1QPLA

Fk506 binding protein (12 kda, human) complex with l-707,587
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 32-Indolyl ether derivatives of ascomycin: three-dimensional structures of complexes with FK506-binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
total genus 21
structure length 107
sequence length 107
chains with identical sequence C
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1qplA00
1T11A 4ODRA 5HT1A 2Y78A 4LAXA 1N1AA 1PINA 2PPOA 3LUOA 2XP7A 4JFLA 4U86A 2PV2A 5DITA 3UI5A 4DRJA 2MF9A 4J4OA 4TW7A 3PRBA 2L2SA 2F2DA 2AWGA 1FKTA 2KR7A 2LKNA 1NMVA 1JNTA 3O5PA 2VCDA 5B8IC 2ZR5A 2F21A 3UI4A 5HWBA 3O5LA 1Y0OA 2LPVA 5I98A 2XP4A 5HKGA 3NI6A 3H9RB 1QPFA 4C02B 1FD9A 3B7XA 2UZ5A 3JYJA 2RUCA 3OOBA 4G2PA 4ODKA 4DH0A 3EY6A 1Q6IA 2KI3A 4DRKA 4MSPA 4QT2A 3UQAA 2F4EA 2M08A 1PBKA 1BKFA 3O5RA 2VN1A 3I6CA 4DRMA 3JXVA 5HW8A 4DZ3A 2ITKA 2RURA 3O5JA 5HTGA 4JFJA 1A7XA 1FKSA 4J4NA 2JZVA 3KADA 1D7JA 1Q1CA 3TC5A 4JYSA 2LGOA 2PPPA 4IPXA 4DROA 2KGJA 4TX0A 4LAWA 4W9QA 3NTPA 3RFWA 2Q5AA 2MPHA 2RUDA 3KAHA 1J4IA 2D9FA 2KO7A 2XP9A 2IF4A 3MDYB 2KFWA 1Q6UA 3IKDA 1ZK6A 1ROUA 2ZQTA 3KAGA 4DRNA 1M5YA 4IQ2A 4TYOA 4R0XA 5HWCA 4LAYA 4ODQA 1C9HA 3KACA 4FAPA 4ODNA 4TNSA 3O5OA 5D75A 3O5IA 4BF8A 4IQCA 1TCOC 5HW6A 1FJDA 4ODOA 5DIVA 3UI6A 3VAWA 4NNRA 4GGQA 1Q6HA 2MLYA 4JFMA 3TCZA 5J6EA 1QZ2A 1D7IA 1HXVA 5DIUA 4W9OA 4DRIA 4DIPA 3IK8A 2XP3A 2ZQSA 3JYMA 3RGCA 1L1PA 1FKDA 3CGNA 1F8AB 4G50A 3O5QA 2XPBA 2PPNA 5BXJA 1YATA 1FKGA 3O5KA 4ODLA 1J6YA 4LAVA 1JVWA 5GPGA 2FAPA 3IHZA 3UF8A 1P5QA 3O5FA 2OFNA 4TW8A 1EYMA 3O5MA 2DG3A 1F40A 2KE0A 1FKJA 3O5DA 1NSGA 3FAPA 1D7HA 4FN2A 1YW5A 2DG4A 2N87A 2PBCA 4DRHA 5HUAA 3CGMA 1FKRA 2RUQA 3O5GA 1FKHA 2K8IA 2PV3A 1FKKA 3KCEA 3UQBA 3ODKA 4DRPA 3GPKA 2ZR4A 2XPAA 3TDBA 1ROTA 5HW7A 1EQ3A 2M1IA 4QT3A 2FKEA 1QPLA 2MLZA 1J4RA 4W9PA 4GIVA 2XP5A 1R9HA 1FKLA 3IKGA 3KABA 4JFIA 1B6CA 3WH0A 4DRQA 1FKIA 3KZ7A 4O2TA 3O5EA 2ZR6A 3UQIA 2MLXA 1FKFA 3NRKA 1ZCNA 1KT1A 1W26A 2ZQUA 2RSEA 4TW6A 2DG9A 2PV1A 1KT0A 4U85A 2ZQVA 2XP6A 1JNSA 1FKBA 2LJ4A 1J4HA 1FAPA 2M2AA 4DT4A 4ITZA 2XP8A 4ODMA 4DZ2A 4JFKA 4MGVA 4U84A 3KAFA 4N19A 1D6OA 1U79A 2RQSA 3KAIA 1NMWA 1BL4A 3PRDA 4ODPA 3PA7A 2MNTA 4QIBA
chains in the Genus database with same CATH superfamily
1T11A 2Y78A 1CTNA 1UR8A 5DITA 4DRJA 2PN0A 2MF9A 2AWGA 1FKTA 1JNDA 1NMVA 1JNTA 4WKFA 1LG2A 4DWSA 3UI4A 4MNMA 1W1TA 2XP4A 2PI6A 3H9RB 1OGGA 1QPFA 3JYJA 3G6MA 4G2PA 1EDQA 4QT2A 2F4EA 1BKFA 3JXVA 2ITKA 2RURA 4Z2KA 1A7XA 1FKSA 2JZVA 4P8VA 3RM8A 1D7JA 1E6NA 4JYSA 1ZB5A 2MPHA 1LG1A 3KAHA 2FDMA 1J4IA 2KO7A 3KAGA 4IQ2A 4TYOA 5HWCA 4L3NA 2A3CA 4BF8A 5HW6A 4WKAA 5DIVA 3VAWA 3B9DA 1OGBA 2MLYA 3RMEA 2WLZA 1OWQA 5DIUA 1HJXA 3ALFA 2QF8A 4DIPA 1E15A 1FKDA 4Z2IA 2ETNA 4MAVA 2PPNA 5BXJA 1YATA 3O5KA 1J6YA 4MNLA 1XHGA 2FAPA 3UF8A 1P5QA 2OFNA 1FFQA 4P8XA 3O5MA 2O92A 1NH6A 3FAPA 1ZBKA 1YW5A 1SR0A 2DT3A 2N87A 2PBCA 3CGMA 4DWSC 4MNJA 1FKKA 2ZR4A 2XPAA 5HW7A 1HKMA 4MPKA 3WD2A 4GIVA 4NSBA 1R9HA 1FKLA 3KABA 4JFIA 3WH0A 4DRQA 4Z2GA 3RM9A 3QOKA 3O5EA 3NRKA 4KQZA 2F23A 1KT1A 3WL0A 4TW6A 2PV1A 1J4HA 1FAPA 1W1VA 4MGVA 4U84A 3KAFA 1U79A 1BL4A 1EIBA 3PRDA 4ODPA 3PA7A 2IUZA 4MTVA 4ZS6A 4LAXA 1N1AA 2PPOA 4U86A 2PV2A 2AOSA 4Z2JA 3CHCA 1W1YA 3AS2A 1ZBWA 2VCDA 5B8IC 2ZR5A 4NZCA 1JCHB 5HWBA 3O5LA 4IT6A 3FY1A 2DT0A 3B7XA 3OOBA 4ODKA 3EY6A 3UQAA 3I6CA 4DRMA 3AQUA 4DZ3A 3WL1A 5HTGA 3EIPA 4JFJA 3AS1A 3KADA 1ZBCA 2LGOA 1RD6A 4DROA 2WLYA 4TX0A 2RUDA 2XP9A 2KFWA 1SYTA 4DRNA 1W1PA 3KACA 3OA5A 3O5OA 4ZPTR 1IX5A 1TFVA 4P8UA 4IQCA 1TCOC 1FJDA 1WNOA 1D2KA 2YBUA 1HXVA 4W9OA 1LQ0A 3IK8A 2DPEA 1NWSA 2EULA 3BXWA 4MNKA 4G50A 3O5QA 1JVWA 4HBOA 5GPGA 4TW8A 2DG3A 1NSGA 4DRHA 5HUAA 2WK2A 3AROA 2O9OA 1FKRA 4L72B 1W9VA 3KCEA 2B5UB 3UQBA 3ODKA 4DRPA 3ARXA 1EQ3A 2M1IA 4QT3A 2FKEA 2DT2A 3CHDA 4IT4A 3UQIA 1ZCNA 4Q22A 2RSEA 3AS0A 4U85A 2XP6A 3WD1A 4PTMA 4ITZA 4ODMA 3ARQA 3WQWA 2RQSA 5DEZA 2G41A 4QIBA 4ODRA 5HT1A 1LL4A 2YBTA 4UDMA 1PINA 2XP7A 3UI5A 4J4OA 4TW7A 3PRBA 3ARTA 4P8WA 2KR7A 3O5PA 4XAKA 3ARWA 1Y0OA 2A3BA 2ESCA 4C02B 1FD9A 4Z2LA 2UZ5A 1Q6IA 4DRKA 3W4RA 4ML4A 3O5RA 4WIWA 5HW8A 4DWSD 3WQVA 3TC5A 1X6NA 2DSUA 4LAWA 4W9QA 3NTPA 3RFWA 2Q5AA 2D9FA 2IF4A 3IKDA 1ZK6A 4R0XA 4ODQA 1C9HA 3ALGA 3O5IA 1K9TA 4Z2HA 3AS3A 3RM4A 4NNRA 4GGQA 1Q6HA 4JFMA 5HBFA 5J6EA 4R5EA 2P4VA 3B9AA 4DRIA 3RGCA 3JYMA 1GRJA 1XRVA 4S3KA 1E6RA 3CHFA 1FKGA 4ODLA 1GUVA 3IHZA 1EYMA 2KE0A 3CH9A 3GU0A 1E44A 4ZPVR 1HKIA 1H0IA 2RUQA 1E6PA 4AY1A 2K8IA 1E9LA 4QZVB 3GPKA 2OLHA 3TDBA 1ROTA 4S3JA 1QPLA 2XP5A 1B6CA 1FKIA 3KZ7A 4O2TA 1JNEA 1W9PA 1WAWA 1FKFA 4HBEA 1NWTA 3WD0A 1W26A 2ZQUA 2DG9A 1KT0A 3BMBA 1EHNA 1HKKA 2WM0A 1GPFA 2XP8A 4N19A 1D6OA 2DSZA 1NMWA 1O6IA 3ARVA 1FFRA 5DO2A 3LUOA 4JFLA 1W9UA 3WKZA 3GTYX 2DSWA 3PR9A 4Q7NA 2L2SA 2F2DA 2LKNA 1UR9A 2F21A 4URIA 3ARUA 5I98A 2LPVA 5HKGA 1H0GA 1LL7A 1ITXA 3NI6A 1ZBVA 2RUCA 3ARRA 5GPRA 4DH0A 2KI3A 2A3AA 3B8SA 4MSPA 4WKHA 1LJYA 2M08A 1PBKA 2VN1A 2DSVA 3O5JA 4J4NA 3ARSA 1Q1CA 4IPXA 2PPPA 2KGJA 3MDYB 1Q6UA 2ZQTA 1ROUA 1M5YA 4LAYA 1LL6A 4WK9A 4FAPA 4ODNA 1VF8A 4TNSA 5D75A 4ODOA 3UI6A 1GOIA 3TCZA 1QZ2A 1HJWA 1D7IA 1NWUA 2A3EA 2XP3A 2ZQSA 1L1PA 3CGNA 1F8AB 3CZ8A 3FXYA 2XPBA 2B31A 5DF0A 1HJVA 4W5UA 4LAVA 3B9EA 3WD4A 1KFWA 3G6LA 3O5FA 1F40A 1ZL1A 1FKJA 3O5DA 4HARA 1D7HA 4FN2A 4LGXA 2DG4A 1X6LA 3O5GA 1FKHA 2PV3A 2G8ZA 5JH8A 1WB0A 1ZU8A 2MLZA 4W9PA 1J4RA 3WD3A 3IKGA 3PRAA 4WJXA 2ZR6A 2MLXA 3ARPA 2DT1A 2ZQVA 3CHEA 4ZPWR 1JNSA 1FKBA 2LJ4A 2M2AA 4DT4A 1NWRA 4KR0B 1HKJA 3WIJA 4DWSB 4JFKA 4DZ2A 1E6ZA 3KAIA 5GQBA 3ARZA 3ARYA 2MNTA
chains in the Genus database with same CATH topology
1T11A 2Y78A 1CTNA 1UR8A 5DITA 4DRJA 2MF9A 2AWGA 1FKTA 1JNDA 1NMVA 1JNTA 4WKFA 1LG2A 4DWSA 3UI4A 4MNMA 1W1TA 2XP4A 2PI6A 3H9RB 1OGGA 1QPFA 3JYJA 3G6MA 4G2PA 1EDQA 4QT2A 2F4EA 1BKFA 3JXVA 2ITKA 2RURA 4Z2KA 1A7XA 1FKSA 2JZVA 4P8VA 3RM8A 1D7JA 1E6NA 4JYSA 1ZB5A 2MPHA 1LG1A 3KAHA 2FDMA 1J4IA 2KO7A 3KAGA 4IQ2A 4TYOA 5HWCA 4L3NA 2A3CA 4BF8A 5HW6A 4WKAA 5DIVA 3VAWA 3B9DA 1OGBA 2MLYA 3RMEA 2WLZA 1OWQA 5DIUA 1HJXA 3ALFA 2QF8A 4DIPA 1E15A 1FKDA 4Z2IA 4MAVA 2PPNA 5BXJA 1YATA 3O5KA 1J6YA 4MNLA 1XHGA 2FAPA 3UF8A 1P5QA 2OFNA 1FFQA 4P8XA 3O5MA 2O92A 1NH6A 3FAPA 1ZBKA 1YW5A 1SR0A 2DT3A 2N87A 2PBCA 3CGMA 4DWSC 4MNJA 1FKKA 2ZR4A 2XPAA 5HW7A 1HKMA 4MPKA 3WD2A 4GIVA 4NSBA 1R9HA 1FKLA 3KABA 4JFIA 3WH0A 4DRQA 4Z2GA 3RM9A 3QOKA 3O5EA 3NRKA 4KQZA 3WL0A 1KT1A 4TW6A 2PV1A 1J4HA 1FAPA 1W1VA 4MGVA 4U84A 3KAFA 1U79A 1BL4A 1EIBA 3PRDA 4ODPA 3PA7A 2IUZA 4MTVA 4ZS6A 4LAXA 1N1AA 2PPOA 4U86A 2PV2A 2AOSA 4Z2JA 3CHCA 1W1YA 3AS2A 1ZBWA 2VCDA 5B8IC 2ZR5A 4NZCA 5HWBA 3O5LA 4IT6A 3FY1A 2DT0A 3B7XA 3OOBA 4ODKA 3EY6A 3UQAA 3I6CA 4DRMA 3AQUA 4DZ3A 3WL1A 5HTGA 4JFJA 3AS1A 3KADA 1ZBCA 2LGOA 1RD6A 4DROA 2WLYA 4TX0A 2RUDA 2XP9A 2KFWA 1SYTA 4DRNA 1W1PA 3KACA 3OA5A 3O5OA 4ZPTR 1IX5A 1TFVA 4P8UA 4IQCA 1TCOC 1FJDA 1WNOA 1D2KA 2YBUA 1HXVA 4W9OA 1LQ0A 3IK8A 2DPEA 1NWSA 3BXWA 4MNKA 4G50A 3O5QA 1JVWA 4HBOA 5GPGA 4TW8A 2DG3A 1NSGA 4DRHA 5HUAA 2WK2A 3AROA 2O9OA 1FKRA 4L72B 1W9VA 3KCEA 3UQBA 3ODKA 4DRPA 3ARXA 1EQ3A 2M1IA 4QT3A 2FKEA 2DT2A 3CHDA 4IT4A 3UQIA 1ZCNA 4Q22A 2RSEA 3AS0A 4U85A 2XP6A 3WD1A 4PTMA 4ITZA 4ODMA 3ARQA 3WQWA 2RQSA 5DEZA 2G41A 4QIBA 4ODRA 5HT1A 1LL4A 2YBTA 1PINA 2XP7A 3UI5A 4J4OA 4TW7A 3PRBA 3ARTA 4P8WA 2KR7A 3O5PA 4XAKA 3ARWA 1Y0OA 2A3BA 2ESCA 4C02B 1FD9A 4Z2LA 2UZ5A 1Q6IA 4DRKA 3W4RA 4ML4A 3O5RA 4WIWA 5HW8A 4DWSD 3WQVA 3TC5A 1X6NA 2DSUA 4LAWA 4W9QA 3NTPA 3RFWA 2Q5AA 2D9FA 2IF4A 3IKDA 1ZK6A 4R0XA 4ODQA 1C9HA 3ALGA 3O5IA 1K9TA 4Z2HA 3AS3A 3RM4A 4NNRA 4GGQA 1Q6HA 4JFMA 5HBFA 5J6EA 4R5EA 4DRIA 3B9AA 3RGCA 3JYMA 1XRVA 4S3KA 1E6RA 3CHFA 1FKGA 4ODLA 1GUVA 3IHZA 1EYMA 2KE0A 3CH9A 4ZPVR 1HKIA 1H0IA 2RUQA 1E6PA 4AY1A 2K8IA 1E9LA 4QZVB 3GPKA 2OLHA 3TDBA 1ROTA 4S3JA 1QPLA 2XP5A 1B6CA 1FKIA 3KZ7A 4O2TA 1JNEA 1W9PA 1WAWA 1FKFA 4HBEA 1NWTA 3WD0A 1W26A 2ZQUA 2DG9A 1KT0A 1EHNA 1HKKA 2WM0A 1GPFA 2XP8A 4N19A 1D6OA 2DSZA 1NMWA 1O6IA 3ARVA 1FFRA 5DO2A 3LUOA 4JFLA 1W9UA 3WKZA 2DSWA 3PR9A 4Q7NA 2L2SA 2F2DA 2LKNA 1UR9A 2F21A 4URIA 3ARUA 5I98A 2LPVA 5HKGA 1H0GA 1LL7A 1ITXA 3NI6A 1ZBVA 2RUCA 3ARRA 5GPRA 4DH0A 2KI3A 2A3AA 3B8SA 4MSPA 4WKHA 1LJYA 2M08A 1PBKA 2VN1A 2DSVA 3O5JA 4J4NA 3ARSA 1Q1CA 4IPXA 2PPPA 2KGJA 3MDYB 1Q6UA 2ZQTA 1ROUA 1M5YA 4LAYA 1LL6A 4WK9A 4FAPA 4ODNA 1VF8A 4TNSA 5D75A 4ODOA 3UI6A 1GOIA 3TCZA 1QZ2A 1HJWA 1D7IA 1NWUA 2A3EA 2XP3A 2ZQSA 1L1PA 3CGNA 1F8AB 3CZ8A 3FXYA 2XPBA 2B31A 5DF0A 1HJVA 4W5UA 4LAVA 3B9EA 3WD4A 1KFWA 3G6LA 3O5FA 1F40A 1ZL1A 1FKJA 3O5DA 4HARA 1D7HA 4FN2A 4LGXA 2DG4A 1X6LA 3O5GA 1FKHA 2PV3A 2G8ZA 5JH8A 1WB0A 1ZU8A 2MLZA 4W9PA 1J4RA 3WD3A 3IKGA 3PRAA 4WJXA 2ZR6A 2MLXA 3ARPA 2DT1A 2ZQVA 3CHEA 4ZPWR 1JNSA 1FKBA 2LJ4A 2M2AA 4DT4A 1NWRA 4KR0B 1HKJA 3WIJA 4DWSB 4JFKA 4DZ2A 1E6ZA 3KAIA 5GQBA 3ARZA 3ARYA 2MNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T11 A;  4ODR A;  5HT1 A;  2Y78 A;  4LAX A;  1N1A A;  1PIN A;  2PPO A;  3LUO A;  2XP7 A;  4JFL A;  4U86 A;  2PV2 A;  5DIT A;  3UI5 A;  4DRJ A;  2MF9 A;  4J4O A;  4TW7 A;  3PRB A;  2L2S A;  2F2D A;  2AWG A;  1FKT A;  2KR7 A;  2LKN A;  1NMV A;  1JNT A;  3O5P A;  2VCD A;  5B8I C;  2ZR5 A;  2F21 A;  3UI4 A;  5HWB A;  3O5L A;  1Y0O A;  2LPV A;  5I98 A;  2XP4 A;  5HKG A;  3NI6 A;  3H9R B;  1QPF A;  4C02 B;  1FD9 A;  3B7X A;  2UZ5 A;  3JYJ A;  2RUC A;  3OOB A;  4G2P A;  4ODK A;  4DH0 A;  3EY6 A;  1Q6I A;  2KI3 A;  4DRK A;  4MSP A;  4QT2 A;  3UQA A;  2F4E A;  2M08 A;  1PBK A;  1BKF A;  3O5R A;  2VN1 A;  3I6C A;  4DRM A;  3JXV A;  5HW8 A;  4DZ3 A;  2ITK A;  2RUR A;  3O5J A;  5HTG A;  4JFJ A;  1A7X A;  1FKS A;  4J4N A;  2JZV A;  3KAD A;  1D7J A;  1Q1C A;  3TC5 A;  4JYS A;  2LGO A;  2PPP A;  4IPX A;  4DRO A;  2KGJ A;  4TX0 A;  4LAW A;  4W9Q A;  3NTP A;  3RFW A;  2Q5A A;  2MPH A;  2RUD A;  3KAH A;  1J4I A;  2D9F A;  2KO7 A;  2XP9 A;  2IF4 A;  3MDY B;  2KFW A;  1Q6U A;  3IKD A;  1ZK6 A;  1ROU A;  2ZQT A;  3KAG A;  4DRN A;  1M5Y A;  4IQ2 A;  4TYO A;  4R0X A;  5HWC A;  4LAY A;  4ODQ A;  1C9H A;  3KAC A;  4FAP A;  4ODN A;  4TNS A;  3O5O A;  5D75 A;  3O5I A;  4BF8 A;  4IQC A;  1TCO C;  5HW6 A;  1FJD A;  4ODO A;  5DIV A;  3UI6 A;  3VAW A;  4NNR A;  4GGQ A;  1Q6H A;  2MLY A;  4JFM A;  3TCZ A;  5J6E A;  1QZ2 A;  1D7I A;  1HXV A;  5DIU A;  4W9O A;  4DRI A;  4DIP A;  3IK8 A;  2XP3 A;  2ZQS A;  3JYM A;  3RGC A;  1L1P A;  1FKD A;  3CGN A;  1F8A B;  4G50 A;  3O5Q A;  2XPB A;  2PPN A;  5BXJ A;  1YAT A;  1FKG A;  3O5K A;  4ODL A;  1J6Y A;  4LAV A;  1JVW A;  5GPG A;  2FAP A;  3IHZ A;  3UF8 A;  1P5Q A;  3O5F A;  2OFN A;  4TW8 A;  1EYM A;  3O5M A;  2DG3 A;  1F40 A;  2KE0 A;  1FKJ A;  3O5D A;  1NSG A;  3FAP A;  1D7H A;  4FN2 A;  1YW5 A;  2DG4 A;  2N87 A;  2PBC A;  4DRH A;  5HUA A;  3CGM A;  1FKR A;  2RUQ A;  3O5G A;  1FKH A;  2K8I A;  2PV3 A;  1FKK A;  3KCE A;  3UQB A;  3ODK A;  4DRP A;  3GPK A;  2ZR4 A;  2XPA A;  3TDB A;  1ROT A;  5HW7 A;  1EQ3 A;  2M1I A;  4QT3 A;  2FKE A;  1QPL A;  2MLZ A;  1J4R A;  4W9P A;  4GIV A;  2XP5 A;  1R9H A;  1FKL A;  3IKG A;  3KAB A;  4JFI A;  1B6C A;  3WH0 A;  4DRQ A;  1FKI A;  3KZ7 A;  4O2T A;  3O5E A;  2ZR6 A;  3UQI A;  2MLX A;  1FKF A;  3NRK A;  1ZCN A;  1KT1 A;  1W26 A;  2ZQU A;  2RSE A;  4TW6 A;  2DG9 A;  2PV1 A;  1KT0 A;  4U85 A;  2ZQV A;  2XP6 A;  1JNS A;  1FKB A;  2LJ4 A;  1J4H A;  1FAP A;  2M2A A;  4DT4 A;  4ITZ A;  2XP8 A;  4ODM A;  4DZ2 A;  4JFK A;  4MGV A;  4U84 A;  3KAF A;  4N19 A;  1D6O A;  1U79 A;  2RQS A;  3KAI A;  1NMW A;  1BL4 A;  3PRD A;  4ODP A;  3PA7 A;  2MNT A;  4QIB A; 
#chains in the Genus database with same CATH topology
 1T11 A;  2Y78 A;  1CTN A;  1UR8 A;  5DIT A;  4DRJ A;  2PN0 A;  2MF9 A;  2AWG A;  1FKT A;  1JND A;  1NMV A;  1JNT A;  4WKF A;  1LG2 A;  4DWS A;  3UI4 A;  4MNM A;  1W1T A;  2XP4 A;  2PI6 A;  3H9R B;  1OGG A;  1QPF A;  3JYJ A;  3G6M A;  4G2P A;  1EDQ A;  4QT2 A;  2F4E A;  1BKF A;  3JXV A;  2ITK A;  2RUR A;  4Z2K A;  1A7X A;  1FKS A;  2JZV A;  4P8V A;  3RM8 A;  1D7J A;  1E6N A;  4JYS A;  1ZB5 A;  2MPH A;  1LG1 A;  3KAH A;  2FDM A;  1J4I A;  2KO7 A;  3KAG A;  4IQ2 A;  4TYO A;  5HWC A;  4L3N A;  2A3C A;  4BF8 A;  5HW6 A;  4WKA A;  5DIV A;  3VAW A;  3B9D A;  1OGB A;  2MLY A;  3RME A;  2WLZ A;  1OWQ A;  5DIU A;  1HJX A;  3ALF A;  2QF8 A;  4DIP A;  1E15 A;  1FKD A;  4Z2I A;  2ETN A;  4MAV A;  2PPN A;  5BXJ A;  1YAT A;  3O5K A;  1J6Y A;  4MNL A;  1XHG A;  2FAP A;  3UF8 A;  1P5Q A;  2OFN A;  1FFQ A;  4P8X A;  3O5M A;  2O92 A;  1NH6 A;  3FAP A;  1ZBK A;  1YW5 A;  1SR0 A;  2DT3 A;  2N87 A;  2PBC A;  3CGM A;  4DWS C;  4MNJ A;  1FKK A;  2ZR4 A;  2XPA A;  5HW7 A;  1HKM A;  4MPK A;  3WD2 A;  4GIV A;  4NSB A;  1R9H A;  1FKL A;  3KAB A;  4JFI A;  3WH0 A;  4DRQ A;  4Z2G A;  3RM9 A;  3QOK A;  3O5E A;  3NRK A;  4KQZ A;  2F23 A;  1KT1 A;  3WL0 A;  4TW6 A;  2PV1 A;  1J4H A;  1FAP A;  1W1V A;  4MGV A;  4U84 A;  3KAF A;  1U79 A;  1BL4 A;  1EIB A;  3PRD A;  4ODP A;  3PA7 A;  2IUZ A;  4MTV A;  4ZS6 A;  4LAX A;  1N1A A;  2PPO A;  4U86 A;  2PV2 A;  2AOS A;  4Z2J A;  3CHC A;  1W1Y A;  3AS2 A;  1ZBW A;  2VCD A;  5B8I C;  2ZR5 A;  4NZC A;  1JCH B;  5HWB A;  3O5L A;  4IT6 A;  3FY1 A;  2DT0 A;  3B7X A;  3OOB A;  4ODK A;  3EY6 A;  3UQA A;  3I6C A;  4DRM A;  3AQU A;  4DZ3 A;  3WL1 A;  5HTG A;  3EIP A;  4JFJ A;  3AS1 A;  3KAD A;  1ZBC A;  2LGO A;  1RD6 A;  4DRO A;  2WLY A;  4TX0 A;  2RUD A;  2XP9 A;  2KFW A;  1SYT A;  4DRN A;  1W1P A;  3KAC A;  3OA5 A;  3O5O A;  4ZPT R;  1IX5 A;  1TFV A;  4P8U A;  4IQC A;  1TCO C;  1FJD A;  1WNO A;  1D2K A;  2YBU A;  1HXV A;  4W9O A;  1LQ0 A;  3IK8 A;  2DPE A;  1NWS A;  2EUL A;  3BXW A;  4MNK A;  4G50 A;  3O5Q A;  1JVW A;  4HBO A;  5GPG A;  4TW8 A;  2DG3 A;  1NSG A;  4DRH A;  5HUA A;  2WK2 A;  3ARO A;  2O9O A;  1FKR A;  4L72 B;  1W9V A;  3KCE A;  2B5U B;  3UQB A;  3ODK A;  4DRP A;  3ARX A;  1EQ3 A;  2M1I A;  4QT3 A;  2FKE A;  2DT2 A;  3CHD A;  4IT4 A;  3UQI A;  1ZCN A;  4Q22 A;  2RSE A;  3AS0 A;  4U85 A;  2XP6 A;  3WD1 A;  4PTM A;  4ITZ A;  4ODM A;  3ARQ A;  3WQW A;  2RQS A;  5DEZ A;  2G41 A;  4QIB A;  4ODR A;  5HT1 A;  1LL4 A;  2YBT A;  4UDM A;  1PIN A;  2XP7 A;  3UI5 A;  4J4O A;  4TW7 A;  3PRB A;  3ART A;  4P8W A;  2KR7 A;  3O5P A;  4XAK A;  3ARW A;  1Y0O A;  2A3B A;  2ESC A;  4C02 B;  1FD9 A;  4Z2L A;  2UZ5 A;  1Q6I A;  4DRK A;  3W4R A;  4ML4 A;  3O5R A;  4WIW A;  5HW8 A;  4DWS D;  3WQV A;  3TC5 A;  1X6N A;  2DSU A;  4LAW A;  4W9Q A;  3NTP A;  3RFW A;  2Q5A A;  2D9F A;  2IF4 A;  3IKD A;  1ZK6 A;  4R0X A;  4ODQ A;  1C9H A;  3ALG A;  3O5I A;  1K9T A;  4Z2H A;  3AS3 A;  3RM4 A;  4NNR A;  4GGQ A;  1Q6H A;  4JFM A;  5HBF A;  5J6E A;  4R5E A;  2P4V A;  3B9A A;  4DRI A;  3RGC A;  3JYM A;  1GRJ A;  1XRV A;  4S3K A;  1E6R A;  3CHF A;  1FKG A;  4ODL A;  1GUV A;  3IHZ A;  1EYM A;  2KE0 A;  3CH9 A;  3GU0 A;  1E44 A;  4ZPV R;  1HKI A;  1H0I A;  2RUQ A;  1E6P A;  4AY1 A;  2K8I A;  1E9L A;  4QZV B;  3GPK A;  2OLH A;  3TDB A;  1ROT A;  4S3J A;  1QPL A;  2XP5 A;  1B6C A;  1FKI A;  3KZ7 A;  4O2T A;  1JNE A;  1W9P A;  1WAW A;  1FKF A;  4HBE A;  1NWT A;  3WD0 A;  1W26 A;  2ZQU A;  2DG9 A;  1KT0 A;  3BMB A;  1EHN A;  1HKK A;  2WM0 A;  1GPF A;  2XP8 A;  4N19 A;  1D6O A;  2DSZ A;  1NMW A;  1O6I A;  3ARV A;  1FFR A;  5DO2 A;  3LUO A;  4JFL A;  1W9U A;  3WKZ A;  3GTY X;  2DSW A;  3PR9 A;  4Q7N A;  2L2S A;  2F2D A;  2LKN A;  1UR9 A;  2F21 A;  4URI A;  3ARU A;  5I98 A;  2LPV A;  5HKG A;  1H0G A;  1LL7 A;  1ITX A;  3NI6 A;  1ZBV A;  2RUC A;  3ARR A;  5GPR A;  4DH0 A;  2KI3 A;  2A3A A;  3B8S A;  4MSP A;  4WKH A;  1LJY A;  2M08 A;  1PBK A;  2VN1 A;  2DSV A;  3O5J A;  4J4N A;  3ARS A;  1Q1C A;  4IPX A;  2PPP A;  2KGJ A;  3MDY B;  1Q6U A;  2ZQT A;  1ROU A;  1M5Y A;  4LAY A;  1LL6 A;  4WK9 A;  4FAP A;  4ODN A;  1VF8 A;  4TNS A;  5D75 A;  4ODO A;  3UI6 A;  1GOI A;  3TCZ A;  1QZ2 A;  1HJW A;  1D7I A;  1NWU A;  2A3E A;  2XP3 A;  2ZQS A;  1L1P A;  3CGN A;  1F8A B;  3CZ8 A;  3FXY A;  2XPB A;  2B31 A;  5DF0 A;  1HJV A;  4W5U A;  4LAV A;  3B9E A;  3WD4 A;  1KFW A;  3G6L A;  3O5F A;  1F40 A;  1ZL1 A;  1FKJ A;  3O5D A;  4HAR A;  1D7H A;  4FN2 A;  4LGX A;  2DG4 A;  1X6L A;  3O5G A;  1FKH A;  2PV3 A;  2G8Z A;  5JH8 A;  1WB0 A;  1ZU8 A;  2MLZ A;  4W9P A;  1J4R A;  3WD3 A;  3IKG A;  3PRA A;  4WJX A;  2ZR6 A;  2MLX A;  3ARP A;  2DT1 A;  2ZQV A;  3CHE A;  4ZPW R;  1JNS A;  1FKB A;  2LJ4 A;  2M2A A;  4DT4 A;  1NWR A;  4KR0 B;  1HKJ A;  3WIJ A;  4DWS B;  4JFK A;  4DZ2 A;  1E6Z A;  3KAI A;  5GQB A;  3ARZ A;  3ARY A;  2MNT A; 
#chains in the Genus database with same CATH homology
 1T11 A;  2Y78 A;  1CTN A;  1UR8 A;  5DIT A;  4DRJ A;  2MF9 A;  2AWG A;  1FKT A;  1JND A;  1NMV A;  1JNT A;  4WKF A;  1LG2 A;  4DWS A;  3UI4 A;  4MNM A;  1W1T A;  2XP4 A;  2PI6 A;  3H9R B;  1OGG A;  1QPF A;  3JYJ A;  3G6M A;  4G2P A;  1EDQ A;  4QT2 A;  2F4E A;  1BKF A;  3JXV A;  2ITK A;  2RUR A;  4Z2K A;  1A7X A;  1FKS A;  2JZV A;  4P8V A;  3RM8 A;  1D7J A;  1E6N A;  4JYS A;  1ZB5 A;  2MPH A;  1LG1 A;  3KAH A;  2FDM A;  1J4I A;  2KO7 A;  3KAG A;  4IQ2 A;  4TYO A;  5HWC A;  4L3N A;  2A3C A;  4BF8 A;  5HW6 A;  4WKA A;  5DIV A;  3VAW A;  3B9D A;  1OGB A;  2MLY A;  3RME A;  2WLZ A;  1OWQ A;  5DIU A;  1HJX A;  3ALF A;  2QF8 A;  4DIP A;  1E15 A;  1FKD A;  4Z2I A;  4MAV A;  2PPN A;  5BXJ A;  1YAT A;  3O5K A;  1J6Y A;  4MNL A;  1XHG A;  2FAP A;  3UF8 A;  1P5Q A;  2OFN A;  1FFQ A;  4P8X A;  3O5M A;  2O92 A;  1NH6 A;  3FAP A;  1ZBK A;  1YW5 A;  1SR0 A;  2DT3 A;  2N87 A;  2PBC A;  3CGM A;  4DWS C;  4MNJ A;  1FKK A;  2ZR4 A;  2XPA A;  5HW7 A;  1HKM A;  4MPK A;  3WD2 A;  4GIV A;  4NSB A;  1R9H A;  1FKL A;  3KAB A;  4JFI A;  3WH0 A;  4DRQ A;  4Z2G A;  3RM9 A;  3QOK A;  3O5E A;  3NRK A;  4KQZ A;  3WL0 A;  1KT1 A;  4TW6 A;  2PV1 A;  1J4H A;  1FAP A;  1W1V A;  4MGV A;  4U84 A;  3KAF A;  1U79 A;  1BL4 A;  1EIB A;  3PRD A;  4ODP A;  3PA7 A;  2IUZ A;  4MTV A;  4ZS6 A;  4LAX A;  1N1A A;  2PPO A;  4U86 A;  2PV2 A;  2AOS A;  4Z2J A;  3CHC A;  1W1Y A;  3AS2 A;  1ZBW A;  2VCD A;  5B8I C;  2ZR5 A;  4NZC A;  5HWB A;  3O5L A;  4IT6 A;  3FY1 A;  2DT0 A;  3B7X A;  3OOB A;  4ODK A;  3EY6 A;  3UQA A;  3I6C A;  4DRM A;  3AQU A;  4DZ3 A;  3WL1 A;  5HTG A;  4JFJ A;  3AS1 A;  3KAD A;  1ZBC A;  2LGO A;  1RD6 A;  4DRO A;  2WLY A;  4TX0 A;  2RUD A;  2XP9 A;  2KFW A;  1SYT A;  4DRN A;  1W1P A;  3KAC A;  3OA5 A;  3O5O A;  4ZPT R;  1IX5 A;  1TFV A;  4P8U A;  4IQC A;  1TCO C;  1FJD A;  1WNO A;  1D2K A;  2YBU A;  1HXV A;  4W9O A;  1LQ0 A;  3IK8 A;  2DPE A;  1NWS A;  3BXW A;  4MNK A;  4G50 A;  3O5Q A;  1JVW A;  4HBO A;  5GPG A;  4TW8 A;  2DG3 A;  1NSG A;  4DRH A;  5HUA A;  2WK2 A;  3ARO A;  2O9O A;  1FKR A;  4L72 B;  1W9V A;  3KCE A;  3UQB A;  3ODK A;  4DRP A;  3ARX A;  1EQ3 A;  2M1I A;  4QT3 A;  2FKE A;  2DT2 A;  3CHD A;  4IT4 A;  3UQI A;  1ZCN A;  4Q22 A;  2RSE A;  3AS0 A;  4U85 A;  2XP6 A;  3WD1 A;  4PTM A;  4ITZ A;  4ODM A;  3ARQ A;  3WQW A;  2RQS A;  5DEZ A;  2G41 A;  4QIB A;  4ODR A;  5HT1 A;  1LL4 A;  2YBT A;  1PIN A;  2XP7 A;  3UI5 A;  4J4O A;  4TW7 A;  3PRB A;  3ART A;  4P8W A;  2KR7 A;  3O5P A;  4XAK A;  3ARW A;  1Y0O A;  2A3B A;  2ESC A;  4C02 B;  1FD9 A;  4Z2L A;  2UZ5 A;  1Q6I A;  4DRK A;  3W4R A;  4ML4 A;  3O5R A;  4WIW A;  5HW8 A;  4DWS D;  3WQV A;  3TC5 A;  1X6N A;  2DSU A;  4LAW A;  4W9Q A;  3NTP A;  3RFW A;  2Q5A A;  2D9F A;  2IF4 A;  3IKD A;  1ZK6 A;  4R0X A;  4ODQ A;  1C9H A;  3ALG A;  3O5I A;  1K9T A;  4Z2H A;  3AS3 A;  3RM4 A;  4NNR A;  4GGQ A;  1Q6H A;  4JFM A;  5HBF A;  5J6E A;  4R5E A;  4DRI A;  3B9A A;  3RGC A;  3JYM A;  1XRV A;  4S3K A;  1E6R A;  3CHF A;  1FKG A;  4ODL A;  1GUV A;  3IHZ A;  1EYM A;  2KE0 A;  3CH9 A;  4ZPV R;  1HKI A;  1H0I A;  2RUQ A;  1E6P A;  4AY1 A;  2K8I A;  1E9L A;  4QZV B;  3GPK A;  2OLH A;  3TDB A;  1ROT A;  4S3J A;  1QPL A;  2XP5 A;  1B6C A;  1FKI A;  3KZ7 A;  4O2T A;  1JNE A;  1W9P A;  1WAW A;  1FKF A;  4HBE A;  1NWT A;  3WD0 A;  1W26 A;  2ZQU A;  2DG9 A;  1KT0 A;  1EHN A;  1HKK A;  2WM0 A;  1GPF A;  2XP8 A;  4N19 A;  1D6O A;  2DSZ A;  1NMW A;  1O6I A;  3ARV A;  1FFR A;  5DO2 A;  3LUO A;  4JFL A;  1W9U A;  3WKZ A;  2DSW A;  3PR9 A;  4Q7N A;  2L2S A;  2F2D A;  2LKN A;  1UR9 A;  2F21 A;  4URI A;  3ARU A;  5I98 A;  2LPV A;  5HKG A;  1H0G A;  1LL7 A;  1ITX A;  3NI6 A;  1ZBV A;  2RUC A;  3ARR A;  5GPR A;  4DH0 A;  2KI3 A;  2A3A A;  3B8S A;  4MSP A;  4WKH A;  1LJY A;  2M08 A;  1PBK A;  2VN1 A;  2DSV A;  3O5J A;  4J4N A;  3ARS A;  1Q1C A;  4IPX A;  2PPP A;  2KGJ A;  3MDY B;  1Q6U A;  2ZQT A;  1ROU A;  1M5Y A;  4LAY A;  1LL6 A;  4WK9 A;  4FAP A;  4ODN A;  1VF8 A;  4TNS A;  5D75 A;  4ODO A;  3UI6 A;  1GOI A;  3TCZ A;  1QZ2 A;  1HJW A;  1D7I A;  1NWU A;  2A3E A;  2XP3 A;  2ZQS A;  1L1P A;  3CGN A;  1F8A B;  3CZ8 A;  3FXY A;  2XPB A;  2B31 A;  5DF0 A;  1HJV A;  4W5U A;  4LAV A;  3B9E A;  3WD4 A;  1KFW A;  3G6L A;  3O5F A;  1F40 A;  1ZL1 A;  1FKJ A;  3O5D A;  4HAR A;  1D7H A;  4FN2 A;  4LGX A;  2DG4 A;  1X6L A;  3O5G A;  1FKH A;  2PV3 A;  2G8Z A;  5JH8 A;  1WB0 A;  1ZU8 A;  2MLZ A;  4W9P A;  1J4R A;  3WD3 A;  3IKG A;  3PRA A;  4WJX A;  2ZR6 A;  2MLX A;  3ARP A;  2DT1 A;  2ZQV A;  3CHE A;  4ZPW R;  1JNS A;  1FKB A;  2LJ4 A;  2M2A A;  4DT4 A;  1NWR A;  4KR0 B;  1HKJ A;  3WIJ A;  4DWS B;  4JFK A;  4DZ2 A;  1E6Z A;  3KAI A;  5GQB A;  3ARZ A;  3ARY A;  2MNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...