1QP0A

Purine repressor-hypoxanthine-palindromic operator complex
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
338
structure length
338
Chain Sequence
b'TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*CP*CP*GP*GP*TP*TP*GP*CP*GP*T
molecule tags Transcription/dna
source organism Escherichia coli
publication title The role of lysine 55 in determining the specificity of the purine repressor for its operators through minor groove interactions.
pubmed doi rcsb
total genus 114
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1qp0A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qp0A03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qp0A02
4JB2A 4XAQA 4F3TA 1SXIA 2PLNA 4OATA 3RVSA 3N6VA 4HNQA 3EULA 4TMYA 1AU7A 4DN6A 4H3KB 4PE5B 2ICPA 3EGCA 2LYRA 2RGYA 1XHEA 3U3WA 1ZESA 2GBPA 3IP9A 1ZY2A 2V0NA 4W5NA 5EWMA 4S05A 3QX8A 3EUSA 1P2FA 4D6XA 4PU7A 4MQEB 2P9HA 5KQPA 3O2QB 1EWTA 2FTKE 3LUJA 4F8DA 4FB4A 1YK1A 5TQJA 3QX9A 1QQBA 2H8RA 3RVKA 1DG9A 4KPYA 1O4XA 2AW6A 2KEJA 1E6KA 5IEJA 3SAJA 3D02A 4UHKA 4W5OA 1CHNA 4YG1A 1ABFA 2PE5A 1ABEA 1X57A 1YK0A 1A04A 1LCDA 3DGEC 5IX8A 3A0UA 1ZZCA 3EJWA 1ZUGA 1E3OC 2ID7A 4B09A 3FYMA 1LBIA 4Z9AA 2F8TA 1LQCA 2WJAA 4NCBA 3NNSA 3A0RB 3LKVA 3M9XA 5IULC 5CNIA 3KZ3A 1ZVVA 4MS4B 2PKXA 1L5YA 4JASB 4RDCA 2JVKA 3NNDA 1WETA 2QVCA 4G0PA 3T38A 1YSEA 1NXPA 2XJ3A 4MCXA 3JVDA 5IUNC 5ED4A 3JXBC 1CYEA 1JDPA 4H60A 4X4BA 3H5VA 1DC8A 2LYKA 5TQ2B 2OR1L 1POUA 4P1ZA 1QKKA 5TPWB 4W5RA 4XARA 2L2QA 3CLKA 1LK0A 3K9CA 4LDZA 1LJUA 3KXAA 3CROL 1BA2A 2XCJA 4O1HA 4PYRA 1LLIA 4ZPJA 3TRBA 3O74A 3IP5A 1BDHA 2FKAA 3I09A 1ZN2A 9ABPA 3HJFA 3HO1A 1Z25A 4LZLA 3HM9A 3F52A 3DLBA 2QSJA 1S7EA 4IF4A 5KQLA 2AXVA 2IOYA 1EAYA 5KC9A 1ADRA 2IVQA 1SXHA 1ZH2A 3LUHA 2E4UA 2RDMA 4EYOA 4ETIA 4S04A 3SCGA 3KLNA 3GYBA 1P8AA 5EWLB 2FN9A 4N47A 2IPNA 4UHJA 4DADA 4YRZA 4X4HA 3H5OA 1ZDMA 3LKBA 2WY2D 3Q7RA 3O1HB 3L49A 3OO1A 4Z5CA 2E4XA 3IP6A 4I6RA 2JVJA 2LCVA 2LUOA 3CHYA 4G0YA 4DQDA 5DTEA 2AXUA 2XI8A 1ZZ7A 4PU3C 3CNBA 2IPLA 4KQ9A 3N0XA 4MYRA 2L8NA 1UTXA 3S99A 4J1XA 2MSLA 5JNTA 3TB6A 4EYKA 4X4EA 3JTEA 4MQEA 2R25B 4E7PA 1CEYA 6ABPA 3I45A 1M2EA 4KK3A 1EWVA 2PUAA 2HQRA 3QK7A 3UK0A 5JNUA 4LDAA 1E6MA 5CNKA 4D6YA 2PIJA 1A0OA 3E3MA 1Z13A 2AYZA 2QXYA 3IPCA 3OLVA 1U2QA 4YG7B 2B1JA 2LBPA 3F6CA 3HZHA 3LUCA 2CSFA 1ZPQA 3H1EA 2GRLA 4GQMA 1D5WA 5TQ0A 5ABPA 2A9QA 1YS7A 5TPWA 4G0QA 1GT0C 2VYCA 3LTEA 3QEMA 4QICA 1HEYA 1NXTA 4ZJPA 3SG0A 2LPMA 5BRJA 1S8NA 5JNWA 3UFDA 2E4YA 4XXHA 3H5TA 2O4AA 1Z2DA 2FVYA 4MR8B 3T6KA 1ZS4A 2JBAA 3R0JA 4MR7B 5HSGA 2GX6A 1JDNA 4LRQA 4MS3A 1ZITA 1PNRA 3W9SA 4PU8A 3CS3A 2QW1A 2FEWB 3CTPA 3D8UA 3QEKA 3GN5A 2PJUA 2WWVD 3CECA 2MQKA 1VPWA 1ZHHA 1JYFA 3OLWA 2QVGA 5JNVA 4YWHA 1FSPA 1Z17A 4QYMA 2IU7A 2KZ8A 1R8JA 1W25A 2B4AA 1M5TA 4JB0A 4LE2A 4NCAA 4RZSA 4WZZA 4FE7A 1DCFA 3C6QA 3EODA 5KI6A 4RS3A 2A6CA 1ZH4A 3MIZA 3N0RA 4TLMB 1VRVA 5IUJC 3BREA 5JS1A 1M5UA 1EWKA 3TO5A 4F11A 2PL1A 3N53A 3CFYA 3K4HA 1L1MA 3JS5A 2WJWA 2OQRA 4LE1A 2PL9A 3QLUA 4JQDA 1KRWA 1MIHA 3MQ4A 3R1FA 3QEMB 4MAAA 1JFTA 4G0OA 2L18A 5TQ0B 4QYWA 1KMIY 3M9WA 3QYXA 3RVLA 2BNNA 1L5ZA 3GT7A 3O2SB 4RK4A 4W5QA 4RK7A 5I4CA 2FMHA 4YR7A 2ID9A 2CWDA 1JHZA 2KEIA 5HQJA 2AXZA 3BD1A 5KQMA 2L17A 1RIOA 2OENG 5JNRA 3DNVB 4YBAA 2FMKA 2JVIA 2M1ZA 4RSMA 5TQ2A 1CQTA 1D1PA 4OTZA 1YMUA 2E4VA 4MRMA 3RVRA 1H9CA 2XSDC 2CD7A 3IP7A 2QV0A 5BR1A 1MAVA 1U8TA 3H1GA 4ETNA 5F64A 1UXCA 3ILHA 5CHYA 5FBKA 3KS9A 2A9OA 4HNSA 1RZRD 4N0PA 4EVRA 4KFCA 4YO7A 1RZSA 3HZIB 1JWLA 3LFTA 2FSPA 4MGEA 1GLGA 4KNYA 3OLXA 5KWSA 4NICA 1AB6A 1NTRA 4RY9A 4Z4EA 3G85A 2NT4A 1NXVA 4Z5DA 1JFSA 1D2AA 4Y42A 2CHEA 2MYUA 2RJNA 2X7XA 3DGFC 3GA5A 3FFWA 4D74A 4ZMRA 2JBAB 1OSLA 1QNLA 4JAVC 1PEYA 2I6FA 4KV7A 4MR8A 4WT7A 4P98A 3LISA 4Q6WA 4E7OA 2FW0A 2WUSR 1RPEL 4Q7EA 3SM9A 3B7HA 5C5CA 2IVGA 3JXDL 1DBWA 2NZVG 3QLUC 4N0QA 3GL9A 4XFKA 4RKRA 3S8QA 3CG4A 5EWMB 2FLWA 4KVFA 3H5IA 1Z26A 3UUGA 1AB5A 3GWGA 1PUXA 4RK6A 3RVNA 5HKOA 2FQWA 5KQGA 1USIA 1C0EA 2HPHA 1UXDA 4PEVA 2PMCA 4OB4A 3LUKA 4GHJA 2FEPA 2PUCA 4Z4CA 4N41A 4ML3A 1Z16A 2EWTA 4WXMA 5T7BA 1R63A 2RJOA 2FN8A 2OFYA 1K68A 4Z58A 3FGZA 3OM0A 2N9UA 3HEBA 3QELA 3H6HA 4HNRA 1BDIA 3RVOA 4EYQA 1X2LA 4MS3B 4Z9BA 1PERL 3SCFA 4Q6BA 4IWRA 4PICA 2BJCA 1Y7YA 3D1NI 4MS1A 5DLEA 1ZZBA 2NZUG 1JH9A 2FMIA 4G97A 4I8TA 1DCMA 1D4ZA 5C5EA 3OMXA 2ZAYA 1KRXA 5FWYA 4RV5A 3OQMA 1ZAYA 1LCCA 1YS6A 3G7DA 3OQOA 5HM6A 3Q7TA 1RXIA 5TPZA 5D2CA 1APBA 1TMYA 3EQZA 2AYXA 1M2FA 2L19A 3HSYA 1DRKA 3JY6A 3KLOA 1JX6A 5FWXB 4XASA 3H75A 2PUDA 3EDCA 2FMFA 1VKRA 3GBVA 3OMWA 4EGSA 4RWEA 4EVQA 4X4DA 1SD5A 3MM4A 3JPYA 3OLZA 1DBQA 2R48A 4MR9A 3FFTA 3F73A 2KPJA 2HSGA 2XDYA 2IUOA 1U2PA 3UKJA 1J56A 1GUBA 3HDGA 5KC8A 3ZHIA 4Z4FA 1YIOA 3KKEA 3H6GA 5IUKC 1ISSA 3BBLA 4G0MA 3KSMA 1YTUA 4X4CA 2LIVA 2IV1A 3GV0A 3OLYA 1SQ8A 1NXSA 3QLVC 5BQ3A 3VK0A 4LE0A 2PUGA 4KK4A 3GN5B 1TM2A 5GOTA 4YLEA 3SQNA 2FLKA 4YCSA 5JNSA 4JCXA 4RK1A 4YARA 2IKSA 4N76A 1WH6A 3MLFA 4WXEA 5EWJA 4N03A 2GWRA 3KJXA 4Z4GA 4RK0A 2A9PA 4KZKA 4O8BA 1JBEA 1I3CA 4EVSA 3N8IA 3FYAA 3JXCL 1ZGZA 3SCHA 3B2NA 4IGAA 4WWHA 5B3JC 1C4WA 2LYLA 3KTOA 3DZDA 2HQBA 3CU5A 2GKGA 4MLDA 3KG2A 2VUHB 1DZ3A 4Z0NA 1PRAA 2PAFA 5FBHA 3I5AA 3NBMA 2KYRA 4L85A 4ZYLA 2O38A 1PEAA 1RNLA 2QZJA 4RXMA 2CHFA 2MSWA 4YG4A 2FQXA 3OMTA 1QPZA 3C3KA 3O2JA 4MQFA 5TE9A 2JCGA 5IBQA 3EAFA 1ISRA 4YP9A 1URPA 1U0SY 1KGSA 3O1JC 2BGGA 2P4UA 2WIUB 2F8SA 4HYEA 1DRJA 2JRLA 1PHRA 1T34A 2A9RA 3HCWA 3KHTA 1VLZA 4OLBA 4Z4IA 3HDVA 4YGXB 1PRUA 3RVQA 3VNAA 2H0AA 4NDWA 1NATA 4KMRA 3BS3A 3MMNA 2IYNA 4MPTA 3LUFA 4OG2A 4QPJC 1FFGA 3FDFA 2R47A 3L6UA 1QP0A 2MSKA 3QELB 3MYYA 2PUBA 3CLCA 4WUTA 4RK5A 3FMVA 4YV7A 3C3MA 4G86A 4OBBA 2H3HA 1Y9QA 1LMB3 1DWKA 2IVBA 3OQNA 4IMJB 4F8JA 3NHZA 3SY8A 7ABPA 1Z12A 3EQ2A 3L1PA 2VUIB 3HV2A 1ZZ8A 3LOPA 2GRMA 2NT3A 3LUAA 2HJ9A 2WRZA 4JP1A 3TMYA 2KEKA 1DP4A 4JA2A 4KQCA 3G5GA 1SXGA 1OXKB 1W9HA 1XHFA 2ZWMA 3P9YA 1SRRA 4F06A 4CBVA 2QR3A 1E6LA 1F4VA 3LUDA 2R4QA 2MYTA 2IDMA 4ETMA 4ZMSA 4MCTA 2LP4Y 4MLCA 4IVZA 2J48A 3QLTA 1DCKA 4TLLB 3T8YA 3CG0A 1QO0D 4FE4A 3HUTA 3Q15C 4RU1A 5EWJB 2M98A 2WMYA 1DBPA 2LYSA 4RKQA 3CZ5A 2EBYA 2XIUA 3MA0A 4H3HB 4EY3A 1JYEA 5EWLA 3LFPA 1A2OA 4Y9TA 5K98B 2CROA 2ICTA 1HF0A 1QMPA 3BRQA 2DRIA 2R63A 3QF3A 1GCGA 1NXWA 3JVIA 1JL3A 1PNTA 3O21A 4NQRA 3RVPA 4MR7A 4KREA 1CJGA 1TVMA 4FBIA 3ILYA 4EUKA 4RXTA 2L49A 3IVPA 5E3JA 1Z18A 1GCAA 3OO0A 4FN3A 4JCYA 1IIBA 1NERA 1QP7A 1FFSA 1NY5A 1FFWA 3Q7SA 3NHMA 1RPJA 1P6QA 3NNNA 4YS6A 3OM1A 3LMKA 3C3WA 1DC7A 4IMIB 4PU4C 3T95A 4IILA 2GZUA 2JB9A 3RZZA 2PUFA 2HINA 1IC8A 2HQOA 4PZ0A 1NEQA 2PPXA 3IPAA 4W5TA 3Q41A 1B00A 1BAPA 2FJRA 2MYNA 1RZRA 2BNOA 2LYPA 3QWGA 1XWRA 4GPAA 3N75A 5IC5A 3BDNA 5GQSA 3HXMA 1GUDA 3KYIB 3VNBA 3TX6A 2O20A 1FQWA 5TPZD 5DKFA 3CKMA 2R1JL 2MEZA 4I6UA 3CZCA 2LYQA 4KRFA 3F7NA 3ROTA 2JK1A 3OP9A 3TD9A 4XLTA 3RQIA 1TLFA 3SNKA 4X4IA 1Y1LA 5A7LA 2D5VA 1LJLA 2E4ZA 1ZGGA 1E2BA 4X4GA 1QQAA 4RY8A 5CNJA 1XWWA 1Z2EA 3M6MD 4Z59A 2PUEA 1MVOA 4MQFB 5BRAA 1WIZA 1QO0A 3HK2A 5FWXA 1DJMA 2JVLA 5PNTA 3ROFA 3RVMA 2E4WA 3GBPA 2NUBA 4RXUA 1UDRA 4F12A 3LUGA 1USKA 2LYJA 4X4FA 1OXBB 4IRXA 1YVUA 4Z99A 1BVHA 1ZZ6A 4O5AA 4G0XA 3URMA 2Q5CA 4L4UA 1PRVA 4IA8A 2FQYA 2AUWA 2YHBA 1USGA 3CRNA 1K66A 3H5LA 3JPWA 1EHCA 2YHAA 3PXPA 3Q9SA 3E61A 4GNRA 5JS2A 1EFAA 4I6TA 2IPAB 4TN5A 3HS3A 1LBHA 3N0WA 3QLVA 4RY0A 2O49A 4MS1B 2B5AA 3BRSA 3KCNA 3A3KA 4OLAA 1TJYA 1JLKA 3C97A 4NV3A 3HVRA 3H1FA 4MS4A 1JFVA 3ZHMA 1NXXA 3F51A 1F51E 3BILA 3MF4A 1OCTC 2TMYA 4JOQA 2EF8A 2BNMA 1D1QA 1P6UA 2MYPA 4Z5HA 3I42A 2FEKA 1JF8A 1BDJA 3A10A 4M88A 3RVJA 2FXIA 3GBFA 1MB0A 5IEBA 3ZKCA 3GRCA 3O9XA 3RH0A 1YMVA 3DBIA 5FWYB 4J1WA 5B3JA 6CHYA 2IPMA 2VK2A 4LX8A 8ABPA 1MB3A 2GI4A 3O75A 3G1WA 5CNMA 3HUUA 1ZZ9A 2WB4A 1R69A 4O1IA 1RXEA 3DLHA 1DW9A 2AWIA 4MR9B 1B0NA 4MRMB 2QU7A 3IDOA 1Z15A 4G0ZA 5DCLA 1WH8A 3QQ6A 5T3YA 4EYGA 3O1IC 5DGCA 3H5WA 3FMYA 4Z4HA 3FFXA 3F6PA 3KYJB 3F6WA 2W42A 1QP4A 1NXOA 1U04A
chains in the Genus database with same CATH superfamily
1FYFA 3ZGVA 4NYMQ 2EW2A 1C7JA 2ZJ3A 4ZO8A 3FW1A 2LTAA 4DLWA 2QD5A 1RWWA 1XXHB 3D3EA 2GT1A 1JBKA 2NACA 1Z06A 3DV0B 3Q2KA 2LYRA 5DTQA 2H29A 5T6MA 3KR9A 4QUBA 3ZY4A 4DB2A 1A72A 5EE9A 2B8NA 2QVBA 2WJYA 3KQMA 5B3LA 2PZGA 1N5MA 2IY7A 3K1JA 4IDDA 3B36A 4X71A 3RIYA 3WKBA 5CFMA 4PU7A 1EE1A 1N78A 1M2HA 3P9RA 3AKYA 4FTWA 4KTVE 3NWPA 2PQ6A 4DMHA 3VUFA 3QX9A 5J9FA 1Z4IA 3EFEA 1MIOA 4OJNA 3AFIA 3OEEA 4I4IA 3S2SA 2ZRGA 4Y2JA 1JE0A 4NZZA 3SAJA 5KCZA 4W5OA 1PZHA 4DIEA 2O2XA 3A32A 4EFMA 1DAOA 4LY6A 1ZMTA 3HV0A 2ETVA 3K6KA 4FEGA 4M37A 2MHCA 3DCNA 3HCFA 3I23A 4XOIA 4ZGGA 4BFYA 2Y0BA 4LHYA 4P34A 1V7ZA 3SQDA 1XZEA 4GAEA 3GI1A 2EGUA 1NKTA 2ZBDA 3NDIA 4J91A 4AMVA 1X7XB 3K0AA 4BNXA 3PWTA 2P3LA 1UCFA 4MTLA 3K9FC 3E2MA 4V03A 4KP7A 4OKSA 1PX2A 5C5DA 3PVZA 4WFJA 1J1IA 3PUIA 3A6FA 1PUIA 3FAKA 1Y42X 1YCDA 1L7XA 3EPPA 1KVQA 3H2GA 1RCTE 4JLWA 4DL9A 3DBLB 5HOEA 1L5KA 2D0PB 2O5VA 1C7FA 2F1OA 1QIDA 3FJ1A 3ILSA 4OGKA 4RX1A 4DJJA 2XJ9A 5JXHA 3NIFB 1Q3HA 3QA9A 1ZN2A 2PZJA 2QVZX 4QQNA 2Y76A 4RD0A 9LDBA 4UD2A 2PLWA 2P67A 1C81A 1W9MA 2VXYA 1NT4A 4XKJA 1A9SA 1K8ZB 3V55A 2OV1A 1L7AA 3W90A 5EQTA 4JU8A 1Z5GA 1PR0A 3G3EA 3O1HB 1OX4B 3R24A 4OP1A 5C7IO 4RL6A 3D54D 4N9QA 4KH1A 1XELA 3OMLA 5AVVA 3A6JA 1UAYA 4AUMA 3SCZA 3LW8A 3V4RA 1ODKA 2JW5A 3H5AA 3SEQA 1YA6A 3PRJA 2H2IA 5C4GB 1LXCA 4EYSA 2Y1WA 3P9XA 4C7OA 4I4NA 4X7BA 3M5PA 1VFNA 2XSZD 5T67A 4DQUA 2R1TB 4XCQA 3RS8A 4R51A 3WA7A 4IS2A 5F9MA 2J1LA 3B1XA 1GCOA 4KQXA 3TW0A 1NUHA 3SVTA 1C29B 2F43B 2WE7A 3AU9A 3ODGA 4NG5A 4BLOA 2LVBA 2E7ZA 3I9FA 3QUBA 5DNYB 3QW2A 2E0IA 4QICA 4UCQA 1JSCA 2ATIA 4YR9A 3ESYA 1AZLA 3X0DA 2ZBPA 1K0FA 2VJKA 3B1ZA 2HW8A 4UUNA 1N1DA 1OAAA 3RGGA 4BVEA 1S89A 2QTWB 1Z2DA 3KHUA 4MR8B 2YMQA 3GD7A 3GRKA 4UVIA 1NI5A 5CA0A 1DO8A 2ZP1A 5AM5A 1EJ2A 3N70A 4MS3A 1FJXA 4C87A 1MJFA 3M6UA 5G41A 1YU9A 5MHTA 1PX0A 2A84A 2G4LA 1OVMA 3KJEA 3A9VA 5FWAA 1I30A 3WRYC 2HY7A 1C7IA 2BWJA 3VPDA 1G5TA 4KQIA 2EBFX 4TSRA 1A27A 3BIFA 2VUUA 4XTRA 4AMYA 2WPDA 5JAUA 1JI3A 3H9QA 4FSDA 5CH8A 4QLBA 1EVQA 5HHTA 3STYA 1OMOA 3QBJA 4RABA 1R9MA 3BREA 4RLFA 3T3GA 1M5UA 2V6IA 2VSFA 2ZJBA 3ZBTA 1F1BA 5CAEA 3DTVD 5JBIA 4XVHA 1C9DB 2JLRA 1RR6A 2HTEA 1O57A 3P27A 4TMFA 4CCSA 2LCFA 2Q3BA 2ZYRA 4PZ9A 4MQUA 3ZK7A 1A8QA 1YS4A 3HZZA 3MQ4A 1GGVA 3G9ZA 1KR2A 2P27A 1QGDA 3CUUA 4JBHA 1VIMA 2H5EA 4FGLA 4XVCA 5LPNA 1N6NA 4D99A 1P7CA 2PXFA 3L6RA 3TFLA 1JEEA 1QHIA 1ATZA 1Y3CE 2HPZA 4CI0B 5C53B 5I5GA 1TQDA 3FI0A 5GM1A 5A0FA 3Q7IA 1C9YA 3WLOA 3AVYA 2NYAA 4UOZA 4G0VA 4KXQA 3GJYA 3H65A 4GXNA 1BX0A 3L5KA 1GUZA 4DIDA 5GVSA 5HQJA 5BQ5A 3F3KA 3SJCA 1JHQA 2L17A 3DMHA 3K9LA 5TQ2A 3WYAA 3N39C 4TMTA 1VMIA 2ZSBA 3DZ8A 3G17A 3T4XA 3PS9A 1P0MA 3E7DA 5D3MB 3TRHA 4NMXB 4B7ZA 1XU9A 2PV7A 1NVXQ 5BR1A 4R2IA 5CYPA 2CHQA 3ILHA 5K3CA 4B6PA 4YK7A 2XGGA 4LY9A 4DE5A 1U5CA 1HZZA 2CNNA 1FNBA 5K99A 1QHHA 3V4OA 4GKJB 4ZO9A 3WGGA 4YRGA 3TLZA 1XMIA 4KIGA 1BS1A 5A9TA 3DE6X 3TSYA 1VP3A 3ZHZA 4FU0A 4JYAB 4OXRA 3LX4A 3ZW9A 4XGIA 4PW0A 2AQ8A 1A71A 4HH3C 1UT8A 4Y2QA 5ALMA 2D54A 4D74A 2AT1A 3PYXA 1TEZA 4YMHA 3PKZA 3ESZA 3C0KA 4Q6WA 4I1VA 4PX5A 2WUEA 5DWDA 2MCFA 1AQNA 4ZCQA 3NTVA 1OYVA 4XFDA 5B3KA 4RELA 5LKAA 4G5RA 1B1CA 4PQEA 3S8QA 3D6NB 5CLIA 1GZHB 4B3FX 2QAGC 5HDQA 3FOBA 3M5DA 2ZWOA 3MTQA 4LSWA 3V2GA 4F84A 1E18A 1S1MA 1UEIA 3FZNA 3L1JA 4FNAA 1KDZA 4PZYA 2QJWA 4Y6OA 2XXPA 3LXUX 1PQYA 4KXFB 4U5XA 3EPJA 3N6XA 3KYCA 4JODA 4YPVA 4H4EA 2FEPA 1EGHA 4JROA 1H6AA 1PTKA 2GUGA 3RFFA 1M1XB 2EWTA 1SRQA 5EP2A 3U62A 4C3VA 1J4AA 2UV8A 3OT5A 4LJSA 2GYUA 3EXG2 3HJNA 3OE5A 4Z58A 1IXKA 5D5QA 1L4FA 2FR1A 4MH0R 2FMTA 3WY9A 1BCSB 1ZNWA 1JXAA 2VWQA 3SCFA 3FTEA 2F17A 3M6VA 2PU7A 2FPPB 4IIJA 5EHGA 4PICA 4ZVVA 3ETDA 4OQXA 5DE3A 1XQXA 2ERXA 2QQGA 5J1SB 3HADA 2CDAA 2PUVA 1X87A 4RSHA 4CJXA 1RYHA 3J81A 1SAYA 2OSBA 4P7BA 3L4JA 1UZLA 2H07A 5C5EA 2VPYA 3KQKA 2ZAYA 4K6CA 4A0SA 3H2YA 3BIXA 3KXKA 1Z7EA 1NQAO 4S2EA 1LSSA 3SDZA 3SXUA 1JU9A 4V0SA 5BN5B 2C0CA 1EFRA 4GX1A 2QM0A 3JAWB 3HO1A 5K8TA 1WNTA 4U6SA 2VZ8A 5AUNB 1D1TA 3R3HA 3ICPA 3IJ5A 4PZUA 2L19A 3DMRA 2HCBA 4YMIA 3A3YA 3SYNA 1MO3A 4DLYA 1ODLA 1H8EA 5KWVA 1ESCA 2X40A 2WSMA 4AMUA 3MOGA 5A05A 1RPZA 4DPLA 1W0JD 5LXTF 5LIRA 2O8BB 1DKOA 1NZJA 3R6LA 3U3MA 1AGYA 4F6RA 2ZBGA 2IYTA 3SYRA 2X0NA 5DHFA 4KQEA 1XDGA 2BPOA 4QD3A 3W0LB 1LLCA 3IODA 1BE0A 4H4CA 4OP2A 4P54A 5IUKC 4PTYA 3DZFA 1IONA 4NZPA 1Y1TA 3DBRA 5TC4A 4O6VA 4A36A 3CX8A 3MB8A 1C0IA 5ALHA 5F3DA 4FINA 3ZI7A 1ZI9A 4RJKA 4DCCA 3WBKA 3OZWA 5B4VA 2OWEA 3TS1A 3LWZA 3D5TA 2EFHB 3V4SA 5KNCD 1U6IA 2PHZA 3OEYA 2EF1A 4LXGA 1GKKA 5J2UB 5JPIA 3VPGA 4D80A 1E9FA 1T5LA 2NZWA 8LDHA 4TLAA 1NJFA 5EIEA 3N8IA 1FFXB 2GNOA 3TTYA 3U26A 2X1HA 3NAMA 1JNYA 2LYLA 2WHPA 3JQ9C 1VIVA 3PFIA 4J0FA 2HQBA 4HNGA 4OXYA 4WBNB 2OCKA 1P9LA 2Q5IA 3K94A 4WAUA 4YECA 2H1WA 4H1TA 4NAUA 5F1KA 2PAFA 1WD5A 1YKSA 1Y9DA 3AF2A 4M8NE 4NR0A 5TX7A 4GS5A 1H22A 1UJ2A 1XP8A 2YWXA 2IK8A 4RH0A 4CEIB 2VLBA 4M0CA 4LOIA 2A0FA 2R87A 4RESA 4FLFA 4Z1OA 1S4MA 4LJ4A 4D96A 1C8BA 4YP9A 5F1YA 2GLXA 3BE4A 3PC2A 3HB4X 4QJBA 1T13A 3ORRA 4YXWA 1PDOA 1T34A 2A9RA 2ECOA 2WMDA 3BH7A 2FZ4A 2D4AA 4YGXB 3FGPA 5DF1A 1M9NA 1UMDB 3F8SA 2HCNA 3BMCA 3KDPA 3RTGA 5D3KA 6LDHA 2EC5A 5G3ZA 3BA1A 4GZ5A 3RUEA 4URZR 2WC1A 4AF6A 4LBVA 4C0SA 5FO1A 3T3DA 4BWVA 2OC9A 3QELB 2GN9A 3UATA 4A8JB 2Z4SA 5CRIA 5DBEX 4GM0A 1YRYE 3FMVA 2QZ4A 4OBBA 5JD3A 1SULA 1Y9QA 1JQLB 3AHGA 3NHZA 4L95C 2ZJ4A 2I54A 1NVVQ 4CU2A 4B85A 2CCJA 1UBSB 1Z28A 2ENWA 3TMYA 1UKEA 5LLSA 2K2WA 3I5YA 2QUAA 1HE1C 3QUQA 4EJSC 1RKBA 1BXGB 1X1BA 3L4BC 2VSNA 3H6KA 4URVR 2GPJA 4A6PA 5EFOA 1L2TA 2PMFA 3ZKAA 4FDMA 4ETMA 4K9NA 1BH6A 2ORWA 3DQZA 1VLJA 3N9IA 2JLZA 1R16A 2ZULA 1E0KA 3OKZA 3QITA 2B92A 1COWA 1ST2A 4Q9NA 5EZ5A 3VDMA 1SUBA 4RKQA 4RDHA 5BV1A 1NNLA 1G55A 1VGQA 3CZ5A 1FNSA 4TKUA 2BFDA 2PX8A 4WTOA 4EUEA 3AV0B 3IVXA 3SHOA 4B2YA 4EG7A 3VR5D 2CROA 5FJIA 2PXUA 2QPOA 2E4AA 1QMPA 3IJRA 4G65A 3A9WA 5TGDA 2P9CA 1PR2A 4I8XA 1CY6A 3OE7A 3PJRA 4PIVA 4PYIA 5J23A 1QSGA 5EIBD 3NLLA 4J2TA 1YIDA 4EUKA 3G5LA 1GGMA 2AUNA 3GJZA 3VMFA 4Q47A 1U98A 2Z43A 3GHYA 3OX3A 1Z18A 4PFQA 2X8LA 4RVSA 1IIBA 2P1DA 1DC3A 2CF6A 3C7AA 3OT1A 7ADHA 2MINA 4D79A 4DLPA 2WP0A 2I1LA 5DGTA 4ZCMA 3IQXA 2RGUA 4BQOA 1QV6A 1IQRA 3S5UA 4FZ3A 1V5EA 1GEEA 4IMIB 1MXHA 2C88A 4WA8A 4RW0A 5JWHA 4BO8A 2QTHA 1CC1S 1P1CA 1F4PA 1TA9A 5JBNA 3GLVA 3TZLA 2CVZA 3IUYA 5K3OA 4CM9D 4KUEA 4GPTA 4WESA 5JVDA 1YOVB 3Q41A 3CZAA 1PJRA 4ENSA 2BP7A 2TRSB 2O48X 5D7NA 2GN2A 1K5DA 1RRFA 1MB4A 2R00A 3QE3A 3BDNA 2Q8QA 1R3DA 1TCUA 1UBTS 3TX6A 4YRFA 2O3TA 3HCNA 3PCRB 2YN0A 3S44A 4XGRA 5EEHA 1P0IA 3L6DA 2GPTA 3H0CA 3MUOA 5HGJA 1F2UA 1XUOA 2H8GA 5I8WA 3C5EA 2GMWA 3TFQA 1O6GA 2O5CA 4YP5A 5T5QA 3E5NA 3A2KA 1YZTA 3HC7A 1R4NA 1PWYE 2QF7A 1HORA 5KTMA 1WIZA 7AT1A 2ANBA 3NR2A 1KA9H 1MA0A 3BGWA 2H2GA 3HHEA 3SZGA 2QVXX 3WIEA 4P5DA 4MMYB 4U3JB 4EFDA 2J6HA 3OTGA 1FBNA 2NUBA 3NDJA 4PG4A 1RXUA 2C1ZA 5ECWA 4QUJA 1DGQA 1V1JA 3PGMA 3C7CB 3VU1A 1NGSA 2VKQA 2ACEA 3JZAA 4LYJA 2FEXA 3VX4A 2GEJA 5L53A 2FQYA 2JAPA 3ENZA 1DAKA 1HR0B 4OQNA 3JPWA 4PPYA 4CTKA 3ZCTA 3KAJA 3RC9A 1JDBC 5BSHA 1OKKD 4BMVA 5AHWA 1IHXA 4TN5A 1DEXA 1HQDA 2XUGA 4CQMB 2GF0A 1X8XA 4WASA 1SQ6A 1S8FA 2YV3A 1MQSA 3A9CA 4FHZA 4HPJB 2FSFA 2G09A 2UYGA 1LS6A 1F0PA 4ZHQF 1ZUWA 4K9OA 2H7YA 2GTIA 4IXMA 1U3VA 2TMYA 4LCJA 1KJWA 1J90A 1UJ4A 4M89A 1T2FA 3JU3A 1SUWA 3I62A 4U2BA 4J0EA 3BWDD 1G7RA 2BGMA 1RLIA 1L8QA 2CCKA 3W6ZA 4OOEA 2JEYA 3FTNA 4ISBA 3KWFA 3E23A 3PRHA 4QVIA 5ITWA 1YD7A 1GQYA 4EK9A 2W43A 3A6EA 4Y2PA 1P18A 4HDRB 4Y9SA 1OFHA 3IUBA 3ERCA 2O19A 1I4LD 2V6MA 3HCPA 2J3KA 2GHTA 2X1LA 1UBKS 4UUMA 5AI6A 3H8SA 4BX9A 4PO8A 5ALRA 5K0TA 1KS2A 3U13A 4MWZA 4CMCA 4ENVA 4QBTA 2BUCA 3U1VA 4UNIA 1E3QA 2XMPA 3I0MA 4EYGA 4NULA 2R86A 3M5CA 1FIUA 3CW2A 1IPHA 4OI1A 2ZWAA 4B3HA 3HDJA 2DAPA 4EJSA 4ARUA 3ZHXA 1V35A 3Q3HA 1FDTA 4FVTA 1N6IA 2AFVA 3CZ4A 3T3NA 1NVGA 2DPHA 1Y3HA 4LXYA 4Y2XA 5AXAA 1JKJB 1NJ5A 1I3NA 2Q50A 3K5IA 2DFLA 4DN6A 3BJZA 2RGYA 3MSCA 1H1TA 1SG6A 1ZY2A 3BRWD 1JQAA 3BGOS 4ATNA 1KYVA 3P52A 2QJFA 1HZZC 4AIIA 4LC9A 1G66A 1EEHA 5B1HA 4KI0A 2HCTA 3GF4A 2AEFA 3AYXB 3LUJA 3SC6A 4NXNB 1QRSA 2OM2A 3L41A 2PLRA 5AK4A 2I9KA 3LPMA 1QQ5A 9LDTA 1D6MA 1DG9A 3O91A 2PJZA 1NPTO 1E6WA 4XWAA 2X0FA 4EQ6B 2KS6A 2ZVPX 1EGQA 5IJ9A 4DMCA 2HHJA 5DYNA 5J3JA 1ZK1A 5TRTA 3RSLA 1S9HA 2IYSA 2YICA 2G80A 2ID7A 1U0FA 3HA2A 2F8TA 4G24A 4B3BA 1FUIA 3DAOA 1U9JA 3ENNA 2H17A 1R0YA 4M3NA 1QR2A 3OCUA 3NEJA 4QLOA 3WGMA 4M0KA 1JDZA 2VF2A 2VYND 4L5JA 1Y63A 1MJGA 2JGKA 4ZQGA 3MG9A 1W6UA 1GZ7A 4GSLA 4X4BA 3ZHOA 2ZJ0A 3K3PA 5AI0A 4BDSA 1PFVA 1POUA 3DBHA 4U8GA 4XJSA 4EI7A 5I7UA 4O2BF 3E1GA 1KP9A 1NFFA 1H9BA 4MKRA 2B21A 4MWTA 4JVNA 1PJ8A 9ABPA 1KDPA 3IP5A 3LXRA 3PXXA 2BP7B 4PLGA 4OFZA 1IZ9A 4N0EA 4TN1A 5JVDB 2P5SA 4F56A 2IOYA 3A9XA 1LU9A 4HTFB 2VXOA 4LPSA 4WW0A 4D4HA 1UBCA 4B3GA 3U19A 1B73A 1T9ZA 5HM8A 2ZSHA 1O5IA 2E37A 1BX1A 4EHDA 4YRZA 4UPVA 1FMLA 4IRUB 4OJQA 2FF7A 3E2IA 3NVMB 3P0RA 2AXPA 3NC4A 4W4TA 4P7JA 2R62A 1QYXA 3GGCA 2SCUB 2AH5A 4KQ6A 1X7ZB 4V0OA 3SQXA 3PQ4A 3FKSD 2R25B 2Q1TA 1KJ8A 4OL0A 1X6VA 1RXCA 1Q7EA 2Y1CA 4PS1A 4Z9YA 4TYMA 5EYPA 5AW6A 3AH8A 1E69A 5GINE 4OFBA 3BSWA 1E8DA 4RJJA 5I48A 2YBDA 1EJBA 1T4MA 4TMVA 1TZKA 2B1JA 3KSZO 4KXWA 3IDAA 3BM5A 3IR6A 3R1IA 3S5JA 1DLIA 4F72A 4GQMA 1B42A 3FMGA 1KYTA 4MVJA 4F38A 4GR5A 4AJPA 1V3VA 3R6DA 1RXWA 4MNTA 1FEZA 5G02A 1JSLA 1I3KA 1ADJA 1YI1A 2HXGA 4H7FA 2FI1A 2W11A 4WD3A 3X1DA 4DUPA 4H9GA 2IOFK 3IAHA 5KWEA 3S8YA 1HH4A 1TKCA 5EJAA 3AERA 3MAJA 1XVVA 2FVYA 4G36A 2X4GA 5C1PA 5KDDA 2IKQA 4ND6A 2VNAA 1DU4A 1GN8A 2H2DA 5BVGA 1T36A 1MMFB 1L7EA 1NF2A 2GYVA 3GVPA 1EP3B 1ONSA 4F85A 1D1SA 4OO3A 4WERA 1N0WA 3T9DA 1QGUB 3OLWA 2MQKA 2G5GX 2G6TA 4CFZA 2I03A 2KZ8A 4HWSA 3RLIA 1E61A 2GESA 4LE2A 4DDKA 1O0BA 4J8PA 5AKZA 5I9TA 4II7A 1DCFA 3EAGA 3MIZA 4RA9B 5I7FA 1KK3A 5AM1A 1YS2X 1U5BB 3V1NA 4LNUA 3PE3A 5JFGA 5F78A 3THXA 5IABA 4LF9B 4RH3A 2J59A 2WJWA 3QWIA 3WKCA 2VDUE 4YH1A 4TV9A 1EVYA 1L1EA 3KU4A 3DLTA 2XXJA 2C1EA 4WE3A 3V9PA 1HX7A 1T10A 4QDJA 4PYMA 3PD1A 1JKIA 4JLVA 4B9EA 1EESA 2FDCA 3DBOB 3B3FA 5JCOC 4LYFA 1OHHA 3T5TA 2EKBA 2I71A 1VG9B 2ZYUX 4RK4A 4EAAA 2MDTA 2J7WA 5I4CA 4ZAGA 2HFKA 5AICA 2ID9A 2KHZA 3BAZA 2ZANA 2ZJFA 2O3UA 1LH0A 3MERA 3NORA 5E0OA 4DZRA 2O3JA 3H16A 4LV6A 4WVLA 4N40A 3EZYA 2A94A 4X66B 1ZFNA 1ZGJA 3DEZA 1KPHA 4BJ3A 5FR2A 1GZDA 2A9OA 3HMKA 5J2UA 3WOHA 3HXQA 3H7AA 3LCVB 3SZUA 4EHFA 3C6KA 2B8WA 3K96A 5L8VA 2Q1YA 4HDSA 2FPSA 3C1OA 3BORA 4ND1A 3K5WA 3MHPA 4ED9A 3ZYCA 3A4MA 2ZRJA 3TELA 1SUEA 4G1FA 1Z8HA 1NXVA 2W2LD 3C5HA 4TRNA 3RIHA 5KYUB 2ZUFA 3I53A 2VPIA 1THTA 2XBLA 4CKWB 3D7RA 4XYGA 4HSGA 4L7QA 4Q7EA 2NU7A 5KHOC 1PV1A 4AG3A 4QGGA 1V7PC 3QLUC 4OHMA 5D51S 3CG4A 3TSAA 3JQ8B 3GDHA 3UAOA 4A0GA 4CL2A 1IWPB 3ZXSA 4HNAB 1WZUA 1ZUIA 4NOMA 5G1NA 2P6UA 3W77A 3DB2A 4DM3A 1U9IA 1DOHA 3SX4A 1EB9A 5SYMA 2GM5A 4Q3NA 2JHCA 3M33A 4HX2A 4R9NA 2LD4A 5IFLA 2HCFA 3LFHA 4EBBA 1C8KA 1QE3A 2PXCA 1TIBA 1AXRA 2OY0A 2UZIR 1XQVA 4INPA 4KN6A 2ZSIA 4PQGA 4WEQA 4LBWA 2FN8A 4HLUC 3ZXUB 3QELA 3U4MA 3VNVA 2N9UA 1IBLB 3L9XA 1X2LA 1N8TA 2ZUBA 2YY6A 2QKYA 1N57A 2QOEA 3GFOA 2BKLA 3A2NA 4FYXA 4WN3A 4AIRA 2DEUA 4DDTA 3C4QA 1JLRA 2QPLA 3PE5A 4X6YA 1KQ3A 1NQOA 2PPLA 5EAIA 1C9KA 4RKFA 3F6RA 3L6BA 1KH2A 1ZJZA 1V4VA 4G1CA 2C7QA 5DN6D 1RWVA 1Z88A 2JI4A 3D0RA 3CUYA 2PD6A 1J0DA 1QBKC 2XYRA 2PMWB 4O3FA 1VBKA 3UJDA 3OFVA 2W6JA 2WV9A 2H06A 2ODPA 4F93B 521PA 1V48A 2HWYA 2ZVQX 3GJ3A 3ID6C 4D3SA 1T2EA 2W83A 3PCXA 4HWPA 2CHUA 4X1OA 4KTTE 5FTJA 4CGZA 3HB9A 1P5JA 3HXPA 2HLDA 2ZI5A 1A8SA 2W98A 5E9QA 4HYYA 2QL6A 2BHSA 4AO8A 2R48A 1YZLA 1YQXA 3AP2A 2R9VA 3FFTA 3LQRA 1I10A 3DL2A 3F0TA 3UFBA 4B7CA 5LSAA 3B6IA 4OHOA 1IOWA 3P2IA 1G3MA 5G1OA 3B48A 1ISSA 4M9ZA 2I2FA 1N6OA 1E2JA 4X4CA 2QUZA 2RONA 4WACA 3TAXA 2VXBA 5I7VA 2C7OA 2QMZA 4ZQFA 3RRBA 2JHFA 4BUZA 4ZZ2A 4Q02A 1TM2A 4NDAA 5A0VA 1VPVA 3R6GA 3AQIA 2GBLC 4XIFA 4ZRMA 3W5BA 2ZKIA 4LBZA 1XPUA 2PZEA 2HRBA 4Z2YA 1I5OA 2A9PA 1TRKA 5E4FA 2QTMA 1TQ4A 4IUYA 1L5HB 3BH0A 4RF4A 4TS4A 4TZ0A 2ZTUA 4R3NA 3FYAA 3VYUB 2PBRA 2QD4A 4PWYA 3UMCA 4EFLA 3NTUA 4H1WA 3LQ4A 2WM9B 4DJFC 1KSHA 1SOAA 2B82A 4PSKA 2BF4A 4IO0A 3CU5A 1L7DA 3ICWA 3F90A 2FX5A 3GAAA 1R5OA 1X3SA 3P0FA 3WFZA 2CLDX 2GOYA 1KJZA 2X9NA 1LI7A 1N5IA 4LPKA 4CUJA 1LSUA 1U0EA 2L69A 4CRWB 4E88A 3LIIA 3FTQA 1QO9A 1C8LA 1XVTA 1ZNXA 1KOFA 4MWDA 1RI4A 1E20A 1G20B 2ZYGA 3WV5A 5GIOE 5IBQA 4EHJA 4MGKR 1SHLA 1C7RA 4TS3A 3EIEA 3HBLA 2IYWA 2RK4A 4RV9A 1E5QA 2G4VA 4R2WA 3EGVA 4EG3A 1AKNA 3TOZA 1TF5A 5DXFA 4Q48A 5B57C 1X13A 4AKTA 1HG0A 1WD7A 3UC5A 5E6RA 4O4IB 4LCBA 4U2DA 3RYHB 4CKEA 3U4QB 4A23A 4D9HA 2IIQA 3I76A 2PM8A 1VMAA 1YDHA 1P39A 1H9AA 1ZVMA 1QP0A 3CLSC 3WMGA 4KIWA 5KYNA 1YOBA 3LM8A 3MIIA 2HTFA 3UA4A 5C7OO 2ZUVA 1ZIPA 2IV7A 2VXCA 4X45A 1M67A 1R0KA 2VHWA 2H3HA 4KAJA 4X91A 1MRSA 2ZXFA 5EUQB 3GLTA 4HK4A 1IC6A 3TTWA 4M1OA 1YQGA 4RJ2A 1XG5A 2D1QA 4L16A 4J0HA 4HMQA 4BEWA 4IFIA 3GCWA 5KQRA 5CUQA 3A11A 4H1HA 1JEQB 1TU3A 2ZS8A 5HIJA 5KKAA 4CCYB 3HKEB 5C3UA 4JLMA 3VSBA 2QSUA 2BZ1A 2FU5C 1L8XA 3GELA 1UQRA 2CLFB 4L07A 4DT1B 1JPJA 1NIJA 3ELBA 5LQNA 3OVMA 3PRKE 2F64A 3ECAA 1KMHA 4G2TA 2DGDA 2GAAA 3GRYA 4RORA 4I6EA 3SICE 1SUDA 5BURA 3HKBB 2BTOA 1T91A 1GQ2A 3OF2A 1OLUB 3UICA 3FTDA 1M74A 3EGOA 4Z4QA 1P4GA 1OCEA 1HF0A 1L0BA 3O9ZA 3Q11A 3WWDA 3ESDA 2Q45A 3L8CA 1EUYA 4QT0A 4DLRA 4BXOA 2B3DA 2VUTA 1RQLA 3RVPA 3G8YA 3ZKWA 5JD4A 1P5FA 5KNCA 3PEWA 3TLCA 2QL9A 4RXTA 2QY6A 1EH5A 2PGAA 3IVPA 5TXGA 1EJ0A 3RTAA 3ZDZB 5C1OA 1GILA 2QR5A 1GCAA 1RP1A 1VHDA 2GJ8A 3UH0A 3DVLA 1TCVA 2NU9A 4AMGA 3PFCA 1IMJA 4BZPA 2D7CA 1R5BA 3NHMA 4CF4A 4ENQA 2I29A 1RPJA 2EU8A 3QIVA 5JZ9A 2YKGA 4A9AA 5IJ0B 3VVBA 3ORQA 1SBCA 4BYMA 3BWBA 4M9SA 5HWSA 2R79A 3DDNA 3V6LA 4IAOA 3RZZA 3OWXA 4AZWA 4MW2A 4LECA 1IC8A 3JZDA 4IX9A 4KR7A 1FRFS 5KEIA 1A9OA 4TM8A 3K1YA 4IQ0A 2Y6VA 4D45A 4Y2VA 2HXYA 4LHSA 4REMA 5AJTA 3VXKA 3W3AA 4WK2B 1Y0BA 2C58A 1R5NA 1RZ3A 1PZEA 3NDPA 2FHPA 3KTDA 3SM3A 2J87A 3ND5A 3TQIA 4B34A 3WLIA 2C97A 5AVRA 2LYQA 4R0VA 4KRFA 2ZLBA 1YVRA 3BC1A 4XTCS 1IEVA 2MT9A 4DLZA 1KKUA 4MVJM 1MQAA 1IULA 1LK5A 2HK6A 3X1WA 1PZXA 4LJ6A 3CT6A 3ZX5A 2E4ZA 4DVJA 2QYTA 4P4SB 2I3BA 3SYLA 8OHMA 3VWSA 3ZE8A 3M6MD 3GGGA 2QTTA 2Y77A 1OGIA 4ZP1A 3TWOA 2WQ7A 2XTZA 3V2IA 3L1VA 5CJPA 3B5EA 1AJEA 2JGDA 4A8HA 1WMEA 5J47A 4AK9A 3H99A 4CE6A 5JALA 2PRSA 4B4OA 3U31A 4BQIA 1MVNA 3DD5A 3N6RA 4L8YA 3F7OA 3D7NA 2PXQA 4ER7A 4O5AA 3QOXA 4C4SA 4A1OA 821PA 5LVAA 4IA8A 4PAWA 3ZU4A 1ZMBA 1OU0A 2P6OA 3D6AA 2TYSB 3RYTC 3MWEB 5JRDS 2HREA 4ZREA 4RHCA 3E9EA 1WSDA 3DMTA 5LA6A 4MO2A 4YCCA 3TINA 5FPQA 3CNQS 3AI1A 4RY0A 4DCUA 4M0FA 3H9BA 5LWHA 3AHCA 5CTAA 1F0KA 4GLLA 3WKEA 4KXLA 3ZHSA 3OKFA 1F51E 2W00A 4QUHA 4ZN6A 1D4AA 3JWEA 3QXXA 1PFKA 4XJTA 3TIXB 2FMXA 4I50A 5E1BA 5EQDA 2FFHA 3AESB 2VDNB 3HGTA 2FFAA 4J0JA 3GBFA 2N42A 1WPQA 3JQDA 3O8LA 3VNRA 4BLUA 5EIWA 1MA3A 4TX1A 4WZAE 3O92A 1V1MA 5B3JA 1TA0A 3KZCA 1A95A 5KX5F 1QE0A 2UZ3A 3LCCA 1AY0A 1KIAA 2FH5B 3CRZA 2UVDA 2GDZA 3CF4A 4L9WA 4JJAA 3JAMA 1JEDA 3KV3O 4JN6B 1M54A 5E6RB 2E87A 1BXRB 1WY7A 1B2LA 1J70A 1OD6A 3ANSA 3MGAA 4FHFA 1MLDA 4FFSA 4P38A 3RHZA 1IM8A 1FLNA 1RM4A 2C96A 1Z6YA 3SSAA 2CUKA 3AKCA 3FMYA 3SZLA 2P90A 3KYJB 1LEHA 1AXGA 4UU7A 1ZC3A 4AXBA 4GNKA 3M81A 3MT9A 5GADl 4A27A 3C14C 1RD4A 3I2IA 2VHUA 1SURA 4E4RA 3DKRA 4WKGA 2AJCA 3IBYA 5IWAB 2AFIB 2J33A 2QAGA 2VAWA 5T8KC 3TB4A 2CK3D 2N3ZA 4XYMA 1FUKA 2AD5A 1GITA 4AF8A 4AQ7A 3NC1C 3V3TA 3SXJA 4J3FA 3CSUA 4R1LA 3WBBA 2XBMA 1PSDA 4J94A 1FU7A 1SVIA 2PX4A 4ZZ0A 1U3CA 1LWNA 3LG2A 1J33A 3EVDA 1BMFA 3VPAA 3RVKA 3STTA 1XR3A 1ACMA 3R0QA 2AW6A 2B5VA 4GX2A 1GSIA 1P1IA 4O4IA 4OM8A 4OU4A 3DUWA 2QVLA 2Q4EA 3FY4A 3DEHA 4IRMA 4KO2S 3AVPA 2OT3B 2WUDA 3GFVA 4BBJA 1JG1A 1AF7A 1PJLA 4BX2A 4QSHA 3BXGA 4F3CA 4M2LA 4ZYVA 1MB2A 2QTVA 1D6NA 4G9BA 3Q8KA 1E3OC 4R69A 3GOHA 3BEDA 4EGJA 2FWBA 5KNLA 1RI5A 1WY5A 3SIWA 3DXXA 3V7YA 2VDLB 2XD4A 4UE2A 1RYEA 4ZYUA 4FWTA 4XWTA 3A0RB 3VBCA 2JAHA 3FLMA 2C61A 1SC1A 2C04A 3CVOA 1H2RS 2AG6A 3VYVA 4MJLA 3WXBA 4A0RA 4LOKA 4F5WA 1L5YA 4ZEMA 4RDCA 4FCCA 4BQQA 1P3Y1 2O07A 5JMPA 5A7GA 4MCXA 1QUFA 2NXNA 1NV8A 4E32A 4UVDA 2EIHA 4BGDA 4H60A 5LOVA 3H5VA 4MI6A 2G5TA 4PWZA 1CYEA 3LNTA 2XMDA 2OR1L 3AF1A 1G8MA 1GPYA 2QD3A 2GXSA 4H77A 2EFDB 4KG7A 4OHFA 4IQGA 3DM5A 4P1ZA 3RC3A 4KDEA 2OLJA 4LQLA 2NU7B 3PA8A 4CQNA 4NOJA 4RTNA 3ESXA 3GLIB 4DRZA 4IVNA 1U0JA 4AO6A 4RVNA 4ZU6X 221PA 2I2AA 5GAGi 2AKEA 1HRKA 5KC9A 4MA4A 3PI7A 2ZRHA 4GT1A 2XWBF 3SCGA 3ADOA 2P4SA 5F12A 2XCUA 5L7WA 2F7SA 2VHCA 3B2EA 1EFVA 3Q7RA 2P6NA 4D57A 3WNDA 2G72A 4RIHA 3CHYA 1FK8A 3H7IA 1GDDA 3UCFA 1VCHA 1WSBA 2OZLB 1ZZ7A 1SPBS 1JGTA 1X1CA 3CPHA 2WFLA 4LA4A 3L8MA 1E6UA 2I6TA 3RUDA 3TOCA 2IDJA 4OI4A 4TMZA 1NE2A 4B7UA 1VA4A 1T9CA 3HMQA 3GLHB 4RPJA 1RJ9A 2AG8A 3UUEA 3G13A 1X15A 6ABPA 3EMBA 3EFOA 4A8JC 1J7JA 2MU1A 3PLAE 3RWMB 5JNUA 2GILA 4DR4B 1XZFA 2AR7A 2QRPA 3V00A 5FBVB 4RTPA 5I45A 1AGPA 4TRRA 3HZHA 1AX9A 1PZFA 2XD9A 4UTOA 3K8YA 1ULZA 3PHGA 2B99A 2PGIA 2WWYA 4DUGD 4QUKA 3LLMA 4RV4A 1SA0A 3H1EA 5IT0A 3QKRA 3KSBC 4UM5A 1QH9A 4S1NA 3O84A 4IIHA 4QBGB 5DFAA 2BFEA 1TFUA 3NO4A 1V8BA 3JXEA 4QOSA 3EIFA 2OO5C 3CIOA 1JR2A 1W4AA 2R8EA 1E99A 1L4UA 1VXOA 2IXAA 1NI4B 2IYVA 2P5UA 3DAGA 4MWEA 3N2KA 2RGNA 3BSYA 3M6AA 1ZJ4A 4ZCLA 3T5GA 1SXJE 3WDMA 2Q41A 4RD2A 3ND9A 4AG5A 4M98A 4RGVA 5K8IA 3BKWA 4RQUA 4POAA 1DO2A 1WQ1R 2VDJA 5EXEA 3IELA 3X2EA 4EHNA 2E89A 4EG5A 4IJKA 1WW8A 4NE9A 2AIRA 2WD7B 3CTPA 1GA4A 2W90A 3QEKA 3VR4A 4ZO6A 1WCIA 2OYSA 3F47A 1CFZA 3C3PA 5HS6A 3TVDA 4BS9A 3TQSA 1ZWKA 4TUYF 5L3QB 4YPOA 3LBIA 4OXIA 2FWMX 2OCBA 3OTQA 1L3IA 1MP0A 1O54A 4NMHA 3CA8A 5KAPA 3BFXA 4A0HA 4B35A 1JIQA 4HAXA 1HUQA 3CJTA 3IHTA 4GI2A 4I4CA 4IV8A 2A5LA 4F11A 1A9XB 4RM2A 1U1DA 4G9EA 3N53A 3VR0A 4C0LA 1L1MA 3NWOA 4J6FA 1N32B 4HWOA 4LDJA 4ZU3A 3TSOA 5J1TB 4DV4B 4IH4A 1NN0A 3TRDA 2DF8A 3NTLA 5I9IA 1M34B 4B87A 1U2EA 4YAIA 1DAPA 2NV0A 1E3DA 1T43A 3IUSA 1DEOA 1NM5C 2NG1A 2NU6A 2FYTA 2F48A 4PINA 4E11A 3EPRA 3QV1A 1LV8A 5HQ3A 1Y9AA 2IU6A 2PX2A 4NARA 3TL6A 2O8EA 3ADKA 1RKXA 2X0EA 4EG4A 2CWDA 4DNFA 2QQEA 5HK8A 3SP1A 2KEIA 4YRAA 5JEDA 3GLHA 3RROA 4Q9HA 5CYOA 1E7MA 1G7CA 1Q1QA 4OBMA 1A2KC 2JVIA 4YBAA 2PNFA 2VAMA 1XBTA 4LJKA 2X8JA 1CQTA 1IU9A 4Y0AA 5DJ5A 4DEXA 4Z54A 1CE8A 4AUEA 2JQEA 4I5IA 2FSVC 1T9KA 1KJYA 1MAVA 4NE7A 1NDQA 2Q2OA 1E2FA 1DBIA 2QLLA 2YJ4A 2P68A 3AZPA 1DQSA 2C03A 3KQWA 4JYBA 2LNDA 3INNA 4K9SA 1WVGA 4YO7A 1IXSB 3TZHA 1F8YA 2R1UA 1H6CA 2XKJE 3JRWA 3ECSA 4I8IA 4W9NC 3UIEA 5LJIA 1Z0SA 2ZOSA 2KI5A 4YRQA 4M22A 4E70A 4EG0A 1OIWA 1WSAA 4LKRA 2RJNA 3RPEA 3KQLA 5EMMA 2P2GA 5B58C 1FA9A 3FCAA 1T36B 4FBMA 2WQZA 4NBRA 3UAVA 2FGJA 1FNNA 1JFFB 3OIYA 3A1DA 2OR3A 3AR4A 2H18A 4E21A 1EI9A 2GLTA 1ENZA 4JP5A 1BE8A 3H5NA 4W99A 4YT5A 5DB4A 5LOVB 3IPRA 1KJIA 2CZGA 2C9YA 3P9IA 5A3VA 3RIEA 1DBWA 3DBHB 3ZWPA 3IC5A 2EJTA 3U80A 2FLWA 1J0EA 3A3PA 3DH0A 3Q12A 4PRKA 3UT5A 4C4AA 5I3ZA 4V0NA 3THXB 1VQ1A 1GTG1 3PL1A 4M21A 1B6RA 2FPIA 3VR5A 5JSFA 4PANA 2FQWA 2BMFA 1D2EA 4DXHA 4PYKA 4OCZA 3OJOA 4ZJYA 2QTLA 2QX8A 4DE8A 3FETA 3OLQA 2H2HA 4DANA 4GHJA 1P61B 3OY7A 1ZQ9A 3HDHA 5GV8A 3RSOA 3IBSA 4N41A 3CZPA 3R9KA 3DEIA 3ZVNA 2PY6A 3AFMA 3DOFA 4WXMA 1YL7A 3U9SA 3L7LA 3U1BA 3T5PA 1XB2A 1LPOA 2IEDA 5AM0A 5BRNA 2XXAB 4KQHA 2VPTA 4EA9A 5C4MA 7MDHA 2W9XA 2YV4A 3L2OB 2EZ9A 3AUAA 2BJCA 4J4HA 4ZA2A 3AERB 3K09A 4ZD6A 1U3DA 5C7YA 3L4SO 1BW9A 1YR2A 5EJ2A 1ZUNA 4Z9FA 2HLHA 3P1JA 4AP5A 4GL2A 1DX4A 4D42A 4XIJA 5FWYA 1R9GA 2DTDA 5GAHi 3T41A 2ORIA 1HRDA 1O6BA 4K81B 3FDZA 2JLCA 3WLAA 4KE8A 3F74A 2BR4A 3Q7TA 5JSKA 2K7FA 1UPTA 1UT5A 4YMTA 3O6VA 2ZUSA 2VEOA 3C2QA 2D3TA 4K03A 4O33A 2QSYA 1JX6A 5AOBA 3GBSA 3W05A 4XASA 4FEEA 5FFFA 3TQTA 1JJAA 2EG5A 3IIEA 4JYZA 1RMTA 4QGSA 5T57A 2DQYA 3JYOA 1GZVA 1C9EA 1K2WA 3MVEA 3OCWA 3MINB 4QXMA 3R9XB 4WY8A 4Y1FA 4NDZA 4M1EA 3OCZA 1XDSA 4GOMD 2A1TS 2G0NA 3PKJA 4JKIA 4I1SA 4PSDA 3USCS 5U4QA 2A67A 4WHMA 4UOQA 1V6SA 2A2ZA 1DBVO 5COQA 2HK7A 4BP1A 2B4YA 3BBLA 2WZDA 5CURA 1B41A 3PC8C 5A7HA 4ZYXA 3EXAA 2EHDA 1V0JA 1F1JA 4M8LA 4NFYA 1MOZA 2OQVA 5J5VA 2O7RA 3TEMA 4TYWA 4P81A 5FAKA 1HK7A 4HN9A 5AVJA 4HY3A 3DDCA 1WTCA 3T9FA 1Q7RA 2GTHA 2RH8A 5AJVB 4KW7A 4OHZA 5IAGA 3DP9A 1P2VA 1ZZEA 5EWJA 3T34A 3WO1A 4IDPA 1YJQA 2PWZA 4QWWA 4YT2A 5LMCA 4A91A 2IHNA 3H5RA 4BEJA 2ZW9A 5BQPA 3A37A 4MP3A 2I65A 4TUYA 4WGGA 1U1IA 1Y8CA 1U8YA 1YKFA 2NYVA 4Q93A 3OOSA 4WWHA 5CBKA 5EJ5A 1ABBA 1QIKA 4J76A 5FDFA 3FNIA 4U8HA 3CVYA 2QRVB 2GKGA 1KL7A 5G0WA 2KX7A 4BQSA 3TRFA 3GRRA 2PAAA 3I5AA 5SV2A 3R3JA 3HCAA 2VDKB 2ZTHA 2I2BA 3SU8A 4DQVA 2JG3A 1NV9A 3CPJB 4CNBA 4JDPA 5FOTA 4OY3A 3N8DA 4A7PA 3C3KA 3FHTA 3E9YA 3Q88A 4WFKA 4DMRA 2CMHA 1RI1A 2EJWA 2QHXA 3FUUA 2JLWA 4FDVA 4IOJA 1L5GB 1NU8A 3ORSA 4KUHA 4UEWA 4IMPA 3MRSA 4JOSA 1SIOA 8ADHA 1ESMA 2OP0A 1Y3AA 4MVJE 4E2FA 3RVQA 1U8ZA 1T3GA 2H0AA 4NDWA 3LX5A 1UWKA 3QPBA 4B4WA 1Z5UA 2I80A 2HCJB 2QK4A 4IW3B 3LY9A 4N49A 4Q1BA 3FHOA 4YQZA 4AZ3A 1WKCA 2XYVA 4FKBA 2A0WA 2A86A 4U63A 2C31A 2NO7A 4RZ3A 3G9QA 4WZBE 2PUBA 1YFJA 1VL0A 4IJWA 2J4FA 1MV5A 3DOHA 3UMRA 3KQUA 2V96A 3U3KA 2NVUA 1V6CA 1W19A 1AIPA 1RJEA 3BE8A 3I5MA 3I6MA 4XX0B 7ABPA 3KB2A 1T2NA 1JT9A 1SR8A 3LUAA 1N4AA 2AQHA 1MNAA 4MW4A 3UKOA 4BJ5A 4JJ6A 3AOEC 4RD6A 2JAOA 2H4YA 1ZJYA 3P9YA 5JCJA 5DHQA 2OXIA 1M34A 5DM60 2EBUA 4Q1VA 1EDOA 5MFPA 4BJ1A 1R3UA 3MCVA 2HA2A 1YB7A 2VAPA 2WKQA 1HPLA 1ZUNB 3NUZA 3PFWO 4K6OA 2OCAA 3PQ5A 3JALB 5IVHA 2HA7A 3CG0A 2REQA 3UJ9A 5KNBA 5L9AA 3Q15C 5YASA 4RU1A 8MHTA 4DIMA 3IT1A 2FSVA 2WU3A 2P2YA 4FI3C 3O47A 5IVDA 4AFNA 4E5YA 4KXVA 1E6CA 1A8HA 3KAQA 3TOVA 3M1AA 4MHTA 1P7VA 2R63A 4QUEA 2GASA 2X5NA 5LQCA 4MR7A 5FBQB 3RREA 4DV0B 4JI3B 2L49A 3SJZA 2JS7A 3EWAA 3JATB 1N8KA 2G17A 2ZIFA 1M8GA 3DAPA 4YDHB 1D07A 1YHYA 3D6HA 3GOQA 4LSZA 4DLNA 2LXNA 3ITDA 4EPVA 4LYEA 4ZV4A 1C0PA 1KBZA 4H7DA 1UZNA 4NE2A 4GPEA 3FMOB 3X43A 1IWOA 2WYVA 3FROA 4PU4C 2Z6VA 3LUBA 2R00C 4GOOD 4OGWA 4P2BA 4UBNA 2Q5HA 3CNNA 3O8OB 1JZTA 4LXXA 1I0LA 3UMSA 3H9GA 3OH8A 5KSZA 5AHKA 1MNQA 5LL6P 3GZCA 4B3JA 2WIAA 1PQWA 3QY9A 3WTBA 4L9AA 1WDWB 1YXMA 3N5CA 2BM9A 3BD7A 3TG8A 5TV2A 3H1PA 3IIKA 3BWXA 3VNBA 5ARDA 1UC8A 1JHRA 4QBIA 2CLLB 1U0OC 4QUIA 4YJHB 4TTVA 1FQWA 5TPZD 1L9KA 5DCUA 1L1FA 3ZH9B 5HR5A 1NBAA 2H4HA 4HGRA 2JGEA 3O94A 1RJ9B 3EEQA 3TD9A 5F2NA 1R9JA 1AUXA 3PZBA 2G1PA 1WMBA 3OFSA 4QRDA 2CE7A 2WP8J 5PGMA 5A7LA 4BB6A 1LJLA 4UAVA 4EYEA 1ZGGA 3EY4A 3MWGA 4XQEA 5DI9A 4KSBA 3L4KA 2BFOA 4RY8A 4CODB 1QGYA 2P62A 3H3XA 1SNYA 5D3QA 1BCRA 1NKSA 2GVZC 2FUKA 2GETA 2GERA 2YZMA 3MJEA 2R44A 3EWSA 4MGIR 4PVDA 2AVNA 2QGNA 3ZLJA 4G1EB 2HK9A 5KREA 4JSTA 2GGSA 1DV1A 4TKUB 1CPYA 4KC0A 1NI3A 1T2DA 1YVUA 4WN9A 1EFPB 1Y6RA 5HBRA 3VR3D 4EVIA 4JI0B 2QN2A 1WE2A 5AO9A 3AVUA 4L02A 2RH4A 3LGSA 3PXPA 3I1JA 4GYKA 4HV4A 2QTZA 2VWHA 1JHMA 3F9RA 3HS3A 1I14A 1DINA 1LBHA 1OXUA 1X9IA 3KPVA 3QLVA 4Q0MA 1ZJ5A 5AVKA 4J1TA 4B48A 5CDYA 5KKNB 3JQCA 4J7XA 2FUG6 3TNFA 3ZWCA 4B32A 3RADC 4MS4A 1JFVA 5JMOA 1K86A 2J3HA 3ZQKA 4Y6LA 1H05A 2C9CA 2X7JA 2XF2A 3L4EA 4FW9A 2IXDA 2EXXA 3WNCA 1GRNA 1YU6A 2FX3A 4KBFA 1SHKA 2B0CA 3QVOA 1GL7A 3THOA 1YA4A 2PL3A 4CQMD 4LV5B 3VC1A 1ODSA 1KARA 1T0BA 2BEUB 3JAKB 2Q5JA 4NJMA 5H7XA 2VJQA 4HWKA 3G2PA 3IOEA 2OO5A 4QFBA 5U9CA 3K70B 4YAKA 3OCCA 1DFHA 3R5TA 4IDCA 3HI6A 3G23A 1UP6A 3R23A 3TPFA 3RG2A 3P9CA 2R6GA 4QUDA 3U39A 4C1NA 2H7XA 1KEKA 3BMQB 1NUAA 1V47A 4HS4A 5C1IA 1H2FA 5K0NA 3WWYA 3LX8A 4HBGA 2Y1XA 4LWPA 4YCBA 4PIMA 4HUTA 4GG1A 4DR5B 1B8UA 3A9TA 3EBLA 2CBGA 1WH8A 2ZK7A 5G0VA 4N5IX 5T3YA 3DFMA 4EA8A 5DGCA 1Y34E 4C22A 2EQAA 1SQ0A 4KCGA 2DT8A 3KEGA 1DWQA 1ETUA 3KYBA 1KAMA 3VV2A 1ECJA 2OGTA 4PZLA 2VZ0A 1NOJA 5FNVA 5TS3A 3GEIA 2P11A 1X1QA 2ZG6A 3NP9A 4AN4A 1ZD5A 1CULC 1EUCB 2DT5A 1FTQA 3ACDA 3FVTA 3L0YA 3Q3EA 4N4AA 1CBUA 1CR6A 1EMDA 1XHEA 3H8JA 4Y2YA 3X2FA 4COKA 1V45E 1GARA 3QKIA 5I9LA 1KVUA 3RRMA 4UKDA 3GLRA 2JBHA 1S3SA 3Q3GE 5CA0F 1T6NA 5FI5A 4JBNA 4DLXA 2NW6A 4ZI7A 1VLVA 2W6MA 2X2FA 4AJJA 3E7FA 2JLVA 1GWNA 1QQBA 2VBCA 4GPZA 1LQUA 5KNDD 3EVZA 3AVWA 3TJRA 1E6KA 5IEJA 2A9JA 1II8B 1RYZA 3L8GA 3UJBA 3DPIA 3BPSA 5JW6A 2NZYA 1OBCA 4FS3A 3VZSA 3DJYA 1M10A 2BGJA 2J9XB 5GJVC 4ROTA 3A0UA 1XKTA 5ALOA 2CXSA 1XJ0A 3EJWA 3MOSA 5D1HA 3VO1A 1U28C 3SS8A 2V3VA 5JLJA 1EM8A 3VNQA 4CMKA 5K45A 2QT9A 5DN9A 4UBJA 1U8UA 3K2QA 5IM4F 2Q3CA 4XM0A 3S1AB 1U0RA 4FC6A 5EN4A 3NASA 4MGZR 3OOJA 2X8WA 2V7BA 1I51A 5HXAA 1OOEA 2YR0A 2ZYDA 3A9SA 1GLVA 2J5KA 4O4HA 3ZJTA 4DLAA 2JARA 4W5RA 1UDWA 3DDZX 2PV0A 4UNQA 3ZNNA 5E1DA 4MB2A 4Q9AA 1PCXA 3F78A 4IMRA 3IAAA 3U60B 3U61B 2Z57A 3DL7A 1S5PA 3HM9A 2H3EA 1XCBA 1NASA 2H57A 4ON9A 5BSUA 3SIPA 3NYWA 5HJ2A 1E4EB 3LUHA 5FH9A 5CT4A 2O1SA 2PFGA 1LLUA 2GPBA 2YWEA 3G89A 3KLNA 4ETIA 1QVZA 2OGZA 2AC7A 4UHJA 6Q21A 3COPA 1FFYA 1AO0A 2XA9A 4QU5A 5EIOA 3IT0A 5AM4A 1IXYA 1JG7A 3HCDA 2IH2A 1UKBA 2FPPA 4MGYR 3C3YA 5KTKA 4Z0PA 2V03A 4U7GA 1A1SA 3LYLA 2FGKA 1JIUA 2XE4A 3E2PA 1SQSA 3Q9UA 1W4RA 5ECGC 2P9ZA 1E6MA 5CNKA 1B6TA 1YE3A 5FTWA 3C48A 2J4DA 2AYZA 1YTLA 2DPMA 1QCYA 3COJA 1N75A 2AX4A 1T9HA 1JILA 1O4WA 1R6VA 2R7LA 1CETA 1EK6A 1UBHS 4CR7A 4YRSA 2DKNA 4WLVA 2IW1A 1NL3A 1XRRA 3FYSA 1SG9A 1G3UA 5AOVA 5JG7A 1MB9A 3H4MA 4BHTA 1ULHA 3O9MA 4P82A 4RMGA 1PLKA 2WIKA 3LQKA 4LQCA 4LKOA 5KVVA 2ZZNA 5TEVA 1Y6FA 1RPAA 1V6AA 3EF1A 1TEVA 3IYLW 4IIJB 4D82A 4M0PA 4CL8A 2O2GA 1Q21A 1ZSYA 3ICCA 3VI4B 3SMQA 1W4CA 3LD9A 1X74A 2GAOA 4B3XA 5TARA 2J5RA 3PEYA 2AQIA 2PKWA 3VDQA 1SB8A 3KZOA 2V7XA 1H23A 2FN3A 3UMFA 2QVGA 4NNPA 3R6WA 5GONF 1J9ZA 2FHSA 3ON5A 1DWOA 1GNQA 1X7YB 4GD3Q 4RAQA 3OIFA 4JZYA 5KB3A 2YNMC 3AB8A 4BTLA 2JA2A 4C03A 2L42A 2HH9A 3I9MA 3A06A 2ZCJA 3L06A 3PQ6A 1ZCAA 5IH7A 1W5TA 1KOGA 2XDWA 1SCJA 5D3MA 1FVXA 1OWOA 3RV3A 4MVJG 1ECBA 4Q7JB 4BMYA 4D43A 3WFIA 4CL0A 1MJ5A 1J8FA 1KI2A 3FN4A 1QQ7A 1OYOA 4HH4A 4NFHA 1E3MA 2FP4A 1JFTA 2J08A 4YMGA 4P0PB 3T7JA 1U1EA 2NQTA 4DTCA 5IZ4A 2ZUUA 2RGCA 1T6YA 2VA9A 2QBYA 2OC4A 3BEOA 2AOXA 4CMAA 4EHKA 4Q4CA 2NAPA 3L0OA 3TMKA 4C0AC 1CS0B 1Z33A 2I5PO 1KRWA 2WWFA 4F1KA 1ZKMA 1SCNE 4BFVA 4D9EA 2AI1A 3B70A 2B4TO 3LP8A 5AHRA 2ABWA 5M2QA 3CVXA 1NVDA 4N8DA 3WFJA 2M6RA 4RHYA 3TXXA 3FNHA 4GWLA 2XBUA 5BWLA 1W581 1OGJA 1XCLA 2G28A 4KR0A 3D64A 3RJ5A 3TNLA 1N34B 1A88A 1E2NA 4FC7A 3VTZA 4JV5B 3HZIB 4NYJQ 4HLUA 4EELA 1ZJWA 1GRQA 4ZI3A 2TMDA 2IZ0A 2M4HA 1L1RA 3DKKA 2GHQA 4P4LA 1AB6A 4KL8S 4ALIA 4GWGA 3I8OA 2MYUA 2X7XA 3N8KA 5KDLA 4AT1A 3HJUA 2WJGA 5B1EA 4OMCA 2B9EA 2J7PA 3EDRA 1FQOA 3IA7A 2P4HX 3A27A 3B2QA 4MR8A 4E7OA 1BEUB 4WT7A 1QNFA 3L8ZA 1U4SA 5D8DA 2IHBA 4O0MA 3RT1A 3STWA 4AJOA 3VPBA 1QHSA 4L4RA 3HP4A 1BQEA 2ET6A 2HBZA 2OUIA 4IXDA 4XDYA 4DWOA 1E1YA 2CV1A 1DDIA 1VE7A 3H5IA 3S55A 1J22A 3QQPA 1I8TA 3QSGA 4OHUA 3VRHA 1K92A 2HKIA 2P7HA 3ZW8A 2HDOA 1GLNA 2QL7A 1L8OA 3CXUA 1SGWA 1YVDA 2HPHA 1B0ZA 3A6ZA 4G81A 4TVKA 1IN8A 3UCXA 1J2UA 1SC4A 3V4PB 1Q95A 3FD8A 1ZN9A 1BH2A 3HUFA 5KYYB 5AKXA 1SHJA 1H0HA 2C83A 3SVZA 3QW4B 3W6PA 3ZCPA 5K4HA 4EZIA 3SF0A 5B7QA 2V58A 1NP3A 1CJMA 5BW6B 1HDCA 2PEZA 4WCFC 1CUCA 1D2RA 2VCYA 4WADA 1HEIA 1XTTA 4MS3B 3E4CA 5LYYA 4YBRA 2PZMA 4Q6BA 4G5SA 5EZYF 3SS7X 4MCHA 1JWBB 4BRUA 3D0KA 3G2KA 1UBEA 4UEOA 1PJAA 3CCFA 4YCLA 4MS1A 4B40A 1NP7A 4DT1A 1IZYA 2WSBA 1QHYA 1VCOA 1OX4A 3VYTB 4IWNA 2HNAA 1KYWA 3N7UA 3S8MA 2PXXA 3MTAA 2O3RA 3HYRA 2IQIA 3OU2A 4HGZA 2DULA 3ZLBA 1GAEO 2UVPB 3FLEA 1XA3A 2PUHA 2P9QA 5T41A 1L5OA 1KEWA 3CLHA 1SZDA 5FLEX 3DDWA 3W5SA 3FG9A 4X84A 4C4OA 2YCLA 4KQ9A 1WVMA 1ZGHA 2FSSA 1LVHA 3ZV4A 1EYZA 1E1RA 1U65A 2WBLC 4P35A 3FPCA 1ZK3A 1AK9A 1TT5B 2D5IA 3BSFA 1M8JA 1MPXA 1O6FA 3BXHA 4DBZA 1IAQA 3G9XA 5DULA 1AMUA 4DM7A 1W34A 4L4SA 2J07A 4B3RB 1J56A 1Y9EA 3MOIA 1SKYE 1UBFA 1EVIA 1Q6YA 1Y7TA 2GZ3A 3H6GA 3KKEA 3RRYA 3VZCA 3W9YA 4DLLA 2GBLA 2LIVA 3TLMA 2DVMA 1IMOA 1JDJA 1V41E 1UFRA 5G4KB 1EHYA 2RJ3A 1SQ8A 1M1NB 3R8CA 3WYBA 3ZR4B 2Y93A 4X41A 3ROXA 3ZZ0A 5KNDA 2VHXA 1L8AA 1MD9A 1RE0A 3SQNA 2I87A 1VIAA 2ZSEA 4OAOA 2ZDHA 3CTMA 2EKZA 4OHRA 4TKVB 3WYGA 2BM1A 3KFVA 5I47A 5LMNB 4N03A 3KJXA 1PBNA 1PJ2A 4FBLA 4OQMA 2BI4A 2WT8A 3EWIA 1EE9A 3N5KA 5CU7A 2A9KA 4AWBA 1AN9A 1WL8A 4NIMA 1P1JA 1JBEA 1YNSA 3LC7O 3VO9A 3VVCA 4V1CB 4FKMA 2WUGA 2Z95A 1IK4A 3W04A 5DASA 4BTEA 2WTMA 3I8XA 3E58A 4AKSA 2GJAA 3TTSA 1SUIA 4OK3A 2CNBA 2M1XA 4TWAA 1DZ3A 2QNRA 2EG9A 5F2EA 2G40A 3CZQA 2YNMD 3SLKA 3ZJYA 2LGJA 4XLLA 1N2CA 4AECA 4JUFA 4D02A 4KZPA 4C7KA 2Q9BA 4MQFA 3FOFC 3WSTA 2V6GA 2BTQB 1SHTX 3S4YA 4HFNA 2WIUB 1P1KA 1D2CA 2GCOB 4LJ7A 1FP6A 5HPYB 3IL2A 2PZBA 4TLCA 4R1SA 1NVUQ 4KO3S 3JQQA 4IZOA 4ACBA 5CA1B 1TGVA 1RFLA 5FBZA 1F9AA 2YIJA 4CU5A 3OAAD 1JA0A 4PG5A 2XTNA 3LKDA 5EESA 1D2HA 1FQJA 1WM1A 3RDPA 1JUDA 1QB8A 5F76A 2IEZA 2G71A 2Q5QA 5LUAA 1F6WA 1TTHA 1A7AA 1UBMS 1ZLXA 1V2HE 2ISQA 2NVBA 3DLPX 4JT8A 4ZVPA 3QTLA 3NVKI 1E1QD 2OMKA 2QN7A 4ZVMA 4YV1A 1AHIA 3SX2A 1EBBA 3WYEA 3R6TA 5JAOA 2VUIB 4YB8A 1ZZ8A 3T3MB 1F2TB 3BS4A 1GCUA 3GJQA 1KMMA 5EIHA 4R8VA 5EL0A 2QR3A 1E6LA 3QOWA 3CURA 3LJKA 2V8BA 4DYVA 2ADMA 3WGQA 5IXJA 5LNK6 4E6EA 2SNIE 4WOPA 4N7RA 5BNZA 4B8WA 3I1IA 3HFRA 1X0VA 3KDAA 5JYDA 1DAFA 2L0XA 3BJIC 4KAAA 5GONB 1BQ4A 4G8JA 3FA2A 4C6TA 6GPBA 1RWPA 2YIMA 4H0NA 4AQYB 1XQYA 2DMRA 3NM5A 4LVUA 5CVJA 3RC7A 1M7GA 2IUSA 4XWGA 2D59A 3ZU2A 1WKVA 2I6QA 2YWGA 3QBTA 1LLFA 1MORA 1G2PA 1M6EX 3PIIA 4IIJF 4OXXA 4A2PA 4X20A 5DI3B 2I4NA 1F4LA 1HT3A 3AG6A 4M86A 5DWVA 4CMEC 4DJDC 1QM5A 2BMVA 3AIKA 4I6JA 4JLNA 3CVVA 4X97A 5A9SB 1AG9A 3KELA 2YFYA 5H4GA 1ILWA 3TOSA 4CIVA 1I6KA 2OAGA 3TOXA 2AJDA 1A76A 3R9IA 4FN3A 3SR0A 4AZSA 1YB6A 1NERA 2Z5LA 1G20E 1VKHA 1JDUA 4U6QA 1SU8A 2BFCA 3NNNA 1VBFA 4GU5A 4UM9B 3QE2A 2ZB7A 4N7MA 1YH3A 1PJCA 4OFXA 1HQYE 3NW9A 2W0MA 1F38A 2BSAA 3D4OA 1OIVA 3DTVB 2PD4A 3FOCA 3MJFA 4OA5A 3ZGLA 4LJRA 4P4GA 4N5HX 4ZO7A 4A0FA 3AXTA 3ELWA 4B79A 4N9WA 3I73A 3T3IA 1RAEA 3U7JA 3JQ7A 1WR8A 1B3RA 2H1SA 3HSSA 3KKQA 5DP2A 3OIWA 3R44A 2ZRKA 3ZWBA 3OQHA 3GLGE 4V1CI 3H2ZA 3PT9A 5JWOA 2C2ZA 1WP4A 2KM1A 3LDHA 5CM9C 4DLTA 5FUXA 5HZHA 4NH0A 3RO7A 3F7NA 3RK4A 2P2NA 1OFUX 4YUAA 3HWRA 4M38A 4PCAA 5C5IA 5C8YB 4YAGA 2R2GA 2VWPA 4JK3A 2SCUA 1E3LA 4QG3A 5BN4A 3M1YA 3V8MA 5K51A 2P65A 4PLPA 5T64A 3WLEA 2VYFA 2BE7A 1MTZA 2WHXA 1PEKE 3UT6A 4Z59A 3KD3A 1ADCA 4HL6A 1Q16A 4KQWA 3YASA 2QTCA 5LBUA 5CFQA 1XZCA 1Y81A 1JSXA 1G5QA 4JX9A 3WL7A 4B81A 5J4VA 2R8PA 3RVMA 2PT6A 3WGIA 4N6OA 3AHDA 4F12A 1IBMB 5KYYA 2HWUA 1A77A 3OOWA 1TTQB 2B37A 3O4JA 4X63A 4N7JA 2XXBA 2Q5CA 4DV1B 4EW2A 1UMCB 1Q1BA 2GEVA 1K66A 4I3GA 4CM8A 2NP7A 3IVGA 2H1RA 5K8VA 4S1PA 3UG6A 4F7DA 3HNPA 3Q3IA 3CEPB 4IVQA 4OL9A 5E2IA 4J1SA 5LFAA 3MCZA 3MS4A 5B6PA 3GEHA 4O02B 3GZJA 1KEPA 4ZI2A 3HHPA 4LYHA 1QORA 5KYWB 2ZZMA 5DK6A 3UAWA 4CMGA 2CEKA 2J45A 2VAVA 3QHPA 3M34A 3ZHMA 4CG1A 3OEED 1QDEA 4B45A 4B1FA 1QC5B 3GIWA 2VRWA 1OAKA 3A6HA 2JLAA 5HFAA 1BDJA 1JALA 4L51A 2IWRA 4IOKA 1K7CA 4ZK6A 1WX1A 2BHLA 4R40A 1QU2A 1HDYA 1HDXA 3F96A 4OXQA 2D2IA 4CT4B 1Z56C 2EKPA 2VK2A 4HAYA 5ALYA 3TGPA 4MV3A 4AO7A 1UJ5A 1E2HA 5ALZA 1UKAA 5ERXA 1SBTA 5DM70 3AUKA 3BUSA 1DW9A 1Z7GA 3EVFA 3SD7A 1MGPA 2I76A 2QAIA 1KZHA 3ILXA 4F4JA 4GIBA 5AXDA 3GG9A 2YN4A 4IV0A 2YVQA 3PPYA 3SQOA 4KXMA 1NR7A 1EFLA 3RS4A 4TV9F 3ZE0B 1PWZA 2NQ2C 4Z49A 2IZ6A 3WL6A 3S8EA 2X0KA 4YBZA 4HADA 2NIPA 1D6JA 3CLUC 3DMDA 3SXUB 4B9AA 1FTNA 2YVAA 4UEQA 5ENDA 4LDRA 2NVOA 3TEJA 2O0LA 1JXQA 1SOWA 1GKYA 1ZH8A 3GA0A 4L75A 4G5QA 3P0IA 4FEAA 5BSRA 2XT6A 2CNOA 4FR5A 4RPGA 3TW6A 5IK2D 2D62A 3DOIA 3WICA 1M5RA 3K8ZA 4DA7A 3V7UA 4BO1A 2CSXA 3AUYA 1QQTA 3HCEA 5TQJA 4ANFA 4D46A 5BR4A 3I3OA 3AI3A 4JH0A 4CIDA 2H8RA 2B1GA 2GF9A 4C30A 4CEJA 1OH7A 1L9XA 5EXTA 1CP2A 4TTAA 1TUIA 4FP9A 1PVVA 1CZRA 1E1CA 3B9PA 1KJNA 2IEIA 2BFFA 2RHGB 2KE5A 2HCRA 2O1EA 5GM2A 3RU7A 4PIPA 4GZLA 1QH1B 3C1TA 1TO6A 5IULC 2I6UA 1M75A 3DPUA 4ARVA 5CLJA 4X64B 1YR7A 2Q2QA 2A7QA 1LY1A 3CZ9A 1WV0A 4BJHB 1PW7A 3JXBC 2CXQA 1HNNA 5IUNC 1D2NA 5K0BA 3DW3X 1PS0A 4KRYA 1IG0A 4D25A 2BBWA 1UJBA 3AYZB 2L2QA 2PGJA 3JYPA 4LCEA 4LDZA 4OBEA 2WJ3A 5IXSA 1GSOA 3VSEA 4O1HA 4ZPJA 3OJ0A 3TRBA 2B5WA 3K09C 5TB5A 2V6BA 5HIAA 1Z25A 1RHJA 4BNHA 3DYIA 4JL8A 3EVCA 4PPQA 4WCVA 1YMQA 1KAOA 4X1IB 5J4KA 4GLFA 4FJ0A 2DLDA 2RDMA 3GRAA 1W49A 3AI7A 3LSTA 3OECA 4L3VA 4PO1A 3WL3A 1SCAA 1WMSA 2Q4RA 1GG9A 2Q5EA 1Y7LA 3ISJA 4ZCIA 4ZMRA 1YS1X 2LCVA 3MELA 4OBWA 4IUCS 5GZ3A 1D0IA 1PJ3A 1UXHA 1AA6A 2PVSA 4CV1A 3A58B 1PQPA 2B8EA 1OI7A 1VC2A 1DQYA 2QL5A 4FR2A 4IIDA 5ICGA 1V11B 4PZEA 4LF5B 1CEYA 2AFIE 2O2ZA 2RCYA 5F7OA 2IHKA 3I6QA 1IVSA 4D6YA 1I01A 3L18A 4QRHA 1PL0A 1RQRA 2WJZB 2WYOA 3IPCA 2LBPA 2QTRA 3VR2D 4TYNA 3KFLA 3IP3A 5FRDA 2PKRA 3AHHA 4MB0A 2R96A 3KQVA 4L8FA 4QEKA 3ZE6A 3BRCA 2PMKA 2A9QA 4O8ZA 2WFAA 3WGHA 3GJ0A 2G0AA 4JJKA 2QM7A 4RJIA 5H02A 4MV5A 3TK1A 5CD1A 4FWBA 3SG0A 3EH2A 4TKMA 1PIWA 4FJ2A 3IURA 1I7PA 4TT3D 1C1XB 3UFDA 2R3SA 5AOCA 3H18A 3H5TA 3NZEA 5SY4A 3V8BA 4WBNF 1U9YA 1QANA 3U7FB 3RF6A 4MYUA 4AY6A 4C2AA 2AE2A 2JBAA 1IY2A 1I9CA 1AUQA 3TAHA 4DCNA 4MQ4A 3HBNA 4YVFA 2RARA 2IYUA 3EXHA 5AXBA 3G1UA 3D8UA 1T8WA 3HQ4O 3OWHA 4HKTA 4BKUA 3FE2A 4RJLA 1T9GR 4EB0A 5COBA 3DE7X 1JDBB 1NT2A 4G5HA 4I5DA 1ESEA 2Z4TA 1FSPA 3KSAC 5B58T 1NG9A 2IU7A 4Y2SA 2FKNA 3FOZA 1JIKA 3CJQA 2DERA 4FE7A 1N2OA 4BO4A 3T54A 3EGWA 1QYDA 5JS1A 1VLLA 1TQ2A