1QPXA

Crystal structures of self-capping papd chaperone homodimers
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
215
structure length
206
Chain Sequence
AVSLDRTRAVFDGSEKSMTLDISNDNKQLPYLAQAWIENENQEKIITGPVIATPPVQRLDPGAKSMVRLSTTPDISKLPQDRESLFYFNLREIPPIALCTKIKLFYRPAAIKTRPNEVWQDQLILNKVSGGYRIENPTPYYVTVIGLGGSEKQAEEGEFETVMLSPRSEQTVKSANYNTPYLSYINDYGGRPVLSFICNGSRCSVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAPD CHAPERONE
publication title Structural basis of chaperone self-capping in P pilus biogenesis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 43
structure length 206
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00345 PapD_N Pili and flagellar-assembly chaperone, PapD N-terminal domain
A PF02753 PapD_C Pili assembly chaperone PapD, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qpxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qpxA01
5E6ZA 1NUDA 2C1OB 5E2UH 3O6FA 5ACMA 1BQHG 3EO1A 3HC3L 5INDB 3RDTB 2XTLA 32C2B 2IMMA 3DGCR 3BZ4A 4UNTA 1ORSA 3ARFC 3VD3A 5IB2B 1R3JA 4PG2C 1S7SB 5K9OA 3UZQA 4RRPA 3D18B 5JR1L 3RTQB 4OCYH 4K3EH 1QYGL 4X6FA 4TTGA 4PJXB 1JYXA 1U95A 3MRJA 4G8EA 4Z7UE 1UT9A 1F4XH 4XX1E 2DL9A 2BVUA 5DJ8B 3CU7A 5C6TL 3GSNL 5HVHB 2OR9H 5FK9B 2R0LL 1G9MH 4R7NB 4PJ9C 3LS5L 1RZJC 3EYUL 5CBEA 5FCUL 1SMOA 1KEGH 3F5WA 3S35X 3F7QA 4URTB 5I74C 3JV6A 5D1QC 5DD1H 3CPLB 3ARWA 3X13B 1MCRA 1GZQB 2EYSB 4HZLA 3MUJA 1I3RB 4S2SB 4NKDB 3T4YA 1RK0A 2HT2D 1KCSH 3RGVB 3FONA 1RZ7L 5F6IB 3PQYA 1J7VR 2WUBL 5TPWH 1CL7I 2OP4L 1JNHB 1MFAL 1OTUD 3IJYA 3I50H 1XZ0A 4AQ1B 2FL5A 3SN6N 1F3DJ 1CU4H 4H5SA 5IEKA 2NCMA 3FOMB 4O2CB 2UZIL 4Y4HB 1WIPA 4UNVA 3C8HA 4I18A 4X6DE 5D4QA 3VH8G 2AK1H 5EUOB 2FJHA 5GRWA 3QUZA 1KB5B 3GSWB 5ANMA 2QHLA 4HMCA 4PBXA 5C07D 4UBDD 2EEBA 3ECBA 2OZ4H 3D69B 1LNUB 5DD0L 2EIBA 1H15A 5JDJA 4MQ7A 1D5IL 4I1NB 3QUXD 5GISH 3HAEG 3SGKC 4C56D 1VFAB 5K9QG 4I0PD 4PGCA 5HHQA 1S9WB 2J8UE 3FKUS 4JFED 3NIGF 3X3GH 3RWFB 3AXLB 3K4DA 2X4SB 4XC1H 2NZ9C 1BP3B 3QQ4A 4LCCB 4PJEB 1G7HA 1FQ9C 1GPOL 4MHHG 3P4OB 3OKMB 3VFUA 1GC1H 3G5ZA 1VACB 5D1ZA 3W0WA 5L2JB 2LQRA 4YWGL 3ARSA 4ZMAT 3NA9H 4N9GB 3T09A 3VD5A 3NFSH 2C1PA 1TQBB 4AIZB 4MGXA 1ZEAL 2A6KA 3UDWC 1A3RH 1FAIL 1KELH 2IPUK 2Y4SA 3QZWG 4GQ9L 4JFOB 1QRND 4KI1A 4J1UA 4G5ZH 3VXRD 3OR6A 5D7IB 1EHXA 2PTVA 2IPUG 3GKZA 3WFEH 2VZUA 1V7MH 4L8DB 4EEEA 4TQEL 2XWJB 2YSSB 3H3KA 3SDCC 2MWCA 1MVFA 4P4KA 3V9FA 2DQGL 2YPVH 3GIVB 3EYOA 4BH8B 2E9WA 5JPMA 4M7ZB 5ICZB 5IFAH 1TZGL 2R2HB 1NGYB 3FO2A 3IDYB 1S7UA 2ICWB 5KTEL 4KMQA 5GGSB 4DKEL 1XIWC 2KKQA 3LDBC 2WBJD 5ADOH 4L4TD 4U1IA 1DQDL 1IILE 1MFEH 1FORL 1KIPA 2JCCE 2YS4A 3NGBB 3OKLB 2VQUA 5JA8B 1LGVA 3KPRE 1IAKB 3LEXA 4X7FC 5GGUA 1Y6NR 1TVBB 5HHXH 5C9JA 5D71H 1YMMD 3OB0H 4QRQA 4P46C 4W4NA 4LARL 3TVMB 2BY3A 1CFQA 4F33B 1RZGA 1NBQA 3JWDH 1DBMH 2P46B 4ZSOA 1IC7L 1R5IB 5HYQA 3MBEC 2V6HA 5E5RB 5GS0D 1XEDA 3D39B 1J8HE 3MOQA 2DQUH 2BSSA 4X6EA 3V79C 3CLEH 2V9RA 4FQJL 3TYGL 4R96A 4P2RD 3PWPE 1T66C 3ARGD 4U7SA 3QIWC 3ABZA 2IH1B 4R26L 3T8XB 1J9CT 4N1EA 4X6CA 3VE0B 4BK4A 1TJGH 3GMRA 3QJFA 4X99B 2FJGB 1RIHH 4Y16A 4HIEA 3HZKB 3RIFK 5T1MB 1QBLL 4CDGC 1QSFD 4F3FA 3MUHL 1PSKL 5HHOD 5A40E 2ATKA 5INDA 1DFBL 32C2A 3EOAB 3O2DH 3RVXD 4NOBA 1WWAX 1N64L 4XAKD 3FN0L 3B5GA 2Y07L 3MV8E 1A3LH 2XZZA 5A2LH 5IB4B 3U0WL 4PJAB 2YMXL 2V9QA 4U1JB 3QISA 1WFTA 1DQQB 1QEWA 3INUL 4RBPK 3D18A 2EYTA 4HULB 4ODTH 2RB8A 4R9HA 3WN5B 1C5BH 5GIRA 1KLFA 4ZFGH 1WK0A 1NBYA 1QFUH 1U3ZA 4NQEB 3UPRA 4IRJA 3E0GA 1W72B 4WUUB 5FK9A 1J12A 4HK3N 1S3KH 3LPFA 4GKOA 4O4YL 4PJHB 4KXZI 4RFEB 1CXKA 2YUVA 4MCZB 5D70L 4OUOA 4UT6L 1KLUB 3UAJC 1N5YL 4K94H 4XXCA 4KJYB 4LCIH 3B2UD 3BAEH 3ILPB 5GHWL 4GG6F 4LPYA 2GAZB 4POZC 1RPQA 4Y19E 5B38G 2AXFA 4N0YL 2W65A 5I1LA 1JZ5A 4WU7B 1QPPA 2BNQB 4ZUVA 5T3ZH 1XF1A 5HY9A 1CGXA 3QO0A 4FFYL 4MCYB 5SX4I 3FAXA 4U1MA 4K9EL 4HGKC 3IXTB 5EORL 3TN0C 4Q9QH 3W82A 4OGYL 3ZKNC 1YYMH 5EUOA 2X4OB 2Y36H 5HHPB 2R8SH 1A6VL 4RMRA 4JFQB 2ZG1A 4EI5B 1A4KB 4WUKH 5DHYA 4D9RE 3VXQA 1W0VB 4M1CD 1N7MH 2K3TA 2OJEA 4JG1H 3ARZA 3LH2L 3EYVA 4PTUB 3T65A 2YPLD 1IM9D 4OSUL 5HGBB 5DD6A 3DRQB 3IKKA 4H8WC 4YDJB 2XT1B 5LVEA 5J11C 3O4OB 1EERB 4NQCD 4JHWH 2IBZY 1ZA6B 3L95B 2X4SA 4P99A 3UYOD 3B3IB 3H7BA 5E8EA 2Q8AL 3QEQA 1NFIB 3L1OH 2XG5A 5KVGH 4LCCA 4HGWB 4GKNB 1C16A 2WWKO 3UBXI 1J5OL 4GRWH 3OKMA 1VACA 1H5BC 2PW2B 4J4PA 2O5ZH 3HI6L 2VL4A 3C6LD 5EA0L 4CMMB 1D3CA 2F5AH 4PRDA 1U8QB 3EJJX 3MRCB 4LLAA 4S1DC 1CE1H 4QOKB 5I6XC 2C5DC 4QHKJ 1JBJA 3HKFA 3TA3D 5LXGL 4YDIL 5ESQB 2HJKA 3OZ9H 4Q7DA 2ZCKL 4OLEA 2Z93B 1K3ZA 2H1PH 3S5LA 4L3AA 5F3HA 1NCCL 5IUSA 4M61B 5D7IA 4DKFL 5IBTH 4XRCB 3SE9H 1Y18B 1OL0A 2R9HD 3Q1SH 1E4XH 1U8OB 2KZ1B 4LPVA 4FXKB 1U3HB 3MRMB 4QTHB 4X4XB 1BHGA 5A2JH 1XCTB 3GIVA 4GS7B 3VGAC 4BH8A 1QSED 2WWKT 4MMZC 3G5VA 1WTLA 2BVQA 1NGYA 5DQJA 3ROLA 1QFWH 5IHUH 5I17B 1PYWB 4LP4A 4MB3A 2J5LC 1QBML 3FRPA 3Q6GL 4PJ7A 5CGYC 2E9JA 5C0BE 2NPLX 4ONGH 2OI9C 4YBHA 4NGHL 3VXMA 1TVBA 2VDRH 3IT8D 4S1RL 3VFRB 1I75A 4UIMB 3RWHB 1C5DA 5IKCB 4G6AC 4LVNC 1U8LB 5FYLH 5F9DC 3CMOL 4L8CB 5AD0B 1AI1L 3A67H 2F53B 2FX7L 3QYCA 1S9KC 4PY7B 3D39A 5KJRH 1LO4L 3QCVL 1KJ3H 5DQ9B 3BRFA 2B5IB 2FD6L 3L9RB 4Y7MA 5IOPB 1P7HL 3MCLL 5F8QC 1BJMA 4XWGH 1JFQL 4NP4L 4NO0A 1BOGB 4WO4C 4IMKC 2L0DA 3SGEI 2OR8A 4LQFL 2FJGA 2IPKB 4XTRC 5IIEA 1NC2B 4PRHE 4DN4L 3KHQA 3LS4L 1MCSA 4KY1L 2ZKHL 1JWSB 1CR9H 1CICD 1I1YB 3VFTA 3VFSB 3B9VA 3TO2B 4FZ8L 4ZG1A 4PJGB 1JIBA 1LDSA 4U1JA 3LKSB 4B0MM 2DDQL 5I1KL 1HQRA 3KLAA 1UWGL 3V7AE 5DUPH 3H9SD 5C0CA 4ZFFB 3PDOA 1ZWIA 3RVUC 4DZ8A 1JTOA 2G9HA 3TF7C 4WIQA 5KVFH 4H0HB 4KROC 1U41A 1W72A 4K8RD 1ADQH 4KJQC 1Q9WA 4L4VE 3JTTA 1EAJA 2D9CA 3ARQA 2RHEA 2ED7A 2ARJB 4ELMB 4I77H 3WUWB 5TQ0H 1JPSH 4P23A 1MVUB 2FLRT 4KZEH 4HK3J 2VLJB 2ICEA 4KJYA 5HDBF 5E9DA 5BOPA 3UTQA 4GRWF 1N8ZA 1KTKE 3BRGC 3EUUA 1UM6H 3R8QA 1IKNC 1BFSA 2V7HB 2VDKL 5ICXA 3QG7L 2V2WA 2R29H 3GSRA 3CDGB 1HWHB 2XTJB 1LEKA 3ZHDA 4QHLB 2IQ9L 2APTA 2IAMB 2BNQA 1HH9A 1F11B 4XPAH 5DD5L 5KG9B 2APBA 1H3XA 3IF1B 5L8LB 2WQRA 5DJ0B 3EFDL 2VQTA 2WINB 1EA9C 3MRQA 5FDWB 3QRFM 3AC0A 5ID0B 3CFCL 1TJHH 4JQXC 5LWYH 4KJWC 3IXTA 1LO3H 5DHVB 3M17A 3CFKB 1BX2B 2IPTL 4I8DA 3QEHB 4YO0B 1NC4A 1FN4B 4NC0B 1RD6A 4CNIA 1PLGL 3QFDA 4IIQA 4K71B 4XNQB 3T08A 4MA1B 1A4KA 1IAMA 3MACH 2E7MA 3VDBA 3IDXL 4ZAKD 1FGNH 4NQXA 5FYJU 1GJIA 1P5UA 4OZHA 4R4NC 4MA3B 4MS8C 1FC1A 4YBLC 3W11D 1NDMB 3BO8B 1PAMA 3KGRA 4NN5C 1JWMB 1W2KT 4M43L 1BFOB 2P43B 4WWKA 3SCMB 5KSBA 3V4PL 4MDJB 3O3DB 3QDGB 3L95A 4F7TB 2GJ6E 2GI7A 5H37H 3KLHD 3BKML 3LD8C 3BKCL 3TYFB 2NY2C 4OZIB 4L3ED 3U9UB 4YHIB 4KDTA 1OGTB 1ZT1A 3CLFH 3IDNA 5CJOL 4ZUUA 3OKKB 4HGWA 3IKCA 4GRMB 1NGXB 2NY3D 1OAQH 2BNUA 3ZE0E 5HHME 1RFDL 1X5ZA 4U6VL 4FHBD 3WJLC 1H3GA 1LO0H 4NCC2 1JF6A 1A6UL 2ESVE 3LQAC 1U8QA 4P4RB 4PRPB 3C8KA 3PDGA 3TT1L 4QOKA 2Z0BA 2Z8WC 4L8SC 1YPZE 5CFHA 5D2NE 5DTFB 4M6NL 1P69B 25C8L 4LASL 4NWUH 2Z93A 2DOCA 1TZHB 1FGVH 1RIUL 2ZCHH 2AK4B 2EDOA 5ESAA 2B2XL 2NMSA 3NACH 3SBWC 1MLBA 1MJUL 1I8KA 4MJIA 3OKYA 2W59A 5CJQL 1U3HA 1R3HB 3O6KL 4QTHA 5D93C 1IZKA 3BH9B 1A6PA 1N6QL 4G3YH 1CGWA 1UFUA 5D6DC 4DUXA 4G9DA 5HI5C 5I17A 1PYWA 1A64A 1C7SA 4XP1L 3DBXA 4NKMB 1BAFH 1E4KC 3W5NA 3A0OA 1QFPA 1I7ZB 3MR9A 2E7LA 3VG9C 2A6JB 1BOYA 1T4KB 2FX8H 3MLWH 4F57H 3GSUB 4H20H 1UZ6E 5CCKL 3D85D 4HWZB 3MBXL 3ARVA 1RURL 1U8LA 5EC1B 3O45B 2APVA 4HXBH 1FPTL 3V6ZB 5JIKA 4Z7VF 5AD0A 4M7LH 1CT8B 5GGTH 3UJIL 5MEQB 2B4CL 4PY7A 1RZKH 3TBTA 5KS9E 1KCRL 4U2YA 1AKJB 2ADGA 3MNZA 2BJML 3ZHKA 3QDJE 1EHAA 5DQ9A 5T3XL 4F9PC 2D4FA 3QFJE 1NUFA 4W70A 3BMVA 3AY4C 4QXWA 5IOPA 1JL8A 4WW2F 1WFUA 4Z7OE 5C92A 1M7DB 3QUYD 4RFOH 2W60B 4WI5A 1KCLA 1BOGA 4ZFZB 2V17L 2VLRB 3O2WH 2FZ3B 2NNAA 5AYUH 5MERA 4NRYA 1V7NL 3MO1B 3HC0A 1JRHI 3N0PB 5KSAD 3WS6A 1CK0H 3AAZB 2P45B 4O9HH 3KXFE 5FM5M 2H41A 1D9KC 5J1AB 1K8IB 3V95A 2WMPA 1RZIB 1T5WA 5EFIB 4POUB 1WBZA 3VFSA 3TT3L 1EPFA 3HMWL 1DSFL 2DQDH 3TO2A 5BW7C 2CLRB 2OXHA 4F37F 1CBVL 5CLWA 1OTTC 2NXYB 5IQ7L 3WJJA 1DN2A 3RKPA 1SY6L 4JFDB 5BS0D 3QCUH 1JGEB 3WXWL 1D6VL 2BVOA 4NN6B 1BBDL 4JPKH 4BZYA 4RAUB 5K93A 2GUOB 1RI8A 5C07A 1UH2A 2YK1H 1RSFA 5ACZB 5AWNL 5C0EA 1TVHA 4YEFA 5HYEA 5TDNA 1DZBA 1Z9MA 1ZANL 2EH8L 2HN7A 2ZG2A 4QCIB 2W9EL 2CQVA 4NKQB 3TWCH 1FYTB 4ZDHB 2ARJA 5B21A 1IM9B 2G2RB 2IJ0C 4XWOC 1I9RH 4C56A 5D1XD 4ELKB 2J3SA 2VLJA 1NL0H 4Z7WE 4I0PA 1HILA 1ZAGA 3AGVA 1RUQH 2HLAB 1KTDB 2GJZA 4JFEA 1RJYB 4KAQL 3NPSC 1F8TH 1ZTXL 5EN2A 3CDGA 1II4E 3UP1A 2DQHH 1WF5A 2V5YA 2OS7A 2NX5B 2CLVB 1RHHA 4JZOA 1FIGH 3MLXL 3O8XB 3QUMH 5E6IC 2Q87A 2ZUQC 1MOEA 2WINA 4BQ6A 5FDWA 1VCAA 5DJAB 3T0ED 3BN3B 4KMTH 5E2VH 5C0FB 4PJ9D 1QBAA 5DHVA 4JM2C 1FL3A 1MWAL 3U7WL 1H3WM 2HG5B 3UZVB 3QEHA 1LMKA 2X9XA 2FECL 4YO0A 5D1QD 2FB4L 1FN4A 4PV9A 4ZD3H 5JIIA 3JV4B 4XNQA 3DMMB 1NFDF 4OGAC 4U6YB 1BJ1H 3VXSB 4QXUH 1QRNA 3VXUE 1IGCH 4HJ0C 4OV5B 3VXRA 4M1GH 1AD9B 4HUWA 1G7JA 2YEZB 4NDMA 3EYQC 5DSCA 2FEEL 4CVZB 2VDML 5JOFB 3C5ZC 3BO8A 2MPAL 1JWMA 1QQDB 2NXZB 2OTUA 3N1MC 1ODAA 3L7FB 1BQLL 1NEZA 1MAMH 3FB6B 3SCMA 3U4BH 4XPTL 3W2DL 3QDGA 5IVZB 2WBJA 4L4TA 4HKXB 4OCRH 1SYSA 5DHXB 3U9UA 4OZIA 1MCLA 3OKKA 3AFLA 4OBSA 4GRMA 1NGXA 3RU8L 2CUHA 5IHLB 1YMMA 3QXDB 3DGGA 4GRLB 1K6QL 2YUXA 4K3JL 1BEYL 4ERSH 4DFHA 1T03L 1ZHNB 3GSXA 3ZMRA 4P4RA 2W0LA 3QDMB 4PB9H 9CGTA 4BFIA 4M6AA 4XMPL 4N90E 1YN7B 1VB9A 4NNYB 5SV4A 4UIKH 5T33L 1TCMA 5I19H 3AUVA 3TV3H 4QRSB 4P2RA 1N4XH 2X9YA 3WLWC 2NY5L 5TDOB 3ARGA 2NZ9D 3EOBA 4HIIA 3DRTB 2FWOB 4G6JH 5CSZA 5B39G 4I5BB 3EDKA 4PJIB 4TSAH 4WVRA 3RZCC 4PGJA 3C8DA 5DVOA 3WSQL 5E5MB 1AXIB 4MA8L 4PB0L 1R3HA 1EO8L 3B83A 1AR2A 3ARDD 1BFVL 4XMKH 3VW3H 5F7EH 1UJ3A 5E2UL 3BD3A 4R7DA 1N59B 1QSFA 3PL6C 3MLSH 3C5SA 5HHOA 4NKMA 5FO7B 2FBJH 3ROOA 2EDRA 3NCYP 4LCUA 1HK6A 3BQUB 1T4KA 4CU8A 3BPOC 4K3EL 5LCVH 5SWZE 2NR6C 4TNVF 5FXCH 3PHOB 3DYPA 1BFTA 4AG4H 4MYWB 4G8GD 1F4XL 1BIIA 2BP3A 4E41E 4MXVF 4LGRB 2R2EB 3PNWB 2OR9L 2KUTA 4HAFA 4DVBB 4KTEH 3WL9A 5DEGB 4BYHA 2FYYB 2DIJA 1P5VA 1CT8A 1G9ML 5JMRA 4KDWA 1HQ4A 1AKJA 4TUOA 3MRNA 1KEGL 2VH5H 3LKQA 4G6KH 3BWAA 1ZS8A 1XIWD 4OZFH 1A6WH 2R0KH 2X6MA 3WNLA 5DD1L 1WITA 1SJHB 1I8IB 3K2UH 1WT5C 4BFGA 1MCWW 2VXVH 5EWIH 4AM0A 4PR5A 1OSZB 5SWQB 2ZSVA 3BHBA 1KCSL 4LKCB 4WDIB 5C0JB 4P46D 1HHIB 4YFLF 2QSCH 5TPWL 5C71A 3AAZA 1RUMH 3WYRA 4IHOB 1D6EA 2AKRB 3RVWC 3I50L 3BZEB 4JKPH 1I7RB 2QQKH 4YNYB 1CU4L 4YX2H 5D7KE 1AD0B 3T2NH 4XXDB 2AK1L 2QEJA 5I71B 1XGUB 1L4IA 4F37K 1T66D 3EJYC 3QIWD 2OZ4L 4HHAB 3OAYK 3MNWA 5CEXA 5MEPB 5ACZA 2EYRA 1UA6H 4XBEH 3IU4H 4OBRA 5BO1H 3SPVA 3H7LA 3OKDB 3D3VD 4QHUB 3GJFA 1J86A 2OX5A 3DUSA 4QCIA 5MENB 1PKQB 5DVNA 3MFGB 2VR4A 5GISL 4ZDHA 5F1NA 2YPLA 5DA0B 1IM9A 1A6AB 4F7MA 5I1EH 4ELKA 3EIFA 2Z8SA 2BHZA 1EK3A 3X3GL 3KS0H 2HLAA 4NQCA 1K2DA 1IRAY 3OWEA 3NCJH 3DUUB 3BVNB 5H37G 4XC1L 5E8OB 1UGNA 2AGJH 5DJ2B 4UUJB 2PYEE 2P7TA 5HGAB 2HYMA 5EPMB 3TO4B 4L3EB 2VOTA 3W9EB 2NX5A 1KJ2H 1PZ5A 1AC0A 2X4PB 1GC1L 2VZOA 1ZLUK 5IV2B 3ME0A 4NO2A 3OQ3B 4C55A 1RV6X 1FL6A 3NA9L 5IF0B 3C6LA 3RWCB 1KOAA 3D0VA 1EFQA 3JVGA 5F9AC 2QJDA 4JFXB 2QSQA 3NFSL 2HG5A 3TA3A 1A1OA 3UAJD 1A3RL 1XCQA 1WCBB 4LLDA 5FM8A 3IDIA 1KELL 4S1QH 3TC9A 4OF8A 4G5ZL 3HG1D 4OV5A 2N7BA 3WFEL 1V7ML 1B0RA 2YEZA 4KTDH 4CVZA 2BSTB 3UBXG 2YPVL 4XVSH 5EU6B 5JNYB 2D31B 3EOYG 5IFAL 2MNUA 2X1XR 1HSBB 5DLMH 3NVQA 3V8CA 1I85A 1OAYH 2O26U 3R0NA 4JZJB 5ADOL 1WWBX 4LNRA 2QADC 4JPIA 5FF6B 1VFOA 1MFEL 5IVZA 1AFVH 3TN0D 5SV3A 3ZKND 2PXYC 1NDGA 4YLQT 2FX9H 3O9WD 3VMNA 4YHNB 5HHXL 3KLSA 1T21A 1XGTA 4YHYC 1G9MC 3SE8H 1CFTB 1HXMA 4PP1C 1PY9A 3KPOB 1FDLH 2C26A 3OXRB 2VWEC 4D8PA 3QXDA 3JWDL 1DBML 3O11B 3I3BA 4PPTA 1F3RB 1UVQB 4J2XA 5DEFB 3TPKA 5D96C 1INQB 1KYOK 4MNQB 1F00I 3WFCH 4XCEB 3QDMA 4X7DC 5F7MC 1LDPH 3O4LB 1FZMB 3PDDA 1VFBB 2DQUL 2D0HA 3CLEL 3KYOA 3CX5K 3QXWA 4XPHH 3NOIA 4OKVB 1FCGA 4JO1H 1X5HA 1JPST 2R1YA 1X5FA 4HFWA 2YD2A 2AP2A 4I5BA 1TJGL 4PJIA 3C60C 4LIQE 4AENB 4UZGA 3STLB 3GBMH 3SE3A 3TH3T 1RIHL 1T0MB 3D6GA 5FGBA 4GBXB 3EJZC 1I7UB 1AGFA 1MUJB 3AU1B 3U83A 1N59A 4OQTA 4U3HA 4S1DD 5H2BB 5T1LB 1CICA 3O2DL 5TE7L 4Y2OA 1S9XA 2OXGA 2EZ0C 4OM1H 4RMUA 3S37H 3FMGH 1A3LL 4TUKH 3VRIB 4ETYA 4G7YH 4ZNEE 3LKNA 1ZHLB 2V5TA 2DAVA 4ODTL 5BS0B 1C5BL 2UVEA 4KKBC 5DZNA 1IC4H 3HR6A 1NLBH 4PJDB 3PHOA 4ZFGL 3H9SA 2YD5A 1RMFH 1QFUL 5M94B 5JW5B 3PWUB 4P2QD 4RA0C 1UXWB 3OL2A 3F6LA 4TNVK 2R2EA 4R0LC 5DYOB 5SWSB 3STBA 3OAZH 1NUGA 2OLDA 5DEGA 5I66A 4CADB 1S3KL 1Q1JH 1I3UA 5GSVB 1KXTB 3B8YA 3OKEB 3PV7A 4K94L 4LCIL 4OFIA 3BAEL 3S96A 1SJHA 4FFVC 4IJ3C 3DX8B 5IMKB 1U2CA 2GY7B 4ZFOL 3NABH 3ARFB 5SWQA 5DJ6A 4WI9A 2WAHA 3HUJE 3B9KB 2HP4A 1PX3A 1YEKH 5IK3B 4BSVA 4JDTL 4G6AD 5EO0B 1U8IB 4Z76B 3MLVH 1F58H 4Z7UB 4JGMA 5E8DL 2GT9B 3M45A 3DTXA 1IEBB 4EOWH 2NW3B 2A1WH 2Q20A 1MHHB 4Q9QL 4XXDA 3V52H 4DW2H 1YYML 1NAMH 2Y36L 3FHAA 1YEIH 3GSOA 2R8SL 5MI0B 4UOW1 5I74B 1TZIB 1YEEH 3LSOB 4MLIA 1KLGB 1P84K 3OSKA 1H0DB 1MHEA 4WUKL 5IT2H 4N8VB 4WO4D 3TP4A 1N7ML 3E6HB 4JG1L 1S7TB 3MYJB 4XTRD 4ZAKA 4ZNCD 5C3LD 3QCTH 3SGJA 1QLRB 4ODVH 4B7IA 1PKQA 2GK2A 3MJ8B 3O3UN 2F9BT 4LSVH 1KYOJ 1EEZB 3ZHLA 3A6BH 4A6YA 1L0YA 1F97A 1TQCC 4JHWL 3BT2H 4EQ3A 4QXGL 5I73C 2DQFA 2OCFD 1Q0YH 3T0WA 5BMFH 3CX5J 4X6DB 4HIXH 4X7TB 3BVNA 3CFDB 4NNPH 4EUPG 5JMOC 2EDBA 4HLZG 3CFEA 5J7CC 3L1OL 3RPIA 5KVGL 4KWUA 4L3EA 5TH2A 3DXAD 5MHSE 3DX9B 3TIEB 3VA2C 5BXFA 2O5ZL 3VI4F 4JHZA 4U6HB 3NA4A 4GAYA 4P5MB 4M48H 2WUCH 1N2RB 4MQSB 1CIUA 5EIVA 3OZ9L 4ODWB 1HNFA 2XQBH 4UINH 5E70A 5IMLA 2H1PL 2J8UB 4JN2A 1ZVYA 2JJSC 2Q1EA 3QAZB 5ESVA 1TNNA 5IROC 5IBTL 5FHAH 3VRLE 4RQQB 2VXSH 3SE9L 2EKSB 3Q1SL 4MB5A 1E4XL 3PQYE 4MNHA 1BVZA 1A0QH 5DJCA 4P2OD 4N0UA 5EU6A 1HSBA 2H26B 4OCNC 1QFWL 4TNWK 3LY6A 1LP9F 2WANA 5FF6A 2ARWA 4S0SD 2MSPA 1GOHA 3Q3GA 3QUZC 4ONGL 1QA9B 4JLRB 3T1WA 4YHNA 4CUCA 3G5XB 1S5IH 3GMMB 4K07A 3GZKA 2YD4A 5ANME 5GRZA 1XAUA 3BKJH 3KPOA 2AERT 3OXRA 4FP8H 4R3SA 3QI9B 4WV1B 3IETB 3I84A 1ES0A 5F3BA 1MJ8H 4MDIA 5FYLL 4Z6AT 2NTSP 3D85A 5DS8B 2GSIB 4MNQA 3MROB 4R4ND 3QXTA 1OT2A 3A67L 3SDCB 2IQAB 2NW2A 4OQ1A 1Z0NA 3O4LA 5KJRL 4XBPA 1FNEB 1VFBA 5TE4H 1KJ3L 3MCKB 3UTZB 1BZQK 4XGZB 4OZFG 5AAWA 3VJ6B 3WKMH 1E27A 5IESH 4XWGL 2JCCB 3KJ4C 4RNRA 4TOYH 4UV4H 3KPRB 2NY2D 3QUYA 5DRXB 5E6YA 3U9PH 3DO3A 3HE7B 1CGSH 2UZYB 1T6VN 1MCHA 4EVNA 1FL5B 3MXVH 4AENA 1VFUA 4JDVA 3ZTJH 2ICWI 1MCKA 1UZ8A 4P46B 4GBXA 1R5WA 3HI5H 5KSAA 4JZNA 5FO9A 3W0WE 1CR9L 1WSST 3AM8A 4Q6IA 4FQXB 2Y23A 5H2BA 1MLCB 3CMGA 3V0VB 3MBEB 4KRNA 3DVIA 1J8HB 1RJLA 4F58H 3VRIA 5F9JB 4WI8A 4KRPB 4BQCA 2BOBA 1CL7H 3JZ7A 1ZHLA 2R23B 3MJGX 1DUYA 3EFFA 5BS0A 3PWPB 1D5XB 5ETUA 3BXNB 1A6TB 1FSKC 4PJDA 1M7IB 1U2HA 2X4QB 3PWUA 4ZYKB 2E8YA 3GMLA 4OFKA 4IOFC 2Y7QA 4NUGL 2I24N 2Y5TB 1ADQL 1IT9H 4LPWA 2E7BA 1A1NB 3S4SB 4J23A 3ULSA 1CXFA 2EXYD 4I77L 1U8JA 5TQ0L 3RX7A 1JPSL 1LWRA 4KZEL 1GOGA 2GFBA 3FFCD 4OI7A 1CIDA 1NLDH 5GZND 3DX8A 5CHNB 1L0XA 2UZXB 5IMKA 3GMPA 4AYFA 3MV8B 1UM6L 3ARFA 1HCVA 3QNYA 4PG2A 1SJEB 4H1LA 4D2NA 2VL5A 2EDHA 3FQUB 5CMAA 4JFFD 4XPAL 1U8IA 4Z76A 5GS1C 2GT9A 2O61A 3TLRA 1IEAB 1IEBA 1TJHL 1IARB 1UKTA 1EVUA 1HH6B 4PRBB 4HKZB 4Y4KB 5LWYL 1KNOA 1LO3L 2FNBA 2P4AB 4GAJH 4WI4A 1S9YA 4PJ9A 4ETQB 1CD1A 4Z5RA 3CD4A 5ICYA 3SGDI 4MVBC 1DLHB 5D1QA 2DYPB 4Y19B 3T77A 3MACL 2BC4B 4D3CH 1KGCE 4X6CE 1OWRM 1KCVH 3E6HA 1FGNL 2CD0A 2D03H 3RUGF 1S7TA 3MRIB 5C0AD 1Q0XH 4U4BA 3QG6B 4MAYB 1D9KD 1VGKB 4FQCH 3BN9C 2IFFH 3H2WA 4NKIL 4U1HB 2BFVH 3QIUD 1Z9OA 4I4WA 4ALAH 1R3LB 1C1EH 1XF4A 5IW1B 5CWSA 1OTTD 4JPVH 3DURB 3TNMB 3VFMB 5CAYB 3TCLB 3BX7C 4JO4H 3CLFL 1ED3B 3FZUD 1Z5LB 4PJFA 5DRZB 4XVJH 2NLJA 4XP9H 5F7DA 3UO1H 3HNSH 3QXAB 1OAQL 5FA4B 3KPPA 1EGJH 3U7AA 3TIEA 1RIVH 1LO0L 1Z0MA 2QTEA 3U0TB 4HKJA 4FRWA 4XZUB 4MB4A 1P7KB 5ECJE 4KI5F 5IEHA 3R1GH 4XWOD 3SGKA 3BIBX 1NANH 4NWUL 2PUQT 2J8UA 2F5BH 4RZCB 1F2XK 1FGVL 2ZCHL 3K8KA 4MXQC 3VFWB 2IFGA 4UT9H 3NACL 3HRZA 1OGAD 4GW5B 5L0QB 3QPQD 4RQQA 3THMH 1PEZA 4L9LC 4Q9BA 4QRPD 2EKSA 1NGQH 5EIIB 1MCDA 2AQ1A 2IADA 2YD6A 3WFHA 1OSPH 4L3CB 3ARDA 4G3YL 5J57B 4NQVB 1H5BB 4LSUH 5HVGB 3VWJB 4PREB 3LKOA 2WBKA 3KPLB 1KB5H 3DWTA 4UMGA 2NY1C 4LVOB 3VFNB 3BSZH 4JM2D 4LHUG 5LAXB 2BY2A 1BAFL 3ZE1E 5IMMA 3NFNB 3ALXA 4JLRA 5F89A 5EUOE 3KR3H 15C8H 1CTNA 4PD4K 2Z91B 2FX8L 3UDWA 3V2AR 3MLWL 1T1XB 1H8NA 4OGAD 4F57L 4FTVD 1ZVSA 2UYLA 1MI5D 4H20L 4G8IB 4RX4A 5F7KC 3HMXL 4OCLC 3UTSE 1YJDL 2P5ED 3U2SA 1BECA 2DTMH 5IW6B 4HJ0D 4E42A 4NWTH 3IETA 5ILTH 4WEUD 4NNXB 3OB8A 4HS6B 4HXBL 5DS8A 3LZFH 4FQ2H 4M7LL 5I75C 3SDCA 5GGTL 2VR5A 4FQ1L 3C5ZD 3H42H 1RZKL 5EO1B 5GRVL 5DK2A 3UTZA 4LVHC 2H32A 1G6RB 4WW2C 5CBAA 1XIWA 3KPMB 3T3PE 2Y1VA 4YXHH 4RFOL 1G9NH 2FBOJ 1QG3A 5C0BB 3P40A 2RJMA 4IOIB 4NFCA 3PIQB 2F74B 3QEQE 3ZLQC 3O2WL 1FL5A 3TIDB 1GYAA 5AYUL 3V5DA 4MQXC 4YQXH 2X4RA 1PG7W 1FLTX 1CK0L 4P46A 4Z95H 4O9HL 5T3XD 2AW2A 2ADFL 4PUBH 4HG4K 3QQNA 2A6DB 4N68A 3MBEA 5CJBA 2DQDL 5C3TA 5A16A 1BWWA 1UB6B 4PTTB 3FRUB 5I1DA 4YPGB 4OD1H 4Y88A 3QCUL 3ZDZF 4OB5H 1QVOA 4HX1B 5IHZA 1KIUA 4JPKL 1JPGB 3WLWD 2YK1L 4D0DB 1ZA3B 3QIWA 4JE4B 5D7IE 5IJKC 4JN1H 4XCYB 1MFBH 1SEBB 4M6OH 4Y1AD 1DJSA 3BD4A 4XCNB 1A1NA 3PHQB 4PRHB 4KPHH 3TWCL 4P9HH 4RMQA 1ZMYA 2AQ2A 5JIPA 1LD9B 5HGDB 3WHE1 4Y4FB 4PJXF 2UWEB 1G0DA 1I9RL 1UEMA 4KRMB 4MQTB 5LGHH 5KSVB 1QFOA 2MMXA 5C09D 1RUQL 3BIKB 5DMKB 1IFHH 4PJ7E 1MCBA 3BEVB 3JWOC 1A6ZB 4OUUB 1F8TL 1M71B 4NT6B 5FYJH 1T20A 2AJ3A 1I1AC 3VXME 5CIPB 2DQHL 5I9QC 3FQUA 2VLKD 1JGLH 2NR6D 1VFMA 1FIGL 1MFDH 5FECA 3SDAD 2WP3T 2X09A 5ERWB 5HTSA 1DQJB 1EIBA 5A2IH 3NFPB 4DUWA 5IB5B 2YPKB 2EKJA 1IEAA 1FZJB 5TFSH 4HKZA 4KMTL 5E2VL 4KROB 1KACB 4L4VB 3U6RA 2QL1A 2IALB 4U2ZA 8FABB 1TNMA 4MX7B 4RDQG 3D39E 1J0JA 1K4CB 5IM7A 1CN4A 3RX5A 4PP2B 4ZD3L 4C57C 2X7LB 2M26A 2V2XB 1W0YT 4QXUL 2FHBA 4PD4J 5CD5C 1IGCL 4P3WA 3CDFA 4ODXB 3HG1A 3DROB 4M1GL 4MJ6A 5EUOF 3ZKXC 3MRIA 1JWUB 4PLKD 3M1BB 2VDLL 3CZFA 3EDDA 1EHLH 3HPJA 3P9MA 3T1FA 3RVWD 3JTSA 5L7XH 3M07A 4U1HA 5FB8A 4ZPTB 1CDYA 2VLMD 1MAML 2GYSA 4OZ4B 2AJYH 2XWTA 3U4BL 1R3LA 3LOWA 4LSRH 4HPOH 5IW1A 3VFMA 4PGEA 5JIHA 3I6LD 3TCLA 3GI9H 4LF3B 4OCRL 4L8BB 3TN0A 3D0LA 1Z5LA 3LIZH 3EJYD 4AEEA 4UILL 3QXAA 5EU7C 1FNSH 1W72H 5EU7E 3RWDB 5FA4A 5C0CE 1CDHA 1TXKA 3FCTA 1I4FB 4Y5VC 4Z77A 5FUOH 2F58H 4XZUA 5EH1A 4HG4J 4PB9L 4PJEF 1JTPA 3TBYB 5FFLA 4PGZA 2GITB 4FXGA 1HHKA 1U0QA 4UIKL 3BW9A 5FYKE 4QLRA 2WWMC 5I19L 3TV3L 5E9DE 2BVEA 1N4XL 2GJ6B 2ZUXA 4LCYB 5TDPA 5E2WH 3OJ2C 4G6JL 5IR1A 3LD8B 3AB0B 3BUYA 4TSAL 3K74B 5F21B 1ZK9A 1C12A 1I1RA 4F7PB 5HHMB 4XMKL 3VW3L 5F7EL 4PJBA 5LGJA 1TTGA 1BQSA 1AO7D 1H5BA 1H8SA 5D7IF 4B7LA 1I3VA 4L4JA 4TVPH 2H3NB 3BD5A 3MLSL 4U1SA 3SGEH 1YPZB 4JM4H 5D2NB 2ATPA 4CN6A 1OAXH 2FBJL 1OD9A 3NFNA 5BZWA 3J7HA 4C59B 3S9DB 4L5FH 4NUJA 3LKRB 2Z91A 1I1FB 5C6WH 3GUTA 5LCVL 4HD9A 4KRLB 3GGWB 3O3EA 1W0WB 3FB5B 5IW6A 4AG4L 1NBVH 1B0WA 3IDJA 1HHHB 4R4BB 1BQHB 3TZVB 3QULA 4P2QA 4KTEL 2VQ1B 4OZHE 1CXIA 2ITCB 2VDQH 3V6BR 4ODUA 2VH5L 4TTDC 3MLPA 2BDNH 3DVGB 2R0KL 1G6RA 1G0YR 5KSBE 2QADD 3VFOB 5EZOH 5MP6H 2BVPB 3V5HA 3K2UL 2VXVL 5EWIL 4NM4H 4RGMB 3QJHA 3P0VH 1HHGB 3X3FH 3PIQA 1A5FH 3SKOB 3FTGB 3VG9B 3SJVD 4PP1D 5F7HA 4D9LH 4YHZH 2QSCL 3VRJA 1RUML 1CGYA 5AAMA 1YNTA 4X7SH 5DC4B 1UACH 3CUPA 3C09B 1XR8A 3EOTH 4LSQH 4CBPA 2A6DA 4ZQKB 4JKPL 1P7QB 4OLYH 2QQKL 2EICA 2RFXB 1URLA 5SX5K 3WFBL 4YX2L 5KS9B 2PO6C 5F1KC 2CDEB 1PKOA 1TITA 3G08B 4QF1A 3T2NL 2R0WH 3QDJB 3Q5YA 3QFJB 2V7NA 4N5ED 1S5HB 2HTLC 4JVPA 1VADA 3IRZA 3F58H 3G6JA 2XFXB 4D0DA 3TJHD 3MRLA 1KV3A 1UA6L 4XBEL 2IEPA 4WHYG 3L3DB 1KPRB 3C60D 5BO1L 4WO4A 5HYFA 4MJIE 4UU9B 1UWXH 4PJAF 4IMKA 5BQ7B 2IH3B 4XCNA 2E27H 1A4JB 4PRHA 1OQXA 4UOW0 3EJZD 4WI6A 3VXOB 1IAOB 3K1KC 5J3HC 3DARA 5HGDA 3KXFB 2UWEA 5I1EL 4PIRF 5KSVA 3KYNA 3BDYH 3DX6B 2VIRA 1LILA 3FQWB 4X9IA 1RZFH 3NCJL 4KK9C 1HSAA 3IFOA 2VC2H 2AABH 4M9OA 2AGJL 4PJHF 4NT6A 2W0FB 2LU3A 5M95B 4RGOH 4KKBD 2JIXD 1KJ2L 5INCB 1S7RA 2VMFA 3HAEB 1DQJA 1BVLB 3DXAA 3K46A 1DQTA 2CIKB 3Q0HA 4WTZG 5DGRA 4L4VA 1XH3B 4B5EA 1G7QB 1OOAA 2IALA 4NJ9H 8FABA 4HUUA 5FAAA 4AT6A 2G5RA 1JF1A 4Q9CA 4DZBA 1K4CA 2MJWA 1JHLH 5CGMA 5J4MA 3MODH 3CVIH 1NGWA 3BP5B 4FFVD 4S1QL 4Z7WB 4UNUA 4E0RA 2ID5A 1GZPA 4YFDB 5I2IB 5FV1L 5TF1H 1IKNA 4DFIA 3EDJA 4KTDL 2F8VA 4QRPB 4QYOB 4U1KB 5EU3B 2BOCB 3M1BA 4XVSL 5FO8B 3QXUA 5K9JH 5HYJD 2VXTH 3HPLB 2HFEA 4MD4A 5DLML 5H8DA 5E6IB 2ZUQB 1OAYL 2DQIH 2D0GA 4LLYB 4OZ4A 4R90H 4JQXA 2EDTA 2XY2A 1AFVL 2Z35B 3OR7B 3BUTA 4LRIC 3NAAH 1KJMA 2FX9L 1HCFX 5DFVC 4OFVA 3QNZA 3ZZ1A 4CGTA 5KVDH 5EZLA 3SE8L 1N0LA 2P8LA 1FDLL 5E8PB 3RWDA 5C07E 3HCVB 3VXUB 1CGUA 3VWKC 5J1TC 3S36H 2G5BB 1U8KB 1YEGH 5D7SH 3TBYA 1LDPL 3QUXC 4M02A 5J0BA 2F54D 5M7QA 1X5KA 3QQ3B 2Q3ZA 4C56E 4XPHL 1YA5A 2OTPA 2YD3A 2DM3A 4LIQL 4CU7A 5DDHB 4JO1L 4I48A 5IG7B 4JFEE 3DIFB 2DMKA 1R3KB 4KK6C 3U0WH 3PGCB 2OQJB 3UJTH 3GBML 1MCQA 3IJHA 4IBLT 5HYSA 3GMQB 1O7SA 5IBUG 1FFNA 3LCYA 3DVNA 4KV5F 5DHVH 5JO5A 5GRUH 3WJLA 2QKIA 3I2CH 2H6PB 2P5WD 4S1SH 2W0KA 3K81A 3KNBA 5B22A 1K9TA 4OM1L 4FMFA 4JVWA 4L8SA 3S37L 3FMGL 4TUKL 4G7YL 1Y0LB 2J8HA 5DO2D 1TDQA 1OARL 1IC4L 5GHWH 3RHWK 1NLBL 1WZ1L 4HH9A 2A9NH 2HJLB 4LOUC 1UCBH 1W0WA 1RMFL 3FB5A 1QRNE 3IDMB 3MJ7B 3U46B 4WGWB 5AZEH 1XF3B 3BGFC 1J87A 1LVEA 3VXRE 2YRLA 1BQHA 2VQ1A 3RZCB 3C2SA 4HV8A 3RWJA 4P59H 2ITCA 2UY7A 5EIQA 5CEZH 1Q1JL 4YDLC 5K9QI 2HKFH 4QKXB 5D6DA 43CAB 3DVGA 2C3VB 3PL6B 3FFCA 4NFBA 2VDPH 3NABL 3LEVH 1RK1B 2IAND 4L4TE 4DQOH 4H25B 3KPSD 1E4KA 4IRSB 4NHUA 3BH8B 4PJCA 3DV6B 3SKOA 1A6VH 3FTGA 1YEKL 5SWZB 4JDZB 1S8DB 3MLVL 1F58L 3IAGC 2MQCA 1YMME 4E41B 4EN3C 4P3CH 1BVKB 3DI2B 4QRRD 5EUKA 1CLYH 2AQ3A 5GS0H 4EOWL 4XP4H 2A1WL 4O2EB 2HRPL 4YDVA 1L6ZA 1BZ7B 4JFYB 3V52L 4DW2L 1NAML 3QFJA 1YEIL 1OW0C 4F9PA 1YEEL 1IGFH 1FVEB 4OZGE 3AY4A 3K0WA 5T3ZD 2K7PA 4UDTB 4O51A 5F7FA 4YZFF 4P2RE 1FV1B 5IT2L 2H2PC 3ARGC 4CW1B 1FZOB 3GSVA 1LEIB 2X5PA 4L9DA 2A73B 4PJGF 1KPRA 3BMWA 5C8JA 3ULVC 3QCTL 4ODVL 2CRIA 2IH3A 5C0GB 1A4JA 2QSVA 4PYGA 1DVFC 4LSVL 1IAOA 2ZOLA 4CRPA 3MFFB 3JV0A 4R6UA 3VH8A 4J6RH 1XGYH 1I8MA 1U93A 1D9KA 4KHXH 1QSFE 1IAIH 1SVCP 4FQQB 5HHOE 3RVXC 4E5XA 1CLZH 1Q0YL 5C7XH 1YEHH 4XPBH 2AJZB 5BMFL 5BW7A 4HIXL 3O3AA 3L3KB 1IQWH 4NNPL 3UZEA 5J6HB 4XAKE 3C9NB 4ELMF 3OX8A 1DBJL 1QR1B 1INDH 3FT2A 4UT7H 5INCA 1NCCH 4GG8B 3HAEA 4NZTH 4NQUA 3MV7D 1BVLA 4MA7H 4M48L 3GI8H 2WUCL 4LLUB 1GXEA 4X5WA 1XH3A 2YA0A 1JMXA 1GAFH 1AXTH 3MRBA 4F15C 5FDYA 2XQBL 4ZS7H 4UINL 3P4MB 4LVEA 3ESUF 2VAJA 3F7VB 3CVHA 4MD0B 4OGXH 2XA3A 2BCKB 3Q6GH 1UYWH 4HUMB 4FQIH 1I9IH 4OLXH 2PYEB 5FHAL 2VXSL 1F90H 2DJSA 1OGAA 2X41A 4S1RH 2OL3A 4QRPA 4QYOA 4U1KA 1A0QL 3QIBD 2ICWJ 5EU3A 1K5NB 3ZSTA 2ZCLH 3L7EA 5FO8A 5J6GB 1OP5K 3ULUH 3B8SA 5E6IA 1T3FB 2XZCH 3UYRL 4PBVC 3QZWA 4WHCA 2I07B 1YEDB 2LABA 2Z35A 3WLBB 3G5YB 4JM2A 5E56A 4CL7A 1TCRB 4NKOB 5D7JC 4M6MH 4MVBD 1S5IL 1NCBH 4ODSH 1ETZB 5JORB 1HDMB 2HH0H 2X4TB 3TJEH 1OF2B 3AS3A 2J12B 3LHPH 3BKJL 3GJFH 1TJIH 4M4RA 5E8PA 1YY9C 4AZ8A 4FP8L 5F93C 4ZXBD 3BFOA 4FTVA 2L7JA 3LRSA 4EDXB 1A02N 4M1CC 1MJ8L 1OP3K 4M93B 2ZG3A 1WEJH 3U30B 1U8KA 1V3KA 1NCNA 4OZIF 1HWGB 5K59E 3MLUH 4APQD 2YPLE 3BN9D 3C5ZA 5TE4L 5JDSB 1N0XH 4F8TA 4X4ZA 4RIRB 5JPNA 4JKKA 1PEWA 3WKML 2KPNA 4NO3B 3T0DA 4NQCE 4AK1A 4TOYL 3BGAA 3DIFA 4XB8A 2O5XH 3AS0A 3U9PL 3PWLA 5FYLD 1CGSL 2PXYB 3PGCA 1XF5A 1AJ7H 1P2CB 1T22A 3RBGA 2XWBA 3MXVL 4O02H 2MTPA 4OV6F 3Q6FB 3HI5L 1RVFH 3PWVB 1SBSH 3MRRA 1NCWH 2H6PA 2HFGH 4OFDA 4LEXH 2E6QA 4F58L 1XR9B 4LK4A 2E6JA 1CL7L 1YC7A 4HK0B 3VFGL 1MCWM 2ADJA 4MXQD 3DVFA 2ZUSA 1U8NA 1JPTH 3SDDC 4D94A 1J0IA 3I9GH 2BZDA 5DJYB 2GCYB 3OJDB 3RZCA 1IT9L 4NQDD 2E3VA 2FEEI 4GW4B 4Y1AA 1WUNT 2ZUYA 5HJ3B 3FB7B 4WHTA 2M8XA 3EFDH 1QSEE 4I0CC 1NLDL 3BPNC 2NY1D 4K7PX 3PL6A 5ID1A 3GBLA 5C09A 1RK1A 3PJSA 5F9OH 2HT3D 2CLZB 3DV6A 1FP5A 3BRDA 4YK4B 5E1AA 2VLKA 5GJSH 5MEOB 4E41A 1CFNA 4KK5C 4XNUH 2YC1A 2I27N 4U6XA 4LGPB 3RKDC 1ITBB 4GAJL 3HR5A 3RWGB 5B38A 3GHEH 4CJ1A 1FNGA 4ONFH 5GGVH 3L3OA 2VZ1A 1C08B 1FVEA 1DDHA 1HEZB 1FV1A 4IJ3B 1RU9H 1NCUA 1JGUH 5E2TL 3ULUF 1WT5A 2NY6C 4K55A 5BZDA 1P1ZA 4QGTA 2ZSWB 3HUJB 3NMEA 1N3NB 4PJIE 3SE3C 2OK0H 2D03L 1I7TA 4MQXD 3BZFA 4IOSD 1SJXA 3L3HA 3QWOB 4OQTH 1Q0XL 3ARBD 1UEYA 4RFNC 2CUIA 4YHOH 1MWAA 4FQCL 2IFFL 4MSWA 2BFVL 3OKOA 2DM7A 1YY8A 1CICC 1E28B 4ALAL 3O3BB 1Z9LA 1C1EL 4QNPF 1UC6A 4O58H 1G7LB 1JNNH 3L3KA 2CKBA 5J13B 5EG6C 5JW4Q 3C9NA 4JO4L 25C8H 2FSEA 1JZ7A 4XVJL 4XP9L 2HT4C 3UO1L 3NTCH 1JGDB 3HNSL 1QSZA 1WZLA 2YR3A 4MD5B 3WHXB 1EGJL 2MCG1 2BK8A 3H9SE 1RIVL 3VMOA 4K8RH 1A9BB 5BRZD 3WUWG 3KLDA 4F8QA 3HZYB 5DQDH 2W07A 4KI5C 1A7RH 3IFPB 3R1GL 2JELH 5EZIH 2ESVD 3O6FB 5B3JF 1IGJB 3EO1B 4PV8B 2FO4A 2VXQH 1AQDA 2F5BL 4EIGB 1TQCB 3BZ4B 4MD0A 2K7QA 4KC3B 2BCKA 5I73B 2J6EA 1R3JB 4UT9L 2EDYA 4O2FA 3THML 1I1AD 2XZQH 5HDLA 1H3UA 1NGQL 3D2UD 4FNLH 5L9DH 2WIMA 1FZKB 1U95B 3MRJB 2YZ1A 5J6GA 1OSPL 4EIZC 4LSUL 4KKAD 5LG1A 1CE6B 1MF2H 1T3FA 5IVXB 1AO7A 3OXSA 5J06A 1KB5L 3BSZL 2IBGA 4MNGE 1N6VA 5CBEB 3WLBA 3F5WB 3KR3L 15C8L 3JV6B 4IM8A 5JORA 2X4TA 5DGQA 5JQHC 1B2WH 3STZA 2LU4A 1T1ZA 3HTLX 1W8NA 5CD5D 4HZLB 2DTML 4NWTL 5ILTL 4Q2ZB 3HNTH 3T4YB 3S35H 3FONB 3LZFL 4KFZC 2WV3A 3EZ8A 3PQYB 4FQ2L 3SGJC 2Z8RA 1PKQE 3H42L 4JQVC 2R56H 3W11C 1ROWA 1FIEA 2I60H 4PRNA 5JDSA 1F4WH 3TNNB 3GJEA 3IJYB 2A9MH 2XICA 4F9LC 2FL5B 5D7LD 1QPXA 3N1GC 3PXJA 4X5LA 2OYPA 4P9MH 4U0RC 4H5SB 5IEKB 1QACA 4YXHL 4JY6A 4G9FB 4HBQA 4JPWH 4NO3A 4WFGD 1ZT4B 2CH8A 1G9NL 1DL7H 4I18B 2EE6A 2PXYA 3QUZB 3PP3H 1P2CA 1X5JA 4QRUA 5ANMB 5T1KD 3S88H 1MFNA 1WCQA 2DQCH 4L3EE 2N56A 2GIYA 4YQXL 5ISZD 1DBBH 2NY3C 3ECBB 4HIJA 3SJVA 1ZGLP 4Z95L 1B9ZA 4LCWD 1H15B 4YGVA 4PUBL 1JN6A 4DWHA 2XYCA 4Z9KB 3MJ9H 2DBLL 2IC2A 1V3MA 4R2GD 4OM0H 1QRKA 1RJCA 4PJIF 1NCAL 2W9EH 3LKPA 4WGVB 2K1MA 3QB7C 2MHAB 3T3MF 3WS3A 4HK0A 4OB5L 3E6FA 4J3XA 3RDTC 5F6HI 3G04A 4ZUTB 3KJ4B 1YUHA 4JN1L 3QQ4B 1MFBL 1FFQA 4M6OL 1G7HB 3C60A 2GCYA 1DUZA 3RTQC 1H9VA 4KPHL 4WU5B 5EOCH 3G5ZB 4N0UE 3RRQA 1M6OA 3RWIA 3MLZH 4LPXA 3W0WB 4QGYA 3QNXA 5LGHL 4KQ3H 4CKVX 1QHPA 5HVHC 3V4UH 1A2YA 1IFHL 4EBQH 3R06A 2C1PB 4RAHA 5GRYA 4RGND 2UUDK 5FYJL 2A6KB 1EAPB 3QHTC 5GZOD 2N4IA 3MLRH 1JV5A 1MFDL 4P2YA 4J1UB 4WRLA 3OR6B 1T1WA 1DANT 3LPWA 4PRID 5I1GH 5BOZG 2EDNA 2X4UB 5TFSL 2FO1A 1WIUA 4R0LA 3RGVC 3OGOE 5F6IC 4Y5YC 3I6KA 4X8JA 3EYOB 3RWGA 3FQNA 5JPMB 3PWNA 3F7PC 4TTDD 1KPUA 1FRGH 3EZJB 2FH8A 4YUEH 1C08A 1X5GA 4U7MA 5F9WC 3QEGH 4U1IB 4UQ2A 1KIPB 3MGAA 4GG6A 1X9QA 1DN0A 1FAKT 4Y4HC 5HYIA 3LEXB 1BD2D 5C9JB 3QT2A 3QWOA 4HKBA 1EHLL 5KSAC 1RZGB 5L7XL 1M4KA 4M8QA 1BEYH 1MHCA 1ZGLM 5HYJA 1JPFA 5HYQB 3I02A 4LSRL 2VB5A 3WXVH 2PO6D 4HPOL 1G7LA 4W6YB 4KK8C 3KVQA 2VITA 1MCOH 4X6EB 2X42A 2HTLD 3LIZL 1WFOA 4X9GA 3PGFH 4R96B 4X7EC 5A3ID 4XCFH 5BS0E 2LV4A 1FNSL 1W72L 5I15H 3NCFB 4MD5A 3MQIA 4PJDE 4JFPA 4OFPA 4X6CB 5D9SB 1L7TH 3O2VH 5ITFA 5FUOL 3GMRB 2F58L 3EDEA 3QJFB 3MRKA 2AV1B 3V6FA 3MV01 1JJUA 4F7EA 2YXMA 5FYKL 4Y16B 3WD5H 4HIEB 5J3HD 1BFVH 1Q94A 3RL1A 1G9NC 5DJZA 4F3FB 4ORZC 2F54A 3GMOA 1IGJA 4PV8A 2ATKB 5D1XC 2IG2H 4KK9D 5E2WL 4BSWA 4C4KT 3HLAB 1TQBC 4RWYH 1QEWB 2EYTB 5DVKA 3RY4A 3UTTD 5GIRB 1FZKA 3BZDA 3DO7A 5I8EA 2VYRE 1TLKA 1FG2B 1NBYB 3FHQA 4QRTA 3TM6A 1CE6A 1RZJH 4GQPH 3UPRB 4TVPL 3QDAA 4IRJB 4NN7B 5IVXA 3MNVB 5I16A 3T0EC 1F13A 2HTKC 4JM4L 3T0EE 1OAXL 4M7ZC 5I18H 3E8UH 5KN5A 4L5FL 1FH5L 3KPNB 3B9DA 3IDYC 4F2MA 1X5AA 2L7UA 1JP5A 5AG8A 5J12B 5DVLA 4P9HC 4V2CB 4OLZH 5IW3A 1FJ1A 2AXFB 2JJSA 2W65B 4PFEA 5I1LB 3ARRA 1NBVL 4Q2ZA 4QHNA 5IROA 4LDLB 5E00A 1R5VA 1ONQB 3O2DA 2VDQL 4J3VA 4ZUVB 1H3TA 4LPUA 5HY9B 3NIDE 3QO0B 5HPMA 2KZWA 4HCRH 4KZDH 4PS4H 3TVMC 2I9TA 4U1MB 3TNNA 2BDNL 3BE1H 2ZJSH 3GM0A 4LKXA 3P0GB 5EZOL 1QLFA 5MP6L 2WSKA 1JYNA 2LVCA 4G9FA 3UTPD 1ZT4A 1XGRA 4NM4L 3P0VL 3X3FL 5DFVD 2IANA 1A5FL 4NHCH 5H94B 1V5JA 3UXFA 5C0IA 3KPSA 4PJFE 4D9LL 4YHZL 1QKZH 1HYSC 3UTSB 3OV6A 1R0AH 1EFXD 5DHYB 3VWKD 4FG6C 3VXQB 5IQ9B 1TMCB 4X7SL 1UACL 4LSQL 3EOTL 2OJEB 4OLYL 3EYVB 4QRRA 1Q9OA 3T65B 2CXGA 2HFFA 1AIFB 5E4IA 5DD6B 3VI3F 2MHAA 2R0WL 1HXYB 3HC4H 3DETC 3QWQB 3F58L 2MKWA 1BZ9A 4ZO9A 4Z0BH 4ZUTA 2LU7A 3FO0H 4KK6D 2OMNA 5F7NC 3H7BB 5E8EB 3ZE2E 3QEQB 2XNAA 4J12A 2JB6A 1J05B 1HHJA 5HI4D 4HUVB 3OF6D 1E4XI 4BUHA 1C16B 4OCXH 2E27L 5FOBA 2K9UA 3WN5C 1OD7A 1QO3B 4JREB 4WU5A 3ARDC 1LEGA 1KT2B 4PJDF 1KIQB 2Q76A 5DEZA 4JKMA 3LMJH 3BDYL 4PRDB 2OBGA 1KUMA 4LLVA 5E95B 4DVRH 1RZFL 2VC2L 2AABL 5L2KD 2HJKB 1KJVB 4HUXA 3RJDA 1EAPA 4RGOL 1Z9SA 3S5LB 1EJOH 2A6IA 1P4IH 4LOUD 5F3HB 1F3JA 2GEEA 3D5OF 2HVJA 3K4ZA 4OF6A 4UQ3A 5B8CA 3S98A 4G8GE 2X4UA 5BRZB 1X4XA 2Z92B 2H32H 1OLLA 4NJ9L 3V8OA 2D2OA 1AGEB 3F12A 3G5VB 3PG2A 1JHLL 4Z7UF 2BVQB 2DB8A 4R97C 5DQJB 4LBEA 3MODL 3CVIL 5F1OB 1ZLWH 3ROLB 3RI5F 1A21A 43C9A 2EDKA 4PJ7B 4XC3H 1T0PB 1NEUA 4NZRH 4LL9A 5TF1L 3P73A 3VXMB 4NQSB 1D5ZA 2V2TA 5EBWA 2FEDC 1C5DB 4NBYB 1P9MC 1WBYA 4EI5C 5K9JL 4EN3D 2VXTL 3B43A 1B6UA 1DLFH 5GS1A 2DQIL 2BNRD 3ZT6A 2FIKA 4R90L 5FHBH 2X70B 5EBGA 1JZ6A 5LGKA 3GRWA 4Y2DD 4G6FD 3NAAL 3LQMA 3P77A 4CJ0A 5C2BH 4DGYH 3ZTNH 5KVDL 3NCEB 3O4OC 2H2PD 3UBXB 2WLZA 2Z8VC 2XRAH 3U7YH 4IS6A 4KKNA 3V6OC 5D9SA 4NO0B 3S36L 4X6DF 1MCPH 3ULVD 5KBNC 2AV1A 2ZUVA 1U8PB 5IIEB 1YEGL 1DVFD 4LPTA 2EXWD 3D3VE 5D7SL 5J9PB 2NY4D 5FKAA 2P8PB 2EH7H 4APQA 2IMNA 3DV4A 3SDXE 3VFTB 1NJ9B 1TETH 1IC5H 2JTDA 3HZMA 5TE7H 2CGRL 3PP3K 3HLAA 5E0QA 1HQRB 5F88A 2JLLA 3KLAB 3UJTL 4CVWA 3KJ6L 2J8UF 3WMSA 4WJ5A 5C0CB 3G6AA 3PDOB 2PNDA 4X6BA 1FG2A 1ZWIB 5GRUL 4DZ8B 2G9HB 3I2CL 2GTZA 4S1SL 3MNVA 2Y72A 1CVSC 4JRYD 1Q9WB 3JTTB 4R8WH 1JRHL 5A2FA 3IJSB 5B39A 4P23B 4BH7A 4XPFH 1EVTC 3KPNA 4TRPH 5I1HH 1UKSA 2ICEB 2XZAH 5E9DB 3UTQB 2A83A 2BHUA 2CRMA 1N8ZB 2A9NL 4W68A 4X0KA 1UCBL 1JF5A 4LMQI 5AZEL 1X6LA 5I8OH 5ICXB 3HG1E 2DIBA 2HKHH 2V2WB 4HXAH 3GSRB 4LAQH 1LEKB 3BP4A 4L9LA 2J4WH 4LHUD 1ONQA 1HH9B 4P59L 1B90A 4JDTH 5CEZL 5E8DH 4GMSH 2VABA 3CZJA 2HKFL 3MRQB 2CXKA 4HLJA 3DUHA 1CFSB 2VDPL 3M17B 5KAQF 3GSQB 2YRZA 3LEVL 5ELIA 3HZVB 4DQOL 4GSDH 5D7JD 2BMKB 5I1IH 1NC4B 3PP4H 5H94A 5I1AA 3O9WC 4CNIB 4HW6A 1KB9K 3QFDB 5FUCC 4IIQB 5FGRA 2B5IC 5FCSH 1YY9D 1ADQA 3UTSA 5IQ9A 2JCCF 4P3CL 2IF7A 3LN9A 3Q48A 3ZL4H 1CLYL 5GS0L 4NQXB 4NCC1 4HDIA 4XP4L 2H8PA 3H9HA 4H8WH 4OZHB 5DWUH 1YN6A 3ILQC 3LN5A 4ZO7A 1AIFA 2D9QB 4MJ2A 2EDDA 3ALWA 1HXYA 4XNYH 3H9YA 3FQTA 2PYFA 4WWKB 1IGFL 3AMLA 3E3QC 4Z78A 5KSBB 4QXGH 4WW2A 3BPLB 3TESA 4GW1B 4NM8H 1ZT1B 3IDNB 1J05A 4ZUUB 4HUVA 3IKCB 2BNUB 3FT3A 1QO3A 3SO3B 3KYKL 2JF1A 4PJBE 1FCCA 2M2DA 4J6RL 1XGYL 1KT2A 3BGMB 5JZ7C 1KIQA 2C4FU 4KHXL 3EYSH 1CLCA 1IAIL 1T7YA 3C8KB 1FFPA 1CLZL 1HIMH 3S7GA 1YEHL 4XPBL 2DM2A 1GIGH 5C7XL 5DFWH 1IQWL 2CR6A 1KJVA 1NBZA 4YR6A 2X4NA 4YXLL 1INDL 3P9WB 3FFDA 2BSED 4ZO6A 4UT7L 1CXHA 1MCCA 4ZUSA 1I9EA 1EX0A 4Q0XH 5ESAB 3SDDD 4NZTL 4JHAH 4MA7L 4M4PA 1MLBB 3GMNA 5IB3A 1I8KB 4NO5A 4MJIB 2KH2B 5IJKA 3GI8L 5BRZA 3ARXA 4P2QE 2XTJC 2Z92A 1GAFL 1AXTL 1G6RH 2IAMC 2ZOKA 1AGEA 4DTGH 4NQTA 4EUPB 4ZS7L 2AEPL 1T2JA 2EC9T 4G9DB 3H6JA 4OGXL 1BIHA 2CK2A 3DBXB 1UYWL 4QXTB 1JK8A 3RI5K 3UJJH 2DWEB 3AVEA 4FQIL 1I9IL 3L3IA 4OLXL 1F90L 3MR9B 3S6CA 4NQSA 4XX1G 1I1AA 3MTRA 2KL6A 3BEWA 1U36A 2Q86A 4GXVH 2ZCLL 4RSVA 3IXAA 4MA1C 4KK5D 3ULUL 4U1NA 2XZCL 2WK2A 1NMBH 4Z0XB 3RKDD 2X70A 3O6MH 5BVJA 2CK0H 3TBTB 2ADGB 3MNZB 5LKNA 3SQOH 3NIFE 1VENA 3OGCA 4M6ML 4HS3A 4N8VG 1NCBL 4ODSL 3A6CH 3OBAA 2HH0L 3TJEL 4JRXD 3LHPL 1TJIL 3G6JE 3UBXA 3DNKA 3KWWB 1KB9J 2NY6D 1Y6KR 3WE6B 5JQ6H 4K9EC 3S8WA 1WEJL 1U8PA 2NNAB 5MERB 4NRYB 4E9LA 3HC0B 3MLUL 5J9PA 4HIHA 1F2QA 2P8PA 3PWJB 4XB7A 4BA8A 1LE5A 2UWEE 1N0XL 1T5WB 1UB5B 1WBZB 4P57A 1P4LB 3JBG7 1NJ9A 2X1QA 3MUZ1 5E7FA 5CIPH 5D7LA 1WV7T 2CDGA 2PTUA 3N85H 2O5XL 2F19H 3BYYA 2DD8H 3FO9A 1AJ7L 2HT4D 4JKLA 4GXUM 4JB9H 1QP1A 3PE9A 1FFRA 2BVOB 4O02L 5T1KA 5C07B 1T04B 2YKLH 3EO0A 5ISZA 3VXPA 1RVFL 5C0EB 3DXAE 1SBSL 4XHJD 1TVHB 4LCWA 5TDNB 1NCWL 2HFGL 4Y5VA 3BPCA 4NUGH 4X9FA 4YFLI 2HN7B 4LEXL 4KI5D 5F1IB 4JG0H 2DMBA 1UXSA 2GK0A 3QUXB 3CSYB 3PV6A 4C83A 4EI6A 5D1ZD 3IJSA 4C56B 2UVFA 3TPUA 2QQLH 1EH9A 2XI9A 4I0PB 1HILB 4XT1C 1R24A 4DGVH 1V8HA 2GJZB 4JFEB 1JPTL 1MSPA 2O5YH 2PW1A 3LN4B 2Y6SD 5EN2B 3I9GL 2BSRA 3IGAA 1IEHA 4Y5XC 1CFBA 1RHHB 4JZOB 5AZ2H 2XN9D 1U42A 4P2OC 3U36A 1BPVA 2OM5A 2PR4H 2O93L 4P4KD 1DEEA 1CFSA 1U58A 5DA4A 3GSQA 1FL3B 4NRXA 3HZVA 2D4DA 2BMKA 1AGCA 5F9OL 3WEXA 4PV9B 1NUNB 4YH6A 4FQPA 5GJSL 3CSGA 5KAQG 1F3DH 1QRNB 3MRPA 1GOFA 4XNUL 5E94A 3VXRB 4HUWB 1G7JB 1Q72H 4NDMB 4PRIA 5DSCB 4JQIH 1XGPA 1AGBA 3GHEL 1HKFA 2R1XA 2OTUB 4ONFL 3BP7A 1G1CA 4NKIH 1EMTH 1FO0B 3I6GA 5GGVL 5DUBA 5EB9A 4BM7A 5B4MC 1NEZB 5T1DL 2WBJB 1RU9L 3DECA 1JGUL 4L4TB 3QUMA 5F71A 4MXWH 4GW1A 2NXYC 1SYSB 1K4DB 3B9EA 1JHTA 3OB0K 1KC5H 4EDWH 2R1WA 2OK0L 4K7PY 1A9EA 4PJ5D 4OQTL 3WDJA 2EDJA 5EC2B 1S7VB 4NN6C 3LQAH 1ZLVH 1YMMB 3CH8A 4G8FA 4YHOL 3DGGB 3W39A 1WAAE 3MV9D 3BGMA 2EIDA 3H9ZA 5DZLA 3GSXB 1OHQA 4KUZL 5C08D 1KXQE 4O58L 5FKPA 4LLMA 4BFIB 1JNNL 5JW4M 2PO6A 1NMCC 1EEYA 3T4AB 5CD3A 2UWEF 1F4YH 1HOCA 3NTCL 4GKSA 4OZGB 3VXTA 3RDTD 5BJTB 4P2RB 3ARGB 1L7IL 1D5BA 3EOBB 4HIIB 4K8RL 5CSZB 3S4SG 5ADPH 3IVKA 4M7JH 3RTQD 4YFEA 4M7KH 5DQDL 1EZVY 1A7RL 1GHFH 4HWUA 2EXYC 2JELL 4EUPA 3O8XC 1UJ3B 5EZIL 4CN1A 1GRWA 4R7DB 4JJ5A 1QSFB 5CP7A 3MUGA 2VXQL 2FGWH 3C5SB 3LV3B 5HHOB 4GXUN 3FFCE 5GZNC 1KFAH 2PCPB 4QXTA 5FYKU 2DWEA 5DMGD 3ROOB 4LCUB 1EUTA 2QLVB 3DX7B 2GSGB 2XZQL 4PJCE 5DD3H 4FNLL 4NBZB 5L9DL 4AJ0A 3DMMC 7FABH 3HMXH 4JFFE 4DN3H 1YJDH 3UTTA 2F8XC 1BIIB 3QEUB 5BCAA 1MF2L 3WO3B 3RGVD 3MMEA 3WL9B 2AAVA 4C54A 4Z0XA 1MRFH 4FQ1H 1HQ4B 4OF5A 3S3JA 4TUOB 3MRNB 4F15B 5A1AA 4LDOB 3LKQB 2BXZA 3BWAB 1ZS8B 2NXZC 4LHJB 4PLJC 1S7QA 4X83A 1B2WL 4R4FH 5KSUA 3TBSB 1MIMH 3MRHA 1F42A 3BP6A 5F6HJ 1J11A 3KWWA 2VERN 4Y4HD 4AM0B 4PR5B 2ZSVB 3WE6A 3HNTL 3BHBB 3S35L 1O7VA 2AV7A 1LHZA 4IRZL 1AHWC 3QQ9C 2R56L 3RGHA 4XVTH 5C0AE 1S7XA 3V0AC 4QWWC 3SOBL 3PWJA 2I60L 5AUMB 1D6EB 4JGUA 1F4WL 2ADFH 4GRLC 2A9ML 5F96H 1UB5A 3CX2A 3QIUC 4XNMB 1P4LA 4P9ML 3T0BA 2LTQB 5L8KB 4JPWL 4KUCF 5I76A 4KK8D 1DL7L 5HHNA 2EEDA 1S78C 4LRIA 3HAEH 3P30H 3S88L 5D7JB 3MGOA 3ZYZA 4DK3A 3FZUC 2DQCL 35C8H 1DBBL 3S34H 1H8OA 4Z18A 1T04A 3MNWB 5CEXB 2EYRB 4W4OC 1I3GH 1EFXA 4PGDA 1S9VA 3VWKA 1Q8MA 3SPVB 3FL7A 3MJ9L 5F72S 2VR9A 1OPGH 3GJFB 4OM0L 4OZFA 3DUSB 5EBMB 1X44A 3B9AA 3GDBA 2P8MB 5F1IA 1FBIH 3CVHH 3CXHK 5F1NB 3ZE0F 2YPLB 1LK2B 3QUXA 3CSYA 5I8KH 2VZVA 3GO1H 1EDQA 1JZ3A 5FA3A 4N1CA 4F7MB 3QDHA 1QR4A 4PRAA 4NQCB 1G84A 1K2DB 2OL3H 3N1QC 1YPZF 3LN4A 1CDJA 1MFCH 1LE9A 3JUZA 4GUPB 2P7TB 3VGHA 3QPQC 2YOCA 3ZDYE 1OGAE 3BQUC 2P44B 4QRPE 2QSTA 1PZ5B 5D5MB 3OF6A 5EOCL 5FV2A 4LSSH 4NO2B 3MLZL 5JW4N 1FL6B 2CRYA 3T0XA 4KQ3L 3C6LB 2P1YA 3D0VB 2HTKD 4G43A 3V4UL 2A0LC 3ISWA 3MX0A 4EBQL 3MA9H 3TA3B 4P5KA 1A1OB 4PBWD 5L2KA 1XCQB 2DM4A 4LLDB 3IDIB 1U8HA 4PYHA 4EJ1C 1MJ7H 1HE7A 3WDIA 3MLRL 1Q9KB 1N5AA 2VDNH 3HI1A 5C0DB 4WI3A 4FTVE 3RIAF 1IE5A 1MI5E 2P5EE 5I1GL 1IM3A 4KU1A 4OJFH 1B0RB 1U92B 2DQTH 1A22B 1BLNA 4GJTB 2VDLH 4V1DD 5FYJD 3TVMD 1UZ6F 2JK5B 3KYMB 1FRGL 1QSEB 1JVKA 1FO0A 4ORGB 4I13B 2FLBT 4YUEL 1G0XA 3P4NB 4LNRB 3QUKA 3QEGL 3BPNB 4JPIB 1KJ2A 1Y6MR 5DFTA 3HN3A 5KS9F 5GPRA 1NDGB 1U9KA 1K4DA 5I71C 1T21B 3U82B 3MA7A 1XGTB 4UILH 4EXKA 1HYSD 1HXMB 3W5MA 2B4CC 5EC2A 1S7VA 5HDQH 4Z7OF 2HJFA 4FG6D 4D8PB 4N8CH 4FZEH 3BJ91 4EN3A 5T3XE 3JXAA 2DS4A 4XAWL 3WXVL 2N7AA 2NY0C 2BNRA 4D0BB 4NZUH 5IFJA 2FRGP 2AVGA 1ZXQA 4XNXH 1MCOL 1DEDA 3DETD 3T4AA 3KYOB 3PGFL 2A74A 4OZGA 1OW0A 5I30H 4XCFL 5BJTA 1AXSA 5I15L 5A43C 2R1YB 4HFWB 1L7TL 5E99L 3O2VL 5BV7L 1T89C 1J0KA 2P24A 2M1KA 3FOLA 3WD5L 3TO4C 1H3VA 4NYLA 1DANU 2DI7A 4Y1AE 4X4YB 1DVFA 1YECH 3KYAA 1AGFB 3WIHA 1OCWH 3SKNA 4NQED 3CXHJ 1CICB 2IG2L 3LV3A 4JANA 4WUUD 1S9XB 2PCPA 5C09E 5KOVC 4OCMC 3VCLA 4RWYL 3LKNB 3DX7A 2GSGA 1F6AA 2G75A 4Z7WF 2P49B 2VLKE 3H9SB 3SDAC 1DQML 1K8DA 4JAMA 4V2BA 3QEUA 4OGZA 1RZJL 4EZMA 4NCDA 5I66B 2BNQD 2H9GB 2CDFA 2EE3A 5I18L 3E8UL 4P3DA 5DT1H 5D2LA 1A47A 3VFVA 4ZPVA 3S96B 5J8OA 1DR9A 1SMAA 3TBSA 4JZJC 4OLZL 4F7CB 3AS1A 5HXMA 1MY5A 2F15A 5DJ6B 3MZTA 4IEFB 4TVPD 3H8NA 5F7YC 2FEDD 1IGMH 4BSVB 3LEYH 1X5IA 4LHUA 4EI5D 4PLKC 1LO2L 4HCRL 4KZDL 4PS4L 5AUMA 2EDLA 2HLFC 2VZ3A 1KULA 2AS5M 3BE1L 2ZJSL 2CKBH 3DTXB 4XNMA 3REWA 4K7FA 2VLME 1IJ9A 3Q5TA 4MNGB 3WFBH 1QUNA 1RHFA 4NHCL 3VFPA 1MRDH 3GSOB 5D7JA 3I6LE 2X44D 2BXYA 4CVXA 2C3XA 1QKZL 2JE8A 1MHEB 1R0AL 4HZAA 2PN5A 2GW5A 2EIEA 4LLQB 1E4WH 4Q58C 3BDBA 4ZAKB 5EBMA 4YGAB 2P8MA 4D9QD 1LK2A 1IGYA 1KG0A 1NMAH 2J6EH 3HC4L 4A6YB 1KCUH 1S7WA 2CJUH 2W91A 3FB8A 3CH1B 3VD9A 4QOKD 2DQFB 4Z0BL 3NIGE 4U0RB 3CGTA 3FO0L 3X12A 4WEBH 3ZKMD 3CFEB 4NPYA 4GUPA 1FVCB 3RPIB 2Y25A 4LDEB 4YAQB 5TH2B 5D5MA 4OCXL 8CGTA 2OR7A 2NY3B 1NAKH 4RISH 5BXFB 1FE8H 2W9DL 3LMJL 1NAMA 4GAYB 4NFDA 4PG9A 1AO7E 4Q9RH 1U3HD 4DVRL 1QNZH 2NY5C 4LLWA 4BZ2H 4JO2H 5C08B 2CSPA 5IMLB 4OD2A 1G7PA 3IDGA 1EJOL 1P4IL 4JN2B 5JOPD 1Q9KA 5C0DA 5LBSH 5ESVB 4Q6YA 2E9BA 3SDDA 2AJVH 4N0RA 4MNHB 1ZV5A 3RIAK 2EE2A 1U92A 4HJGA 1U3YA 3B9KC 5DJCB 4N0UB 4DOHE 3RNKA 2DI8A 1YDPA 2WNGA 1XT5A 3PGDA 2JK5A 3KYMA 2A77H 1QSEA 4ORGA 4LHQB 5E4EC 3AS2A 3RNQA 1KBGH 3GHBH 3P4NA 1XGQA 2F53D 2XACC 4Z7QE 4XC3L 3TFKC 4YHLL 3Q3GB 4NZRL 2MCPH 4I9WD 1ZHBA 2VKWA 4ONOA 1GGCH 4QY8A 5MI0C 1REIA 3SJVE 3AROA 4R3SB 2VWEE 1DLFL 1ES0B 1TFHA 5F3BB 4MDIB 5B3NA 3D85B 4HC1H 2OSLA 3ILQD 4L29B 5FHBL 2XKNB 2NW2B 5T5NF 5EBLB 4D0BA 1NC2D 4Y5YB 5GRVK 2E7CA 4XBPB 1HYRC 2VUOA 5C2BL 4N5EC 4DGYL 1BBJB 3T04D 2H45A 3ZTNL 4YHPA 1ACZA 4LIQH 1E27B 1TTUA 5GGRY 5IJVA 5F9WB 4RNRB 4JRXA 2XRAL 3U7YL 3QUYB 3UMTA 3TJHC 1T80A 5CEYA 4EVNB 1MCPL 3FN9A 5EO9B 5DK3A 4JDVB 4JY5H 4X80H 2F8OA 3RUGA 3W9DA 1UZ8B 5GGRB 3R8BB 2GY5A 3U0PA 4FMKA 1R5WB 4X4YA 3R0MA 2EH7L 3C5JA 5JZ7D 4JZNB 5FO9B 5KSAB 3WO4C 3KPQB 4Q6IB 4U1GB 1TETL 1IC5L 1QSVA 1KN2H 1RJLB 1AH1A 1ZSDB 3HS0A 2BOBB 3WIIL 4YC2B 4XNZB 2LVEA 1DUYB 5AYQA 3EFFB 1OARH 2VLJD 3EHBC 3CXDH 5KZCD 5ETUB 3W81A 1WZ1H 5DJXA 2Z4QB 2A2QT 3IS1X 5KW9H 3H3PH 3GMLB 3QAZC 3K7UA 4CAGA 2XTJD 2Y7QB 2VLLA 2IAMD 1OY3B 4I2XA 5ALCH 3ULSB 4R8WL 2H9GA 1U8JB 5BV7B 1G7MA 4WEMB 4XPFL 2GFBB 3P0YH 4TRPL 1VEOA 5CSGA 2XZAL 5CKAA 5I1HL 5D1XB 2VZSA 4P49A 1GC1C 3GMPB 5IBUB 1WIOA 4F7CA 2VZTA 4GG6E 5C1MB 4YXKH 4L1HA 3RVTC 5I8OL 3QNYB 1RULH 2HKHL 4HXAL 4H1LB 4LAQL 2BVYA 2J4WL 2VL5B 3LVEA 5CMAB 3ORJA 3QO1B 4ZUWB 5HGGS 2JKXA 4J3WA 2B1HH 1UH4A 3HE6C 3D25B 3NCBB 4GMSL 2O61B 1MJJB 2XN9A 4BZ1H 3QI9C 4WV1C 1CG9B 2VE6A 5HYJE 1PG7H 2DLTA 1KNOB 5GGSY 4MNGA 2HRPH 3T0EB 2MQ3A 1S9YB 4TPRH 4GSDL 4PJ9B 4U1LA 5L6YH 1CD1B 4Z5RB 1C8PA 5I1IL 3PP4L 5ICYB 7CGTA 4U33A 3L3JA 5D1QB 3ET9F 3SCMD 5CEZD 4G7VH 5IWLA 1YMHB 3NZHH 3QDGD 3T77B 1INEH 4Z7QF 1WZMA 4LLQA 3ZL4L 1T83C 1VKXB 3HE7C 4H8WL 5DWUL 1OT1A 2ARJQ 1I9JH 4JQVA 3MRGA 2W92A 4V1DB 4XNYL 1NANI 4YDKH 2F54E 3SE4C 4I4WB 3FAWA 4FQXC 3CH1A 2R2BA 4F9LA 4PRPD 2CO7B 3HHRB 1XF4B 4G42A 5CWSB 1T7XA 1T5XA 1HZHH 1AP2B 3IFNH 1OTSC 1UENA 1JI1A 3JWDC 4NM8L 1FVCA 1A7NH 4PJFB 4KRPC 2NLJB 5F7DB 1L9NA 2FR4A 1DBJH 4YAQA 1Q9LA 3FN3A 4FFZL 3VU2A 1FHGA 1BGXH 4PJ5A 5GRJL 5C6PB 3KPPB 2AK4D 1JZ2A 2OTWB 1IKFH 2ERJC 3EYSL 3PABA 4M00A 3MV9A 4HKJB 3SKJH 4XPGH 5IVXE 1ULVA 4ZTOH 2P5WE 1HIML 1GIGL 5K9KA 5IEHB 5C08A 4QEGA 2ZPKH 4MJ5A 5DO2C 3U79A 2C1OA 5J56B 2FHFA 3RDTA 4Q0XL 4JHAL 2NYYC 3HRZB 3QHFH 4Q97A 4GLRH 5IB2A 2XY1A 1S7SA 5CZKA 1G6RL 3RTQA 2IADB 3WFHB 4DTGL 2E6PA 3ARDB 4TN9A 4PJXA 3HFMH 1VEMA 2XPGB 3UYRH 4UTAH 3HNVH 3LKOB 1PDKA 2G60H 5DJ8A 1F02I 4Y4KC 4MAUH 4G9FE 3GFUA 3UJJL 5IMMB 1AKJD 1EGJA 3IAQA 1I8LC 4R7NA 5F89B 1TPXC 3WIFB 2IANE 5EDXA 5E5UB 3KPSE 2Z9TA 3RZWA 4WTZA 1ZVSB 4GXVL 3QRGH 2UYLB 1CDGA 4RMWA 3QPXL 3U2SB 5FUZH 4OF0A 4E42B 3CPLA 3X13A 1GZQA 2EYSA 4EXPX 1KEMH 4TVSa 4G8GB 2VLRD 4K94C 1I3RA 2XXMB 2YA1A 1WFNA 4NKDA 4S2SA 5ITBH 1NMBL 3HUJF 4L29A 4QRRE 3O6ML 2XKNA 2CK0L 3RGVA 5CJXC 5EBLA 4Y5YA 3CDYA 3BKYL 3SQOL 3V0WH 4DUVA 3NN8B 5B4MD 1O5DT 1UG9A 3MLTB 4MAYC 5DK2B 3A6CL 4R97B 1BBJA 2H32B 1JNHA 3NZ8B 5CBAB 1XIWB 5GXBB 3LDBB 5T5NG 1BJ1J 3ULUD 5T3ZE 2NXYD 2FCBA 4ODBD 3FOMA 5JQ6L 2V5RA 1P84J 4O2CA 1L9MA 4Y4HA 1EEUA 4JFDD 4LP5A 5EO9A 1MCJA 3GSNB 3V5DB 1KB5A 2X4RB 3GSWA 1A3QA 5GGRA 2WW8A 3UPAA 3KPQA 3IDUA 4UTBH 3D69A 3OJVC 1LNUA 1JMZA 3B4NA 5TE6H 4PJ8C 5A16B 3H0TB 2D7MA 2AXHA 2EC9U 3N85L 5I1DB 1FYTD 1ZSDA 2F19L 2DD8L 2Z31C 3C08H 5CSBA 3VFGH 1VFAA 1QVOB 4JB9L 4WFFD 5IHZB 1KTRL 4NJAL 1T6WA 2R2CA 4WCYH 1PJ9A 4WFED 2YKLL 1S9WA 2Z4QA 3RQ3A 3T2PA 3QIWB 5B8CC 1X5LA 3RWFA 3X14B 2HAZA 3AXLA 1EO7A 3MV7E 1YYLH 5L0QC 4U6TA 3GBNH 2FGZA 3D3VB 1AR1C 2NX5D 3VD7A 4JG0L 3U1SH 4PJEA 2OMBA 5KANI 3O8XD 3P4OA 3SDXB 5C2UB 3ARPA 1X4YA 5L2JA 2QQLL 5D1XA 3VWJC 4DGVL 1FLRH 5IVXF 5HDBE 2AI0H 2O5YL 4GRWE 4LVOC 4N9GA 2D7OA 2YN3A 1T20B 1PG7X 1DE4B 2AJ3B 5JW4R 5HVWA 2VSDA 4AIZA 3QO1A 4ODHH 4ZUWA 3DMMD 3U4EB 3QIBC 5AZ2L 3PUCA 3VXSD 5FECB 3D25A 3MREB 4JFOA 4A2MA 1MJJA 3V4VH 3GRWH 4QHMB 1CG9A 1FG9C 5JHDD 2PR4L 3VRLF 3KG5A 1IGIH 4L8DA 3U6RB 2CPCA 2XWJA 2YSSA 3T0EA 5LQBH 1V3JA 5IM7B 4X4MA 2NXZD 3MGTB 4PLJD 5ICZA 2R2HA 5GGQH 2ICWA 5GGSA 1YMHA 4OIIL 4XCCH 4ZXBC 3RY6A 5E2TH 1J1PH 2DJ4A 3HG1B 4MJ6B 3OKLA 1VKXA 1Q72L 1YNLH 1IAKA 4JQIL 4TULH 5ENWB 3QQ9D 3K4AA 3CZFB 4QWWD 4APQC 3HPJB 3P9MB 3T1FB 3JTSB 4GRLD 4V1DA 5FB8B 1EMTL 3TVMA 3N1FC 1HINH 4ZS6C 4F33A 1RAMA 1VESA 2XWTB 4XVUC 4BK5A 4ESKA 3QDMD 1R5IA 3K3QA 1AP2A 4OF7A 1S78D 4PGEB 4MXWL 3GIZH 3TN0B 3D0LB 4EDWL 1KC5L 1C5CH 5F44A 3O9WB 1UJTA 5FYLE 4EQ2A 3ARTA 3LQAL 3FCTB 2OTWA 1QLEH 2IH1A