B;  1N6Z A;  3BY4 B;  3HM6 X;  2DYO A;  1C4A A;  3OLM D;  3TEY A;  1YJJ A;  3Q69 A;  4LLG M;  1NYR A;  4WWP A;  3Q8A A;  4KZ0 A;  1VCB A;  3A4R A;  4KX6 B;  1P7F A;  4JE3 B;  3W1S A;  3AV8 A;  1KOT A;  3A9J A;  2D10 A;  1DOY A;  4HVB A;  5CHW A;  3AE2 B;  2N9P C;  1WJN A;  1AN8 A;  3P4R B;  4XX5 A;  4P16 A;  1EWC A;  1UZX B;  1Y56 A;  4XYC A;  3VAW A;  3Q8F A;  1KJT A;  2PW9 A;  2KK8 A;  2MH7 A;  2J4X A;  4RM9 A;  3BIN A;  3R3M A;  1J0G A;  1STE A;  2BYE A;  1L4D B;  3PT2 B;  3VQI A;  2WU2 B;  2DYB A;  1N5X A;  1SEB D;  3PHX B;  2MRP A;  3L17 A;  1DOX A;  2JXT A;  2VH2 A;  1G6J A;  2IO0 B;  2D5G A;  1I4X A;  1GG3 A;  1NI2 A;  3ZTC A;  2WDT B;  2JRH A;  4LDT D;  1WWT A;  2KC2 A;  1AW7 A;  4OVV A;  1YQ4 B;  4K3B A;  3GE3 C;  2M0A A;  1UNS A;  5LNK 1;  3QC8 B;  3VVW B;  3N30 A;  3KH0 A;  1DOI A;  1SGH A;  1E7U A;  2FIF A;  1UGJ A;  2KAJ A;  3MTN B;  3PTF C;  3MP9 A;  1TT5 B;  1YJI A;  2R61 A;  2PE9 A;  1TKG A;  2FBW B;  3MC8 A;  2ZPN A;  4WAF A;  2RMM A;  2H88 B;  5IA7 A;  1KFY B;  4FUL A;  1I35 A;  2DYM A;  3JSV B;  3NZU A;  4W9K A;  4R3D A;  2D2Q A;  4HLE A;  1TS3 A;  2PVO D;  4M8M A;  3UIN B;  4KVG B;  2D3C A;  4EEW A;  1TY0 A;  2N1W A;  3H9D A;  4XGA B;  5E6N A;  3R7Q A;  2I1K A;  4BVU C;  1KM7 A;  2AX5 A;  1PQS A;  1SF0 A;  2MX2 A;  3KWL A;  1WJ6 A;  1SE4 A;  1UBI A;  4W9J A;  3A9K A;  4KKI A;  2IDY A;  2KO3 A;  3A1Q B;  5L95 C;  2IZV B;  1NVI D;  4M0W A;  4F7Z A;  2KFJ A;  5JXV A;  2MBB B;  1Q1O A;  2WDQ B;  1BUI C;  2LEK A;  2DX5 B;  1IP9 A;  4GXB A;  3KUC B;  4XZ4 A;  4IM2 A;  4IM3 A;  3MJ5 A;  1PUT A;  2C9W B;  3UI3 A;  4G0N B;  3WA0 A;  4X57 B;  3VR9 B;  2KDE B;  4TQ1 A;  3FIL A;  1QF6 A;  2J42 A;  4RGO S;  1SIJ A;  1ZGU B;  2JF5 A;  5LXH A;  2QIE B;  1Z2M A;  4PS7 A;  2MWS B;  1FIQ A;  3ZJU A;  4MGZ E;  2CU3 A;  1GB4 A;  2LJI A;  2KWU B;  1E8Z A;  1MVK A;  5AUI A;  3NJT A;  1VLB A;  4JIO U;  3N32 A;  4ZRQ A;  2KMM A;  2C7H A;  2ZEQ A;  1ZW7 A;  4E3C A;  2ZCC A;  3AN1 A;  4OVZ A;  1ISN A;  3PZ8 A;  3J9C A;  3TL5 A;  3R8B A;  3AE7 B;  2WS3 B;  3NRZ A;  3VHT C;  1J8C A;  3N1Y C;  4MDK E;  1FM0 D;  3Q6B A;  1WR1 A;  3MFG A;  4DXG A;  4P1B C;  3AE1 B;  3P4S B;  2DBY A;  4MGK E;  4IC7 B;  2RR9 A;  3AE3 B;  2N7J A;  1HZ5 A;  1WYG A;  3DQV A;  1T3Q A;  4PT5 A;  3AB5 A;  4XDD A;  3CST A;  4NAM A;  4EUT A;  3AE6 B;  3LDZ E;  5BYS A;  1M94 A;  4W9H A;  1T0Q C;  1HE8 A;  2FCQ A;  1P3Q U;  4XWW A;  2K1F A;  5BO4 B;  4A6Q A;  3VTU A;  3PLV A;  2IGH A;  1IBX B;  4HRS A;  1J7B A;  1WGR A;  4A3P A;  3ZJV A;  1XT9 B;  2L83 A;  4NNJ B;  2K8H A;  2LMC A;  4ZYS A;  5KHQ A;  1L4Z B;  2KTR A;  1JQ4 A;  3TEX A;  1WMH B;  4WWM A;  2BQQ A;  3EUB 2;  1ENF A;  1K51 A;  2KAN A;  2KXJ A;  2JZ3 B;  3NVW A;  1F2R C;  4BBN F;  2MBQ A;  3W1Y A;  1YN4 A;  2WXK A;  4E74 A;  3KLS X;  3ECI A;  4JWU C;  5D3I B;  2I1J A;  2KDM A;  3BII D;  1FXI A;  2Z8L A;  2KDI A;  3UQA A;  1JRO A;  2QCZ A;  1K50 A;  2ZNV C;  3QCA A;  3WAL A;  1FNU A;  3DBH I;  3H8H A;  2JX5 A;  1WZ3 A;  4FBJ B;  4PK1 A;  1WJ4 A;  3DHI C;  3AEB B;  2JWU A;  4AUQ C;  1FNW A;  3DBL B;  3W2D A;  2GBN A;  4FLH A;  4LNK A;  4B0E A;  3ZXR A;  3ZW3 A;  1V6E A;  2FID A;  5JH5 C;  1I42 A;  2KWD A;  5AUK A;  3T9L A;  1FXA A;  2MA9 B;  4ANU A;  2G3Q B;  2DAJ A;  4GU2 A;  4TKN A;  3RFZ B;  1LM8 B;  3JYU A;  2VZK B;  4OZA A;  3WIM A;  1E0Z A;  1V5O A;  1WGH A;  2BKR B;  4XC2 A;  1F0Z A;  1QQR A;  4IUM B;  2D07 B;  1SXT A;  2LVP A;  1JRP A;  4K7U A;  3PRM B;  3V62 A;  3NS8 A;  2WXH A;  3N3K B;  5HHD G;  1MHX A;  2WU5 B;  5GMV A;  3OG5 A;  1E90 A;  2M1M A;  3EFU A;  4GB9 A;  4US8 A;  3Q3M C;  1FPY A;  1S1Q B;  3HVD A;  2INP E;  3W9C B;  4DHZ E;  1TJE A;  1L6U A;  2IGG A;  1V1P B;  3ZUN A;  4KSL C;  3WAO A;  1JWA D;  1EO6 A;  1T5X D;  2WXL A;  1I4G A;  3KVF B;  3DHG C;  4S17 A;  3BK1 A;  2R2Q A;  3TBL D;  3CSF A;  4L1B A;  2J0K A;  2WGS A;  1KRH A;  3V05 A;  2QMT A;  4JQW C;  4ANX A;  4ZRK A;  2EKI A;  2ONQ A;  5CX3 A;  3DVG X;  2GBK A;  4C4V A;  4EFO A;  1XO3 A;  1E7V A;  1N5W A;  2GB1 A;  2MHJ A;  2WYQ A;  3ALB A;  3FAH A;  1V9J A;  2JZZ A;  4DBG A;  4RGT A;  2LVO A;  2L1A A;  2JQR B;  1HXY D;  2M8S A;  4YSX B;  2MBO A;  3PSE B;  4NAW B;  3B1L X;  4NY0 A;  3X23 A;  4P7I A;  1I4H A;  3PV1 A;  4P1C C;  5EE3 A;  3RPF C;  3MC0 B;  2UYZ B;  3PHW B;  2GBJ A;  5G5G A;  1OFF A;  3Q8B A;  1CK1 A;  3A1Q A;  3EGR A;  3TEW A;  1MPE A;  1EF5 A;  1UF0 A;  2NVU I;  1C76 A;  4AOF A;  1BML C;  2MCN B;  4GMV A;  1FFV A;  4HDQ A;  2Y5B B;  1ZPS A;  3HRD D;  2KKC A;  2ZW0 A;  1FFU A;  3DBS A;  1L6V A;  2IPK D;  1S3S G;  2GLS A;  4J3O D;  2ZVN A;  2EKE C;  4K81 A;  4W9E A;  1WXS A;  4KDI C;  5EE1 A;  2ON8 A;  2JPH A;  2LGI A;  4BOZ B;  1YOV B;  2K9X A;  3KW5 B;  2MW5 A;  1SE2 A;  5CTR C;  1YQ3 B;  3K9O B;  5C2T B;  1GAQ B;  2JXX A;  3APD A;  3HVZ A;  4RM8 A;  3O13 A;  2R2O A;  3ML9 A;  2IJ0 A;  5L83 A;  4NQL B;  3ZKJ C;  4LTU A;  5DPS A;  1GB1 A;  3DBR I;  2BWE S;  1X1M A;  4C7Y A;  2M56 B;  2FCM A;  2GBR A;  1Q5W B;  4EOY A;  4CQN A;  1XLP A;  3NUH B;  5IKC M;  2AQ2 B;  2G9H D;  3A4S C;  2KX3 A;  1SE9 A;  5BMG A;  4B95 A;  5LLI A;  2NBU A;  3IFW B;  2PKO A;  3DVN U;  2HE7 A;  3BZD B;  3E56 A;  1SBB B;  2BYF A;  1D4B A;  1D6E C;  2MLB A;  2LD9 A;  3DWM A;  3ZVV A;  3VH3 B;  2KLG A;  4W9G A;  1I4Q A;  2WDV B;  2DZI A;  3RZF A;  2ACZ B;  2IND C;  3AU5 A;  2O6V B;  3NZ3 A;  5HFY A;  1GNU A;  1TGZ B;  3NVV A;  4B0M A;  1F9J A;  2ICI A;  1XLQ A;  4C56 C;  4MM3 B;  2MJD A;  4N58 A;  2LGX A;  2EMT A;  2W3R A;  3P4Q B;  3SU8 X;  3TJP A;  1C1Y B;  4BKG A;  3UIP B;  1XXG A;  5FR6 A;  1WMH A;  3KUD B;  3V3X A;  1Y8R C;  3PS6 A;  2J0J A;  4BKS A;  4LK0 M;  2V3S A;  4MEM A;  1LO5 D;  3WAP A;  5GXG B;  3RNC C;  1IGC A;  3B08 A;  2XK5 B;  4MJS B;  2LUE A;  1WXQ A;  3NVZ A;  1JW9 D;  4F1S A;  5E6O A;  1T0R C;  2KQS A;  4M8N A;  5JHA A;  2JSV X;  5FR3 A;  4TMA B;  4OZC A;  1RRB A;  2MQJ A;  4GSW A;  1IUE A;  2MEK A;  2WXN A;  2CU1 A;  3IT6 B;  3H7P A;  3ZO5 B;  2RPQ A;  2DNF A;  4L2Y A;  1ROE A;  1ZOY B;  1VD2 A;  1CMX B;  2KDB A;  3OAW A;  4KDL B;  3M3J A;  3D32 A;  4I6N B;  1E8Y A;  2IO2 B;  2CJO A;  3AH7 A;  1E6E B;  2ASQ A;  4FAD A;  2K6Q A;  1GC7 A;  1IGD A;  2BVC A;  3NZS A;  4ICU A;  1YMH E;  4XDC A;  4HKZ E;  1NEK B;  3B9J A;  5D94 A;  2HDE A;  1YX6 B;  2RDG A;  1XLN A;  2C60 A;  2KFK A;  2K39 A;  2L76 A;  2K3U A;  3RMK C;  1GPX A;  2VH1 A;  2DLB A;  1WRI A;  1C79 A;  1L7Y A;  2PJH A;  3ETR A;  1H8C A;  2D3A A;  4RCO A;  4WJN A;  3ZDM C;  4M02 A;  3U52 E;  3SFD B;  2IO1 B;  2KYW A;  2IBI B;  4ARC A;  1EU3 A;  4MT5 A;  3A33 B;  3GOE A;  2GI9 A;  1UWM A;  4HPP A;  4WIP A;  2BWF A;  2B3A A;  3QX1 A;  1AYF A;  1WE6 A;  3PO0 A;  3Q3N C;  1OQR A;  3PLU A;  4RNA A;  2NS5 A;  3AE9 B;  3RNB C;  2AWT A;  3Q3J A;  5G2N A;  2GRI A;  4N6E B;  4KIK B;  1RWS A;  4BZA A;  1GC6 A;  2J52 A;  2XEW A;  4HDO A;  2EMS A;  4NZL B;  4LJO B;  3KYD D;  4WQM A;  2A5U A;  4TUU A;  4ZOH C;  2YEP F;  2IO3 B;  4I6L B;  2KLC A;  1B9R A;  1AWD A;  1V5T A;  1SE3 A;  3AEF B;  1V86 A;  4E71 A;  1T0S C;  2MBH A;  2LFI A;  2PLP A;  4HKQ A;  2LGS A;  3BVG A;  2KJH B;  2I38 A;  3VTV A;  1VJK A;  3RNG C;  1TS5 A;  2D11 A;  1OQY A;  2C5L C;  1V81 A;  2IY0 B;  4DHJ D;  2KAC A;  3KYC D;  2ZCB A;  2LI5 A;  2L8J A;  4WUR A;  4BBN C;  3ENE A;  3OJ4 B;  1RFK A;  3P4P B;  4O1N A;  2BTE A;  2L7R A;  2CJN A;  1TS4 A;  4BAX A;  1UD7 A;  2WNM A;  1HQR D;  1UBQ A;  1YIW A;  3I9V 1;  1WF9 A;  3ZNI D;  4IOI E;  2KJR A;  2LAS A;  3SEB A;  4GOC A;  4LNI A;  1V80 A;  4B9K A;  1YNT E;  4JL9 A;  2NTT A;  3ZRC A;  2FCS A;  2X8X X;  3RT3 B;  3X0W A;  5JHB A;  4YTN B;  3V61 A;  3H7S A;  3ZDT A;  3RYT A;  1J7A A;  4HPM B;  3VRA B;  3AXC A;  3RD2 A;  3O65 B;  2QSD A;  3TMP B;  2DWQ A;  1E8W A;  3CF6 E;  1MG8 A;  3BWU D;  3PPA A;  4BKS D;  4ZRI A;  2DAF A;  2FNJ B;  2L3Z A;  1KH0 A;  3APF A;  2QIL A;  1TKE A;  1ET9 A;  1RAX A;  2BB6 A;  5IO9 A;  3U30 A;  3PRZ A;  3L4P A;  4KV2 A;  4TSS A;  1XD3 B;  1FNV A;  2BW2 A;  3VUY A;  4AP4 C;  2ZPY A;  1XCT L;  4RF0 A;  4KZC A;  2N7E A;  3ZGZ A;  3VDZ A;  4RMA A;  3ZQ4 A;  3QA8 A;  3AEG B; 
#chains in the Genus database with same CATH homology
 1XO3 A;  1N5W A;  2GB1 A;  3FAH A;  2BS4 B;  1XF5 L;  4RF1 A;  1OQQ A;  2K22 A;  4GDL B;  4AS1 A;  4RGT A;  1EM7 A;  4KKJ A;  2W3S A;  2L1A A;  2JQR B;  2WQY B;  1HXY D;  4ITK A;  2NMQ A;  2N9L A;  2DYO A;  4YSX B;  1C4A A;  4NAW B;  3TEY A;  1YJJ A;  3Q69 A;  4LLG M;  1KTK A;  1NYR A;  1I4H A;  1UWX A;  3Q8A A;  1K52 A;  2IGD A;  2VZK D;  5HG2 A;  5EE3 A;  1FCC C;  1JML A;  3FC4 A;  3RPF C;  4JX1 C;  3MC0 B;  5E6J A;  3P63 A;  1NI3 A;  2PMV A;  5G5G A;  3B2G A;  4KX6 B;  1OFF A;  4L23 A;  3Q8B A;  1CK1 A;  1JWS D;  1P7F A;  1VZ6 A;  3EGR A;  4JE3 B;  2XN9 C;  1DGJ A;  1ZE3 D;  3TEW A;  3W1S A;  3AV8 A;  1MPE A;  3AE4 B;  3LYY A;  1DOY A;  3BK2 A;  1C76 A;  1BML C;  4MAC A;  5TSS A;  3AE2 B;  4KGS A;  2WXI A;  5BMI A;  1HA5 A;  1FFV A;  2LUM A;  1AN8 A;  3P4R B;  1ZPS A;  3HRD D;  4P16 A;  1EWC A;  4US9 A;  1Y56 A;  5HI1 A;  1ET6 A;  2ZW0 A;  1FFU A;  3Q8F A;  3T3N A;  1L6V A;  2IPK D;  2YEP B;  3DWG C;  3AE5 B;  2PW9 A;  4J3O D;  1QOB A;  1K53 A;  2MH7 A;  2J4X A;  3Q8C A;  1STE A;  2EEL A;  4WH4 A;  1L4D B;  1NYQ A;  3VQI A;  4OHJ A;  2INN E;  4HRO A;  1TKY A;  2WU2 B;  2WXJ A;  1T6B X;  5EE1 A;  2ON8 A;  2FUG 1;  1N5X A;  2LGI A;  4KGR A;  1SEB D;  2K9X A;  2KQ4 X;  1SE2 A;  2E3T A;  3U7Z A;  5FKA C;  1DOX A;  2JXT A;  2WXO A;  2Q5W D;  1YQ3 B;  5C2T B;  1I4R A;  1ZXH A;  1GAQ B;  3N9Y C;  3KWV A;  2D5G A;  3BVM A;  3HVZ A;  4RGM A;  3NS1 A;  1GOZ A;  1I4X A;  1JWB D;  3O13 A;  1HEZ E;  3B2F A;  2IJ0 A;  3R2T A;  4UDU C;  4LTU A;  1WWT A;  1GB1 A;  1AW7 A;  1V1O A;  1YQ4 B;  4C7Y A;  2N0S B;  4C80 A;  2M56 B;  4CQN A;  1XLP A;  2M0A A;  1UNS A;  1WSP A;  3NUH B;  2K0P A;  5LNK 1;  1E10 A;  2L52 A;  1JCK B;  2AQ2 B;  2G9H D;  2X38 A;  5H92 C;  3AED B;  2WXG A;  1DOI A;  3VRB B;  1EU4 A;  5BMG A;  3P1M A;  1PGA A;  1UGJ A;  2KAJ A;  3GS2 A;  2PKO A;  3MP9 A;  1PGB A;  2NTS A;  1YJI A;  1YN5 A;  2R61 A;  3BZD B;  3E56 A;  1TKG A;  1SBB B;  2FBW B;  3HUI A;  2W55 A;  1N61 A;  1D4B A;  1D6E C;  1Q10 A;  2RMM A;  2H88 B;  4WAF A;  1KFY B;  1VZ8 A;  2J53 A;  2DYM A;  3DWM A;  4ZRP A;  3NVY A;  2PTL A;  2OED A;  4RH6 A;  4R3D A;  4ZHP A;  2LHD A;  2AQ3 B;  1TS3 A;  2PVO D;  2Y5C A;  1I4Q A;  2SEB D;  2WDV B;  4YSZ B;  4HJG E;  2ACZ B;  3NZ3 A;  2WXP A;  5HFY A;  3NVV A;  1TY0 A;  4B0M A;  2ICI A;  3AM9 A;  1C4P A;  1XLQ A;  1M4V A;  4C56 C;  4MM3 B;  2MJD A;  4N58 A;  3R2I A;  2AX5 A;  2W3R A;  3P4Q B;  1SF0 A;  3KWL A;  1KF6 B;  1SE4 A;  4N59 A;  3WCQ A;  4KKI A;  2IDY A;  1CJE A;  4A8X C;  2BT6 A;  1NVI D;  4M0W A;  4USA A;  1BXT A;  4OW0 A;  5JXV A;  2Y5P A;  2LHE A;  1XXG A;  3V3X A;  2WDQ B;  3BYT B;  1BUI C;  2LEK A;  2WXF A;  3FIL B;  1P7E A;  2RDH A;  4LK0 M;  5I4D A;  1L0V B;  1SSN A;  1CQV A;  1VZ7 A;  1LO5 D;  5GXG B;  1IGC A;  1L0X B;  1PUT A;  3MJ5 A;  3SFE B;  1ESF A;  3UI3 A;  2JU6 X;  3VR9 B;  3OWE B;  2V3P A;  1WXQ A;  4TQ1 A;  4JPS A;  1R7S A;  3FIL A;  1QF6 A;  3NVZ A;  1JW9 D;  1N63 A;  2J42 A;  4RGO S;  1SIJ A;  1TY2 A;  2E6X A;  2JSV X;  5FR3 A;  4JWS C;  1ZDV A;  4TMA B;  4A90 A;  4OZC A;  5BMH A;  2QIE B;  1IUE A;  1FEH A;  2MEK A;  2WXN A;  3W5U B;  1FIQ A;  1V97 A;  3ZJU A;  3IT6 B;  2Y3A A;  4L2Y A;  2CU3 A;  5T8I A;  1ROE A;  1XCQ L;  1ZOY B;  3MHZ A;  4P6V F;  1GB4 A;  2LJI A;  5AUI A;  1MVK A;  5BYQ A;  1VLB A;  2WP9 B;  1V8C A;  2QEJ C;  5D3D A;  4ZRQ A;  2KMM A;  1N60 A;  3U2S C;  1MHH E;  3AN1 A;  1I7H A;  2ZW1 A;  2H89 B;  4OVZ A;  4YWG G;  4ARI A;  3AEA B;  3PZ8 A;  4TQ0 A;  1ZP0 B;  3J9C A;  5G5H A;  3R8B A;  3AE7 B;  2WS3 B;  3NRZ A;  2CJO A;  3AH7 A;  3ZYY X;  1E6E B;  1FM0 D;  1FD6 A;  1C77 A;  2SAK A;  4HEA 1;  4NJC A;  2WDR B;  3MFG A;  4DXG A;  1IGD A;  1JWM D;  5EE9 A;  3AE1 B;  3P4S B;  2DBY A;  4YT0 B;  3C8Y A;  3I57 A;  4D2K A;  4RGN A;  1TZO A;  1YMH E;  3AE3 B;  3E9S A;  3PZ7 A;  4HKZ E;  4XDC A;  1NEK B;  4YTM B;  1D5M C;  3B9J A;  2N7J A;  1UUP A;  2HDE A;  3TUO A;  1HZ5 A;  1WYG A;  4FXC A;  4AQ7 A;  1I4P A;  1XEE A;  1XLN A;  2RDG A;  1T3Q A;  4IKG A;  4PT5 A;  2K3U A;  2JZP A;  1GPX A;  2BBC A;  3AB5 A;  4XDD A;  4NAM A;  3AE6 B;  1QOG A;  4REZ A;  2DLB A;  3AEC B;  3W5V B;  5BYS A;  1WRI A;  1C79 A;  3VR8 B;  3ETR A;  2K5P A;  5MPO A;  4XWW A;  1D5X C;  1ZXI A;  2JYE A;  4A6Q A;  2IGH A;  1IBX B;  4RCO A;  4HRS A;  2PVG C;  1J7B A;  3ZJV A;  3U4E G;  2B76 B;  3U52 E;  3SFD B;  2KN4 A;  2L83 A;  1WGK A;  2LMC A;  3ZJT A;  1EU3 A;  1FO4 A;  3P42 A;  4ZYS A;  1HZ6 A;  4ARC A;  1L4Z B;  1J7C A;  4MT5 A;  1SJH D;  2GI9 A;  3BVZ A;  1SB3 C;  1UWM A;  1JQ4 A;  3TEX A;  4WIP A;  3TSS A;  4WWM A;  1IBX A;  3ABV B;  3EUB 2;  1AYF A;  1ENF A;  3GP7 A;  1K51 A;  3AE8 B;  3PO0 A;  3NVW A;  1F2R C;  1OQR A;  1FRR A;  3CWI A;  4RNA A;  3AE9 B;  2PIA A;  2V3N A;  1YN4 A;  2M19 A;  2WXK A;  5H8Y E;  3KLS X;  1QT9 A;  2GRI A;  4N6E B;  3AEE B;  1MI0 A;  1L0Y B;  4JWU C;  1RWS A;  5D3I B;  1L5P A;  2KDM A;  2QJL A;  1VR9 A;  2J52 A;  3BII D;  2OHF A;  1QKZ A;  5C3J B;  5D7G A;  1VRA B;  4NZL B;  2L32 A;  4WQM A;  1FXI A;  3IAS 1;  1C78 A;  2Z8L A;  4A55 A;  4XE0 A;  1JRO A;  4ZOH C;  3IT4 B;  1N62 A;  3T3O A;  1K50 A;  2YEP F;  2WXR A;  3IXS A;  5BYR A;  1RYJ A;  3LXF A;  3GB1 A;  1B9R A;  1AWD A;  2FE8 A;  4YTP B;  1FNU A;  3URY A;  1SE3 A;  3AEF B;  3H8H A;  4GDK B;  2LFI A;  3IAM 1;  4ZHO A;  1XLO A;  2PLP A;  4HKQ A;  3EA6 A;  1B1Z A;  2JX5 A;  3BVG A;  3AEB B;  4H2A A;  2I38 A;  2JWU A;  1D5Z C;  3TEZ A;  1FNW A;  1VJK A;  1ZDX A;  1TS5 A;  2I2Y A;  3W2D A;  1E9M A;  4B0E A;  2MJE A;  2WXQ A;  2KAC A;  4C7Z A;  2KWD A;  4A9A A;  5AUK A;  4WUR A;  2N9K A;  3BYY B;  1FXA A;  1C4C A;  4DXF A;  1SJE D;  3P4P B;  1RFK A;  1YN3 A;  4O1N A;  2BTE A;  5FK9 C;  4XWT A;  2CJN A;  3RFZ B;  1TS4 A;  2BS2 B;  2W54 A;  1KLG D;  1PDX A;  2TSS A;  1QLB B;  2VZK B;  4OZA A;  1QOA A;  3CIR B;  4IDI A;  4RFB A;  4Q2J A;  1E0Z A;  2WNM A;  1NEN B;  1HQR D;  2G1E A;  3AMZ A;  1PYW D;  3I9V 1;  4IOI E;  2HTM E;  4KGT A;  1F0Z A;  3SEB A;  1QQR A;  2RPV A;  1YNT E;  2MJ3 A;  2NTT A;  1SXT A;  3Q8E A;  1TS2 A;  4YTN B;  1TYG B;  1E7P B;  1JRP A;  1QOF A;  2W82 A;  1KLU D;  2WXH A;  5EE0 A;  1J7A A;  4GLS C;  5HHD G;  1MHX A;  3VRA B;  1C9F A;  2WU5 B;  1QIL A;  2QSD A;  2DWQ A;  3KQ4 A;  1EWY C;  3BWU D;  1ZUD 2;  1FMA D;  2BYT A;  4US8 A;  3SR6 A;  3HVD A;  1KH0 A;  2INP E;  3W9C B;  2QIL A;  1PGX A;  2XNA C;  1TJE A;  1TKE A;  1FCL A;  2AQ1 B;  1CZP A;  1ACC A;  1L6U A;  2IGG A;  1ET9 A;  1V1P B;  2BB6 A;  1JWU D;  2WXM A;  4MH8 A;  4YXD B;  1F77 A;  2V0G A;  1PFD A;  1JAL A;  2JYT A;  3L4P A;  1JWA D;  4TSS A;  2WXL A;  1T5X D;  3LB8 C;  1I4G A;  3BK1 A;  1FNV A;  4DQO C;  2BB5 A;  2BW2 A;  4L1B A;  4EE2 A;  1DYQ A;  1F2R I;  1RM6 C;  1V1P A;  1KRH A;  3V05 A;  1VDV A;  4OZB A;  2QMT A;  1XCT L;  1A70 A;  4RF0 A;  2EKI A;  1FRD A;  2ONQ A;  3ZGZ A;  2V4I B;  2BS3 B;  2WLB A;  3ZQ4 A;  4YSY B;  3AEG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...