1QPLA

Fk506 binding protein (12 kda, human) complex with l-707,587
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FK506-BINDING PROTEIN)
publication title 32-Indolyl ether derivatives of ascomycin: three-dimensional structures of complexes with FK506-binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 21
structure length 107
sequence length 107
chains with identical sequence C
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1qplA00
1FKFA 1F8AB 1Q6HA 3KAHA 5DIVA 4DRJA 1EYMA 5BXJA 1KT1A 2N87A 3GPKA 4O2TA 4ITZA 1D7IA 2M08A 3KADA 4JFMA 5HW7A 2VCDA 5HWBA 2RUDA 1F40A 3PA7A 3H9RB 2PBCA 2LKNA 2RSEA 4GGQA 3UI6A 3O5DA 2FAPA 1J4HA 2ZQSA 4U84A 5HW6A 2OFNA 2PV1A 5DIUA 4W9PA 1JNSA 5J6EA 1ZK6A 5HWCA 4IQCA 4JFIA 1D6OA 2XP3A 3JXVA 3O5IA 3RGCA 4U85A 2Y78A 2K8IA 1FKRA 5HT1A 4ODLA 2LGOA 3UQIA 3UQAA 1FKIA 4ODNA 1FD9A 1JNTA 1FKJA 4ODMA 2MLYA 1YW5A 3OOBA 1NMWA 3WH0A 4JFJA 3LUOA 2KE0A 4TW8A 4R0XA 4ODQA 4DRQA 1B6CA 1FKHA 3TCZA 2XP8A 3B7XA 1BKFA 3RFWA 3IK8A 3O5OA 4G50A 2KFWA 4TW7A 2KO7A 2XP4A 2RQSA 5B8IC 3O5EA 2PV3A 2MLZA 4MGVA 1A7XA 2RURA 2XPBA 1FKLA 2F4EA 1W26A 4DZ2A 2ZR6A 1FKDA 4ODOA 3O5KA 4G2PA 4MSPA 2MF9A 4FN2A 2VN1A 2DG3A 4GIVA 4QT2A 2ZR4A 1D7JA 2UZ5A 3NI6A 1YATA 1Q1CA 4DIPA 4ODKA 5HW8A 1J6YA 2ZQTA 3JYMA 2MLXA 3PRBA 4TX0A 1R9HA 3UF8A 5HKGA 3O5JA 1D7HA 2XP7A 4TW6A 1FAPA 1ZCNA 1QPLA 2Q5AA 1FKGA 3CGNA 2MPHA 1U79A 3KABA 1P5QA 2M2AA 2ZR5A 3TDBA 2PV2A 3CGMA 4LAYA 1QZ2A 1L1PA 2PPOA 4U86A 1TCOC 2JZVA 5I98A 3IHZA 3O5LA 4TYOA 3O5PA 5D75A 1M5YA 1ROUA 1HXVA 4QT3A 2PPPA 1Y0OA 2PPNA 4IQ2A 1ROTA 3KACA 3O5RA 4TNSA 1KT0A 3NTPA 1JVWA 2XP6A 2RUCA 2LJ4A 4JFKA 3UQBA 2MNTA 1BL4A 4JYSA 2AWGA 3KZ7A 3UI4A 4BF8A 3O5GA 1C9HA 1NSGA 4ODPA 4DRPA 3NRKA 4J4NA 4DRIA 4W9OA 3IKDA 1QPFA 3VAWA 4W9QA 4DZ3A 2XP9A 1J4RA 4N19A 2M1IA 5HTGA 4J4OA 2F2DA 3EY6A 3I6CA 1N1AA 2F21A 2KGJA 3JYJA 4DRHA 2D9FA 3KAGA 4ODRA 2DG9A 2XPAA 1PBKA 1EQ3A 1Q6UA 3IKGA 3KAFA 3ODKA 4DROA 1J4IA 1FKSA 1T11A 1Q6IA 4LAWA 4LAXA 4DRKA 3O5FA 1NMVA 3MDYB 1FJDA 3O5QA 5HUAA 3UI5A 2LPVA 3KAIA 4DRNA 2KI3A 2IF4A 4LAVA 4DRMA 1FKBA 5DITA 2KR7A 2ZQUA 4IPXA 3O5MA 1FKTA 2L2SA 4NNRA 4QIBA 4C02B 4DH0A 3FAPA 2XP5A 2RUQA 2ITKA 2ZQVA 4DT4A 2DG4A 4FAPA 3PRDA 4JFLA 3KCEA 5GPGA 3TC5A 2FKEA 1PINA 1FKKA
chains in the Genus database with same CATH superfamily
1FKFA 3G6MA 3AQUA 5DO2A 5BXJA 1HJWA 1D7IA 3CHEA 4JFMA 3PA7A 4URIA 4WKAA 2PV1A 3FY1A 2K8IA 3UQIA 1NWTA 1E15A 4P8VA 1FKJA 1YW5A 3OOBA 4P8UA 1NMWA 5HBFA 2A3CA 4DRQA 1BKFA 3RFWA 3QOKA 3IK8A 5B8IC 3RMEA 2XP4A 2QF8A 2RQSA 3CZ8A 3AS3A 1LG1A 2RURA 1FKLA 1H0GA 1W1VA 3B9EA 2ZR6A 4Z2HA 1SYTA 3O5KA 4G2PA 2MF9A 2A3AA 2PI6A 3CHCA 2DG3A 4GIVA 2UZ5A 1Q1CA 1J6YA 1HKIA 3CHDA 3UF8A 1ZBCA 2DSWA 1QPLA 3KABA 2ZR5A 4LAYA 1ITXA 2PPOA 3GU0A 2F23A 4Z2IA 4TYOA 1NWRA 5DF0A 5DEZA 4IQ2A 1ROTA 4R5EA 1X6NA 2LJ4A 4Q7NA 2AWGA 4MNKA 1NSGA 2DSUA 4J4NA 3WD3A 4W9OA 1HJXA 1QPFA 4DZ3A 1J4RA 4J4OA 1N1AA 3JYJA 4ZPTR 1W1YA 2B31A 2XPAA 4MNLA 3WD4A 3ODKA 1J4IA 1LG2A 1Q6IA 3O5FA 5HUAA 1W9VA 3UI5A 1ZU8A 1LL7A 4MPKA 4L3NA 2IF4A 4DWSC 5GQBA 3O5MA 4DH0A 4NNRA 2XP5A 2RUQA 4MAVA 4PTMA 4FAPA 3PRDA 1NWUA 4JFLA 1GUVA 3RM9A 4IT6A 2FKEA 2OLHA 1PINA 1FFQA 1Q6HA 2FDMA 2N87A 1TFVA 2PN0A 2M08A 1FFRA 3KADA 1F40A 3H9RB 2LKNA 2RSEA 1J4HA 3CHFA 2ZQSA 2DSZA 1E6ZA 5HW6A 3WL1A 1W1PA 2DT3A 1ZK6A 1KFWA 4IQCA 4MNMA 3O5IA 3RGCA 2Y78A 4ODLA 4ODNA 2O9OA 2O92A 3LUOA 2KE0A 4TW8A 4R0XA 1B6CA 4ZS6A 2KO7A 3FXYA 1LL4A 1RD6A 3BMBA 2XPBA 2F4EA 1ZB5A 4ODOA 4HBOA 1O6IA 2ETNA 3NI6A 4DIPA 2G41A 1EHNA 4TW6A 3ARXA 1FAPA 1FKGA 3WQVA 1L1PA 1QZ2A 3AROA 4U86A 1TCOC 1WNOA 2AOSA 4Z2LA 1M5YA 1XHGA 1HXVA 1UR9A 3PRAA 1Y0OA 4TNSA 4WK9A 1JVWA 2A3BA 2RUCA 4JFKA 1BL4A 1VF8A 3KZ7A 1K9TA 1X6LA 1C9HA 3O5GA 4ODPA 3RM4A 3NRKA 1JNDA 4N19A 5HTGA 3EY6A 4DRHA 2KGJA 2D9FA 2DG9A 1ZBVA 1Q6UA 4Z2KA 4DRKA 3MDYB 2LPVA 1E44A 1E6PA 4LAVA 2YBUA 2KR7A 1GPFA 1EIBA 1W9PA 4C02B 3FAPA 2ITKA 1WB0A 4ZPWR 1NWSA 1ZBWA 4Z2GA 1F8AB 5DIVA 3CH9A 4DRJA 2EULA 3AS0A 3BXWA 1EYMA 2DSVA 3GPKA 4ITZA 1OGGA 4Z2JA 5HW7A 2VCDA 2RUDA 2PBCA 4GGQA 3O5DA 2WM0A 1W1TA 3ARTA 1JNSA 1E9LA 3ARSA 3ARYA 1D6OA 3JXVA 3PR9A 3UQAA 1FKIA 1FD9A 2WLYA 2MLYA 3WH0A 3EIPA 3TCZA 1FKHA 3B7XA 3ARVA 1E6NA 5GPRA 1EDQA 2PV3A 4MGVA 4S3KA 2B5UB 1H0IA 4IT4A 1ZBKA 4WJXA 1LJYA 4MSPA 2VN1A 4NZCA 5HW8A 1D7JA 1YATA 3W4RA 1HKKA 4WIWA 3PRBA 5JH8A 1CTNA 4NSBA 1R9HA 5HKGA 3O5JA 2XP7A 3CGNA 2Q5AA 4QZVB 1U79A 1P5QA 2M2AA 3TDBA 2PV2A 3CGMA 2DT1A 4Q22A 3G6LA 2JZVA 4P8WA 3O5LA 4ML4A 1ROUA 4QT3A 2PPPA 1LQ0A 2PPNA 3KACA 3UQBA 1JNEA 2MNTA 4JYSA 1OWQA 3ARUA 3WQWA 3GTYX 4BF8A 4DRPA 3ARPA 4DRIA 3IKDA 4W9QA 2M1IA 4WKHA 2F2DA 3KAGA 4ODRA 1PBKA 3ALFA 3IKGA 4DROA 4LAWA 1FKSA 1T11A 4LAXA 3B9DA 3KAIA 4DRMA 1FKBA 5DITA 2G8ZA 4IPXA 4QIBA 2ZQVA 1UR8A 1GRJA 4MTVA 5GPGA 3WD1A 3WIJA 1FKKA 3KAHA 3B8SA 1ZL1A 2DPEA 1KT1A 3ARZA 4O2TA 1LL6A 1W9UA 4L72B 5HWBA 4W5UA 3UI6A 2FAPA 4U84A 2OFNA 2A3EA 5DIUA 4W9PA 1HKMA 5J6EA 1XRVA 3ARQA 2XP3A 4JFIA 1FKRA 4WKFA 4U85A 5HT1A 2LGOA 1JNTA 4ODMA 4AY1A 4JFJA 4DWSA 4ODQA 3WD0A 2XP8A 3O5OA 4G50A 2KFWA 4TW7A 3O5EA 2MLZA 1A7XA 1W26A 4DZ2A 1FKDA 4FN2A 1IX5A 4QT2A 2ZR4A 1GOIA 2YBTA 4ODKA 2ZQTA 2DT2A 3JYMA 2MLXA 4TX0A 1SR0A 2IUZA 1D7HA 1NH6A 1ZCNA 1OGBA 4S3JA 2MPHA 4KR0B 4HARA 3AS1A 2WLZA 2WK2A 3RM8A 2P4VA 3B9AA 3WL0A 4ZPVR 3IHZA 4KQZA 5I98A 4UDMA 3O5PA 4LGXA 4P8XA 5D75A 4XAKA 4DWSD 3ALGA 1D2KA 3WD2A 3O5RA 4MNJA 1KT0A 3NTPA 2XP6A 4DWSB 3UI4A 3WKZA 4HBEA 2DT0A 3VAWA 1JCHB 2XP9A 5HWCA 3I6CA 2F21A 3OA5A 1EQ3A 3KAFA 1NMVA 1FJDA 3O5QA 1HJVA 1HKJA 1WAWA 2KI3A 4DRNA 2ZQUA 3ARWA 2ESCA 1FKTA 2L2SA 4DT4A 1E6RA 2DG4A 3ARRA 3AS2A 3KCEA 3TC5A
chains in the Genus database with same CATH topology
1FKFA 3G6MA 3AQUA 5DO2A 5BXJA 1HJWA 1D7IA 3CHEA 4JFMA 3PA7A 4URIA 4WKAA 2PV1A 3FY1A 2K8IA 3UQIA 1NWTA 1E15A 4P8VA 1FKJA 1YW5A 3OOBA 4P8UA 1NMWA 5HBFA 2A3CA 4DRQA 1BKFA 3RFWA 3QOKA 3IK8A 5B8IC 3RMEA 2XP4A 2QF8A 2RQSA 3CZ8A 3AS3A 1LG1A 2RURA 1FKLA 1H0GA 1W1VA 3B9EA 2ZR6A 4Z2HA 1SYTA 3O5KA 4G2PA 2MF9A 2A3AA 2PI6A 3CHCA 2DG3A 4GIVA 2UZ5A 1Q1CA 1J6YA 1HKIA 3CHDA 3UF8A 1ZBCA 2DSWA 1QPLA 3KABA 2ZR5A 4LAYA 1ITXA 2PPOA 4Z2IA 4TYOA 1NWRA 5DF0A 5DEZA 4IQ2A 1ROTA 4R5EA 1X6NA 2LJ4A 4Q7NA 2AWGA 4MNKA 1NSGA 2DSUA 4J4NA 3WD3A 4W9OA 1HJXA 1QPFA 4DZ3A 1J4RA 4J4OA 1N1AA 3JYJA 4ZPTR 1W1YA 2B31A 2XPAA 4MNLA 3WD4A 3ODKA 1J4IA 1LG2A 1Q6IA 3O5FA 5HUAA 1W9VA 3UI5A 1ZU8A 1LL7A 4MPKA 4L3NA 2IF4A 4DWSC 5GQBA 3O5MA 4DH0A 4NNRA 2XP5A 2RUQA 4MAVA 4PTMA 4FAPA 3PRDA 1NWUA 4JFLA 1GUVA 3RM9A 4IT6A 2FKEA 2OLHA 1PINA 1FFQA 1Q6HA 2FDMA 2N87A 1TFVA 2M08A 1FFRA 3KADA 1F40A 3H9RB 2LKNA 2RSEA 1J4HA 3CHFA 2ZQSA 2DSZA 1E6ZA 5HW6A 3WL1A 1W1PA 2DT3A 1ZK6A 1KFWA 4IQCA 4MNMA 3O5IA 3RGCA 2Y78A 4ODLA 4ODNA 2O9OA 2O92A 3LUOA 2KE0A 4TW8A 4R0XA 1B6CA 4ZS6A 2KO7A 3FXYA 1LL4A 1RD6A 2XPBA 2F4EA 1ZB5A 4ODOA 4HBOA 1O6IA 3NI6A 4DIPA 2G41A 1EHNA 4TW6A 3ARXA 1FAPA 1FKGA 3WQVA 1L1PA 1QZ2A 3AROA 4U86A 1TCOC 1WNOA 2AOSA 4Z2LA 1M5YA 1XHGA 1HXVA 1UR9A 3PRAA 1Y0OA 4TNSA 4WK9A 1JVWA 2A3BA 2RUCA 4JFKA 1BL4A 1VF8A 3KZ7A 1K9TA 1X6LA 1C9HA 3O5GA 4ODPA 3RM4A 3NRKA 1JNDA 4N19A 5HTGA 3EY6A 4DRHA 2KGJA 2D9FA 2DG9A 1ZBVA 1Q6UA 4Z2KA 4DRKA 3MDYB 2LPVA 1E6PA 4LAVA 2YBUA 2KR7A 1GPFA 1EIBA 1W9PA 4C02B 3FAPA 2ITKA 1WB0A 4ZPWR 1NWSA 1ZBWA 4Z2GA 1F8AB 5DIVA 3CH9A 4DRJA 3AS0A 3BXWA 1EYMA 2DSVA 3GPKA 4ITZA 1OGGA 4Z2JA 5HW7A 2VCDA 2RUDA 2PBCA 4GGQA 3O5DA 2WM0A 1W1TA 3ARTA 1JNSA 1E9LA 3ARSA 3ARYA 1D6OA 3JXVA 3PR9A 3UQAA 1FKIA 1FD9A 2WLYA 2MLYA 3WH0A 3TCZA 1FKHA 3B7XA 3ARVA 1E6NA 5GPRA 1EDQA 2PV3A 4MGVA 4S3KA 1H0IA 4IT4A 1ZBKA 4WJXA 1LJYA 4MSPA 2VN1A 4NZCA 5HW8A 1D7JA 1YATA 3W4RA 1HKKA 4WIWA 3PRBA 5JH8A 1CTNA 4NSBA 1R9HA 5HKGA 3O5JA 2XP7A 3CGNA 2Q5AA 4QZVB 1U79A 1P5QA 2M2AA 3TDBA 2PV2A 3CGMA 2DT1A 4Q22A 3G6LA 2JZVA 4P8WA 3O5LA 4ML4A 1ROUA 4QT3A 2PPPA 1LQ0A 2PPNA 3KACA 3UQBA 1JNEA 2MNTA 4JYSA 1OWQA 3ARUA 3WQWA 4BF8A 4DRPA 3ARPA 4DRIA 3IKDA 4W9QA 2M1IA 4WKHA 2F2DA 3KAGA 4ODRA 1PBKA 3ALFA 3IKGA 4DROA 4LAWA 1FKSA 1T11A 4LAXA 3B9DA 3KAIA 4DRMA 1FKBA 5DITA 2G8ZA 4IPXA 4QIBA 2ZQVA 1UR8A 4MTVA 5GPGA 3WD1A 3WIJA 1FKKA 3KAHA 3B8SA 1ZL1A 2DPEA 1KT1A 3ARZA 4O2TA 1LL6A 1W9UA 4L72B 5HWBA 4W5UA 3UI6A 2FAPA 4U84A 2OFNA 2A3EA 5DIUA 4W9PA 1HKMA 5J6EA 1XRVA 3ARQA 2XP3A 4JFIA 1FKRA 4WKFA 4U85A 5HT1A 2LGOA 1JNTA 4ODMA 4AY1A 4JFJA 4DWSA 4ODQA 3WD0A 2XP8A 3O5OA 4G50A 2KFWA 4TW7A 3O5EA 2MLZA 1A7XA 1W26A 4DZ2A 1FKDA 4FN2A 1IX5A 4QT2A 2ZR4A 1GOIA 2YBTA 4ODKA 2ZQTA 2DT2A 3JYMA 2MLXA 4TX0A 1SR0A 2IUZA 1D7HA 1NH6A 1ZCNA 1OGBA 4S3JA 2MPHA 4KR0B 4HARA 3AS1A 2WLZA 2WK2A 3RM8A 3B9AA 3WL0A 4ZPVR 3IHZA 4KQZA 5I98A 5D75A 3O5PA 4LGXA 4P8XA 4XAKA 4DWSD 3ALGA 1D2KA 3WD2A 3O5RA 4MNJA 1KT0A 3NTPA 2XP6A 4DWSB 3UI4A 3WKZA 4HBEA 2DT0A 3VAWA 2XP9A 5HWCA 3I6CA 2F21A 3OA5A 1EQ3A 3KAFA 1NMVA 1FJDA 3O5QA 1HJVA 1HKJA 1WAWA 2KI3A 4DRNA 2ZQUA 3ARWA 2ESCA 1FKTA 2L2SA 4DT4A 1E6RA 2DG4A 3ARRA 3AS2A 3KCEA 3TC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKF A;  1F8A B;  1Q6H A;  3KAH A;  5DIV A;  4DRJ A;  1EYM A;  5BXJ A;  1KT1 A;  2N87 A;  3GPK A;  4O2T A;  4ITZ A;  1D7I A;  2M08 A;  3KAD A;  4JFM A;  5HW7 A;  2VCD A;  5HWB A;  2RUD A;  1F40 A;  3PA7 A;  3H9R B;  2PBC A;  2LKN A;  2RSE A;  4GGQ A;  3UI6 A;  3O5D A;  2FAP A;  1J4H A;  2ZQS A;  4U84 A;  5HW6 A;  2OFN A;  2PV1 A;  5DIU A;  4W9P A;  1JNS A;  5J6E A;  1ZK6 A;  5HWC A;  4IQC A;  4JFI A;  1D6O A;  2XP3 A;  3JXV A;  3O5I A;  3RGC A;  4U85 A;  2Y78 A;  2K8I A;  1FKR A;  5HT1 A;  4ODL A;  2LGO A;  3UQI A;  3UQA A;  1FKI A;  4ODN A;  1FD9 A;  1JNT A;  1FKJ A;  4ODM A;  2MLY A;  1YW5 A;  3OOB A;  1NMW A;  3WH0 A;  4JFJ A;  3LUO A;  2KE0 A;  4TW8 A;  4R0X A;  4ODQ A;  4DRQ A;  1B6C A;  1FKH A;  3TCZ A;  2XP8 A;  3B7X A;  1BKF A;  3RFW A;  3IK8 A;  3O5O A;  4G50 A;  2KFW A;  4TW7 A;  2KO7 A;  2XP4 A;  2RQS A;  5B8I C;  3O5E A;  2PV3 A;  2MLZ A;  4MGV A;  1A7X A;  2RUR A;  2XPB A;  1FKL A;  2F4E A;  1W26 A;  4DZ2 A;  2ZR6 A;  1FKD A;  4ODO A;  3O5K A;  4G2P A;  4MSP A;  2MF9 A;  4FN2 A;  2VN1 A;  2DG3 A;  4GIV A;  4QT2 A;  2ZR4 A;  1D7J A;  2UZ5 A;  3NI6 A;  1YAT A;  1Q1C A;  4DIP A;  4ODK A;  5HW8 A;  1J6Y A;  2ZQT A;  3JYM A;  2MLX A;  3PRB A;  4TX0 A;  1R9H A;  3UF8 A;  5HKG A;  3O5J A;  1D7H A;  2XP7 A;  4TW6 A;  1FAP A;  1ZCN A;  1QPL A;  2Q5A A;  1FKG A;  3CGN A;  2MPH A;  1U79 A;  3KAB A;  1P5Q A;  2M2A A;  2ZR5 A;  3TDB A;  2PV2 A;  3CGM A;  4LAY A;  1QZ2 A;  1L1P A;  2PPO A;  4U86 A;  1TCO C;  2JZV A;  5I98 A;  3IHZ A;  3O5L A;  4TYO A;  3O5P A;  5D75 A;  1M5Y A;  1ROU A;  1HXV A;  4QT3 A;  2PPP A;  1Y0O A;  2PPN A;  4IQ2 A;  1ROT A;  3KAC A;  3O5R A;  4TNS A;  1KT0 A;  3NTP A;  1JVW A;  2XP6 A;  2RUC A;  2LJ4 A;  4JFK A;  3UQB A;  2MNT A;  1BL4 A;  4JYS A;  2AWG A;  3KZ7 A;  3UI4 A;  4BF8 A;  3O5G A;  1C9H A;  1NSG A;  4ODP A;  4DRP A;  3NRK A;  4J4N A;  4DRI A;  4W9O A;  3IKD A;  1QPF A;  3VAW A;  4W9Q A;  4DZ3 A;  2XP9 A;  1J4R A;  4N19 A;  2M1I A;  5HTG A;  4J4O A;  2F2D A;  3EY6 A;  3I6C A;  1N1A A;  2F21 A;  2KGJ A;  3JYJ A;  4DRH A;  2D9F A;  3KAG A;  4ODR A;  2DG9 A;  2XPA A;  1PBK A;  1EQ3 A;  1Q6U A;  3IKG A;  3KAF A;  3ODK A;  4DRO A;  1J4I A;  1FKS A;  1T11 A;  1Q6I A;  4LAW A;  4LAX A;  4DRK A;  3O5F A;  1NMV A;  3MDY B;  1FJD A;  3O5Q A;  5HUA A;  3UI5 A;  2LPV A;  3KAI A;  4DRN A;  2KI3 A;  2IF4 A;  4LAV A;  4DRM A;  1FKB A;  5DIT A;  2KR7 A;  2ZQU A;  4IPX A;  3O5M A;  1FKT A;  2L2S A;  4NNR A;  4QIB A;  4C02 B;  4DH0 A;  3FAP A;  2XP5 A;  2RUQ A;  2ITK A;  2ZQV A;  4DT4 A;  2DG4 A;  4FAP A;  3PRD A;  4JFL A;  3KCE A;  5GPG A;  3TC5 A;  2FKE A;  1PIN A;  1FKK A; 
#chains in the Genus database with same CATH topology
 1FKF A;  3G6M A;  3AQU A;  5DO2 A;  5BXJ A;  1HJW A;  1D7I A;  3CHE A;  4JFM A;  3PA7 A;  4URI A;  4WKA A;  2PV1 A;  3FY1 A;  2K8I A;  3UQI A;  1NWT A;  1E15 A;  4P8V A;  1FKJ A;  1YW5 A;  3OOB A;  4P8U A;  1NMW A;  5HBF A;  2A3C A;  4DRQ A;  1BKF A;  3RFW A;  3QOK A;  3IK8 A;  5B8I C;  3RME A;  2XP4 A;  2QF8 A;  2RQS A;  3CZ8 A;  3AS3 A;  1LG1 A;  2RUR A;  1FKL A;  1H0G A;  1W1V A;  3B9E A;  2ZR6 A;  4Z2H A;  1SYT A;  3O5K A;  4G2P A;  2MF9 A;  2A3A A;  2PI6 A;  3CHC A;  2DG3 A;  4GIV A;  2UZ5 A;  1Q1C A;  1J6Y A;  1HKI A;  3CHD A;  3UF8 A;  1ZBC A;  2DSW A;  1QPL A;  3KAB A;  2ZR5 A;  4LAY A;  1ITX A;  2PPO A;  3GU0 A;  2F23 A;  4Z2I A;  4TYO A;  1NWR A;  5DF0 A;  5DEZ A;  4IQ2 A;  1ROT A;  4R5E A;  1X6N A;  2LJ4 A;  4Q7N A;  2AWG A;  4MNK A;  1NSG A;  2DSU A;  4J4N A;  3WD3 A;  4W9O A;  1HJX A;  1QPF A;  4DZ3 A;  1J4R A;  4J4O A;  1N1A A;  3JYJ A;  4ZPT R;  1W1Y A;  2B31 A;  2XPA A;  4MNL A;  3WD4 A;  3ODK A;  1J4I A;  1LG2 A;  1Q6I A;  3O5F A;  5HUA A;  1W9V A;  3UI5 A;  1ZU8 A;  1LL7 A;  4MPK A;  4L3N A;  2IF4 A;  4DWS C;  5GQB A;  3O5M A;  4DH0 A;  4NNR A;  2XP5 A;  2RUQ A;  4MAV A;  4PTM A;  4FAP A;  3PRD A;  1NWU A;  4JFL A;  1GUV A;  3RM9 A;  4IT6 A;  2FKE A;  2OLH A;  1PIN A;  1FFQ A;  1Q6H A;  2FDM A;  2N87 A;  1TFV A;  2PN0 A;  2M08 A;  1FFR A;  3KAD A;  1F40 A;  3H9R B;  2LKN A;  2RSE A;  1J4H A;  3CHF A;  2ZQS A;  2DSZ A;  1E6Z A;  5HW6 A;  3WL1 A;  1W1P A;  2DT3 A;  1ZK6 A;  1KFW A;  4IQC A;  4MNM A;  3O5I A;  3RGC A;  2Y78 A;  4ODL A;  4ODN A;  2O9O A;  2O92 A;  3LUO A;  2KE0 A;  4TW8 A;  4R0X A;  1B6C A;  4ZS6 A;  2KO7 A;  3FXY A;  1LL4 A;  1RD6 A;  3BMB A;  2XPB A;  2F4E A;  1ZB5 A;  4ODO A;  4HBO A;  1O6I A;  2ETN A;  3NI6 A;  4DIP A;  2G41 A;  1EHN A;  4TW6 A;  3ARX A;  1FAP A;  1FKG A;  3WQV A;  1L1P A;  1QZ2 A;  3ARO A;  4U86 A;  1TCO C;  1WNO A;  2AOS A;  4Z2L A;  1M5Y A;  1XHG A;  1HXV A;  1UR9 A;  3PRA A;  1Y0O A;  4TNS A;  4WK9 A;  1JVW A;  2A3B A;  2RUC A;  4JFK A;  1BL4 A;  1VF8 A;  3KZ7 A;  1K9T A;  1X6L A;  1C9H A;  3O5G A;  4ODP A;  3RM4 A;  3NRK A;  1JND A;  4N19 A;  5HTG A;  3EY6 A;  4DRH A;  2KGJ A;  2D9F A;  2DG9 A;  1ZBV A;  1Q6U A;  4Z2K A;  4DRK A;  3MDY B;  2LPV A;  1E44 A;  1E6P A;  4LAV A;  2YBU A;  2KR7 A;  1GPF A;  1EIB A;  1W9P A;  4C02 B;  3FAP A;  2ITK A;  1WB0 A;  4ZPW R;  1NWS A;  1ZBW A;  4Z2G A;  1F8A B;  5DIV A;  3CH9 A;  4DRJ A;  2EUL A;  3AS0 A;  3BXW A;  1EYM A;  2DSV A;  3GPK A;  4ITZ A;  1OGG A;  4Z2J A;  5HW7 A;  2VCD A;  2RUD A;  2PBC A;  4GGQ A;  3O5D A;  2WM0 A;  1W1T A;  3ART A;  1JNS A;  1E9L A;  3ARS A;  3ARY A;  1D6O A;  3JXV A;  3PR9 A;  3UQA A;  1FKI A;  1FD9 A;  2WLY A;  2MLY A;  3WH0 A;  3EIP A;  3TCZ A;  1FKH A;  3B7X A;  3ARV A;  1E6N A;  5GPR A;  1EDQ A;  2PV3 A;  4MGV A;  4S3K A;  2B5U B;  1H0I A;  4IT4 A;  1ZBK A;  4WJX A;  1LJY A;  4MSP A;  2VN1 A;  4NZC A;  5HW8 A;  1D7J A;  1YAT A;  3W4R A;  1HKK A;  4WIW A;  3PRB A;  5JH8 A;  1CTN A;  4NSB A;  1R9H A;  5HKG A;  3O5J A;  2XP7 A;  3CGN A;  2Q5A A;  4QZV B;  1U79 A;  1P5Q A;  2M2A A;  3TDB A;  2PV2 A;  3CGM A;  2DT1 A;  4Q22 A;  3G6L A;  2JZV A;  4P8W A;  3O5L A;  4ML4 A;  1ROU A;  4QT3 A;  2PPP A;  1LQ0 A;  2PPN A;  3KAC A;  3UQB A;  1JNE A;  2MNT A;  4JYS A;  1OWQ A;  3ARU A;  3WQW A;  3GTY X;  4BF8 A;  4DRP A;  3ARP A;  4DRI A;  3IKD A;  4W9Q A;  2M1I A;  4WKH A;  2F2D A;  3KAG A;  4ODR A;  1PBK A;  3ALF A;  3IKG A;  4DRO A;  4LAW A;  1FKS A;  1T11 A;  4LAX A;  3B9D A;  3KAI A;  4DRM A;  1FKB A;  5DIT A;  2G8Z A;  4IPX A;  4QIB A;  2ZQV A;  1UR8 A;  1GRJ A;  4MTV A;  5GPG A;  3WD1 A;  3WIJ A;  1FKK A;  3KAH A;  3B8S A;  1ZL1 A;  2DPE A;  1KT1 A;  3ARZ A;  4O2T A;  1LL6 A;  1W9U A;  4L72 B;  5HWB A;  4W5U A;  3UI6 A;  2FAP A;  4U84 A;  2OFN A;  2A3E A;  5DIU A;  4W9P A;  1HKM A;  5J6E A;  1XRV A;  3ARQ A;  2XP3 A;  4JFI A;  1FKR A;  4WKF A;  4U85 A;  5HT1 A;  2LGO A;  1JNT A;  4ODM A;  4AY1 A;  4JFJ A;  4DWS A;  4ODQ A;  3WD0 A;  2XP8 A;  3O5O A;  4G50 A;  2KFW A;  4TW7 A;  3O5E A;  2MLZ A;  1A7X A;  1W26 A;  4DZ2 A;  1FKD A;  4FN2 A;  1IX5 A;  4QT2 A;  2ZR4 A;  1GOI A;  2YBT A;  4ODK A;  2ZQT A;  2DT2 A;  3JYM A;  2MLX A;  4TX0 A;  1SR0 A;  2IUZ A;  1D7H A;  1NH6 A;  1ZCN A;  1OGB A;  4S3J A;  2MPH A;  4KR0 B;  4HAR A;  3AS1 A;  2WLZ A;  2WK2 A;  3RM8 A;  2P4V A;  3B9A A;  3WL0 A;  4ZPV R;  3IHZ A;  4KQZ A;  5I98 A;  4UDM A;  3O5P A;  4LGX A;  4P8X A;  5D75 A;  4XAK A;  4DWS D;  3ALG A;  1D2K A;  3WD2 A;  3O5R A;  4MNJ A;  1KT0 A;  3NTP A;  2XP6 A;  4DWS B;  3UI4 A;  3WKZ A;  4HBE A;  2DT0 A;  3VAW A;  1JCH B;  2XP9 A;  5HWC A;  3I6C A;  2F21 A;  3OA5 A;  1EQ3 A;  3KAF A;  1NMV A;  1FJD A;  3O5Q A;  1HJV A;  1HKJ A;  1WAW A;  2KI3 A;  4DRN A;  2ZQU A;  3ARW A;  2ESC A;  1FKT A;  2L2S A;  4DT4 A;  1E6R A;  2DG4 A;  3ARR A;  3AS2 A;  3KCE A;  3TC5 A; 
#chains in the Genus database with same CATH homology
 1FKF A;  3G6M A;  3AQU A;  5DO2 A;  5BXJ A;  1HJW A;  1D7I A;  3CHE A;  4JFM A;  3PA7 A;  4URI A;  4WKA A;  2PV1 A;  3FY1 A;  2K8I A;  3UQI A;  1NWT A;  1E15 A;  4P8V A;  1FKJ A;  1YW5 A;  3OOB A;  4P8U A;  1NMW A;  5HBF A;  2A3C A;  4DRQ A;  1BKF A;  3RFW A;  3QOK A;  3IK8 A;  5B8I C;  3RME A;  2XP4 A;  2QF8 A;  2RQS A;  3CZ8 A;  3AS3 A;  1LG1 A;  2RUR A;  1FKL A;  1H0G A;  1W1V A;  3B9E A;  2ZR6 A;  4Z2H A;  1SYT A;  3O5K A;  4G2P A;  2MF9 A;  2A3A A;  2PI6 A;  3CHC A;  2DG3 A;  4GIV A;  2UZ5 A;  1Q1C A;  1J6Y A;  1HKI A;  3CHD A;  3UF8 A;  1ZBC A;  2DSW A;  1QPL A;  3KAB A;  2ZR5 A;  4LAY A;  1ITX A;  2PPO A;  4Z2I A;  4TYO A;  1NWR A;  5DF0 A;  5DEZ A;  4IQ2 A;  1ROT A;  4R5E A;  1X6N A;  2LJ4 A;  4Q7N A;  2AWG A;  4MNK A;  1NSG A;  2DSU A;  4J4N A;  3WD3 A;  4W9O A;  1HJX A;  1QPF A;  4DZ3 A;  1J4R A;  4J4O A;  1N1A A;  3JYJ A;  4ZPT R;  1W1Y A;  2B31 A;  2XPA A;  4MNL A;  3WD4 A;  3ODK A;  1J4I A;  1LG2 A;  1Q6I A;  3O5F A;  5HUA A;  1W9V A;  3UI5 A;  1ZU8 A;  1LL7 A;  4MPK A;  4L3N A;  2IF4 A;  4DWS C;  5GQB A;  3O5M A;  4DH0 A;  4NNR A;  2XP5 A;  2RUQ A;  4MAV A;  4PTM A;  4FAP A;  3PRD A;  1NWU A;  4JFL A;  1GUV A;  3RM9 A;  4IT6 A;  2FKE A;  2OLH A;  1PIN A;  1FFQ A;  1Q6H A;  2FDM A;  2N87 A;  1TFV A;  2M08 A;  1FFR A;  3KAD A;  1F40 A;  3H9R B;  2LKN A;  2RSE A;  1J4H A;  3CHF A;  2ZQS A;  2DSZ A;  1E6Z A;  5HW6 A;  3WL1 A;  1W1P A;  2DT3 A;  1ZK6 A;  1KFW A;  4IQC A;  4MNM A;  3O5I A;  3RGC A;  2Y78 A;  4ODL A;  4ODN A;  2O9O A;  2O92 A;  3LUO A;  2KE0 A;  4TW8 A;  4R0X A;  1B6C A;  4ZS6 A;  2KO7 A;  3FXY A;  1LL4 A;  1RD6 A;  2XPB A;  2F4E A;  1ZB5 A;  4ODO A;  4HBO A;  1O6I A;  3NI6 A;  4DIP A;  2G41 A;  1EHN A;  4TW6 A;  3ARX A;  1FAP A;  1FKG A;  3WQV A;  1L1P A;  1QZ2 A;  3ARO A;  4U86 A;  1TCO C;  1WNO A;  2AOS A;  4Z2L A;  1M5Y A;  1XHG A;  1HXV A;  1UR9 A;  3PRA A;  1Y0O A;  4TNS A;  4WK9 A;  1JVW A;  2A3B A;  2RUC A;  4JFK A;  1BL4 A;  1VF8 A;  3KZ7 A;  1K9T A;  1X6L A;  1C9H A;  3O5G A;  4ODP A;  3RM4 A;  3NRK A;  1JND A;  4N19 A;  5HTG A;  3EY6 A;  4DRH A;  2KGJ A;  2D9F A;  2DG9 A;  1ZBV A;  1Q6U A;  4Z2K A;  4DRK A;  3MDY B;  2LPV A;  1E6P A;  4LAV A;  2YBU A;  2KR7 A;  1GPF A;  1EIB A;  1W9P A;  4C02 B;  3FAP A;  2ITK A;  1WB0 A;  4ZPW R;  1NWS A;  1ZBW A;  4Z2G A;  1F8A B;  5DIV A;  3CH9 A;  4DRJ A;  3AS0 A;  3BXW A;  1EYM A;  2DSV A;  3GPK A;  4ITZ A;  1OGG A;  4Z2J A;  5HW7 A;  2VCD A;  2RUD A;  2PBC A;  4GGQ A;  3O5D A;  2WM0 A;  1W1T A;  3ART A;  1JNS A;  1E9L A;  3ARS A;  3ARY A;  1D6O A;  3JXV A;  3PR9 A;  3UQA A;  1FKI A;  1FD9 A;  2WLY A;  2MLY A;  3WH0 A;  3TCZ A;  1FKH A;  3B7X A;  3ARV A;  1E6N A;  5GPR A;  1EDQ A;  2PV3 A;  4MGV A;  4S3K A;  1H0I A;  4IT4 A;  1ZBK A;  4WJX A;  1LJY A;  4MSP A;  2VN1 A;  4NZC A;  5HW8 A;  1D7J A;  1YAT A;  3W4R A;  1HKK A;  4WIW A;  3PRB A;  5JH8 A;  1CTN A;  4NSB A;  1R9H A;  5HKG A;  3O5J A;  2XP7 A;  3CGN A;  2Q5A A;  4QZV B;  1U79 A;  1P5Q A;  2M2A A;  3TDB A;  2PV2 A;  3CGM A;  2DT1 A;  4Q22 A;  3G6L A;  2JZV A;  4P8W A;  3O5L A;  4ML4 A;  1ROU A;  4QT3 A;  2PPP A;  1LQ0 A;  2PPN A;  3KAC A;  3UQB A;  1JNE A;  2MNT A;  4JYS A;  1OWQ A;  3ARU A;  3WQW A;  4BF8 A;  4DRP A;  3ARP A;  4DRI A;  3IKD A;  4W9Q A;  2M1I A;  4WKH A;  2F2D A;  3KAG A;  4ODR A;  1PBK A;  3ALF A;  3IKG A;  4DRO A;  4LAW A;  1FKS A;  1T11 A;  4LAX A;  3B9D A;  3KAI A;  4DRM A;  1FKB A;  5DIT A;  2G8Z A;  4IPX A;  4QIB A;  2ZQV A;  1UR8 A;  4MTV A;  5GPG A;  3WD1 A;  3WIJ A;  1FKK A;  3KAH A;  3B8S A;  1ZL1 A;  2DPE A;  1KT1 A;  3ARZ A;  4O2T A;  1LL6 A;  1W9U A;  4L72 B;  5HWB A;  4W5U A;  3UI6 A;  2FAP A;  4U84 A;  2OFN A;  2A3E A;  5DIU A;  4W9P A;  1HKM A;  5J6E A;  1XRV A;  3ARQ A;  2XP3 A;  4JFI A;  1FKR A;  4WKF A;  4U85 A;  5HT1 A;  2LGO A;  1JNT A;  4ODM A;  4AY1 A;  4JFJ A;  4DWS A;  4ODQ A;  3WD0 A;  2XP8 A;  3O5O A;  4G50 A;  2KFW A;  4TW7 A;  3O5E A;  2MLZ A;  1A7X A;  1W26 A;  4DZ2 A;  1FKD A;  4FN2 A;  1IX5 A;  4QT2 A;  2ZR4 A;  1GOI A;  2YBT A;  4ODK A;  2ZQT A;  2DT2 A;  3JYM A;  2MLX A;  4TX0 A;  1SR0 A;  2IUZ A;  1D7H A;  1NH6 A;  1ZCN A;  1OGB A;  4S3J A;  2MPH A;  4KR0 B;  4HAR A;  3AS1 A;  2WLZ A;  2WK2 A;  3RM8 A;  3B9A A;  3WL0 A;  4ZPV R;  3IHZ A;  4KQZ A;  5I98 A;  5D75 A;  3O5P A;  4LGX A;  4P8X A;  4XAK A;  4DWS D;  3ALG A;  1D2K A;  3WD2 A;  3O5R A;  4MNJ A;  1KT0 A;  3NTP A;  2XP6 A;  4DWS B;  3UI4 A;  3WKZ A;  4HBE A;  2DT0 A;  3VAW A;  2XP9 A;  5HWC A;  3I6C A;  2F21 A;  3OA5 A;  1EQ3 A;  3KAF A;  1NMV A;  1FJD A;  3O5Q A;  1HJV A;  1HKJ A;  1WAW A;  2KI3 A;  4DRN A;  2ZQU A;  3ARW A;  2ESC A;  1FKT A;  2L2S A;  4DT4 A;  1E6R A;  2DG4 A;  3ARR A;  3AS2 A;  3KCE A;  3TC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...