1QPLA

Fk506 binding protein (12 kda, human) complex with l-707,587
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title 32-Indolyl ether derivatives of ascomycin: three-dimensional structures of complexes with FK506-binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 21
structure length 107
sequence length 107
chains with identical sequence C
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1qplA00
2DG9A 3B7XA 1JNSA 2MLZA 2Y78A 1KT1A 3JYMA 4J4NA 4ODOA 3UF8A 2PPNA 4BF8A 2FAPA 2KR7A 1HXVA 3ODKA 4JFMA 4IPXA 4U86A 4U85A 2RSEA 1FKSA 1QPFA 2PBCA 3MDYB 2M1IA 4TX0A 3O5KA 5DITA 2RUQA 3O5PA 3I6CA 4ODKA 2MPHA 3KAFA 4LAVA 5DIUA 3TDBA 1ROTA 4U84A 3KADA 4QT2A 3O5MA 2MLXA 4G50A 4TW6A 5HUAA 1FJDA 1D7IA 3IKDA 4ODLA 1BKFA 1NMWA 4GGQA 3RGCA 3TC5A 1M5YA 2RURA 4DRHA 4DRQA 3O5IA 3UQIA 5I98A 3IKGA 3UI4A 3NRKA 3O5LA 2M08A 3O5JA 1FKDA 2XP3A 2PPOA 2LPVA 1Q6HA 2JZVA 3UQBA 1FKIA 2XP8A 4MGVA 3O5GA 4QT3A 1ROUA 2M2AA 2VCDA 3KAHA 4W9QA 5HW8A 4QIBA 3O5RA 4ITZA 2ZR6A 4TYOA 2LGOA 2IF4A 3VAWA 1D7HA 3PRBA 4ODRA 4GIVA 2LKNA 4DRPA 1QZ2A 3KAIA 1D7JA 2Q5AA 2FKEA 5D75A 1Y0OA 1B6CA 1FKBA 1Q6IA 5HW7A 4JFJA 4FN2A 4MSPA 5BXJA 2RUCA 4JFLA 4DT4A 1QPLA 2PPPA 1J4RA 3KZ7A 4DRNA 3UI5A 1YATA 5HTGA 1C9HA 2UZ5A 4DRJA 1PBKA 1L1PA 2XP9A 3TCZA 2L2SA 1Q6UA 4LAXA 2VN1A 4TW8A 3O5EA 4DRKA 5B8IC 4DH0A 2MNTA 3LUOA 1D6OA 2DG4A 2ZR4A 4JFKA 2MLYA 2KO7A 1FKKA 1FAPA 3JXVA 2K8IA 4ODMA 1F8AB 5HT1A 2RUDA 2XP6A 3NTPA 4NNRA 2XP7A 4IQCA 1YW5A 3JYJA 4W9OA 4DZ3A 2KGJA 2DG3A 3IHZA 2ZQUA 4JFIA 1FKHA 1FD9A 4W9PA 3UI6A 1NMVA 2ITKA 2F2DA 4J4OA 2PV1A 3RFWA 4LAYA 4DRMA 1Q1CA 4ODPA 1NSGA 2XP5A 5HKGA 1BL4A 1FKTA 3PRDA 5GPGA 5HWCA 4LAWA 2KI3A 3O5FA 1W26A 2MF9A 5DIVA 3O5QA 4C02B 3KAGA 5HW6A 2PV3A 1KT0A 1PINA 2PV2A 2XPAA 4ODQA 1T11A 4N19A 2XP4A 1JVWA 2N87A 4ODNA 2XPBA 4FAPA 4G2PA 3KCEA 2KE0A 2RQSA 1FKLA 1P5QA 1FKJA 2OFNA 3GPKA 4IQ2A 4DROA 3CGMA 4DZ2A 1F40A 3KACA 1J6YA 3O5OA 3H9RB 4O2TA 2ZR5A 1TCOC 2D9FA 1JNTA 4TNSA 1EQ3A 2ZQTA 2KFWA 3NI6A 3OOBA 3UQAA 2LJ4A 3FAPA 3O5DA 1U79A 3EY6A 3KABA 3IK8A 4TW7A 2AWGA 1R9HA 1ZCNA 3WH0A 1J4HA 2ZQSA 4R0XA 4JYSA 2ZQVA 1A7XA 1FKRA 3PA7A 5HWBA 1FKFA 1ZK6A 4DRIA 1EYMA 1J4IA 3CGNA 1FKGA 2F4EA 5J6EA 2F21A 4DIPA 1N1AA
chains in the Genus database with same CATH superfamily
3ALGA 1KT1A 1UR9A 2PPNA 3TDBA 4Z2JA 1E6RA 4ODKA 3KAFA 4LAVA 1ROTA 4U84A 4TW6A 1FJDA 3IKDA 4ODLA 2DPEA 4MAVA 4Z2GA 2ETNA 1EDQA 3UQIA 5I98A 3IKGA 3NRKA 1W9UA 2XP3A 3ARWA 4S3KA 4HBOA 3UQBA 3O5GA 4QT3A 2M2AA 4W9QA 4MNLA 3O5RA 4ITZA 4TYOA 2IF4A 3B8SA 4DRPA 1LG2A 2LKNA 4WK9A 2FKEA 3ARRA 1B6CA 1E6NA 4FN2A 4MSPA 4JFLA 3ARUA 2B31A 3KZ7A 4DRNA 1X6NA 1YATA 1C9HA 4DRJA 3BMBA 1Q6UA 1HJVA 4XAKA 4DRKA 2OLHA 2MNTA 3LUOA 2DG4A 1F8AB 2WM0A 4Z2LA 2RUDA 2XP7A 4IQCA 3JYJA 3WQWA 1FKHA 1W1VA 3UI6A 4QZVB 1HJWA 2F2DA 2ITKA 4ODPA 1NSGA 2DSVA 5HKGA 2DT2A 2KI3A 1W26A 2MF9A 3GU0A 1LL4A 1KT0A 1JVWA 3FY1A 4Z2HA 2XPBA 4DZ2A 3KACA 1J6YA 3O5OA 1JNTA 2DSUA 3UQAA 3OOBA 2WK2A 2A3BA 3EY6A 4IT6A 3AS2A 3WH0A 4MNKA 2ZQSA 4R0XA 1LJYA 1ZK6A 4HBEA 1J4IA 2F4EA 2O9OA 1N1AA 3FXYA 4MNMA 2MLZA 3JYMA 3UF8A 1HXVA 1FKSA 4URIA 1RD6A 2RUQA 3I6CA 3ARPA 2EULA 2PN0A 3KADA 3O5MA 5DEZA 2O92A 4Q7NA 1NMWA 4GGQA 3TC5A 2RURA 4DRQA 3O5IA 2M08A 3O5JA 1ZBKA 2PPOA 3AS3A 2YBTA 1FKIA 1ROUA 2VCDA 1NWUA 4QIBA 4MNJA 1D7HA 3RM9A 1EIBA 3AS1A 4ODRA 2Q5AA 2AOSA 2WLYA 3WD2A 3PRAA 5HW7A 4L3NA 3RMEA 5BXJA 2RUCA 4P8WA 3WL1A 3ALFA 1J4RA 1E44A 1PBKA 1NWRA 3ARSA 4DH0A 5GPRA 4AY1A 1H0IA 2ZR4A 1FKKA 1FAPA 2DSZA 4Z2KA 4S3JA 5HT1A 1WNOA 2KGJA 3AQUA 2DG3A 4IT4A 2ZQUA 1ZBVA 4MTVA 2PI6A 3CHDA 3RFWA 2XP5A 5GPGA 4LAWA 3O5FA 4C02B 4ZPTR 2PV3A 2XPAA 1T11A 4Q22A 2YBUA 2RQSA 1ITXA 1P5QA 1FKJA 3H9RB 3WD3A 4KQZA 1TCOC 4TNSA 1EQ3A 1JCHB 3CH9A 2A3EA 1U79A 3IK8A 2AWGA 4WKAA 4JYSA 3PA7A 1LG1A 1EYMA 1GPFA 1NWTA 3CGNA 1FKGA 4DWSC 4DIPA 1E15A 3B7XA 2Y78A 3G6MA 4BF8A 2FAPA 2KR7A 4JFMA 3W4RA 4U85A 1QPFA 2PBCA 3MDYB 1D2KA 3O5KA 5DITA 2MPHA 3CHCA 4G50A 1H0GA 4NSBA 1D7IA 1WAWA 1K9TA 1BKFA 4DRHA 1M5YA 1NWSA 1X6LA 3UI4A 3O5LA 1FKDA 2LPVA 3WKZA 2JZVA 2XP8A 4MGVA 1UR8A 3KAHA 4P8VA 3VAWA 2ZR6A 3PRBA 2A3AA 4GIVA 1QZ2A 3GTYX 3KAIA 1D7JA 4P8XA 1E6PA 1FKBA 4JFJA 4DT4A 2PPPA 1SYTA 1LL7A 3WL0A 2ESCA 3UI5A 3BXWA 1ZBWA 1SR0A 1GRJA 2F23A 1TFVA 2XP9A 3TCZA 2DT1A 1NH6A 1LL6A 3O5EA 4ZPWR 1D6OA 4JFKA 2KO7A 1HJXA 1OWQA 5GQBA 2WLZA 1ZU8A 1LQ0A 3IHZA 2IUZA 1FD9A 4P8UA 1EHNA 4J4OA 2PV1A 4LAYA 1BL4A 1FKTA 3CHFA 3PRDA 3ARZA 2G8ZA 5HWBA 5DIVA 3WD1A 3CHEA 1PINA 4N19A 2XP4A 1E6ZA 2N87A 1XHGA 2P4VA 3PR9A 1WB0A 4IQ2A 1VF8A 1FFQA 4ZPVR 2QF8A 1HKMA 4O2TA 2D9FA 1GOIA 1IX5A 2ZQTA 3NI6A 3B9EA 2LJ4A 4WKHA 4TW7A 1R9HA 1JNEA 1ZCNA 3QOKA 2ZQVA 1A7XA 1FKRA 1FKFA 4DRIA 2DT0A 5J6EA 2F21A 2DG9A 2A3CA 1JNSA 4ODOA 4J4NA 4DWSA 5DO2A 3ODKA 4IPXA 4LGXA 4U86A 2RSEA 3RM4A 2M1IA 4L72B 4TX0A 4NZCA 3O5PA 5DIUA 1HKIA 4Z2IA 4KR0B 1JNDA 2MLXA 4QT2A 3RM8A 5HUAA 4ZS6A 4ML4A 3RGCA 1ZL1A 2FDMA 3ARQA 1FFRA 3ARXA 4DWSD 4WJXA 1Q6HA 3OA5A 5HW8A 3WQVA 2LGOA 1O6IA 1HKKA 2B5UB 4DWSB 5D75A 1Y0OA 1Q6IA 3G6LA 1CTNA 1OGBA 1QPLA 3ARTA 5HTGA 2UZ5A 1L1PA 3B9DA 2L2SA 4LAXA 2VN1A 1ZBCA 4TW8A 5B8IC 3EIPA 3WD4A 1E9LA 4PTMA 2MLYA 3JXVA 4ODMA 1W9VA 2K8IA 1ZB5A 3ARVA 4MPKA 2XP6A 3NTPA 4NNRA 1W1PA 1YW5A 4W9OA 4DZ3A 4JFIA 4W9PA 1NMVA 1GUVA 4W5UA 3B9AA 1Q1CA 4DRMA 5JH8A 2DT3A 5HWCA 5HW6A 3O5QA 3KAGA 1HKJA 3CZ8A 2G41A 2PV2A 4ODQA 4ODNA 4FAPA 4G2PA 3KCEA 2KE0A 5DF0A 1XRVA 1FKLA 2OFNA 3GPKA 4WIWA 4DROA 1W9PA 1OGGA 3CGMA 1F40A 4UDMA 2ZR5A 2KFWA 3FAPA 3O5DA 3AS0A 3KABA 1W1TA 4R5EA 2DSWA 1J4HA 4WKFA 3ARYA 3WD0A 1W1YA 5HBFA 4HARA 1KFWA 3WIJA 3AROA
chains in the Genus database with same CATH topology
3ALGA 1KT1A 1UR9A 2PPNA 3TDBA 4Z2JA 1E6RA 4ODKA 3KAFA 4LAVA 1ROTA 4U84A 4TW6A 1FJDA 3IKDA 4ODLA 2DPEA 4MAVA 4Z2GA 1EDQA 3UQIA 5I98A 3IKGA 3NRKA 1W9UA 2XP3A 3ARWA 4S3KA 4HBOA 3UQBA 3O5GA 4QT3A 2M2AA 4W9QA 4MNLA 3O5RA 4ITZA 4TYOA 2IF4A 3B8SA 4DRPA 1LG2A 2LKNA 4WK9A 2FKEA 3ARRA 1B6CA 1E6NA 4FN2A 4MSPA 4JFLA 3ARUA 2B31A 3KZ7A 4DRNA 1X6NA 1YATA 1C9HA 4DRJA 1Q6UA 1HJVA 4XAKA 4DRKA 2OLHA 2MNTA 3LUOA 2DG4A 1F8AB 2WM0A 4Z2LA 2RUDA 2XP7A 4IQCA 3JYJA 3WQWA 1FKHA 1W1VA 3UI6A 4QZVB 1HJWA 2F2DA 2ITKA 4ODPA 1NSGA 2DSVA 5HKGA 2DT2A 2KI3A 1W26A 2MF9A 1LL4A 1KT0A 1JVWA 3FY1A 4Z2HA 2XPBA 4DZ2A 3KACA 1J6YA 3O5OA 1JNTA 2DSUA 3UQAA 3OOBA 2WK2A 2A3BA 3EY6A 4IT6A 3AS2A 3WH0A 4MNKA 2ZQSA 4R0XA 1LJYA 1ZK6A 4HBEA 1J4IA 2F4EA 2O9OA 1N1AA 3FXYA 4MNMA 2MLZA 3JYMA 3UF8A 1HXVA 1FKSA 4URIA 1RD6A 2RUQA 3I6CA 3ARPA 3KADA 5DEZA 3O5MA 2O92A 4Q7NA 1NMWA 4GGQA 3TC5A 2RURA 4DRQA 3O5IA 2M08A 3O5JA 1ZBKA 2PPOA 3AS3A 2YBTA 1FKIA 1ROUA 2VCDA 1NWUA 4QIBA 4MNJA 1D7HA 3RM9A 1EIBA 3AS1A 4ODRA 2Q5AA 2AOSA 2WLYA 3WD2A 3PRAA 5HW7A 4L3NA 3RMEA 5BXJA 2RUCA 4P8WA 3WL1A 3ALFA 1J4RA 1PBKA 1NWRA 3ARSA 4DH0A 5GPRA 4AY1A 1H0IA 2ZR4A 1FKKA 1FAPA 2DSZA 4Z2KA 4S3JA 5HT1A 1WNOA 2KGJA 3AQUA 2DG3A 4IT4A 2ZQUA 1ZBVA 4MTVA 2PI6A 3CHDA 3RFWA 2XP5A 5GPGA 4LAWA 3O5FA 4C02B 4ZPTR 2PV3A 2XPAA 1T11A 4Q22A 2YBUA 2RQSA 1ITXA 1P5QA 1FKJA 3H9RB 3WD3A 4KQZA 1TCOC 4TNSA 1EQ3A 3CH9A 2A3EA 1U79A 3IK8A 2AWGA 4WKAA 4JYSA 3PA7A 1LG1A 1EYMA 1GPFA 1NWTA 3CGNA 1FKGA 4DWSC 4DIPA 1E15A 3B7XA 2Y78A 3G6MA 4BF8A 2FAPA 2KR7A 4JFMA 3W4RA 4U85A 1QPFA 2PBCA 3MDYB 1D2KA 3O5KA 5DITA 2MPHA 3CHCA 4G50A 1H0GA 4NSBA 1D7IA 1WAWA 1K9TA 1BKFA 4DRHA 1M5YA 1NWSA 1X6LA 3UI4A 3O5LA 1FKDA 2LPVA 3WKZA 2JZVA 2XP8A 4MGVA 1UR8A 3KAHA 4P8VA 3VAWA 2ZR6A 3PRBA 2A3AA 4GIVA 1QZ2A 3KAIA 1D7JA 4P8XA 1E6PA 1FKBA 4JFJA 4DT4A 2PPPA 1SYTA 1LL7A 3WL0A 2ESCA 3UI5A 3BXWA 1ZBWA 1SR0A 1TFVA 2XP9A 3TCZA 2DT1A 1NH6A 1LL6A 3O5EA 4ZPWR 1D6OA 4JFKA 2KO7A 1HJXA 1OWQA 5GQBA 2WLZA 1ZU8A 1LQ0A 3IHZA 2IUZA 1FD9A 4P8UA 1EHNA 4J4OA 2PV1A 4LAYA 1BL4A 1FKTA 3CHFA 3PRDA 3ARZA 2G8ZA 5HWBA 5DIVA 3WD1A 3CHEA 1PINA 4N19A 2XP4A 1E6ZA 2N87A 1XHGA 3PR9A 1WB0A 4IQ2A 1VF8A 1FFQA 4ZPVR 2QF8A 1HKMA 4O2TA 2D9FA 1GOIA 1IX5A 2ZQTA 3NI6A 3B9EA 2LJ4A 4WKHA 4TW7A 1R9HA 1JNEA 1ZCNA 3QOKA 2ZQVA 1A7XA 1FKRA 1FKFA 4DRIA 2DT0A 5J6EA 2F21A 2DG9A 2A3CA 1JNSA 4ODOA 4J4NA 4DWSA 5DO2A 3ODKA 4IPXA 4LGXA 4U86A 2RSEA 3RM4A 2M1IA 4L72B 4TX0A 4NZCA 3O5PA 5DIUA 1HKIA 4Z2IA 4KR0B 1JNDA 2MLXA 4QT2A 3RM8A 5HUAA 4ZS6A 4ML4A 3RGCA 1ZL1A 2FDMA 3ARQA 1FFRA 3ARXA 4DWSD 4WJXA 1Q6HA 3OA5A 5HW8A 3WQVA 2LGOA 1O6IA 1HKKA 4DWSB 5D75A 1Y0OA 1Q6IA 3G6LA 1CTNA 1OGBA 1QPLA 3ARTA 5HTGA 2UZ5A 1L1PA 3B9DA 2L2SA 4LAXA 2VN1A 1ZBCA 4TW8A 5B8IC 3WD4A 1E9LA 4PTMA 2MLYA 3JXVA 4ODMA 1W9VA 2K8IA 1ZB5A 3ARVA 4MPKA 2XP6A 3NTPA 4NNRA 1W1PA 1YW5A 4W9OA 4DZ3A 4JFIA 4W9PA 1NMVA 1GUVA 4W5UA 3B9AA 1Q1CA 4DRMA 5JH8A 2DT3A 5HWCA 5HW6A 3O5QA 3KAGA 1HKJA 3CZ8A 2G41A 2PV2A 4ODQA 4ODNA 4FAPA 4G2PA 3KCEA 2KE0A 5DF0A 1XRVA 1FKLA 2OFNA 3GPKA 4WIWA 4DROA 1W9PA 1OGGA 3CGMA 1F40A 2ZR5A 2KFWA 3FAPA 3O5DA 3AS0A 3KABA 1W1TA 4R5EA 2DSWA 1J4HA 4WKFA 3ARYA 3WD0A 1W1YA 5HBFA 4HARA 1KFWA 3WIJA 3AROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG9 A;  3B7X A;  1JNS A;  2MLZ A;  2Y78 A;  1KT1 A;  3JYM A;  4J4N A;  4ODO A;  3UF8 A;  2PPN A;  4BF8 A;  2FAP A;  2KR7 A;  1HXV A;  3ODK A;  4JFM A;  4IPX A;  4U86 A;  4U85 A;  2RSE A;  1FKS A;  1QPF A;  2PBC A;  3MDY B;  2M1I A;  4TX0 A;  3O5K A;  5DIT A;  2RUQ A;  3O5P A;  3I6C A;  4ODK A;  2MPH A;  3KAF A;  4LAV A;  5DIU A;  3TDB A;  1ROT A;  4U84 A;  3KAD A;  4QT2 A;  3O5M A;  2MLX A;  4G50 A;  4TW6 A;  5HUA A;  1FJD A;  1D7I A;  3IKD A;  4ODL A;  1BKF A;  1NMW A;  4GGQ A;  3RGC A;  3TC5 A;  1M5Y A;  2RUR A;  4DRH A;  4DRQ A;  3O5I A;  3UQI A;  5I98 A;  3IKG A;  3UI4 A;  3NRK A;  3O5L A;  2M08 A;  3O5J A;  1FKD A;  2XP3 A;  2PPO A;  2LPV A;  1Q6H A;  2JZV A;  3UQB A;  1FKI A;  2XP8 A;  4MGV A;  3O5G A;  4QT3 A;  1ROU A;  2M2A A;  2VCD A;  3KAH A;  4W9Q A;  5HW8 A;  4QIB A;  3O5R A;  4ITZ A;  2ZR6 A;  4TYO A;  2LGO A;  2IF4 A;  3VAW A;  1D7H A;  3PRB A;  4ODR A;  4GIV A;  2LKN A;  4DRP A;  1QZ2 A;  3KAI A;  1D7J A;  2Q5A A;  2FKE A;  5D75 A;  1Y0O A;  1B6C A;  1FKB A;  1Q6I A;  5HW7 A;  4JFJ A;  4FN2 A;  4MSP A;  5BXJ A;  2RUC A;  4JFL A;  4DT4 A;  1QPL A;  2PPP A;  1J4R A;  3KZ7 A;  4DRN A;  3UI5 A;  1YAT A;  5HTG A;  1C9H A;  2UZ5 A;  4DRJ A;  1PBK A;  1L1P A;  2XP9 A;  3TCZ A;  2L2S A;  1Q6U A;  4LAX A;  2VN1 A;  4TW8 A;  3O5E A;  4DRK A;  5B8I C;  4DH0 A;  2MNT A;  3LUO A;  1D6O A;  2DG4 A;  2ZR4 A;  4JFK A;  2MLY A;  2KO7 A;  1FKK A;  1FAP A;  3JXV A;  2K8I A;  4ODM A;  1F8A B;  5HT1 A;  2RUD A;  2XP6 A;  3NTP A;  4NNR A;  2XP7 A;  4IQC A;  1YW5 A;  3JYJ A;  4W9O A;  4DZ3 A;  2KGJ A;  2DG3 A;  3IHZ A;  2ZQU A;  4JFI A;  1FKH A;  1FD9 A;  4W9P A;  3UI6 A;  1NMV A;  2ITK A;  2F2D A;  4J4O A;  2PV1 A;  3RFW A;  4LAY A;  4DRM A;  1Q1C A;  4ODP A;  1NSG A;  2XP5 A;  5HKG A;  1BL4 A;  1FKT A;  3PRD A;  5GPG A;  5HWC A;  4LAW A;  2KI3 A;  3O5F A;  1W26 A;  2MF9 A;  5DIV A;  3O5Q A;  4C02 B;  3KAG A;  5HW6 A;  2PV3 A;  1KT0 A;  1PIN A;  2PV2 A;  2XPA A;  4ODQ A;  1T11 A;  4N19 A;  2XP4 A;  1JVW A;  2N87 A;  4ODN A;  2XPB A;  4FAP A;  4G2P A;  3KCE A;  2KE0 A;  2RQS A;  1FKL A;  1P5Q A;  1FKJ A;  2OFN A;  3GPK A;  4IQ2 A;  4DRO A;  3CGM A;  4DZ2 A;  1F40 A;  3KAC A;  1J6Y A;  3O5O A;  3H9R B;  4O2T A;  2ZR5 A;  1TCO C;  2D9F A;  1JNT A;  4TNS A;  1EQ3 A;  2ZQT A;  2KFW A;  3NI6 A;  3OOB A;  3UQA A;  2LJ4 A;  3FAP A;  3O5D A;  1U79 A;  3EY6 A;  3KAB A;  3IK8 A;  4TW7 A;  2AWG A;  1R9H A;  1ZCN A;  3WH0 A;  1J4H A;  2ZQS A;  4R0X A;  4JYS A;  2ZQV A;  1A7X A;  1FKR A;  3PA7 A;  5HWB A;  1FKF A;  1ZK6 A;  4DRI A;  1EYM A;  1J4I A;  3CGN A;  1FKG A;  2F4E A;  5J6E A;  2F21 A;  4DIP A;  1N1A A; 
#chains in the Genus database with same CATH topology
 3ALG A;  1KT1 A;  1UR9 A;  2PPN A;  3TDB A;  4Z2J A;  1E6R A;  4ODK A;  3KAF A;  4LAV A;  1ROT A;  4U84 A;  4TW6 A;  1FJD A;  3IKD A;  4ODL A;  2DPE A;  4MAV A;  4Z2G A;  2ETN A;  1EDQ A;  3UQI A;  5I98 A;  3IKG A;  3NRK A;  1W9U A;  2XP3 A;  3ARW A;  4S3K A;  4HBO A;  3UQB A;  3O5G A;  4QT3 A;  2M2A A;  4W9Q A;  4MNL A;  3O5R A;  4ITZ A;  4TYO A;  2IF4 A;  3B8S A;  4DRP A;  1LG2 A;  2LKN A;  4WK9 A;  2FKE A;  3ARR A;  1B6C A;  1E6N A;  4FN2 A;  4MSP A;  4JFL A;  3ARU A;  2B31 A;  3KZ7 A;  4DRN A;  1X6N A;  1YAT A;  1C9H A;  4DRJ A;  3BMB A;  1Q6U A;  1HJV A;  4XAK A;  4DRK A;  2OLH A;  2MNT A;  3LUO A;  2DG4 A;  1F8A B;  2WM0 A;  4Z2L A;  2RUD A;  2XP7 A;  4IQC A;  3JYJ A;  3WQW A;  1FKH A;  1W1V A;  3UI6 A;  4QZV B;  1HJW A;  2F2D A;  2ITK A;  4ODP A;  1NSG A;  2DSV A;  5HKG A;  2DT2 A;  2KI3 A;  1W26 A;  2MF9 A;  3GU0 A;  1LL4 A;  1KT0 A;  1JVW A;  3FY1 A;  4Z2H A;  2XPB A;  4DZ2 A;  3KAC A;  1J6Y A;  3O5O A;  1JNT A;  2DSU A;  3UQA A;  3OOB A;  2WK2 A;  2A3B A;  3EY6 A;  4IT6 A;  3AS2 A;  3WH0 A;  4MNK A;  2ZQS A;  4R0X A;  1LJY A;  1ZK6 A;  4HBE A;  1J4I A;  2F4E A;  2O9O A;  1N1A A;  3FXY A;  4MNM A;  2MLZ A;  3JYM A;  3UF8 A;  1HXV A;  1FKS A;  4URI A;  1RD6 A;  2RUQ A;  3I6C A;  3ARP A;  2EUL A;  2PN0 A;  3KAD A;  3O5M A;  5DEZ A;  2O92 A;  4Q7N A;  1NMW A;  4GGQ A;  3TC5 A;  2RUR A;  4DRQ A;  3O5I A;  2M08 A;  3O5J A;  1ZBK A;  2PPO A;  3AS3 A;  2YBT A;  1FKI A;  1ROU A;  2VCD A;  1NWU A;  4QIB A;  4MNJ A;  1D7H A;  3RM9 A;  1EIB A;  3AS1 A;  4ODR A;  2Q5A A;  2AOS A;  2WLY A;  3WD2 A;  3PRA A;  5HW7 A;  4L3N A;  3RME A;  5BXJ A;  2RUC A;  4P8W A;  3WL1 A;  3ALF A;  1J4R A;  1E44 A;  1PBK A;  1NWR A;  3ARS A;  4DH0 A;  5GPR A;  4AY1 A;  1H0I A;  2ZR4 A;  1FKK A;  1FAP A;  2DSZ A;  4Z2K A;  4S3J A;  5HT1 A;  1WNO A;  2KGJ A;  3AQU A;  2DG3 A;  4IT4 A;  2ZQU A;  1ZBV A;  4MTV A;  2PI6 A;  3CHD A;  3RFW A;  2XP5 A;  5GPG A;  4LAW A;  3O5F A;  4C02 B;  4ZPT R;  2PV3 A;  2XPA A;  1T11 A;  4Q22 A;  2YBU A;  2RQS A;  1ITX A;  1P5Q A;  1FKJ A;  3H9R B;  3WD3 A;  4KQZ A;  1TCO C;  4TNS A;  1EQ3 A;  1JCH B;  3CH9 A;  2A3E A;  1U79 A;  3IK8 A;  2AWG A;  4WKA A;  4JYS A;  3PA7 A;  1LG1 A;  1EYM A;  1GPF A;  1NWT A;  3CGN A;  1FKG A;  4DWS C;  4DIP A;  1E15 A;  3B7X A;  2Y78 A;  3G6M A;  4BF8 A;  2FAP A;  2KR7 A;  4JFM A;  3W4R A;  4U85 A;  1QPF A;  2PBC A;  3MDY B;  1D2K A;  3O5K A;  5DIT A;  2MPH A;  3CHC A;  4G50 A;  1H0G A;  4NSB A;  1D7I A;  1WAW A;  1K9T A;  1BKF A;  4DRH A;  1M5Y A;  1NWS A;  1X6L A;  3UI4 A;  3O5L A;  1FKD A;  2LPV A;  3WKZ A;  2JZV A;  2XP8 A;  4MGV A;  1UR8 A;  3KAH A;  4P8V A;  3VAW A;  2ZR6 A;  3PRB A;  2A3A A;  4GIV A;  1QZ2 A;  3GTY X;  3KAI A;  1D7J A;  4P8X A;  1E6P A;  1FKB A;  4JFJ A;  4DT4 A;  2PPP A;  1SYT A;  1LL7 A;  3WL0 A;  2ESC A;  3UI5 A;  3BXW A;  1ZBW A;  1SR0 A;  1GRJ A;  2F23 A;  1TFV A;  2XP9 A;  3TCZ A;  2DT1 A;  1NH6 A;  1LL6 A;  3O5E A;  4ZPW R;  1D6O A;  4JFK A;  2KO7 A;  1HJX A;  1OWQ A;  5GQB A;  2WLZ A;  1ZU8 A;  1LQ0 A;  3IHZ A;  2IUZ A;  1FD9 A;  4P8U A;  1EHN A;  4J4O A;  2PV1 A;  4LAY A;  1BL4 A;  1FKT A;  3CHF A;  3PRD A;  3ARZ A;  2G8Z A;  5HWB A;  5DIV A;  3WD1 A;  3CHE A;  1PIN A;  4N19 A;  2XP4 A;  1E6Z A;  2N87 A;  1XHG A;  2P4V A;  3PR9 A;  1WB0 A;  4IQ2 A;  1VF8 A;  1FFQ A;  4ZPV R;  2QF8 A;  1HKM A;  4O2T A;  2D9F A;  1GOI A;  1IX5 A;  2ZQT A;  3NI6 A;  3B9E A;  2LJ4 A;  4WKH A;  4TW7 A;  1R9H A;  1JNE A;  1ZCN A;  3QOK A;  2ZQV A;  1A7X A;  1FKR A;  1FKF A;  4DRI A;  2DT0 A;  5J6E A;  2F21 A;  2DG9 A;  2A3C A;  1JNS A;  4ODO A;  4J4N A;  4DWS A;  5DO2 A;  3ODK A;  4IPX A;  4LGX A;  4U86 A;  2RSE A;  3RM4 A;  2M1I A;  4L72 B;  4TX0 A;  4NZC A;  3O5P A;  5DIU A;  1HKI A;  4Z2I A;  4KR0 B;  1JND A;  2MLX A;  4QT2 A;  3RM8 A;  5HUA A;  4ZS6 A;  4ML4 A;  3RGC A;  1ZL1 A;  2FDM A;  3ARQ A;  1FFR A;  3ARX A;  4DWS D;  4WJX A;  1Q6H A;  3OA5 A;  5HW8 A;  3WQV A;  2LGO A;  1O6I A;  1HKK A;  2B5U B;  4DWS B;  5D75 A;  1Y0O A;  1Q6I A;  3G6L A;  1CTN A;  1OGB A;  1QPL A;  3ART A;  5HTG A;  2UZ5 A;  1L1P A;  3B9D A;  2L2S A;  4LAX A;  2VN1 A;  1ZBC A;  4TW8 A;  5B8I C;  3EIP A;  3WD4 A;  1E9L A;  4PTM A;  2MLY A;  3JXV A;  4ODM A;  1W9V A;  2K8I A;  1ZB5 A;  3ARV A;  4MPK A;  2XP6 A;  3NTP A;  4NNR A;  1W1P A;  1YW5 A;  4W9O A;  4DZ3 A;  4JFI A;  4W9P A;  1NMV A;  1GUV A;  4W5U A;  3B9A A;  1Q1C A;  4DRM A;  5JH8 A;  2DT3 A;  5HWC A;  5HW6 A;  3O5Q A;  3KAG A;  1HKJ A;  3CZ8 A;  2G41 A;  2PV2 A;  4ODQ A;  4ODN A;  4FAP A;  4G2P A;  3KCE A;  2KE0 A;  5DF0 A;  1XRV A;  1FKL A;  2OFN A;  3GPK A;  4WIW A;  4DRO A;  1W9P A;  1OGG A;  3CGM A;  1F40 A;  4UDM A;  2ZR5 A;  2KFW A;  3FAP A;  3O5D A;  3AS0 A;  3KAB A;  1W1T A;  4R5E A;  2DSW A;  1J4H A;  4WKF A;  3ARY A;  3WD0 A;  1W1Y A;  5HBF A;  4HAR A;  1KFW A;  3WIJ A;  3ARO A; 
#chains in the Genus database with same CATH homology
 3ALG A;  1KT1 A;  1UR9 A;  2PPN A;  3TDB A;  4Z2J A;  1E6R A;  4ODK A;  3KAF A;  4LAV A;  1ROT A;  4U84 A;  4TW6 A;  1FJD A;  3IKD A;  4ODL A;  2DPE A;  4MAV A;  4Z2G A;  1EDQ A;  3UQI A;  5I98 A;  3IKG A;  3NRK A;  1W9U A;  2XP3 A;  3ARW A;  4S3K A;  4HBO A;  3UQB A;  3O5G A;  4QT3 A;  2M2A A;  4W9Q A;  4MNL A;  3O5R A;  4ITZ A;  4TYO A;  2IF4 A;  3B8S A;  4DRP A;  1LG2 A;  2LKN A;  4WK9 A;  2FKE A;  3ARR A;  1B6C A;  1E6N A;  4FN2 A;  4MSP A;  4JFL A;  3ARU A;  2B31 A;  3KZ7 A;  4DRN A;  1X6N A;  1YAT A;  1C9H A;  4DRJ A;  1Q6U A;  1HJV A;  4XAK A;  4DRK A;  2OLH A;  2MNT A;  3LUO A;  2DG4 A;  1F8A B;  2WM0 A;  4Z2L A;  2RUD A;  2XP7 A;  4IQC A;  3JYJ A;  3WQW A;  1FKH A;  1W1V A;  3UI6 A;  4QZV B;  1HJW A;  2F2D A;  2ITK A;  4ODP A;  1NSG A;  2DSV A;  5HKG A;  2DT2 A;  2KI3 A;  1W26 A;  2MF9 A;  1LL4 A;  1KT0 A;  1JVW A;  3FY1 A;  4Z2H A;  2XPB A;  4DZ2 A;  3KAC A;  1J6Y A;  3O5O A;  1JNT A;  2DSU A;  3UQA A;  3OOB A;  2WK2 A;  2A3B A;  3EY6 A;  4IT6 A;  3AS2 A;  3WH0 A;  4MNK A;  2ZQS A;  4R0X A;  1LJY A;  1ZK6 A;  4HBE A;  1J4I A;  2F4E A;  2O9O A;  1N1A A;  3FXY A;  4MNM A;  2MLZ A;  3JYM A;  3UF8 A;  1HXV A;  1FKS A;  4URI A;  1RD6 A;  2RUQ A;  3I6C A;  3ARP A;  3KAD A;  5DEZ A;  3O5M A;  2O92 A;  4Q7N A;  1NMW A;  4GGQ A;  3TC5 A;  2RUR A;  4DRQ A;  3O5I A;  2M08 A;  3O5J A;  1ZBK A;  2PPO A;  3AS3 A;  2YBT A;  1FKI A;  1ROU A;  2VCD A;  1NWU A;  4QIB A;  4MNJ A;  1D7H A;  3RM9 A;  1EIB A;  3AS1 A;  4ODR A;  2Q5A A;  2AOS A;  2WLY A;  3WD2 A;  3PRA A;  5HW7 A;  4L3N A;  3RME A;  5BXJ A;  2RUC A;  4P8W A;  3WL1 A;  3ALF A;  1J4R A;  1PBK A;  1NWR A;  3ARS A;  4DH0 A;  5GPR A;  4AY1 A;  1H0I A;  2ZR4 A;  1FKK A;  1FAP A;  2DSZ A;  4Z2K A;  4S3J A;  5HT1 A;  1WNO A;  2KGJ A;  3AQU A;  2DG3 A;  4IT4 A;  2ZQU A;  1ZBV A;  4MTV A;  2PI6 A;  3CHD A;  3RFW A;  2XP5 A;  5GPG A;  4LAW A;  3O5F A;  4C02 B;  4ZPT R;  2PV3 A;  2XPA A;  1T11 A;  4Q22 A;  2YBU A;  2RQS A;  1ITX A;  1P5Q A;  1FKJ A;  3H9R B;  3WD3 A;  4KQZ A;  1TCO C;  4TNS A;  1EQ3 A;  3CH9 A;  2A3E A;  1U79 A;  3IK8 A;  2AWG A;  4WKA A;  4JYS A;  3PA7 A;  1LG1 A;  1EYM A;  1GPF A;  1NWT A;  3CGN A;  1FKG A;  4DWS C;  4DIP A;  1E15 A;  3B7X A;  2Y78 A;  3G6M A;  4BF8 A;  2FAP A;  2KR7 A;  4JFM A;  3W4R A;  4U85 A;  1QPF A;  2PBC A;  3MDY B;  1D2K A;  3O5K A;  5DIT A;  2MPH A;  3CHC A;  4G50 A;  1H0G A;  4NSB A;  1D7I A;  1WAW A;  1K9T A;  1BKF A;  4DRH A;  1M5Y A;  1NWS A;  1X6L A;  3UI4 A;  3O5L A;  1FKD A;  2LPV A;  3WKZ A;  2JZV A;  2XP8 A;  4MGV A;  1UR8 A;  3KAH A;  4P8V A;  3VAW A;  2ZR6 A;  3PRB A;  2A3A A;  4GIV A;  1QZ2 A;  3KAI A;  1D7J A;  4P8X A;  1E6P A;  1FKB A;  4JFJ A;  4DT4 A;  2PPP A;  1SYT A;  1LL7 A;  3WL0 A;  2ESC A;  3UI5 A;  3BXW A;  1ZBW A;  1SR0 A;  1TFV A;  2XP9 A;  3TCZ A;  2DT1 A;  1NH6 A;  1LL6 A;  3O5E A;  4ZPW R;  1D6O A;  4JFK A;  2KO7 A;  1HJX A;  1OWQ A;  5GQB A;  2WLZ A;  1ZU8 A;  1LQ0 A;  3IHZ A;  2IUZ A;  1FD9 A;  4P8U A;  1EHN A;  4J4O A;  2PV1 A;  4LAY A;  1BL4 A;  1FKT A;  3CHF A;  3PRD A;  3ARZ A;  2G8Z A;  5HWB A;  5DIV A;  3WD1 A;  3CHE A;  1PIN A;  4N19 A;  2XP4 A;  1E6Z A;  2N87 A;  1XHG A;  3PR9 A;  1WB0 A;  4IQ2 A;  1VF8 A;  1FFQ A;  4ZPV R;  2QF8 A;  1HKM A;  4O2T A;  2D9F A;  1GOI A;  1IX5 A;  2ZQT A;  3NI6 A;  3B9E A;  2LJ4 A;  4WKH A;  4TW7 A;  1R9H A;  1JNE A;  1ZCN A;  3QOK A;  2ZQV A;  1A7X A;  1FKR A;  1FKF A;  4DRI A;  2DT0 A;  5J6E A;  2F21 A;  2DG9 A;  2A3C A;  1JNS A;  4ODO A;  4J4N A;  4DWS A;  5DO2 A;  3ODK A;  4IPX A;  4LGX A;  4U86 A;  2RSE A;  3RM4 A;  2M1I A;  4L72 B;  4TX0 A;  4NZC A;  3O5P A;  5DIU A;  1HKI A;  4Z2I A;  4KR0 B;  1JND A;  2MLX A;  4QT2 A;  3RM8 A;  5HUA A;  4ZS6 A;  4ML4 A;  3RGC A;  1ZL1 A;  2FDM A;  3ARQ A;  1FFR A;  3ARX A;  4DWS D;  4WJX A;  1Q6H A;  3OA5 A;  5HW8 A;  3WQV A;  2LGO A;  1O6I A;  1HKK A;  4DWS B;  5D75 A;  1Y0O A;  1Q6I A;  3G6L A;  1CTN A;  1OGB A;  1QPL A;  3ART A;  5HTG A;  2UZ5 A;  1L1P A;  3B9D A;  2L2S A;  4LAX A;  2VN1 A;  1ZBC A;  4TW8 A;  5B8I C;  3WD4 A;  1E9L A;  4PTM A;  2MLY A;  3JXV A;  4ODM A;  1W9V A;  2K8I A;  1ZB5 A;  3ARV A;  4MPK A;  2XP6 A;  3NTP A;  4NNR A;  1W1P A;  1YW5 A;  4W9O A;  4DZ3 A;  4JFI A;  4W9P A;  1NMV A;  1GUV A;  4W5U A;  3B9A A;  1Q1C A;  4DRM A;  5JH8 A;  2DT3 A;  5HWC A;  5HW6 A;  3O5Q A;  3KAG A;  1HKJ A;  3CZ8 A;  2G41 A;  2PV2 A;  4ODQ A;  4ODN A;  4FAP A;  4G2P A;  3KCE A;  2KE0 A;  5DF0 A;  1XRV A;  1FKL A;  2OFN A;  3GPK A;  4WIW A;  4DRO A;  1W9P A;  1OGG A;  3CGM A;  1F40 A;  2ZR5 A;  2KFW A;  3FAP A;  3O5D A;  3AS0 A;  3KAB A;  1W1T A;  4R5E A;  2DSW A;  1J4H A;  4WKF A;  3ARY A;  3WD0 A;  1W1Y A;  5HBF A;  4HAR A;  1KFW A;  3WIJ A;  3ARO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...