1QP7A

Purine repressor mutant-hypoxanthine-palindromic operator complex
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
338
structure length
338
Chain Sequence
b'TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLAVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*CP*GP*CP*AP*AP*CP*CP*GP*GP*TP*TP*GP*CP*GP*T
publication title The role of lysine 55 in determining the specificity of the purine repressor for its operators through minor groove interactions.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription/dna
total genus 119
structure length 338
sequence length 338
ec nomenclature
pdb deposition date 1999-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
A PF13377 Peripla_BP_3 Periplasmic binding protein-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1qp7A01
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qp7A03
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1qp7A02
4LX8A 5EWLB 3KYJB 3JVDA 3N8IA 1PNRA 2E4XA 3OO1A 3Q41A 5EWJB 5ABPA 1C4WA 3H75A 4EY3A 5HQJA 3A0RB 4X4FA 4OG2A 2QVGA 4J1WA 3ZKCA 2KYRA 4Z59A 4ETIA 3OM1A 3Q7RA 1ISSA 2O38A 1FSPA 2RJNA 3UUGA 1SXGA 1XHFA 3C6QA 4HYEA 2AXUA 2GZUA 1BDIA 1DG9A 2XSDC 3LUKA 1Z15A 2FLWA 3CKMA 3LFPA 3CZCA 2PKXA 4X4EA 1NXSA 1NXPA 3H6GA 2KEIA 3RH0A 4Z4FA 1Z13A 3BS3A 3BBLA 2WWVD 4YCSA 3DBIA 1U0SY 4RZSA 4MR9B 3HZIB 1SD5A 1OCTC 1BA2A 3BD1A 4RKRA 4RWEA 5KC8A 1ZHHA 3QQ6A 5EWMB 4PU4C 1MAVA 1DBQA 3KXAA 2MYUA 3ROTA 4YRZA 3RVLA 2GRMA 3TB6A 1CHNA 3OLVA 2WB4A 4MQFA 4QPJC 1M2FA 3H1FA 2PL9A 4G0MA 3RVQA 3HO1A 2CROA 3IP6A 4JASB 4PU8A 3FFXA 3OMTA 1Z26A 3QLVA 3OO0A 4LRQA 4DADA 4YARA 2AYXA 1NXWA 4RK6A 2PLNA 4P98A 1E2BA 3GL9A 4O1HA 2ID7A 1MB0A 5B3JA 1R69A 2MSKA 2MYNA 4G0QA 4W5QA 1DRJA 2O20A 3F6CA 3IPAA 3HM9A 4WWHA 4KFCA 3MIZA 1DCMA 2FSPA 3OM0A 4MGEA 2LYQA 2IVGA 3FYMA 3RVSA 1ZH2A 3TRBA 3LMKA 4LE0A 3KYIB 4Z4CA 2GKGA 4YWHA 4Z4HA 3FMYA 2PMCA 1F4VA 3JPYA 1OXBB 1TLFA 5BQ3A 2PE5A 2FMFA 2H0AA 2ICPA 1SRRA 1ISRA 1QP0A 3IVPA 3R1FA 3MA0A 3NNNA 3Q15C 8ABPA 4H60A 2PPXA 4Z5HA 3BDNA 1JX6A 3URMA 4D74A 2PAFA 5JS1A 4RDCA 3JXCL 4WUTA 1Z2EA 4X4IA 3F73A 4TN5A 1L5ZA 2IVQA 2PL1A 4Q6WA 3KCNA 4FB4A 2QV0A 3CS3A 2O49A 3CZ5A 2H3HA 1Z12A 3BILA 3HDVA 4YS6A 4Z9AA 1SQ8A 2OQRA 3GA5A 4RS3A 2IPAB 1DBPA 3BREA 1LJUA 3DZDA 3LUGA 1DRKA 2FMIA 3Q7TA 3DLHA 1LBIA 1ADRA 5I4CA 4ZMSA 1F51E 1QO0A 4RV5A 1FFSA 5PNTA 4MR8B 4JCYA 4KPYA 3CNBA 9ABPA 1M5TA 1U2QA 1KRWA 4F11A 3CROL 3PXPA 3H5OA 2IU7A 5JS2A 5CNMA 3SQNA 2JVJA 3CG4A 3RVNA 1PHRA 1E6KA 1QQBA 1U2PA 3F7NA 4P1ZA 2M1ZA 4LE1A 1BDHA 1RZSA 4W5NA 4TMYA 3OP9A 3ILYA 1Z16A 3HDGA 3CECA 3CLCA 4N0QA 4EVQA 5KQGA 3G85A 2XCJA 4EVSA 2B4AA 2PUFA 5D2CA 4G86A 2JVKA 4JOQA 3HXMA 5T7BA 3HJFA 1JWLA 3HUTA 3GBPA 3EQZA 3FMVA 1ABEA 1LBHA 4H3KB 6ABPA 3CLKA 2JCGA 4GQMA 2MSWA 4Q7EA 2XDYA 3DGFC 3QYXA 1ZUGA 3T38A 2LUOA 4DN6A 2E4VA 1ZGZA 1XWRA 1P6UA 3L49A 3O2SB 3JY6A 2CHFA 4TLMB 4MQEB 3QELB 3QWGA 3O1IC 3M6MD 2MEZA 2XJ3A 3H5TA 1DCKA 1HEYA 3EJWA 3H6HA 3I5AA 3IPCA 3MF4A 5FBKA 3ROFA 4MCTA 1JDPA 3OQNA 2IV1A 3QF3A 2WJWA 3IDOA 4OATA 4Y42A 2L2QA 3O75A 3QX8A 1YS7A 1JBEA 5TE9A 3JVIA 2BJCA 1JYFA 1C0EA 4X4CA 1A2OA 5JNWA 4QICA 5GQSA 1NY5A 3TO5A 3KLOA 3H5VA 5K98B 3M9XA 4N0PA 1T34A 4RY8A 1EWTA 4O8BA 3DNVB 2LIVA 2FQWA 1LMB3 1DP4A 1ZDMA 2QVCA 2L49A 3N53A 1ZPQA 1ZH4A 1POUA 3QK7A 4EYQA 1ZZ6A 2L19A 1RNLA 7ABPA 2D5VA 1UXDA 1OSLA 3ZHIA 1JFVA 1ZESA 2CWDA 3MM4A 4E7OA 3OQMA 3RZZA 4XXHA 4RK1A 2WRZA 5CNKA 1QKKA 2FJRA 2PUGA 1USIA 3N6VA 3QLVC 2NT4A 1YK1A 4MLCA 4IILA 4GNRA 4EVRA 3EUSA 5IUNC 1L5YA 1A04A 2A9RA 1KMIY 5TPWA 3QLUA 2W42A 2WIUB 2BGGA 3LUFA 1URPA 2ZWMA 5IC5A 1EWVA 4KK4A 2PUAA 2MYPA 5B3JC 3C3WA 1D2AA 4JP1A 5IEJA 4UHJA 2RGYA 4JCXA 4NQRA 4MRMB 1E3OC 5TQ0A 3GRCA 4QYWA 2QZJA 2AYZA 1YMVA 1J56A 1TM2A 2P4UA 3RVKA 5CNIA 2IYNA 1PRUA 1O4XA 4O5AA 1M2EA 2F8TA 4OBBA 4G0OA 2LYRA 4MR7A 2HQBA 2I6FA 5IULC 3O21A 4MCXA 3EQ2A 1D4ZA 2NT3A 4O1IA 5IUKC 1AB6A 3D1NI 3EGCA 3GN5A 5F64A 1LLIA 1USKA 3H5WA 3LUJA 4RY9A 3JXDL 1D1QA 3QEMA 5E3JA 3FFTA 5FWYA 3HK2A 1D1PA 4KQ9A 4XASA 2AXZA 1IIBA 4Q6BA 1ZGGA 1M5UA 4Y9TA 4ETMA 3CRNA 5DLEA 1RIOA 1JFSA 4Z9BA 4ZPJA 3A10A 4KK3A 1DBWA 1P8AA 4MS3A 1YS6A 1QQAA 2E4ZA 3C3KA 1X2LA 1L1MA 1DWKA 1JH9A 4MPTA 4MS4A 2NUBA 3G5GA 3OQOA 1HF0A 1DCFA 2X7XA 4KQCA 1PRAA 2ICTA 2JRLA 3VNAA 4W5RA 4OLBA 2BNOA 5FWXB 4XAQA 3UFDA 1PUXA 2WUSR 3LKVA 5C5EA 4W5OA 3JTEA 2JK1A 2KZ8A 3JS5A 1DC7A 1R8JA 1UDRA 4RXTA 1ZN2A 1AB5A 4EGSA 1NXVA 4RKQA 1QP4A 3GV0A 2HPHA 4F8JA 2OFYA 2FQYA 3OLWA 4JAVC 4KV7A 4Z0NA 2A9OA 3H5IA 4W5TA 1PEYA 4IRXA 5HM6A 3QELA 1EFAA 2V0NA 1ZS4A 4F12A 3KLNA 3T6KA 2FW0A 3BRQA 3CHYA 1U04A 2FEKA 4I8TA 2J48A 4LZLA 1EAYA 1NXOA 4N03A 4NCAA 2FTKE 5EWLA 3F6PA 3SCFA 3N75A 5KQMA 2R25B 1DZ3A 4I6TA 2VYCA 3HCWA 5EWJA 2EBYA 4PZ0A 1EHCA 1K68A 2R48A 3SG0A 3F52A 1NERA 2AXVA 2GBPA 3E61A 4KVFA 4I6RA 4Z99A 3M9WA 1RXIA 3KSMA 4HNRA 4MAAA 2WJAA 1RPJA 4D6YA 3JPWA 1E6LA 3CTPA 4RXMA 3A0UA 2NZUG 2RDMA 4J1XA 1RZRD 2O4AA 1JLKA 1GT0C 2AWIA 4MQFB 3OLXA 4PEVA 3S99A 3EULA 4Z5DA 2HINA 2H8RA 4EUKA 4L4UA 3HVRA 2YHAA 2DRIA 1OXKB 2NZVG 1NEQA 3O9XA 2PUBA 4PE5B 4N76A 2IPNA 3LUCA 2HSGA 1JL3A 1PNTA 3HUUA 1VKRA 3EDCA 4MS1B 2QR3A 2HJ9A 5CNJA 5HSGA 1Z18A 1Y7YA 1YSEA 4MR9A 3F6WA 5ED4A 2KEJA 3GT7A 4EYKA 4Z4GA 1ZZ7A 1RXEA 4FE4A 1ZY2A 2GI4A 3D02A 3KTOA 5EWMA 5BRJA 3FDFA 4MRMA 2LYSA 2HQOA 5DCLA 2ZAYA 2FKAA 1FFGA 4RU1A 2PIJA 4TLLB 1NTRA 3ZHMA 1NXTA 3O1HB 4PYRA 2IPLA 1U8TA 1PEAA 1LCCA 3IP9A 4YP9A 3KKEA 1KGSA 2KEKA 3N0WA 4Z4IA 4F3TA 2LYLA 1WH8A 1Y9QA 1BAPA 3LUDA 3S8QA 2JBAB 1QMPA 1SXIA 3I42A 3QLUC 4YR7A 2MYTA 3RVRA 3W9SA 4EYOA 1GUBA 1MB3A 2A6CA 1JF8A 4NDWA 1Z25A 4N41A 1RZRA 4NV3A 1B00A 1WIZA 4ML3A 4RK7A 1TJYA 4LDAA 4IGAA 3RVMA 1YTUA 2IPMA 5CHYA 1PERL 4YG4A 4X4HA 2HQRA 1BDJA 3A3KA 3QLTA 3MYYA 4IMIB 1WH6A 1XHEA 4IMJB 2A9QA 1P6QA 3LFTA 1MVOA 2WMYA 2VUIB 1ZZBA 2IKSA 5T3YA 3HV2A 3DLBA 3E3MA 3LUAA 1I3CA 2GRLA 2R1JL 2Q5CA 1CJGA 1YK0A 3IP5A 4GPAA 2GWRA 1FQWA 5IUJC 3OMXA 3BRSA 5FWXA 4YG1A 1LJLA 3EAFA 3NBMA 1ZZCA 1GCAA 2RJOA 4IF4A 4HNQA 4JB2A 4DQDA 4KZKA 1JHZA 1NXXA 3RVOA 1ABFA 3K9CA 4S05A 5KWSA 1GLGA 5TQ2B 3NNDA 1TVMA 3VNBA 2CD7A 4YBAA 1DJMA 3QX9A 1QPZA 6CHYA 2M98A 2VK2A 3GBVA 3HS3A 4YGXB 3C97A 4G0XA 4RXUA 4KRFA 5JNSA 2FN9A 4UHKA 1DW9A 1YMUA 2P9HA 2LYJA 3HEBA 3RVJA 1A0OA 1ZZ8A 3N0RA 1GUDA 2FLKA 4G0ZA 3NHZA 4MYRA 4FN3A 2VUHB 4RK0A 3B7HA 4Z5CA 2LYPA 1UXCA 2JVIA 3CU5A 2R47A 2OENG 2QU7A 2FXIA 1Y1LA 3R0JA 5A7LA 4X4BA 4G0YA 4MR8A 1X57A 4F06A 1Z2DA 3LUHA 2IDMA 1VPWA 3HSYA 3LOPA 4G97A 5JNVA 2QSJA 2TMYA 3RVPA 3SCHA 1EWKA 4WXMA 1JFTA 1AU7A 5JNUA 3KG2A 3NNSA 4M88A 5KQPA 4NCBA 5TPZD 1IC8A 4YG7B 1E6MA 2OR1L 3VK0A 5FBHA 2R4QA 3N0XA 5KC9A 3IP7A 4HNSA 4XLTA 2CHEA 4XARA 3JXBC 4JB0A 4N47A 2MSLA 1WETA 1ZITA 4OB4A 1CYEA 2GX6A 4JA2A 4IA8A 3MMNA 5KI6A 1XWWA 4KMRA 4YV7A 4PU3C 1D5WA 4EYGA 5C5CA 1LQCA 5IX8A 4FE7A 4LDZA 1Z17A 4MS1A 4OLAA 2PUDA 2L18A 4X4DA 1JDNA 1B0NA 2JB9A 3DGEC 3KS9A 1QO0D 4L85A 2FMHA 2WY2D 5JNTA 1GCGA 2QXYA 4X4GA 4QYMA 3OLYA 3CFYA 2PUEA 1DC8A 5IEBA 2FVYA 4MQEA 3SCGA 3H5LA 2QW1A 2FQXA 3EODA 4IWRA 3T95A 3TMYA 1PRVA 4KNYA 3L6UA 5TQJA 3O2QB 3LKBA 1NATA 3LISA 5DKFA 5TPWB 3F51A 4PICA 1RPEL 2LPMA 4CBVA 1LK0A 3O2JA 4WZZA 4OTZA 3MLFA 1W25A 2JBAA 2IVBA 4JQDA 2LBPA 2FEPA 4RK4A 1QP7A 2PJUA 1QNLA 3MQ4A 2LP4Y 5TQ0B 5TPZA 2IUOA 3GBFA 3U3WA 1CQTA 2N9UA 4KREA 1FFWA 1P2FA 3C3MA 3KHTA 3QEKA 1CEYA 3P9YA 3H1EA 1TMYA 2AUWA 2PUCA 3TX6A 2JVLA 2B1JA 4MR7B 3LTEA 3FGZA 3NHMA 3O74A 3KZ3A 4RY0A 2E4UA 4WT7A 3Q9SA 1USGA 1UTXA 2XIUA 3GN5B 2BNNA 1YVUA 3OMWA 2L17A 4GHJA 3QEMB 5FWYB 1ZZ9A 4Z4EA 2KPJA 4IVZA 1S8NA 4G0PA 5TQ2A 1KRXA 4E7PA 2CSFA 1LCDA 1JYEA 3GYBA 5HKOA 3D8UA 4XFKA 4MS3B 3OLZA 2BNMA 3GWGA 3SNKA 4MS4B 5BR1A 4ZYLA 2R63A 1YIOA 3G7DA 3B2NA 4WXEA 5KQLA 1K66A 1APBA 4PU7A 1ZVVA 1MIHA 3I45A 3UKJA 3RQIA 4B09A 4YLEA 5BRAA 3ILHA 3Q7SA 4FBIA 3SM9A 3L1PA 3I09A 2YHBA 4F8DA 2E4YA 3FFWA 3H1GA 2XI8A 5DGCA 2E4WA 3G1WA 4MLDA 1VLZA 2LYKA 3UK0A 4ZJPA 5IBQA 4D6XA 2EWTA 4RK5A 3T8YA 2F8SA 3KJXA 1VRVA 3HZHA 1S7EA 2MQKA 2EF8A 4Z58A 2FEWB 4YO7A 3SY8A 3O1JC 3FYAA 1H9CA 4I6UA 1R63A 2A9PA 4S04A 4ETNA 2IOYA 1SXHA 2ID9A 3K4HA 4LE2A 5DTEA 2FN8A 4RSMA 5JNRA 1BVHA 4NICA 3CG0A 5GOTA 2LCVA 3SAJA 2B5AA 4H3HB 1W9HA 3TD9A 2AW6A 2L8NA 1ZAYA 4ZMRA 2FMKA
chains in the Genus database with same CATH superfamily
3I1YA 2Y1KA 4QJ3A 4GMKA 4M6WA 2VP6A 1XZHA 2JK0A 3UA4A 1K89A 2ZT6A 4QWMA 3WIVA 5ABPA 2GJ8A 1C4WA 1T6XA 4Y2RA 3AR6A 3NBXX 5CW1A 5HQJA 5E7QA 1XVUA 5J23A 4GOJA 4B3RB 2C2ZA 1UPCA 2XCUA 4R1QA 1ZUNA 3NFRA 5EVCA 1YF3A 3P5SA 2PAAA 2X1LA 2IP1A 3PQ4A 2LNMA 2J3LA 2A0KA 3C4QA 2P3OA 3M6AA 2YRXA 1C0IA 5EE0A 4F8YA 2ZUFA 2NNLD 2ZVJA 4L78A 2A8YA 3L7IA 3HXLA 3K05A 4LX0A 4LJ7A 1XZLA 3L6DA 1W36B 1TIPA 3IT3A 3OX3A 3V32A 1IUKA 1P4RA 3AWDA 4FMBB 1TECE 3ANXA 1O94D 3RAFC 2C58A 3T7JA 4M0MA 4QDXA 1L8QA 5AJWA 4MR9B 5GGYA 1U9ZA 3VH3A 1KDRA 4S1WA 5JJBA 4QASA 2EV9A 4UOZA 1ULHA 1DBQA 3OPYB 4XWTA 5FHRA 5TXGA 5IHPA 2ZBPA 4GVLA 4DR2B 5D00A 2JI7A 3EWAA 4WJLA 3QBVA 3NJRA 1B0UA 1QOQB 3BE8A 1IMJA 1Y4ZA 4KIFA 5H7XA 3N05A 4NULA 3EPJA 2NP7A 3I4CA 2WMDA 4CUZA 4D9HA 3IP6A 1MPXA 4GAEA 1GGNA 3FFXA 3JQAA 4FM9A 1FP4A 2ZTVA 5EKXA 1JLLA 2HC9A 2KI5A 1G4HA 1GZDA 4GBMA 3UAWA 5LP6B 3HBNA 3OAAA 5CEJA 2BEKA 4RZXA 3SYKA 4LN1A 4BP8A 1K4YA 5THXA 5CLFA 2C8VA 4G36A 4E21A 1TCBA 2P6PA 1FX0A 3N2ZB 4ZRDA 3HB4X 1DRJA 3F6CA 5G2OA 4P2BA 3S28A 4A8JC 5DF1A 4AY4A 4KFCA 3AJ8A 3MIZA 5A4IS 5CBKA 4S12A 5EQJB 2YN2A 5BQ5A 3INGA 4E33A 4C22A 5FLXA 1ADGA 5K01A 3AM1A 1GQSA 4JJ6A 5B57C 1F2UA 1JHYA 1B6GA 3PGKA 4FSHA 3WLRA 4EG5A 5J4HA 5ILOA 2GKGA 3ICVA 4UVGA 4YWHA 2RBGA 2PMCA 1I1QB 3KALA 1GJRA 2DFTA 2WWRA 2WSMA 2WA1A 3LPDA 4AWXA 1OZGA 2VF5X 2HAEA 4N3CA 1ISRA 1GQ2A 3DXZA 4BQFA 2NSJA 1CUIA 1EI9A 5FAKA 4MICA 1MGPA 3IQXA 2Z8ZA 4HZIA 4TWBA 1LEHA 8ABPA 4RD0A 5EP4A 3C3BA 1JEYA 5KOHA 2CJPA 4Z5HA 1GLNA 2Y0BA 5DO9A 3FBTA 5AM4A 3DOEA 5IWCA 3KK0A 4YASA 3E8MA 3QPWA 4HAXA 3TLGA 3WYFA 2C2YA 3I8XA 3H9JA 1J21A 4KP7A 1A9RA 3B5EA 4JU8A 2J7UA 1T5TA 3HWWA 3AYZB 4YAFA 4DDUA 1JIUA 3L82B 3G9TA 2JFPA 1SQ8A 9ATCA 3FNBA 3ND5A 4XWWA 1WCYA 3HFSA 1U9IA 3UV7A 2ZITA 2WPDD 1J8QA 4IDBA 1BRMA 1AY0A 2QENA 1U9JA 5IZCC 4BB6A 4JLUA 1F8FA 1W30A 5K0SA 1ZJ5A 3CH6A 3IQEA 1D9ZA 1NN1A 3DOIA 1ZD4A 2B20A 1K63A 1N1MA 3REGA 1E3MA 1CQJA 3SQNA 1O57A 3WV4A 1PHRA 1VBFA 3ED5A 2J7PA 5BV7A 3RSGA 3RU3A 1XZJA 3H5RA 2HDOA 3LC1O 5HJ5A 4NBKA 4OGFA 3BHJA 4WBNF 1PTKA 2VHUA 1SELA 2XUPA 1XDZA 4KIJA 1Z2OX 5FPYA 3PGXA 4O4IB 3RT1A 5FB3A 3TKLA 4JMLA 5C18A 4AULA 1WHTA 5D2CA 2F55A 4AJ9A 4CM4B 4RC9A 2JDID 3KZXA 3JXEA 6ABPA 4JFRA 1M34B 3ESZA 3OIYA 4HYTA 2HFJA 1W19A 2XNJA 3OZEA 1ND6A 1SVSA 3L43A 3P9ZA 1NMSA 1FDIA 5KYKA 2Z2KA 4YCDA 5JSUA 2HZ7A 5AVXA 1GQOA 3I73A 2M1XA 3DA8A 1G5QA 1U7TA 4JFAA 3VX4A 4E0BA 3PFHA 3CLSD 4OHPA 4PAGA 3ZW7A 3M6MD 4BIIA 5L95A 2VT6A 2HYIC 1QO9A 3LBIA 3OQNA 3ZJUA 1GYPA 1Z33A 3HDJA 3ND9A 1W76A 4R51A 1SWVA 3SZOA 1JBEA 2NO1A 1N0HA 1W35A 3OJCA 1X8KA 2WILA 3BH7A 4O2LA 5BN3A 1AKQA 1ZK2A 2PWZA 4MI6A 4RELA 5CUQA 3VC3A 1QXSA 3NPAA 1NY5A 1ST3A 3KE9A 1KYIA 2GCIA 2WJVA 5H9VA 2XVZA 5ICFA 3V8RA 4WUVA 1TADA 3OCVA 3KQOA 5DNCA 2AEJA 2C0PA 3HY6A 4H2DA 4MCHA 3DAPA 1MR3F 4NPHA 1VG1A 3CUKA 3LDUA 3K1ZA 1JQAA 4RESA 1WPGA 1EFCA 2QZ4A 4UOEA 3V55A 1GAXA 3AVTA 4CM9A 1JFVA 3MSCA 4WD3A 4CTKA 3KO8A 3TUJC 1G1MA 1W29A 1CC1S 3WQHA 2ZULA 1T3ZA 4LJ4A 3C15C 3HJCA 4DE5A 3QKTA 1XRLA 2QAGA 5HR5A 2NT4A 2ODQA 4OI0A 2ID8A 4C6TB 3EUSA 1SCDA 2D0OB 2R8ZA 3K5HA 4X0EA 1A7UA 1VPLA 4IIBA 4YT8A 4KSCA 1FS4A 3DUFB 3LVBA 4C78A 2E82A 1QB7A 1RYBA 4L0MA 2ODNA 2K5UA 4I55B 2PZLA 3MJ4A 4YJ2A 1CZUA 2ZUVA 1KK0A 1NVXQ 5KU1A 5CNIA 2X0JA 1JQ5A 2P9TA 2RGNC 4K6GA 1LDBA 1P39A 1A77A 1K2WA 3CURA 4KUHA 5B1SA 2UZ1B 3TR5A 3C85A 1FYXA 3H9BA 3Q2OA 1L5NA 3ROGA 3KQUA 3ZBUA 3B1XA 1O0CA 1UXHA 2I7VA 1L7PA 3P20A 5IN5A 3ZWYA 4AN0A 5B4TA 4KSYA 3LUJA 2PQ0A 2AEEA 1SG6A 1JA9A 3O2NA 3A04A 3VZPA 4GMHA 4N01A 1K6EA 1Z56C 4FDLA 2XB6A 4V0KA 1UM8A 2CXTA 1R64A 3IKJA 1V9LA 1IZZA 4EF4A 3HJAA 3H8SA 1V4VA 3N2NA 3MGBA 3NHJA 4L4RA 5BN4B 1YS6A 2WAMA 1DQZA 2IIBA 1X2LA 3ICCA 4V0NA 4JHLA 1U5BA 2C03A 2C83A 3MMXA 4YUXA 1PRAA 5C31A 2VJKA 3A06A 1JTVA 3D64A 2BNOA 2RKWA 3SYLA 4ATNA 2WZDA 2OLKA 2PH5A 4I4TF 4FEEA 1LNQA 1YMQA 3PNVA 5FL3A 4B7XA 3AKDA 4YRTA 4W5OA 3TRKA 3JS5A 1NHWA 1G2OA 1AN0A 3AILA 1NVKA 1MTZA 1SXJD 4FR2A 1TCCA 4L3OA 4PHTA 1UANA 5I9LA 1GPAA 1PEKE 2NV6A 2Z0MA 4A1OA 4UTVA 1FQKA 4FYHA 5EJMA 1EFAA 3UWSA 3NWOA 3BTUA 2C4UA 2Q49A 1U1DA 2YW2A 1ZRHA 3PQFA 3ULKA 3BRWA 3JWGA 2J3KA 4OB7A 1F6DA 1ORTA 4B3BA 1LBTA 5CDYA 5LM3A 5B1DA 3UHAA 1EP9A 2HM7A 3I9NA 2R65A 4FMCB 1H2FA 1Q7RA 4BWVA 2EBYA 2EKDA 3BGIA 4KAXA 1J1ZA 1NZJA 1UC9A 2AXVA 1P5FA 1WXEA 3MS2A 3R5FA 3KSMA 4TMFA 4DUZB 2BMJA 3PEYA 2R7LA 2C5FA 4F71A 3HRIA 1XD9A 4NP6A 3ZEIA 2QVZX 4MQFB 5E1DA 4S1NA 1LSOA 5IAEA 4CTMA 1YDHA 2PXLA 5B7GA 3G49A 6ADHA 2UYGA 1PFGA 1E92A 3SS7X 1YL7A 3GNSA 3O9XA 3W05A 4MUAA 4PHGA 3GDWA 4N76A 3VNVA 1QH9A 5DTQA 4NXNB 2FWMX 4Y1RA 1M6NA 2FZ4A 1BGWA 2YUTA 4MS1B 2E3JA 4R98A 4ZA2A 2P7HA 4NNOA 3F6WA 1O8CA 2AD1A 5GM2A 2OVBA 3FKSA 3MTQA 3SZ3A 3K0SA 3WP0A 1R4NA 3M3PA 2UZAA 3W9YA 4MB6A 2QQGA 1CLUA 3CY6A 5TDHA 3O5AA 3WB2A 4DJ5X 4RMIA 4D44A 2GDJA 1KBQA 1QYDA 5DM2A 2PXDA 3O91A 2ABWA 4V3BA 1EFPB 3EXHC 3FPSA 1L7XA 3KQVA 4HPJB 2EZ4A 4YJ3B 2FX5A 1BE1A 5LD2B 1WH8A 4DPLA 2Y68A 1B43A 1SUDA 2B98A 4ENUA 5AVSA 3U7JA 4F9EA 1MC1A 2DQZA 3LDGA 4UTXA 1R6BX 3QWHA 4TMZA 4X20B 2OC4A 3U19A 4FP9A 3DAOA 2R6HA 5THKA 3H2IA 2IS4A 3WYEA 3FZNA 3H9EO 4XQCA 1GSHA 1A4UA 1NN3A 3OVMA 4YROA 4V03A 5GJWC 2QM3A 1MABA 2IYRA 4CMEA 4TZ6A 1ETHA 1XDDA 2IKSA 1GA4A 1XF1A 1GFIA 2HRCA 2R1JL 5DP1A 1EB9A 4L5JA 1HEIA 1PQUA 1S2OA 4D8YA 2IBTA 1JWAB 3FMGA 4UBMA 3HGQA 2RJOA 2HLPA 3QV1A 1MDBA 2V97A 3OCJA 2JFWA 3K1YA 1JVSA 1JJAA 3AGQA 2HY7A 3HMQA 3NNDA 5FL7A 2V98A 3H3JA 4LOJA 5AVTA 1W48A 4AK9A 1FL9A 4UJ3A 2E5WA 3T3OA 1LD3A 5J9FA 3JQFA 3OCYA 3WL5A 2AZXA 4P2GA 2QD3A 3C97A 4G0XA 5DI9A 5C4IA 1HDIA 2FPOA 3TQIA 3Q11A 3QU5A 1RAIA 2OD2A 5BYBA 2P75A 5H82A 1MHTA 4BO3A 1Q0SA 1HTWA 5IWAB 3T0GA 3BA6A 1YS4A 4DCOA 3DF7A 3KXLA 4NYIR 4B80A 4H17A 2AVDA 2NM0A 3GFQA 3GG2A 4ND2A 3G82C 2IV2X 2OCDA 2ON6A 3A9RA 3EVBA 3VOBA 1Y1LA 2QYTA 2QNIA 4X4BA 4R01A 2PSHA 1X57A 3UGKA 1IJBA 9LDBA 3FTDA 3NIGB 1MPTA 4P08A 2X76A 3D3WB 1UJ5A 2AMJA 2VXYA 3TZKA 4UMEA 3EQ8A 2BKAA 2FEOA 2GILA 2XVYA 4JROA 4L8VA 5KQPA 5JTUA 3RBAA 1M1NA 3A4NA 4ISCA 4MVYA 5KC9A 4IZ6A 3DXYA 2QHXA 3ZJVA 4XARA 4B34A 1JQ3A 1MIOA 1W8IA 4GICA 2ONCA 1HYGA 2HXSA 1BXRB 5BR7A 4B3IA 4YV7A 1R8QA 1D5WA 4HDCA 2YWBA 5JEDA 3WMFA 3MMPA 3NU1A 4LDZA 4JEMA 3TELA 1E9CA 2GBLC 2WVJA 1NIPA 1VHLA 1VLVA 3UNXA 4UMDA 1V6SA 4Z9FA 2ZDGA 2RHTA 3OCCA 2FE4A 2J0EA 5DRTA 5EXDA 2IW1A 2XQIA 1I30A 2REXB 3GAMA 3D31A 5JS7A 3NIFB 3PZRA 4LKOA 1O0SA 2NU9B 4CEJA 3HMKA 3SKXA 2H31A 4JUIA 2QRMA 4PU0A 2BELA 4LSWA 3EODA 1K2VN 3H0KA 3AIKA 4IWYA 2C9MA 3HYSA 4KWCA 4WEQA 5E6UB 3LISA 4KE7A 5DLYA 5EUBA 1A4RA 3PI6A 2VI5A 3COYA 4IS3A 4WSOA 1PX2A 2RB5A 5TPWB 1RPEL 4EEZA 4PG8A 3HADA 3MD9A 3GLFA 1PT8A 3A3YA 1E5LA 3LY5A 2JBAA 4MLZA 4QBKA 4UAGA 4CKCB 1Z4IA 3IO3A 1MTOA 4F85A 3MQ4A 3HB1A 4Q4JA 4LY3A 1CQTA 1PSWA 4RAQA 1JAIA 3KJFA 4GRIA 3L6EA 5BT9A 2Q5IA 4W9NA 4HADA 4QU9A 1V4BA 1XZBA 5EXPA 4TTAA 1UKCA 1W94A 5TGDA 3K5PA 1L7DA 1R6XA 4PFKA 3OTHA 4RAOA 4ZREA 1XNRB 5FR1A 3OTIA 2FPKA 5COQA 3VJRA 3ZY2A 3WQRA 2O9JA 2ZJ1A 4G0VA 4GHJA 2RGRA 1SC6A 1SIUA 3LX4A 4BQEA 1YV9A 1SD1A 3EQ7A 3F5SA 3TF5A 2W22A 5DK6A 4QM7A 5AOCA 4UFPA 1KSGA 3R9KA 1RYZA 4BZXA 4R2LA 3RI3A 5FCDA 1QQ7A 2AE1A 1OZFA 1AD2A 3VR1A 3NBAA 3D5QA 2ZWVA 4CNQA 3TW0A 1DV2A 2CBXA 2HJHA 3T3EA 1CUWA 4U2DA 1IBCA 4XIGS 3R76A 4DMLA 4QJ5A 3G7DA 1FFEA 3IAAA 5E9WA 1W4ZA 1GKIA 2FUG1 2ADMA 2XVAA 4G2NA 3ONNA 3PC2A 4X45A 4DSOA 2ZZMA 2C88A 2H17A 1V7QA 2XDAA 2ZJ5A 2UVPA 4U7HA 3HB9A 3MJEA 5GONB 5T8KA 1X7YB 3GXBA 3S81A 4MLDA 4YJDA 2Q07A 5KMGA 5ITSA 1GNQA 1EJ2A 2SCUA 3HLTA 3MIIA 4FMDF 4R3NA 1S7EA 1II9A 1D09A 1TYBE 3FYAA 1WPQA 2XODA 1TZBA 4X41A 3ANYB 4I6UA 3WA6A 2FW1A 1IOZA 1Q15A 1ZS9A 4MVJA 3L05A 2KMLA 4ZCSA 4B4KA 4Z0TA 3OM8A 3KOOA 1JIVA 2GHQA 3E7PA 2A5LA 4CIWA 3AINA 2WWFA 4L4SA 5IK2D 5EWLB 1R6UA 4R4JA 4WNIA 3DM5A 4O2AF 1ZGHA 3DAFA 3ZHOA 2FYTA 2HDWA 2YHSA 4AW9A 4EARA 5FBZA 3ZS8A 1J5XA 2O0HA 1QQ5A 2C59A 2W00A 3FPGA 2W70A 3UUGA 3I9MA 4BMSA 2BTOA 1MORA 2CY0A 1WTCA 3A8TA 5SYNA 4HYEA 3QOXA 1HL3A 4DHEA 2OV1A 4DV0B 2P6NA 1J7KA 4ZKDA 1WUKS 2FLWA 5BPFA 1COWD 1NOKA 1JEAA 1RADA 2Q5LA 7ADHA 4X4EA 5ISMA 3H2ZA 3LY9A 4ZVRA 4ESEA 2P2SA 2KEIA 1XD2B 3CCBA 4CEIB 4QAJA 3OF5A 5A3SA 4RDHA 5BW8A 3LTNC 4CCYB 4RKRA 5B2ZA 4O8ZA 1ZHHA 2XECA 4L6CA 4U5QA 4EGCB 1V6AA 4OY3A 4QT0A 1KR2A 4PO8A 4HZGA 4Q1CA 1TC1A 1JA1A 1RHMA 2H7XA 1PR4A 3SKYA 5F35A 2E4AA 1NJ1A 3NRCA 1G2QA 3UH1A 3Q0TA 1L5LA 4P3XA 3LQ2A 2X2OA 5FI3A 1USWA 3WLAA 5AICA 4DLBA 4DMCA 5EIAA 1OBHA 2C4NA 1HDGO 5EL0A 3C7CB 3D3KA 4KU4A 4XDZA 2PV7A 4WK4B 5FLKA 3J7TA 4M2LA 4J0QA 3L7YA 4QVGA 2ZRNA 1O1YA 1WULS 4UZFA 1TW3A 1NPDA 2ZT8A 3DMRA 4YWJA 3TVYA 1R69A 1UKYA 2NYVA 4GRAA 3ZGZA 1HLPA 4WX2B 4HAWA 4Q93A 3RS5A 1YVEI 1V16A 3FYUA 4FDUA 5EMJA 2QUBA 1FMCA 5COAA 5A5VA 2BHRA 2WK1A 4BN5A 5E0OA 5KKCA 3QKWA 2Q4EA 3WI7A 4P8RA 3HWRA 4A1FA 1RXYA 1VXRA 5EMHA 5IFLA 4Y6SA 4D8WA 1A8PA 2VZLA 1KK2A 3PGJA 3K8OE 1L5FA 3NRJA 3BUSA 3Q6IA 4KRXA 4D0NA 1F9AA 2OY0A 3UB4A 4HV4A 1U0TA 4FBMA 2PKYX 2NQ2C 3ONEA 1MENA 4BVLA 3AMVA 1FTSA 4Q1FA 1RHKA 4D74A 2C4HA 4KDCA 4CV1A 4LOHA 1BOOA 1WZCA 4YJFA 3HLKA 5G0TA 4B32A 1Y7PA 2QV0A 4FGKA 4JKYA 4OM7A 3BT7A 4QEZA 3V48A 3FSGD 4Q02A 4A2CA 4JNKA 4B2PA 3KFXA 3E70C 4W5HA 2YZNA 3UWPA 2INGX 3GA5A 3P8ZA 2OGZA 4PXAA 1ZW6A 4RS3A 5KNBD 4BEWA 1V0JA 3HL4A 2O2YA 3W1VA 1MGOA 3ZTWA 4N18A 4O4HB 4BOYA 1HC7A 2NXEA 3AIMA 3KIPA 3TZLA 4KPYA 1U2EA 2ACEA 1JFRA 1U2QA 3EVDA 1YA6A 3E5NA 2NU7B 4CQLB 4FFRA 4RPGA 3V00A 3F4LA 4A4DA 5DOZA 3RVNA 1XZAA 1SU7A 2HX1A 5DCYA 2ZRBA 3F7NA 2B3TA 3P9QA 4HP8A 1LGYA 3NVDA 5C7IO 3LO8A 2B4TO 5B37A 5KTPA 4KR6A 2LCQA 2H65A 3UPDA 3ILYA 1Q1BA 3OWXA 2J6BA 3V5NA 4ILEA 4II7A 1W5BA 3DE3X 1JPVA 4CKXA 5IYZB 3ETEA 1HMYA 1FXUA 3ORHA 2ZBDA 1OAKA 3FMVA 1D1SA 1FOEB 3B38A 2BZ0A 2VDNB 4YQFA 3GPCA 3EEYA 1RXCA 2FR1A 1T3HA 4WDRA 5G4KB 5BWBA 1V8ZA 3DZFA 1TJ4A 2HF8A 3BIWA 3OU2A 4NS4A 2VF7A 4P93A 4WKGA 3ZXYA 2PGDA 1Y81A 3F3MA 2ANBA 3L18A 1MJFA 4MVJH 1DCKA 2JHPA 5FQOA 1FTNA 1XA4A 4QJIA 1JDPA 2FEAA 1ZCFA 2IV1A 3CONA 2X5NA 3CVJA 3IDOA 3GVIA 3L8DA 4FYIA 4LTDA 3SICE 4W7IA 4F5ZA 2A3NA 2JLXA 5CCDA 2B4RO 1OD6A 1TAHA 3L1IA 1OFUA 1RABA 2JAHA 4JUFA 2VJLA 5ALQA 3RT9A 3SSOA 4CKBB 4DKJA 4AYTA 4A0FA 2A5GA 3N07A 3IKLA 2QP4A 3WNZA 1T6NA 4KE9A 1UJ4A 1WKVA 3BSFA 1IEWA 2BEWB 3L7JA 3V8MA 1EM8B 4KQWA 1O97C 3SEFA 2P5SA 2JFFA 4MV1A 1C7IA 4U2GA 7ABPA 2WM9B 4DXHA 4DUYB 3ID6C 2OP0A 3FCOA 4YRFA 1YAHA 3ZLVA 4ZHQA 1D6NA 2D7DA 1ECJA 4N8SA 5DEIA 3SYRA 4LXUA 3GK3A 2VEDA 1RWVA 2P67A 4IIFA 1PYOA 2ZGVA 2F4VB 3L4JA 1U3DA 4UZEA 3GRZA 4BRWA 1CUYA 3QYAA 3H1TA 3LC7O 3ET5A 2HUPA 5E4JA 3NETA 1E1NA 1KYQA 2Q3JA 1Z5VA 3PXEA 3PWTA 4R5HA 5EJ2A 3N2GA 4Z3OA 2RGYA 4MRMB 5TQ0A 5IABA 1XN4A 1FYFA 5BQFA 3WL3A 5CX1B 1TJ5A 3BXHA 4M49A 3AEUA 4I36A 1V3VA 4EPYA 5J4KA 3K6SB 3HG7A 3NHLA 4MR7A 3PQ6A 1SH7A 2I6FA 2O1WA 3A6PC 1GRRA 4MCXA 2HKIA 3KZVA 4O1IA 3AR3A 5I4BA 5LD2C 3CF4G 3ZG6A 1ZICA 2AXQA 4N3NA 4EQ6A 1QCDA 3BMNB 4BJ3A 4FFSA 4RY9A 3UZUA 2BYTA 2HT1A 1FQJA 1IXRC 1HNNA 1MU0A 2IGTA 3G8BA 1R6VA 1JU9A 1SCNE 2WTBA 2X8LA 3HVUA 2JCXA 2Q6OA 3DAHA 3PFKA 5CP8A 4DSUA 2A0UA 1VIAA 5AI5A 4PX5A 2NZ2A 2FRDA 5ALLA 4B3HA 1D03A 2HJVA 2UVDA 3CVVA 2I22A 1AC5A 2AH5A 4DLVA 2Z04A 1U3TA 1BFKA 4JKIA 1JB9A 4YJKA 4KW7A 4EUHA 3K92A 4R40A 2PSFA 3A6FA 4WTOA 3BAZA 3A25A 3UFDA 1JTFA 3IVGA 1CUFA 3FIJA 5FIUA 1OXVA 2ZI9A 2OK7A 3Q8KA 3K70B 2KZ8A 1WCV1 1X86B 1C7JA 4FWIB 2HA3A 1W85A 4YUWA 1FE8A 1UZAA 3C98A 3RHTA 1OH7A 1BD4A 3I05A 2OAP1 4GS5A 1HDCA 3BIJA 1OAOC 1KDTA 2O2HA 2NVUA 2AZTA 3EVCA 3A6KA 3VPAA 3X44A 3PVZA 4MVJI 4N03A 5IF9A 2GXSA 4ZMBA 3ZR4B 1UC8A 4LI3X 1H8HD 3GRYA 1JHMA 3VA7A 3J81A 1T9ZA 1XJCA 3DZ8A 3DEHA 4K5QA 1P4AA 3LZCA 2EJUA 3DZHA 2PSEA 4HPWA 1CE8A 4OYRA 4WPGA 1H3NA 3KJGA 5FUMA 4XB6B 2CLOB 1EFUA 1DXQA 1PJCA 2JLRA 1JXQA 3EGOA 3UOGA 4E2WA 2VDLB 1TF5A 3K9FC 3QTTA 2PWYA 2IHUA 1R12A 1G5TA 2F2TA 2ZYRA 2BI7A 4Q12A 2Y4OA 4KPUB 4QFBA 4R9NA 1GUYA 2IHZA 5KQSA 2OZEA 2NZVG 4OBMA 3PUWA 2IPNA 3BJEA 1DV1A 2NPFA 3RC1A 3DKIA 2RGDA 1B15A 1KVSA 1RRVA 2QE7A 3M4YA 2QR3A 3SZRA 4D8VA 4YT5A 2HJ9A 3AY0A 1Z18A 4ZTBA 1L7OA 1VKZA 1D9XA 1COZA 1DHRA 5KNDH 4X60A 4FYKA 1U7ZA 3T5GA 3A1WA 4RTNA 1T29A 2VSOA 4NOKA 3I2FA 4URYR 1Y80A 3NKFA 3BD6A 5JXGA 1FFGA 1V96A 4PLHA 2XNDD 4B85A 3PKZA 1Z2NX 3ZHMA 2GO7A 1SEPA 4M7WA 3N39C 2F1RA 4IHAA 2XOKA 4IH4A 1K06A 3M5DA 3ST7A 3WRVA 4CR7A 1G6Q1 2KEKA 1XYYA 1G291 2R66A 2R1ZA 2YY5A 4OJMX 5JWRA 3U44A 1XRPA 4Q4HB 2FP3A 1T1RA 1JQBA 2G5PA 7REQB 2QZSA 521PA 3PXDA 5I7HA 1JF8A 3ABZA 1SBYA 3IEIA 3ISTA 3NVKI 4D25A 1SB9A 1T1EA 3JQ6A 2AFIB 2OFFA 5ESXA 2F6RA 3QMPA 4NNPA 1Z7BA 1SIOA 4EB6B 1OF1A 3T7EA 3LDHA 1D5CA 2VUIB 3AVVA 1LW6E 1Q83A 1SOWA 4GOKA 5ED0A 3L8CA 3ZD7A 4JT4A 3HBMA 4D3FA 1I3CA 5C1DA 1ZN9A 3PXAA 2ERXA 2QMHA 4TV8A 3UMVA 1G21A 4IMPA 4HSGA 3TEJA 4Z7NB 4IF4A 1NVGA 2OCBA 2H4ZA 3JU3A 4WL0A 5DXJA 2VRCD 4J2OA 3N2LA 2DCUA 5ECYA 1E1QD 4BQQA 4D4HA 4PYIA 2OM6A 1D0IA 1TVMA 1Y1TA 3QXCA 4C14A 4FWTA 3A1CA 4RKEA 4EFDA 4WINA 3F3YA 1PGPA 1CS0B 2V7EA 2YH2A 1A5SB 2X77A 4FLEA 4D3DA 1S0UA 4HFRA 2Z1NA 5IHXA 3R3ZA 5J5VA 3C8UA 1YRQA 2QIOA 5JRJA 1GAWA 1UEIA 4ASUA 4UHKA 4UU7A 1C3JA 5UKDA 3HXPA 4RA9A 3RVJA 5B2EA 2C3UA 5C5DA 3PDIB 3S1AB 2C2XA 5I9IA 1U0HC 1R6DA 2VUHB 3KZOA 4E3WA 1JDVA 3U7IA 4IH9A 3ZWVA 2CVQA 4YH1A 3J7AC 2FPXA 3OZDA 3FE2A 4DNFA 3BVPA 2IOFK 3I61A 1P5JA 4MGHA 3V42A 2FZGA 1GZVA 3I6QA 3IV9A 3ZJ5A 1LI5A 3GEMA 2BR5A 2NG1A 2NUPB 3P2EA 2M6KA 3R7LA 1CK4A 3CIFA 2JLAA 2JH9A 4YRMA 4KDRA 2GETA 4Q9KA 4GEKA 1SKYB 5IJXA 1F2VA 4M88A 1NBAA 2GM5A 4DJDC 4YAIA 4NCBA 1ACJA 1G8AA 1KQPA 3QI7A 1WSAA 1IWPB 1K9VF 3IP7A 2G1PA 3BMQA 3SBEA 2FN4A 2WHPA 3E22B 1YOVA 4CIDA 1AN9A 5FWDA 3PNOA 2OV2A 2JA2A 4GWLA 4AO8A 1H6DA 3A28A 4DUGA 3CPHA 3GUZA 5JATA 3ZZTA 2BC9A 3EISA 4RQBA 1VHDA 2AR9A 2QMYA 3FY4A 4UVDA 4B76A 2GDZA 5TMEA 3AP1A 1P1JA 5BUCA 3SYMA 3ETGA 2CFOA 2WF6A 1UXKA 1VLLA 1AKTA 1NWCA 1C3VA 2G1AA 4QUEA 2I55A 3IEKA 3WKCA 4XGRA 3WAGA 3K94A 2H2DA 4K9OA 3A05A 4D1YA 3LKBA 1SR8A 3QNUA 1IPEA 2Q3FA 4DRXA 2A6PA 4AKTA 1EX9A 2OHFA 4HDMB 1Z8HA 1N2BA 1KYVA 2ZUSA 4NZPA 1LK0A 3GI1A 5EZ5A 2GK7A 1AQNA 2NO6A 3VR2A 2FEPA 3EBPA 4KV9A 4LUCA 4E46A 4ZO7A 3BHMA 5A3VA 4ALJA 3P9IA 1JHRA 1E6UA 1EGMB 1ZC3A 1CJSA 3D7SA 1FLAA 2PX0A 3IHTA 3KQMA 3M82A 4H15A 3CLRC 1Q92A 3VZSA 4RPHA 2J46A 4TKVA 1H2XA 4BVHA 4ZVMA 3VU3A 4JT8A 5LCXA 2A5YB 1OE0A 1BE0A 1JNYA 1TMYA 4IR7A 4P4SB 5AOVA 5ER6A 1NQUA 2GD2A 3R41A 1H8ED 3DHNA 4J0DA 1ZIXA 4CDGA 1NM5A 2BSXA 3E35A 4HUTA 5JADA 4ENWA 4OIMA 4MAFA 1FTWA 1GFSA 1NMXA 3CZMA 4HXFB 1KZGB 3CO5A 2BNNA 4TWRA 5LA6A 4EW2A 5LQJA 2FRXA 3KE8A 3QNMA 3H17A 5G02A 3WGGA 5J2UA 4PZEA 1I2MA 2Q0SA 1XMOB 5AHRA 1KQNA 5SYMA 1W34A 5FOTA 1CDDA 4D82A 2G28A 4K8OA 3CH4B 1M2HA 1NJGA 5ECDA 2ZWAA 3CXRA 1RZUA 4IVQA 1GQFA 4JLJA 5BSFA 2GJKA 3P0JA 1IVYA 1XKXA 4ZOLF 5JI3E 3RSHA 5I8WA 1TX4B 4N0MA 3PJDA 3NKVA 3IUNA 1A8QA 4JYPA 2MINA 4KMSA 4P4GA 4PPGA 5JCZA 5AHWA 1SCUB 2ZQZA 4KG7A 2JFBA 5BVHA 4D81A 2VDPB 1N9KA 1F4PA 1QRRA 2EZ8A 3EF1A 5F7JA 5AUOB 4NU0A 3LT4A 2WG1A 2P0AA 2O0LA 2CE2X 1XQ6A 3PVCA 3KJXA 1X87A 2I1WA 4FUTA 1MAHA 4YO7A 3TFQA 3I0NA 2PMKA 2I6QA 3I1FA 4ND8B 1F7VA 4E5UA 2VDUE 3DEIA 2H59A 4LE2A 2ID9A 3B9BA 3LQKA 1OI4A 3O90A 3NB0A 5CVTA 2Z30A 5H4GA 1VHWA 1IATA 2B5AA 2QA5A 2XUAA 1Y98A 2X86A 3CVYA 4PTLA 4WLVA 5ERYA 4F72A 4LWPA 3AK4A 4FYXA 2CV2A 3B8EA 1ZPDA 4DAEA 1ZVJA 3WRWA 4OHUA 1RM3A 1DTWB 4RGBA 3KU4A 1MCZA 3LA6A 1IZ9A 1RJWA 3A0RB 3JALA 4OG2A 2HBRA 3JAKB 4ETIA 3EQ6A 1HWYA 1UMKA 3EAGA 4EG0A 5EERA 8ATCA 1CQIA 3OZUA 4ZTZB 3A36A 3CX4A 5KIAA 4UQOA 3GGOA 4MI1A 3ZXUB 5C51B 3HPRA 1DKPA 4JP8A 4HDRA 3RWOA 2W2XA 2ZRQA 1BC5A 1KZ7B 4LGMA 3BFJA 4XGKA 1XPUA 5A2GA 3EARA 4RHCA 2O5EA 1Y33E 4UNNA 1QUEA 3LFPA 1UT5A 1ZIDA 2ZSUA 3E2PA 1C3EA 3FMPB 3PFBA 2L1PA 1NC1A 5EHIA 3UY4A 3EG5A 1ENZA 1G20B 3FPFA 4ZVOA 4H4CA 4B2LA 1MOZA 1NP7A 3FB4A 3CCFA 3FUVA 4RD3A 4DC9A 2B1GA 2NXNA 1VJ5A 2ZYAA 3VR6A 1UPTA 4EPXA 3OE1A 5CCBA 4N6NA 3K0CC 2VHVA 1Z6YA 3TOCA 3UT5A 4M0CA 2A78A 4WFKA 3DULA 2AOTA 4ZIRB 3ZGLA 3EG9B 2G9UA 2H4JA 2J4DA 1AXRA 2PBLA 4UBIA 5TVKA 4AJPA 5M29A 2DUMA 1HFJA 3IOEA 4DR3B 2MSEB 1HDOA 3OLVA 4OSPA 1JHQA 2H5LA 3AO0B 3DOFA 4JELA 2H4YA 3HO1A 4BX8A 1L5SA 3IRUA 3PSHA 3KXDA 4TRJA 4H31A 2FFHA 5HQ3B 2XIQA 3FPAA 4Y6LA 3WBFA 4RK6A 4AMZA 2REBA 4M0EA 1E2BA 2C77A 4CBVA 2JGFA 2FHPA 3WLEA 5HIIA 1WZEA 1FW6A 3PQDA 3AF4A 1XT6A 4REMA 1Z4LA 2O20A 3SZGA 3IPAA 3T1NA 1XHLA 4EEXA 5KSZA 4HN9A 2VQDA 4M9ZA 4Y2GA 3EUWA 3UMJA 5KYWB 1RRGA 3GA0A 1P33A 3LMKA 1KFJB 1RPTA 1ZAKA 5D87A 5FOXA 4IIGA 4ZODA 3TRIA 2D3TA 4UCQA 5DT2A 1XTVA 5KHOC 3JPYA 1FJHA 4PYOA 4DDWA 1LTHR 3V97A 4N82A 3WFZA 4GR9A 5EJ9A 1W36D 2G1KA 3JATA 2ACVA 5FBVB 3P7MA 1PWYE 3G02A 1Q2XA 1WHSA 4KFTA 1HQCA 4CW7A 5LLSA 1HSZA 1I1NA 3PJEA 3MYRA 4GQAA 1PHPA 5H0IA 1R7RA 2QTFA 3UJ6A 3L0PA 2JFZA 1QC5B 1KEUA 3BBPA 3U4DA 2CLMB 1GHTA 4IYJA 4BFZA 4C1BA 3IKVA 3IKTA 3VSEA 3S8MA 3LH5A 1QJ4A 1UF9A 1B2LA 4MPDA 3AVWA 3F1KA 3OCXA 2BKUA 5J47A 1PX0A 1Z12A 2OBNA 3HYCA 1KP3A 1UEJA 4A0RA 1W5AA 2WZQA 3ZW8A 4HVLA 1YFLA 3ZTYA 4EHKA 4OIFA 3DDHA 5BOSA 3QYJA 2WI8A 5ALWA 1LBIA 1J90A 2AI1A 1J5PA 3VPXA 1RAAA 3CIOA 4ZMSA 3WLSA 4TSKA 4YRKA 1E4YA 4UMFA 2W6OA 3E3OA 1VIVA 4FEGA 3TPFA 1IQRA 2JVJA 3CG4A 2HV8A 4F2HA 5BNWA 1R4MB 1U8EA 2HF9A 5FYQA 3TRFA 2HGZA 2WP0A 3RC9A 2CUNA 2IUEA 2NZ8A 4W9MC 1N6NA 3HDGA 4XDGA 2Z83A 3H84A 2PXUA 1X9IA 1SVNA 5E95A 2V7QD 2B4AA 3PPVA 3WK6A 3SGLA 1U0GA 4JOQA 3HJFA 1JWLA 3TQCA 3LBFA 3VC1A 3G5AA 4GEGA 3SVZA 1GTRA 1LBHA 3ONWA 4O4LF 5LLDA 3H8JA 3U7RA 4QQ8A 1EDZA 3V4FA 4BMXA 5GZ1A 2R7NA 3NJ8A 2COKA 4I50A 2V3WA 4MWTA 3PZBA 3UWKA 2IHKA 1ZO8A 3QELB 4GDMA 3RS7A 1QHEA 3I5AA 5KBYA 3WJAA 4F3YA 2BEJA 2A9KA 1THZA 3QX8A 5G1PA 6PFKA 5CXSA 1YBMA 4EKDA 4XRGA 2DHEA 2VWQA 1M0TA 2PUWA 3TLCA 5KVSA 3HUFA 1QH0A 2W2LA 5GIOE 3M9XA 4JH0A 4D3ZA 2AX3A 2I78A 2PGOA 2KPOA 1EWTA 3DNVB 1Y48E 1KS2A 2XMGA 3NHUA 3QWBA 4QUAA 5E4TA 1CEQA 3WOVA 4BZZA 3QHQA 5CLJA 1N75A 2AW3A 4X92A 4XQGA 5GV7A 1PI3A 2AG0A 4IHJF 4XB1A 1H0SA 2J9ZB 3WKEA 2XE4A 4EPRA 2M9MA 5PGMA 3TNLA 4EKNB 2PG3A 4U0KA 4JOCA 2P5TB 1SG9A 2CNOA 3ZHBA 3EHDA 2D8MA 4WAUA 1WSWA 5AKYA 4TSFD 4CF6A 1E32A 1KMIY 4LRXA 3TZHA 4L75A 5BVGA 4JSTA 2JATA 4OYYA 2GPSA 3RUDA 3GLIA 1ZX1A 3P9KA 3VR6H 1EWVA 2X22A 4GP6A 1YFZA 1PV4A 1FUYB 1MA3A 1V47A 4MO9A 3ZZNA 4H1WA 1OT5A 1VE1A 2OCIA 1RI5A 4M0KA 4C4OA 4YBZA 4R8SA 3ZQ4A 3I5YA 1UWKA 4GM0A 3UHPA 2ZBGA 1TVKA 3WXMA 2D54A 1YMVA 3ROZA 4L07A 1J56A 1IAVA 4A2WA 3I64A 3ZEAA 3B36A 4QOFA 4TRMA 3QPUA 2VO1A 1U11A 1LDEA 2NQTA 4LYEA 3QVXA 1KEZA 2VJOA 5IULC 3FBWA 1H0RA 5BSUA 1YE3A 3TCKA 4J1QA 2A14A 3GN5A 1KIAA 3M7IA 1OGIA 2BISA 2VSXA 2ZSHA 3H5WA 3JXDL 2DM6A 4JJGA 4NC9A 4YXWA 1CKEA 1JDUA 4RVUA 1L4MA 4R8VA 4U7JA 1UBSB 4KQ2A 2OHJA 2WWGA 4PO9A 4RE5A 5CM8B 1J49A 4TMKA 3H3FA 1TZ2A 2QJOA 4QL3A 4WKNA 1P60A 3AG5A 2NZXA 5DI3A 5IZ4A 1GRQA 3BMOB 3B6ZA 3WZMA 5K0ZA 2PSDA 1XTSA 2XYRA 1MW9X 1L1MA 4UNIA 4RABA 5LQMA 2Z2JA 4CRWB 1TTTA 3W4JA 3F9CA 3VNAA 5KJ6A 1Q19A 4TXNA 2MTBA 3LWZA 2DTXA 3HGMA 2ST1A 2J85A 3HU5A 2VDWB 2FGKA 1MB2A 2P1ZA 4HXGA 4RDIA 4PAOA 2JK1A 1WAMA 4JR2A 1EK6A 3AY7A 4F6RB 4KPEC 2Y9MB 3ONDA 4UUQA 1UDRA 3NYWA 1KKMA 5DZSA 1U2GC 1T1JA 1GAEO 1S89A 1XZKA 2C99A 2EIHA 3JQGA 4GSLA 1R5BA 3S4YA 3HM2A 4HMQA 4DB4A 4KV7A 4UE6A 5FP0A 4E5DA 3OKCA 3NATA 1ZS4A 3PEEA 4BQNA 1KVRA 5CXXA 1ZRSA 2WYVA 2O2XA 1H93A 1M7BA 1M2JA 1G8HA 1W44A 1K92A 2PT7A 2VYCA 2JCSA 4WY8A 5AOAA 3D6VA 4YAUA 1QSGA 5B6JA 1Z6TA 1QR6A 4GI7A 3SI7A 3ASVA 4PGGA 2HA0A 1VSUA 1DC4A 4IY1A 5J4YA 1VRWA 2GAOA 4H35A 3U5ZB 5CT6A 1HF3A 4GOND 1PL0A 1VECA 4COKA 2DERA 1RI1A 2ASVA 1ZOLA 2UDPA 4LNHA 2VR1A 4DJJA 1Q6YA 3LK6A 3S5UA 3U48A 4D57A 3RWBA 2HINA 1A9ZA 1KAMA 2DC1A 3VWSA 4CTNA 4Y1FA 4YJGA 3VSAA 1U8CB 4NECA 3WK4A 1OXKB 3NGLA 5CDHA 2Y99A 3LQQA 1EUCB 3KYCA 4Q7JB 1J2UA 1TGVA 3THXA 4JYAB 2QTRA 3IDZA 4BJ5A 4YP6A 4HLUC 1JVNA 4YMWA 4HNVA 4CFZA 2BPOA 4V1CB 4A82A 2YQ4A 3C5HA 3TX2A 3KVNA 1M6WA 4LHWA 3UV3A 3PHGA 5A5DA 2X9VA 3RJMA 3BL5A 4OCZA 1PWXA 4URHA 1U2TA 1XCGB 2Q0QA 2FKAA 1XZPA 3M3HA 3HU3A 4RU1A 3BXEA 5JDIA 1N5KA 1F17A 2XXQA 1EM6A 1J97A 4XD7D 3HC7A 4I1UA 3V8BA 4BV8A 2J4FA 4BFWA 1MC5A 1EE9A 1ONOA 4DBLE 2B7LA 1BAPA 4BDTA 1I9CA 3TM5A 3S8QA 4IQ8A 1E63A 4JT2A 1R18A 5BW6B 1KYYA 2PMDA 1MB3A 3SC2A 2A6CA 1I0IA 2C2KA 4LXTA 4D4LA 5C7LO 1JKMA 3GAAA 2G04A 4B35A 4ML3A 4RK7A 4YHBA 1IBMB 1ML4A 2COEA 2GZMA 2QU8A 1FMJA 1JNXX 4NOLA 1ODKA 2IOHA 1YE8A 2V6MA 5IVIA 2DQKA 4NXMB 2BEVB 1A9QA 5EHXA 4QG3A 3M49A 1ZZBA 5CJPA 4G25A 3A7DA 3HV2A 1XLWA 3AUTA 3L8EA 5AXCA 5KTYA 4BWFB 1L5WA 2FG5A 4IG4A 3IJEB 2GWRA 3GFTA 2BFOA 2W2KB 4IWNA 1OLUA 3ZYZA 4KQFA 5F4ZA 4E2XA 4L2IB 3B1JA 4G8DA 4HNQA 3QEBZ 2VBGA 1GPDG 1AKRA 1CJVC 2B8TA 1SHUX 2XI4A 2ZZKA 4NCJA 2ZIFA 3UH0A 1YTLA 3O95A 4G5FA 1IM8A 4KXMA 3L0YA 1B23P 1DJMA 4D9EA 3QX9A 3K16A 3ZE0B 2VLBA 1YQTA 3IOMA 1H1DA 5CRIA 4YAKA 2Y05A 3QLEA 5K8VA 3TLXA 3SS8A 5CFMA 3B20A 2FN3A 4HY3A 4RCZA 4I81A 1BXGA 2XYQA 3P0HA 1P1RA 2WVHA 3CZ4A 4RK0A 4AICA 5L7WA 2DWUA 3AKYA 3QGMA 1E3JA 4OSEA 2NO5A 1GXSA 1W6UA 2IYVA 3M6UA 3L7BA 4FQ5A 4UREA 4D0RA 5HW0A 1HPLA 5FOUA 4URVR 3UB3A 1T8SA 5IYZF 3R0JA 4BCBA 1OREA 3COVA 2YZ2A 1Q1AA 4G0NA 4G6ZA 3SLKA 9GPBA 1PFWA 4WFQA 1HE5A 4ZJZA 1CP3A 4RTOA 3LWBA 1T0UA 4C3OB 3W5DA 3NNSA 1RWBA 4DQLA 1CFJA 3VJLA 3QE3A 3U4QA 2XUZA 1NYQA 3OC6A 3UAVA 3CVOA 3P32A 4GUAA 4TUYF 3K9BA 2IV3A 1O58A 1WMDA 2FR8A 2WDPA 1KHHA 1CQPA 1C14A 2G0NA 4GG1A 3MW8A 4JA2A 2GR9A 3WSVA 5ICGA 1CYEA 2EGUA 5HJEA 1CJBA 2P27A 3G2JA 4FOSA 4RBNA 3C7KA 4TV9F 2F9MA 1V1RA 1TCUA 1ZUNB 1FS5A 1N6PA 3P9XA 1E2IA 1FLVA 1SULA 3T52A 2WF7A 2IOQA 3DTVA 3TNDA 2WD7A 3ZWXA 3W5IA 3FHTA 2O23A 4DQUA 2D4HA 1PQ4A 1PW5A 3BH0A 5FTMA 1YDEA 3TFLA 5I7EA 3L1KA 1B3RA 1TIBA 4FN5A 4BNYA 2YMQA 4BJ6A 2F3QA 1X1DA 3LCCA 3S40A 5EIFA 5JJIA 2FUCA 3INNA 3H4TA 3F51A 2AZMA 2LIPA 1II8A 1QHSA 2IZ5A 3L0DA 4DCCA 5JARA 3CCCA 1KWKA 4GLBA 3IPLA 2IVBA 2CNWD 5FUBA 2CXQA 4RK4A 1O54A 2C97A 1WUTA 2NYRA 1P7PA 4IQ4A 1JA0A 5I5EA 4AT1A 3BL8A 5CA1B 4TL6A 2XQGA 5FADA 3T1YB 1RBZA 1IVNA 2OP1A 1RXUA 1VPDA 1FFWA 1UMDA 3C3MA 2PL5A 3M6FA 3ZNOA 1EK5A 4CU5A 2QVXX 5A4JA 1Y3HA 2YYAA 5MGNA 4JY7A 4DZTA 3FOFC 1IZ7A 1PL7A 1ZYUA 3Q8LA 4KN5A 1KAOA 3GLUA 3QVGB 2ATEA 1DAEA 4L15A 3E9ZA 2RI6A 1LSSA 3Q9SA 4N49A 1EBFA 3ZHRA 1U1GA 4K6KA 1C1YA 5LUAA 1Q7TA 1N2ZA 3WWEA 3QVOA 2DUNA 4IVZA 4MV6A 4NJEA 1SWWA 2XWJI 5K6AC 2VDVE 5JPIA 4KRYA 1BGVA 5TQ2A 1PIWA 1L4LA 4KSBA 4GXNA 4RMGA 3GYBA 3UAXA 1G4UR 1FF9A 1ZMBA 2EJTA 2M6RA 4QQRA 1G8MA 3T5CA 1H5NA 4J0CA 3UMSA 1I8TA 2IFTA 3HYNA 2FPPB 2XXAA 1H05A 1L7AA 2D5AA 1DAMA 2ODPA 2JGMA 3I45A 4FHDA 3BFVA 4FZVA 2BR3A 4JDPA 5F1PA 3GA7A 5HCIA 4FBIA 4MWGA 2YHBA 4ITRC 13PKA 2JAQA 3OIVA 3KYDB 3B89A 3OT1A 2E4WA 3G1WA 4GWGA 1VL6A 1P44A 3TTVA 2EWTA 2LXNA 3MEQA 3ZYCA 1WUIS 1Q22A 3EFEA 5KOHB 2B1QA 1SB8A 3UB2A 5B1YA 2IK8A 3NTRA 4G9GA 4O6VA 1RXWA 2A92A 2CB9A 4RORA 2XF8A 2IOYA 1MLDA 4LRSB 2FN8A 4RSMA 1VG0B 3CG0A 4JWKA 3TLGB 2LCVA 1D6MA 2CHVA 4ZHSA 2YV2A 3VJKA 3CBQA 1LKZA 1I1HA 5JW6A 2OGWA 3BQNB 4P58A 1AZSC 1X14A 3F5QA 1KVQA 5BNFA 1EG7A 3HPQA 5A04A 3AFOA 4ER5A 1UM9A 1XA3A 2EDAA 3E0XA 4OUDB 3EXEB 1QX3A 1RMQA 1NW8A 4OFBA 4X8LA 5EWJB 2MSNA 3H75A 4AZ3B 4CE6A 1ILWA 3VKFA 2XWBF 5HFJA 3M2PA 4Z59A 4JMPA 2I8AA 2ZAIA 3OM1A 4N0DA 3JD2A 3MFYA 4DIEA 2O38A 5KTNA 2E6UX 2RJNA 4FMDB 1Y8CA 3HSSA 3BK1A 1XZ8A 2JGNA 3C6QA 5CH8A 5E3IA 4YPVA 2OCPA 4DR6B 1C0LA 3I28A 1RWKA 1DG9A 1SBIA 5K0JA 2JFVA 1FFXB 2AWNA 2QRKA 2HCTA 1V5EA 2D0PB 1UBHS 1QIFA 1ZLXA 1GNRA 3BKXA 3CH5A 3CZCA 2JIZA 3PHBE 3Q9UA 3PXBA 4DDVA 4B1FA 3BD7A 4ZV4A 5ALDA 2XJ9A 3I8SA 1G19A 4P3NA 4UUBA 1AMUA 3I9OA 4JJ8A 4Z4FA 1Z13A 3HTXA 4GL2A 4B4DA 1U2ZA 3KU1A 4BBPA 5GAHi 3IURA 3K0BA 4KYUA 2SKDA 5LQRA 1KY4A 1ZL0A 4ZDWA 4NYMR 4YO8A 3WTBA 3U80A 3QQ6A 1MAVA 2EP5A 5ALRA 5AVZA 1PLKA 2WNSA 4TKZA 4YRZA 3RVLA 4LVUA 1UJNA 4BNUA 4O0LA 4AKSA 5I7WA 1CHNA 2A57A 2C7QA 2QNRA 5JZSA 2YNMA 4IQGA 1LDMA 1OW3B 2IDJA 1BMFA 1LPBB 4I3FA 1AHIA 4JASB 2ZLBA 4JQOA 4N0EA 4Q48A 4QUBA 4UEKA 3WFIA 1Z3IX 4QUHA 3T3IA 4C07A 3ILXA 3R6LA 3ZNNA 4EP1A 4PW0A 3HCRA 3AHJA 3NTVA 1GPUA 4TT3D 1M7GA 1FS6A 5FTKA 2QXTA 1FDVA 1DAPA 5AJZA 1UBMS 3L07A 3HM9A 4NWIA 1RP7A 3L8MA 4P36A 2B94A 4X3CA 5DASA 3IHWA 4DM4A 5JD5A 1EX1A 1CY4A 3FYMA 2VRBA 4L9AA 3GEPA 3KQPA 1SEVA 4HATA 1I6LA 4YMSA 5B12A 4L16A 4HR7A 3TIGA 3HXKA 4MW5A 1Z4NA 3DM9B 2ZB3A 2SNIE 3GPDG 2AJDA 3AHHA 2I03A 3MINB 3ZH9B 2EZTA 1M2VB 2N3ZA 1U80A 1OXBB 1S2IA 2HUNA 3GZJA 3M6IA 3R7SA 4JXKA 4RD2A 2PE5A 2H0AA 3BXPA 3BXOA 1DKOA 3HR4A 4ZVTA 2W6QA 1FTGA 1X3LA 4IMRA 3JQDA 4ZU1X 3OHSX 3TXXA 3JAWB 2H1WA 2H57A 3KOWA 2P1RA 5JAMA 2BCGY 1X42A 1IHXA 1C7ZA 4E5YA 3QVTA 4IYRA 4NG4A 2GKSA 4OK3A 5J58A 5JS1A 1YVRA 4QJBA 2OBFA 3D6AA 3CX7A 1M5RA 1FLNA 2HNAA 2PKQO 3C1TA 2XUGA 1FVHA 3NAGA 4V2IA 1J8VA 2JANA 3DS8A 1OU0A 3CLRD 1TNDA 1WF6A 3KCNA 3OIGA 3PI7A 5AK4A 5K3FA 1YFKA 1O9GA 3DF9A 3LHDA 2ZAMA 5ALHA 1XEWY 3S0JA 2JQEA 4EB8A 2R6FA 4YJHB 4C0QC 3O8CA 2GFQA 3GLFE 2HCRA 5C1OA 4GPIB 2UXDB 1B0PA 1QF9A 1LJUA 4IP0A 4GX2A 5KTMA 2ZDQA 4YIKA 3U9TA 3ED1A 4C1NA 1RJFA 3BC1A 4C30A 3PLNA 3RYHB 5LMUB 2ZIWB 4J29A 1NW3A 1OZ0A 4OQ4A 4BLWA 3GD5A 5LU9A 1HSOA 4IJ6A 3IPRA 1L7QA 1MN6A 4FTWA 1YZUA 2XUFA 2XR1A 3WKAA 4L28A 3UJ7A 4DLAA 2UZIR 3S7TA 4Z4EA 5J2TF 3CEJA 4C3UA 1IU9A 1U2PA 1VGRA 3GU3A 1O6GA 3EPKA 3W5VA 1A9TA 1EDBA 3FUXA 2I2AA 1OWNA 1TAGA 2AOWA 5KQGA 3HHPA 2XGSA 1CU1A 2CL5A 2OQIA 2YY7A 1KR5A 1U5AA 3PNQA 5CVUA 3H2YA 3TG8A 4MUKA 4PVCA 3MWKA 3CLKA 2D62A 4G85A 3ZW9A 1A7KA 2BFCA 2H4HA 5EKTA 3EY9A 4R3WA 1VRCA 4A91A 3WLQA 2ZB2A 4QXMA 5A0FA 4AUMA 1Z75A 1EDEA 3WGUA 3FTNA 4GU5A 4L4YA 4UU8A 3H5TA 1Q17A 3L5OA 3L4SO 3V1KA 5I7VA 5KPJA 1N9ZA 3CN9A 4NJOA 4I50F 4LYJA 4X1YA 5I8PA 2OZVA 3QE4A 4PG4A 4JLBA 5ALUA 4CEHB 4LK2A 4CR6A 4JR1A 2R8YA 2PXVA 1FY2A 4HEQA 1C0EA 2P1DA 1M1UA 4QICA 1KSJA 5K3DA 2D8AA 4XKJA 1BFDA 4ACBA 3EC7A 4DW8A 3FOZA 1JPUA 3TBFA 4LOKA 5A9RA 1MO5A 2FZEA 4JV5B 1EFRA 1V8BA 2FQWA 1DP4A 3I9JA 1KNXA 2L49A 3FPJA 2BBWA 2ZIZA 3N53A 4YHHB 4Y0VA 1RXSA 1DXYA 1MH9A 2ECOA 2W6MA 4DIBA 3VYUB 5JHHB 4M9CA 3T5PA 3L4BA 1DIRA 2XKJE 4BEBA 4A5SA 2H48A 5H68A 4C6RA 2GNOA 3ZQKA 4RK1A 4QPNA 4GYJA 4MTLA 5CJ2A 4ZYWA 3ZV7A 1KH3A 3SZUA 1P1CA 3M6VA 1SK8A 3JD3A 1QYRA 5GVRA 4BBAA 4DLYA 3UJ3X 2O7NA 4TKUB 4HUQB 4CM6A 4UAVA 1W9MA 3LX8A 3U4AA 1TO1E 3U16A 1XZMA 4R16A 2WFLA 3H8VA 1BU5A 1JSRA 4B3TB 4M0LA 3ESBA 1W1WA 3RRXA 3Q85A 1ZG3A 2W2PA 1XNJA 1E3OC 3RYFA 1W4RA 2YOFA 4BO7A 2NSYA 2HRQA 2N75A 3H2GA 3PEVA 4LHEA 3VR3D 3RVKA 3ZWDA 2Y71A 2VNAA 3MJCA 2JPDA 3LCRA 2GARA 1IQ0A 1UZNA 4ALIA 3IBTA 4IKPA 1ZH6A 3D6NB 4DABA 4YRJA 2VHCA 1USKA 1D1QA 1SJ9A 3WLJA 3W3AD 4BX2A 1Z39A 4CTOA 1B26A 4U6NA 2BFFA 1B8UA 3ONFA 2HDHA 2J6CA 3KPUA 1VE7A 3JYPA 4YRIA 3O03A 2WA2A 4H7KA 4OHWA 5E2IA 1PV2A 4ZD6A 3RIEA 1MABB 4DT1A 3V34A 4MS3A 2E4ZA 4JOSA 1DS6A 3CNOA 2X8BA 5KX5A 2C54A 5A5FA 3GDHA 4HN4B 2G07A 2H51A 1RM0A 2GA8A 3M2TA 3OEYA 1NKSA 3QMMA 1JRLA 3PEFA 1F7UA 1CYDA 1PUXA 3L01A 3DL2A 4MWEA 3MRVA 3X43A 4BP3A 1ZJYA 5BYKA 4NBSA 1KQGA 4JJFA 4IZIA 4KH1A 2A2ZA 3MWDB 4B3CA 1NFQA 2AG8A 3BWMA 1DJOA 1JSXA 1G63A 2Q8QA 1AB5A 2B3DA 4JI2B 1L8LA 1R15A 1QLJA 1FA9A 2HPHA 2ILTA 3I6IA 1AF4A 2GJSA 3OLWA 3T7SA 3TZQA 4G1CA 5K05A 1XTRA 5K8LA 4DV6B 1OZAA 1EWQA 1U04A 4PY2A 5B36A 2ZR8A 1F9EA 4NCAA 1PGOA 5JBQA 1B6TA 3X2EA 2C07A 1R0LA 2I1VB 1Y3FE 3ELBA 3NHAA 1G6HA 1WMEA 1IQUA 1ZFNA 4IIEA 4QRDA 4TWJA 4BVEA 4D9KA 4UATA 4IFTA 4V39A 1DXHA 3L0CA 1GSAA 2V6IA 4FC7A 4ARZB 4F9FA 1RXIA 3HUDA 1TUGA 2WYOA 2CVZA 1RCTE 1NJ2A 3PGA1 2OLEA 3EUAA 4ZGBA 1LPSA 1NX9A 3Q0EA 4M7PA 4CG0A 4PEVA 3W7VA 4L8FA 2NIPA 4NE7A 2PS0A 2Y1FA 1CBUA 2ETXA 3W6ZA 4KVZA 4Z7OB 2I66A 4INOA 5AOBA 3NONA 2HFZA 3O1LA 1ZD9A 3MB5A 2EFYA 4RJIA 4J0KA 1YB6A 5EGSA 5ED4A 3R9WA 4EYKA 3RR2A 1J8YF 3AF1A 2BDUA 3K70D 5DNUA 4O3FA 5BRJA 1NLZA 5EZYA 1S3FA 3G68A 1T0JB 3DXFA 5AK5A 1MO2A 2GM4A 1Q0UA 1EVEA 2ROQA 4JJAA 4TLLB 1VYUA 1XKQA 3ESXA 5CLIA 1PEAA 3LI2A 3NHWA 2WMNB 3GJZA 1UJBA 2OCAA 3LWDA 3MCUA 1NW9B 2QRJA 1TO6A 2H9IA 1SCKA 4E22A 4CCAA 4C5BA 1AK9A 1G3IA 1PQPA 1SXIA 1Z5UA 1GGFA 2JBAB 1EFKA 1YH3A 2Q5HA 2CXOA 5AMXA 3W9SA 4EYOA 2B21A 3FOCA 3RK4A 2QN6A 4WLNA 1C9YA 4YRPA 2BH2A 2FW8A 4Q4JB 1CDZA 1KPGA 5IXYA 4I4NA 1GFWA 1PERL 3KAQA 3DJFA 3QLTA 4PQFA 1TU3A 2ARKA 3N5CA 1XXHE 1CY0A 3PCRB 4OI2A 3SU8A 3R40A 5J3JA 3VM6A 1NWHA 2HJGA 1TKCA 4ZI7A 1N33B 2I2WA 3QRWA 4LV6A 1WDLA 1DEOA 3IO5A 2HIGA 5EYPB 1X3SA 3RS8A 1YU9A 4OBWA 1FEZA 2K87A 3B6IA 5EZ6B 3AI1A 3KOXA 4A2PA 4B5KA 1Y89A 1R5JA 5C8XA 4KZKA 5LOVF 3OE7D 5LL6P 2DSTA 1SU8A 2P9CA 3ZCTA 4JP3A 3QWAA 5J4VA 3WJ7A 2VHEA 5CAEA 5ALFA 4XJSA 4YBAA 2OSBA 4GKVA 3U5TA 1IXYA 2QAJA 2SBTA 3PICA 4KQ1A 2KJQA 5AQ1A 3QIAA 5EINA 1IPHA 4TLDA 3AI7A 1L3BA 1ZXXA 2D5LA 3NCTA 2G6BA 5HE8A 5JCJD 2J67A 4KN8A 1WY7A 1HNZB 3HB7A 3QE9Y 1RMYA 4P7GA 1U7XA 2HO4A 3BH6A 3M9LA 3A70A 1KO8A 5A4FS 2NNWB 2ZRHA 2CT8A 5HPYB 2LYPA 2FUNB 3GJSA 2HMVA 4MKXA 3ZWQA 3AFHA 1ZM7A 4UU1A 5CU7A 2Q9UA 3UQZA 3WWYA 2AIRA 4DG9A 3AL0C 4AP6A 1XAIA 3NDBB 2OHIA 4C03A 4L4ZA 1PJ2A 1ZIYA 2A58A 4HWKA 2VC2B 5JMOA 4E13A 3JQQA 1Q0ZA 3VI4B 4E5KA 4EI8A 3PRYA 3F2IA 3TI7A 4PQRA 2X0EA 5AI9A 5AJHA 1M10A 2QRPA 1XYGA 1TUIA 3B6EA 5FR2A 3RRJA 3OKZA 4AROA 4XUGB 5AW9A 3G2HA 1VMEA 3OIWA 5KPDA 4GBED 4B0PA 5K0CA 3O8QA 2Z6VA 3IAUA 1AQ6A 2RG7A 2F48A 5A7HA 4ACAA 4PU3C 3ITEA 1M83A 1OWMA 1M0SA 2QYOA 2WF5A 5EXEA 4ZCPA 1Q1EA 3BFXA 4RPCA 4TQGA 3V7FA 4U2CA 3GNQA 1TA0A 1T36A 4RZ3A 1WD5A 2YZ7A 4HXYA 4L1KA 4LJAA 4PSKA 2VAPA 4MV5A 4AZWA 3W79A 1NF2A 4MYSA 1XZGA 4RVOA 5CK5A 1IY8A 3EXAA 4JI7B 1G6KA 2DE0X 1FZQA 4B7CA 4UBOA 2BM8A 1H85A 1XD8A 3FHJA 5EE9A 2V0GA 1XXLA 3QY0A 1P1BA 3PHHA 4K87A 5BV8A 1K9SA 1MJGA 1LNZA 1US8B 4UTPA 3MGCA 5T4EA 1DDGA 1HORA 5B53A 1K4MA 3I6ZA 3DEFA 3DD5A 3T15A 1OA0A 1S2NA 1C9MA 2VTKA 3KDPA 4FUQA 1XTQA 4DY6A 2BR4A 2VFAA 3G79A 1BMTA 3EZFA 5AI8A 2BE7A 2FWAA 2VN8A 3F6YA 4JZKA 2N9UA 3Q3CA 2VTVA 4MP6A 5IG2A 3LQRA 4L50A 4MWSA 3VV2A 4OQEA 5TMBA 3VR5D 3ZHXA 5IJ9A 4F4IA 3H1EA 3LVRE 2H2IA 1AKYA 1KMNA 2PUCA 1UZUA 3GUYA 3HRKA 4HTFA 4LCJA 1QFSA 4P7FA 3WMXA 1QFZA 4AN4A 1X7DA 3GJYA 4GWKA 3ANMA 3UWOA 3ABOB 4NBRA 1K7XB 3QX3A 1ZA1A 3K9NA 1KF0A 3QEMB 4OQDA 2WWYA 4N5MA 1TEVA 3R5TA 1MFQC 2CUKA 3I2GA 2NW6A 4RUKA 4ER7A 2VBIA 2VVTA 4Y67A 5DX1A 4D7AA 2VTBB 1TD9A 2JJ2A 4CLOA 1V16B 4CT5A 1QVRA 4K8RB 4B3XA 4N12A 4HBZA 1NYRA 2D1RA 4C0AC 3QH4A 4NEQA 3JD4A 1SKQA 4GECA 4FWBA 1YZVA 2E49A 2G1UA 4LDJA 4WXEA 3DL7A 4KQJA 4E03A 2CVFA 3TXYA 4HGYA 3DC7A 1PR9A 2AFHA 3EGWA 3SM9A 5BMVB 2CYBA 3NUZA 3GVXA 1K3FA 1WL8A 3HUEA 3RLFA 1T9AA 4ZV9A 3ZWOA 1GYRA 3BE4A 3UK0A 3ODPA 5FYDA 4D6XA 2IL1A 3PC6A 5I48A 2QOEA 1ONNA 4IVNA 3SY8A 3VGPA 1N6OA 1OIWA 4WIAA 3HYRA 4WNYA 2HA5A 3O1JC 1W93A 2G4CA 5ERGB 5TS3A 1N7IA 2P6RA 4UAUA 3AVOA 2CLSA 3FSRA 4A8PA 2PS1A 3AIOA 2V5UA 4NICA 5GOTA 3T7IA 4TVSA 1O6CA 5HX7A 2L8NA 1NJFA 3BDAA 5C5IA 3IAS6 2ATCA 1U3GA 4JBIA 2JFGA 1WA5A 3LD9A 1UL1X 3NORA 4IJWA 4R3UC 1KJYA 5E6RA 1DUIA 1G1AA 4AUEA 1A9OA 2GLXA 4PG6A 2GVDC 4S2UA 4XX1A 1WS6A 4QBIA 4EGJA 2K4MA 5IVHA 3VDXA 3LLVA 1CJTC 1D2MA 4MVCA 1ZJJA 5A7GA 3IULA 3ZXIA 4I8IA 2J9FA 3S1LA 5FI0B 3AXTA 4MMZB 5EEHA 4AFNA 4JLKA 4HB4A 5L9AA 3T5AA 2GZUA 1ODIA 1DBIA 1PTJC 3V4OA 2ZIXB 5E6SA 2QLMA 4K81B 1MOSA 1WKBA 4DHWA 1ZCJA 4NCHA 5DBIA 4F2GA 2YDXA 4HQNA 1RWOA 3QA3E 4G5YA 2ZXUA 1PS8A 3JASB 4PRKA 4ARIA 4PNPA 5TNXA 4GKKB 1AH2A 4LISA 4NJMA 3WBBA 3K30A 5GMOA 5IAKA 5KUTA 4HNTA 2FQ1A 2FK8A 3L0IB 3D0QA 3U37A 4L02A 4PC3A 4BNDA 3PC8C 4HX5A 4TTVA 3RBXA 3TYXA 4CL3A 2CXNA 1KPIA 1SVOA 3ROTA 5DDIP 1Q1NA 2R7KA 4BKQA 2WB4A 2ZBFA 1O9HA 2G0TA 3C3DA 4UCFA 4I9FA 2ID4A 5E38A 1QIKA 1XTBA 4P83A 1IK4A 3GUHA 3IODA 4BFVA 3GLRA 5DCWA 2HK6A 5JFGA 1KEEA 3OMTA 3SD7A 2JH3A 4JC5A 4Y0AA 3A2MA 3EXFB 2JAWA 4WZBA 3ZE6A 3K8YA 3LXMA 2HQSA 5FV4A 3GL9A 2PRYA 4QO8A 2R8BA 3D3EA 1U0EA 3LECA 3W2TA 5D5QA 3Q9LA 1XX6A 5G41A 3AQ4A 2UXBB 2ZI3A 1Z8NA 1Y4SA 2HRZA 2ZJ0A 4Q3KA 4UULA 3TD6A 1VFPA 2GN9A 4AY5A 2XSZD 4DG5A 1SO8A 1U6JA 3GFRA 4S3MA 3GLHE 4QBHA 1TJ3A 5DBGA 4IJVA 5F12A 1SBZA 3H97A 4XEHA 1QJCA 2BCEA 1Z7GA 4M1TA 1VCIA 2VP0A 4LOLA 3SMQA 3HJTA 4FDAA 3GMDA 4AZVA 5HKKA 4DWOA 4DJEC 1H2BA 4V38A 3TEFA 4QGGA 2YWJA 3AG6A 3B9QA 3CWCA 5G1NA 3DL0A 4JSYA 3D8RA 1QP0A 5A7FA 1RYEA 3MA0A 5FFFA 2AHOA 1NUTA 4BCCA 2PPXA 1JX6A 2D1QA 2HEIA 1CQZA 2VH5R 2XXBA 4NBNA 2XUHA 3DE0X 2VHTA 8ADHA 4LCEA 3RKRA 3UUWA 2C7PA 4HWPA 4X1IA 3F73A 1M2OB 5CDUA 3AEUB 3B60A 3BORA 3LCMA 3KR1A 4MUYA 4EJSB 5KYYA 1D4OA 1U9CA 1CXZA 3KQHA 1SU6A 1GTL1 3HDVA 1IOVA 1C0KA 1KTIA 1P62B 2EEPA 3EPLA 3P71T 1BVUA 4EQ6B 1U4OA 2FPMA 5T4FA 4AN1A 4QVKA 3STHA 1EB8A 4K05A 3JV7A 3ND6A 1ZP6A 4MR8B 1QFMA 2RC6A 4U63A 1H2EA 2B37A 3CF4A 3HCAA 3QFFA 3PXPA 1OXXK 2G80A 3HO8A 2FK7A 4K3VA 3OY7A 3UW3A 1JKJA 2YJGA 3ABIA 4ENRA 2VSFA 1QQBA 5A5GA 4U0JA 1VL0A 3R3YA 5AJUA 1BDHA 1J42A 3I52A 3QNWA 4CFYA 5CIYA 2ZSEA 4TVBA 3USCS 3UJ8A 4B6QA 4IHJA 1E96A 3U3JA 3MBOA 4OHMA 4CMHA 2JFXA 2RMKA 2PZJA 4FD3A 4J1TC 3JTMA 4WZBE 4OI1A 3ROEA 1DEKA 4CHGA 1Z7WA 4OJNA 4LCBA 2VWPA 2V5VA 3BIXA 5EXTA 1NYLA 4F9GA 2CB0A 2QLTA 2PPVA 4A92A 1R10A 2DWQA 4DN6A 3O2SB 2P30A 1PRYA 1SPBS 1OPXA 1Z0DA 2XTZA 3GJ4A 2APJA 1J06A 2NTNA 4LWOA 4HWTA 2X58A 3G6WA 5FBKA 5F9FA 3LUBA 3ZHYA 4JYBA 2EFEB 1PEDA 3KSZO 4R8KA 4UD2A 3B1KA 4LECA 1HH4A 4KXNA 3DVAA 4ILKA 1JDBB 1A4XA 3HFJA 5TE9A 1X1EA 4Z3KA 1LCIA 2ZJ8A 2IC5A