1QQDB

Crystal structure of hla-cw4, a ligand for the kir2d natural killer cell inhibitory receptor
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
99
structure length
99
Chain Sequence
b'MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSGDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTOCOMPATIBILITY LEUKOCYTE ANTIGEN (HLA)-CW4 (HEAVY CHAIN)
publication title Structure of human histocompatibility leukocyte antigen (HLA)-Cw4, a ligand for the KIR2D natural killer cell inhibitory receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 12
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1999-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qqdB00
4N1HB 4AH2A 2QQLL 3GMLA 5D1ZD 4ODXB 5CCKH 2LTQB 5IB3A 4M7LT 4UTBL 4JY6B 4FNLL 4PJIE 2ZUXA 3LKOB 3HKFA 3EGSA 5C08A 2VN7A 1FN4B 3QUYA 5GS0H 1OAZL 4M6NH 3FN9A 3GKZA 4FQXB 5J6HB 3GHEH 4PJEF 2EDDA 3X13B 1NGYB 3IFNH 3AS1A 4H25B 4WW2B 1D6VL 1HYSD 1RK1A 1ZKAA 4ZOAA 3GFUA 5EBGA 5DR5L 4BSWA 3UX9B 5HGAB 2NW2A 2HLAA 3MV8B 4XC3L 3GM8A 2OP4L 1RHFA 4FQQB 3P9WB 2AEQL 3QDHA 1OT2A 3GI8H 3T0AA 3UTSB 5FGCB 3DJ9A 4WY7H 1F3JA 3ZMRA 3DWTA 4KTDL 1IAOA 3MLSH 3JBG7 3MR9B 4WV1B 4QT5B 2JK5B 3WN5A 4I4WB 5EO0A 5EFIA 2I9LA 4HJJL 4ZS7H 1NEZG 1EK3A 5DWUL 4PB0L 4KZEL 4TN9A 1A6VL 4ZUUB 1T21B 2UUDK 2YK1H 4QOKE 3BIAX 4LLAA 3RWIA 2Y6SD 3P73B 2FR4B 5FB8B 3B6SB 2O61A 3EBAA 1UXWA 2BRQA 5FO9A 3FMGH 4NZDA 5I1HL 1RJLA 2PW2A 1MCHA 3ARUA 4NJAH 3V7AG 3DMMA 1FAIH 4ZSOA 2DQUH 3FB6A 1RU9L 5EBMB 3WHE0 1CFTB 4BQ6A 2GY5A 4Z95L 4MNHB 3C6LB 4Y5YA 3LAFA 1UXSA 1MVUA 2C3GA 3MV9E 5SWZD 2IBZX 1RHHA 3ECBA 5F7MC 1VKXB 4X8XA 1MH5B 1XGYH 3IDYC 3B8SA 3RWEB 4F7TA 3PNWB 4QXWA 5L2JB 5BZDB 3NGBB 3SN6N 2V5SA 3HRPA 3U46A 5IFHH 2EIBA 5T1LB 4TSAH 1TJIL 2Z8RA 5KSBF 2VLMD 4P9MH 1FG2A 4MD5A 3I02A 4XP4H 1ETZB 2CGRL 1CLYH 2F58H 4DAGL 1WBYB 5FDWA 5MEOB 1O5DT 1CVRA 5C09D 5J13C 1XGPA 4IRSA 5F71A 5E5MB 3L3IA 3CMOL 3ZKNC 2BMKA 5IW6A 4UV7H 3VGGA 1R5VA 4LSQL 3TJEL 1DBBH 3V4VL 2ED8A 3E2HB 4IOSD 4YBHA 1UCBL 3CH1A 1T7XA 2VL5B 3STZA 1NLBH 5EU4B 4DKDC 2P44B 2V2WB 4AYFA 4UT7L 3WEXA 4YHZL 1I9EA 1YEJL 1KLGA 2CKBA 2Y06H 1CXHA 3KPPA 1SJVA 5A2FA 4C56E 3SDXE 5DC0A 4HS6B 5IF0A 3VD3A 4DOHB 1CIDA 1R24B 2ZCLH 4FQIL 3VCLA 3TCLA 5DUML 3WCYA 3BP5B 4XCCH 3T3PE 3TGXA 3QJHB 4KHTH 5IFAL 1JPSH 1CGSH 1YMME 5DTFA 1NEZA 1J1OH 1L0YA 1IQWL 5IB4B 3T08A 1JPGA 2FCBA 1BF8A 5EULV 2E7LA 1ACYL 1MCLA 1MFAL 4ZAKB 1M7DA 2HH0L 5KVDL 5LGKA 3DXAD 2APVA 5IFJB 4F9PA 2HTKD 4EUPA 2NPLX 3WBDA 3L3GA 2C7UA 3CXDH 3EYSL 1IC7L 4LCIL 3ZDZE 4Z78B 5GS1C 3T0EB 4S1SH 5TJWK 1A5FL 5K59E 1T1ZA 3BO8B 3AMLA 1XGUB 3GSOA 1S7TA 1XIWD 1O7VA 2PXYB 3F65A 4HCRH 4MNGB 4Q97A 5GRVL 5D1ZB 4X9HA 1NFKA 5DO2D 5KSVA 4TPRH 3B2UC 5E9DD 4HC1L 4P9HL 3TBTB 5DEGA 3NFNB 2WIIB 2HVJA 5I74C 4XP9H 2PNDA 4MJID 1BJ8A 2CH8A 2X89D 3JV4B 4UAOB 2LE9A 1AR1C 4HKZB 4UUJB 1A1NB 2GCYB 1F4YH 3QRFM 2CXGA 3TPKA 1OAKH 1I8KB 1J87A 2W65B 5AD0B 1AKJD 1ZSDA 5J6GB 3OB0H 4LHUG 3GSVA 4P4KD 4KRPB 4AEEA 5EU3A 3FT3B 4FMKA 1QEWB 4P2QE 5IROC 4TTGA 4PJGF 1ACZA 2A73A 2CRZA 1A22B 3WIHH 2ZUVA 4AT6B 2UZIH 3FQRB 1LP9E 3MUJA 4RSVA 5I1GL 1INEH 1MPAL 3QIBA 2MQ3A 4UBDD 5C71A 4MJ5A 2EZ0D 3DX6B 3BX7C 4X7EC 1K4CB 1RVFL 3DROA 5DJ6A 3WXVL 2NY6D 2XQYG 1HHKA 2IBGA 4S0SD 1MHEA 3FQTA 3MRQB 1CXIA 5I1CH 4WWKC 5MENA 4NZJA 4R4NC 3N1GC 4YHIB 4CGTA 1MJUL 3D39D 3RUGF 4PJBF 4HXAH 5C0DB 2XTLA 3H2WA 3HAEH 2QR0A 4MQSB 5J12B 1J0HA 4OLYL 5GZND 5C86A 2VXUH 2J8OA 1XF2B 1QHOA 2DQHL 2HAZA 5EIIB 1KENH 4OB5H 2KPNA 4TNVF 2IPUK 3I3BA 4OQTL 1ZK9A 1XZ0B 2NYYD 2FATL 1NCAL 3EOTL 2NXYB 3O81A 5FEBA 3SBWA 4UT9H 2FX8L 4PUBH 4CU7A 3D0LB 1IAII 4PJ9B 3MLRL 3MPCA 1FZJB 1HXYA 4OKVA 4WU5B 4KPHH 3RWHB 1NCDH 4RMRA 2Y4SA 1MY7A 4OCRH 4WEBL 2W0FB 5F3BB 2DLIA 2IAND 2X5PA 4Q0XL 3BYYA 5AG8A 5E00B 2VZ1A 3BDBA 1XGRB 3RU8L 2MSPA 4KKCC 5IB5A 5KJRL 1UKSA 1ZWIA 2AXHA 1I7TB 1ORSA 5CJQL 4PJ7F 4WFED 3QG7H 5DUPH 4PJAE 4PJ8C 5C09B 1BZ9B 4K94C 3DHJA 1JGLL 3GHBL 2D31A 3EJZC 4M6AA 4MXVE 2UZXB 3BP4B 1UVQA 5SWSE 3GSQB 4DK6A 5ITFB 4PV9B 3G04A 3DARA 1P7QA 4NKQB 5K9QG 1OCWH 1VFUA 3FTGA 3MRNA 2PTTA 1JWUB 1RK0A 3OJDB 3ARSA 2FDBP 4YDKL 4BQ8A 2H26B 3WL9A 5I1EH 3HUJA 4X9GA 3UZQA 2ED9A 1ZT7A 5TQ2L 4HJGB 4PY8I 2ICEB 5DMKB 5JIHA 2FEEI 4CW1B 4NM8H 2GAZA 3O9WD 2GYSA 4LLDA 3DI2B 4QXUL 4CUCA 1WZ1L 3EFFB 4JVWA 3SGKA 3WKNA 1Y0LB 1TZIA 5FYKD 4G6KL 4F33B 3NCFB 4JJ5A 4JY4A 2Z8SA 2APFA 1NGQH 5CKGA 5HHNA 4HWUA 1EO5A 1A14H 3HC3H 3N9GL 3R06B 5E8EB 1T0PB 3QQ9D 4OFVA 4HZLB 3ZE1F 4OZIF 5BMFH 3BP7B 4DEPC 1WZKA 1JPFB 4PRDA 5DF0A 2YUVA 1WAAA 4HHAA 4JDVA 4RIRA 3L3JB 5E9DB 1HOCB 1K9TA 4YHYB 1P4BH 1S7UA 2Y72A 3BKYL 4QHKJ 1QFUH 3HAEB 4O4YH 1PD6A 2MPAL 4XVJH 5KN5A 3BGFB 1A7RL 3QFJA 1G7LA 4MJIB 4OZGE 1HH9A 4Z76A 4H5SA 5LGHH 4X6BA 4HV8B 1NFIB 4DZ8B 3ZSTA 5J89A 5CCKL 5KS9B 2P5WE 2ZUSA 1W0YT 4M03A 4UDUA 5ETUA 5I66A 1AKJB 1EO7A 4J3XA 2HT4C 2CR6A 1G7MB 3KPSA 1IKNA 3VRLF 3HS0B 5FYKH 2C1PB 2CLRB 4E41A 4NUJA 4UU9A 2EC8A 1UWXH 5GS0L 3TJHC 2C4FU 4M6NL 3KPRD 3GHEL 2X41A 1T03H 3U4BH 32C2A 3QQ4B 1BVLB 1G1CA 3MRDB 4GRMA 5D2NE 1UWEH 3MLTA 4JQIH 3PWNB 3STLB 3IFNL 4DN3H 4X5XB 5IJVA 5TPWH 2BHYA 1T7YA 1Z9SA 4ZFZA 1CDJA 2VLKA 4U1HA 1HHGA 5F9AC 1H9VA 1KGCD 3HR6A 2DMCA 3MBXH 3L6FA 4UB0H 4RGOH 1ZVYA 2NZIA 5FOJA 1NCWH 1NC4B 5E03A 2YUZA 5DA4A 2XNAB 1DQLH 2BVOB 3MV11 2VISA 4MCZB 4KRNA 3GI8L 1L9MA 1U58B 1KIQA 4Q9CA 4RMUA 4WY7L 5H35B 2KL6A 3TZVA 3MLSL 1NKOA 4WHDA 1U8HB 3DBXB 1LK2A 5E8PA 1F3DJ 4HDIA 5FO7A 5H94A 3ARGA 4ZS7L 5D8JH 4YHMH 3OKMB 5IOPA 5AEAA 4CVXA 5FHAH 5HI3C 3FQXB 4WW1B 3RTQD 1K3ZA 2YK1L 5GS3A 1FDLH 4EDWH 3HE6C 1KXTB 3VXNB 3DRTA 1I4FA 3FMGL 3MUHL 4CNIB 4U6YA 4GUPA 4M7ZB 3QCUH 4NJAL 5I16A 1FVCA 1FAIL 1I7RB 4XMLL 1UCTA 2DQUL 2P5ED 2DIBA 4GOSA 4FG6C 1ZOXA 5DRWA 4F2MB 4LDEB 3G6AB 4OD2B 4M1GH 4XCFH 1S5HA 3VG9C 3GDBA 4BFIB 2FSEA 5I8KH 2DLEA 3TPUA 2H1PH 2YA1A 4GRWE 3VXMB 1XGYL 3Q5OA 2WBKA 2CDGB 2P8LB 4OF6A 1ODAA 3BXNB 2GJZB 4D0DA 4G8FB 4TSAL 2Y36H 3I9GL 3GO1H 3VRJA 4P9ML 4YGAB 3VWJC 2EDJA 2MOVA 4HGWB 1V05A 3OV6A 1D6EB 2FD6H 5BV7H 2PO6C 1EBAA 4XP4L 3IETA 3QIWC 4JO3H 4NO5A 1CLYL 2F58L 3MRIB 4WHYG 2KH2B 1K2DB 4KZDH 1VFMA 2XWTA 3ESUF 4UV7L 3P3YA 4M61A 1DBBL 3MV7D 1IGYB 1FORH 4QYOA 5KSAA 3SCMC 1HDMB 4PJHB 3MRGB 3VFSA 3WDJA 5C0AD 4GLRI 1RI8A 1RUPH 1ND0B 1NLBL 4OZFB 4UQ2B 3S88H 1KXQE 3S4SG 2BJMH 5GRYA 5EUOF 5L7XH 3NPZB 1FZKA 3TFKD 2Y06L 3D25A 3O9WB 2OR9H 3LEYH 3VXOB 5BRZA 4XVSH 1UZ6F 2XFXB 4DFIA 4E42B 5JXAH 2ZCLL 3JTSA 3GB7B 1HSBB 2OQJA 1KCVH 4NOBA 5CLTA 3ARDB 4F37F 5IMKB 1JZ8A 4XCCL 4YFLF 4KHTL 1JPSL 1CGSL 2R1YA 1J1OL 5B4MD 5CINH 3ZYOA 2Y7QA 2VDOH 4DVBB 5D2NC 3RI5F 4PRHB 2VXTH 4UMGA 4UIKH 3DX7A 3KJ4B 4JM4L 5CGYD 1X6NA 4BH8A 4A6YH 1OY3B 4HPYH 4KI5F 3M1BB 2XKNB 3HCVA 1T89C 2R2BB 4G43B 1U95B 3CXDL 3EDKA 4OLEA 1KJVB 1NFDF 2YUXA 2HFGH 5EOTB 3VE0A 2WK2A 1EH9A 3ILPB 4S1SL 3ULVD 4PGZA 2DM2A 4BFGA 4QRPE 5FA4A 5DQ9B 5B22A 3M17B 3QXTA 3SDAC 2X7LB 1PEZA 4GS7C 1U2HA 4HCRL 4GKZB 3H3BC 1KCRH 4PJ5E 2NNAA 2ADGB 1D7FA 4TPRL 4HWBA 4RFNC 5JPNB 1D9KD 5J1AA 5F7KC 1MCWW 2DWDA 5IK3A 3GIZH 1PGRB 4F57L 4XP9L 1DBKH 1RZJH 1FBIH 2H2PD 1F4YL 2AJSH 4PJFF 4PGCB 3MRHA 4JANB 4U1IA 1OAKL 3T09A 4DCQA 1LD9B 3HI5H 3RX7A 4LCUB 3BD5A 2G5BA 4QNPE 4RX4A 5D2LF 1XF3B 1JF6A 2XN9D 1ZLVK 1J05B 4ZFFB 1F6AA 1IKFH 1FPTH 3P2TA 5ITBH 3WIHL 2YPKA 2UZIL 3C8KB 3L1OH 4I9WE 4X4YB 1NUNB 1KLUA 3TH3T 1INEL 2NR6C 5EU6A 1U93B 3SPVA 3NVQA 4RFEB 1NCBH 1SYVA 4X5LA 1MAJA 3ULVH 4LCCC 3MRCA 1BFOA 4YIQB 3HC4H 3BPOC 5AUMA 2WNGA 1KTLA 3B3IB 4HAFA 5DSCA 3WIFA 5I1CL 4GAJH 3C5ZD 5HGHA 2OL3A 3PV7A 5GGTA 1MHCA 5BV7B 5IMLA 3LV3B 1SEBB 3G6JA 3Q6GH 4HXAL 5ESQB 2ED7A 1XCQB 1ED3A 3SKJH 3TIEB 5IMMA 4JN2B 5BS0E 1U8OA 5C3LD 3RL2B 3FB7B 2VXUL 3UAJD 1CXKA 5FKAA 2HVKB 3N06B 4PTTA 5HHOD 3DVNB 1KENL 1I3UA 5EZLB 4OB5L 3QO1B 5A2IH 3G5ZA 3HMXH 1EGJH 3QH3B 4ZOCA 4NDMB 1JNHB 1NBVH 4NKOB 5CUSL 4FQCH 4OLZH 1E6JL 3KPQB 3AY4C 4LBEA 4UT9L 4PR5A 4PUBL 3VDBA 3ZKMC 2BNQE 1NAMH 3QIUC 2NLJA 4KPHL 5EOQH 1NCDL 3CFCH 3H3KA 5DJ8B 1CDBA 5AZEH 5A16A 4OCRL 3JWDC 3IXTA 3FZUC 1YEFH 3RY5A 4P46A 2WBJD 2EDXA 3TO4C 1HCVA 3CVHH 5JOEA 2W9EH 4PLJC 5EZIH 5JA9A 1ZHLB 4LNVA 5KSBE 2GUOA 5IVXE 1BOGB 3DOSA 4JLRB 4NQEB 3N1FC 1YPZE 4NC1E 1JVKA 4OV5A 1QLFA 3QG7L 1UA6H 3UYPA 4A6YB 2DN7A 5F7HA 3MNWB 5J06A 2EDWA 2DJUA 2FBJH 2NTSP 2IC2A 5CIPH 1MIEH 2FJGB 5DD3H 1AJ7H 3QEGH 5C0BB 4XB7A 1ORQB 2EEBA 3N85H 5T1MB 4GXUN 2I27N 4QEGA 1QRNE 1B0RB 1OCWL 1E4KC 4NQDE 1T04B 5C0AB 1TJHH 3C60C 1RV6X 3FFCE 4CVWA 4OLXH 2DKSA 3O0RH 1BX2A 5L2KB 1JYXA 5EN2B 4MDJB 3D2UB 2CK2A 4ZUVB 4E9LA 5I1EL 2B0SH 3PQYE 4E0RA 1CICB 5I8CB 3RWJB 4KJWD 2VLLB 1EHXA 4NM8L 4Y5VB 4K3JH 4L3EB 4LLWB 4NNYB 5E5RB 3LRSA 2XWBA 1AGFB 5J4MA 4Y4HB 5CMAA 4NZTH 5JW5B 1FQ9C 1KB5A 1EX0A 2D4DA 4IS6A 2OR8A 1QNZH 1Z2KA 2VDPH 1JMXA 1NGQL 2ZG1A 3Q5YA 4LMQI 3B9DA 3DVIA 3WLWD 2PYFB 4Z7UF 1A14L 4KJYB 2P46B 3HC3L 5K9JH 5EZJA 5C0GB 5JORB 3PIQB 1AGBA 4X6DF 4YEFA 5BMFL 5E8NA 3EDFA 2NXZC 2ID5A 3MMEB 4NRYA 1UB5B 3U36A 1R0AH 4S10A 4ODTH 2XYCA 1I8IB 2AQ2A 2YPVH 3N50A 2AAVA 3EYFA 5SX4I 2OYPA 25C8H 1D9KB 1BQHB 1P4BL 5GGUB 1QFUL 4I3GA 4O4YL 4XVJL 1EMTH 1MJ8H 3QDJD 4M43H 1QYGH 3H0TB 1IGMH 4XXCC 5LGHL 3NN8A 5HXMA 4U05A 5JMOC 4GXVH 4MQXC 5HYSG 3KLHC 3QWRD 5T5NG 1FZOB 5B38G 4ZQKA 4UOW0 3OXSA 1F90H 4KAQH 1KJ3H 4IIQB 4Y19D 1GHFH 2DQTH 1X3DA 1FYTB 2XN9B 5DEFA 5FYKL 2FHBA 2APBA 4LLQA 5GS1A 1CFSB 1CD8A 1WV7T 4KKNA 5J9PA 1T03L 3U4BL 1HHHA 3VXSB 3LQZB 4XNUH 1UWEL 1M1SA 4K3DH 4JQIL 2D7OA 2QKIA 1AGEB 2Q7YB 3BPNB 4DN3L 5TPWL 3W9EA 1HEZB 2VABB 3PL6C 2XXMB 2UUDH 4J4PC 1JK8A 1S8DA 2FWOA 3MBEB 4OI9A 5J11C 2WANA 3MBXL 5H8DA 4U31A 5D5ME 2B1AH 2EKSA 4UB0L 4RGOL 3CVHB 1A1OB 1NCWL 2FH8A 5F7UA 4QOKA 2XWJB 4D9RE 4JQVC 2CLZB 3FQUA 5FKPA 1DQLL 2R0WH 3T4YB 1U3JA 4PJBE 2VKWA 4NC1C 5ESVB 1MCFA 2D03H 4G9FA 3OL2A 4X4XA 3SKNA 3OKEB 5JZ7D 3BZ4B 1F42A 5IM7B 4LNRA 1IE5A 2IPKB 1U91A 3LRHA 4F80A 5IHZA 4G5ZH 5IROA 4P49A 5D6DC 4JY5H 5D8JL 2R1XA 5IVOA 4YHML 4NCDA 1YNKH 3BH9B 3DTXB 1J12A 5GGSB 4MB3A 5FHAL 3BEWB 1OTSD 5DJZB 4XP5H 2YD6A 1MCDA 1FDLL 4PGDB 3WSQH 4EDWL 1R3JB 1RULH 1ZHNA 5KVGH 1E28B 2FLRT 4MXQC 5IB1B 3ARPA 3BRGC 2IAMD 2FJFA 3G08A 2K7PA 1GZPB 1UZ8A 1QHPA 2JIXD 5C07D 4NN5B 4P23D 1JTPA 1JHTB 1Q9WA 1KJ2A 2BOBA 4KTYA 4MJ6B 2HRPH 3WDIA 5FGRA 3QCUL 4HUNB 4R2GD 2XY1A 4WWKA 5IEKB 1P7KB 3VI3E 4ISVB 4FQ2H 5GRUH 3BH8A 5ID1A 4LOUD 4U1NB 3K81A 4LPCA 4L29B 4M1GL 4XCFL 4MVBD 5F7DB 4ZYKA 1JYWA 2VDKH 1RZGB 1GPOH 5I8KL 4XB8A 1MELA 2H1PL 4RAVA 3AU1A 5DK3A 3VXRB 1QVOB 4N5ED 1A4KB 4JFXA 5F7YC 5TE7H 4G42B 3KLSA 4I0CC 2OI9B 2Y36L 3ZKSD 3RKDC 1BQLH 5B38A 3GO1L 2GTWA 1EEYB 3K74B 3BW9A 5AYQA 4L4VD 2FD6L 5BV7L 3SGEH 4JO3L 1FVDA 4C56A 3SDXA 3QSKB 1B0GA 1P5UA 1R3HB 4KZDL 5IVZA 4KU1A 1DQQA 1K5NB 1FFQA 3JWOH 5IMOA 4XNMA 1V3KA 1MJ7H 1FORL 2OR7A 1BD2D 3V7MA 3MV8E 4YEEA 4YXKH 3WFZA 2NY4B 1YMMA 3IDNA 3OX8B 1RUPL 2DKMA 1WJ3A 3S88L 1NDMB 3UTSE 3U83A 1D5ZB 5FGCE 5L7XL 3BN3B 4Z6AT 4UIMA 3D85B 3FO2B 2OR9L 1S7VB 2GEEA 2A83B 3RDTC 3IDXH 3LEYL 1AFVH 4PJ8A 2R15A 3L7EB 4XVSL 1JGUH 2VLJB 3GMMA 4QTIH 2FL5A 4LCWD 1MFBH 1F4XH 1GSMA 4P5TC 4WI4A 1T1YB 5JXAL 5BZWB 1KCVL 3VFRA 5JXEC 1A9EA 1IC1A 3L95A 1YMHB 3IRPX 4YHPA 3I75B 4A2MA 1X5HA 1QA9A 5T1KD 2VDOL 2J3SA 5LXGH 4LSRH 2VXTL 3LN4B 4IJ3C 4UIKL 2FX9H 4A6YL 4HPYL 1MAKA 3DURA 2ADJA 4R4BA 3NCCB 1HNGA 1W72A 1M05B 3QDMA 4WNQA 1FZMB 1HHJB 5D93B 1KELH 4L4TA 4YDJA 2HFGL 3C2SA 3QB7C 1TVBA 2AQ1A 1C1EH 3S37H 4P59H 1N26A 1S7XB 3ARQA 3HZMB 1CWVA 3OAZK 5BJTB 4MCYB 1MF2H 3QI9A 3STBA 1KCRL 1N6VA 5LQBH 4D8PB 4P2QA 3RVVC 3SJVB 5INCA 4M7KH 4WTZG 4Y19B 1DBKL 4EVNB 2X4UA 1RZJL 1LP9A 4YUEH 3U0TB 1CE6B 1FBIL 3NZ8A 3VXUA 1TPXB 2LAAA 2EIEA 2AJSL 5DD1H 5I9QC 5B8CB 2ZUWA 3HI5L 3S9DB 2JF1A 3QWOA 4ZS6C 4W6WB 2H8PB 4R0LC 4EI6B 4KK6D 2CRIA 4W4OC 1IKFL 4Y8AA 5DFTA 3VFTA 3ZDYE 1CK0H 1FPTL 5ITBL 4L8SC 4X6EB 5LGJA 2QHLA 5FECB 3L1OL 4AQ1B 1K85A 4TUOB 4O02H 4BKLA 1FSKC 4HMCA 4R7DA 5E56A 3HZVA 5DJYA 2LU4A 5DD0H 4Q74A 1NCBL 3RIAF 3M45A 2HT3D 2DAVA 2LTQC 5DEZA 3S96B 5HGBB 3ULVL 2J6EH 1T0NA 5F96H 2XQYK 3HC4L 4PLKC 3UCRA 4DOHE 4V1DD 3RVXC 1P2CA 4XGZA 4FRWA 4GAJL 4O51B 2CIIA 5C3TA 1TXKA 1T5XB 3UC0H 4HX1A 1X5XA 3Q6GL 4FTVB 3U9PH 3SKJL 4FQXC 2VC2H 3DYOA 5IEHA 4U1LA 5FHBH 2CIKB 2VLRD 4WW2C 4HIHA 3MRBA 1WWAX 2JIXB 4RA0C 2QADB 2EIZA 1A3QA 4P23B 3HMXL 1EGJL 3MOAH 1NBVL 2O5YH 1T66D 1CD1B 4U1GB 4FQCL 1X5KA 4OLZL 1TJGH 4JFDA 4PJDB 1RURH 1UH3A 3T0EE 1L6ZA 1ZV5A 4X7DC 5FUZH 3CUPB 3ZT6A 4ZD3H 5TGBB 4ZPTA 1NAML 4MNGE 1FIEA 3W81A 1R3IH 2ATPB 4PJAA 3OTTA 4B7LA 5EOQL 1AD0B 5C0CD 3CFCL 4WV1C 3OWEA 2Z35A 5AZEL 3K8KA 4X98A 2IEPA 4R3SA 1YEFL 2QHRH 4X5WB 5HI4C 5HGDB 4JGMA 5SWSA 3NOIA 4MX7B 1J5OH 3JV5A 3CVHL 3GJFA 2DQEH 2XOTA 2W9EL 5EZIL 5EOCJ 3LVEA 3HE6A 2GJ6D 3IKKA 1WCQA 5F6HJ 2VO5A 4L4VB 1UA6L 4L8DB 5BW7C 4AMKH 5IP4A 1LWRA 2FEEL 4C4KO 4O5LH 1JYVA 1YNTA 2A74B 5F88A 2FBJL 4UI2A 4P4RA 2GTZA 1Q1JH 5HTSA 2DLGA 1ZLUK 2M1KA 4F7CB 5EPMB 1MIEL 1YY8A 5DD3L 4Y4KD 3FT2A 1AJ7L 3QEGL 2ZG2A 1TMCB 3N85L 3T4AB 1DDHA 4AIOA 3DV6B 5BQ7A 5I6XB 1PG7H 4ZFGH 1U8LB 2ESVD 4ONHA 5IQ7H 3C6LC 4CADB 3GIVA 1I1AD 2UWEB 3OKOA 1TJHL 4YK4B 1N59B 2AJVH 5TDOA 3RZCD 4PG9A 4OLXL 3O0RL 4HH9B 4G8GD 3MZTA 5FV1L 1Z0NA 4N0UB 5EUOE 3QT2A 1EZVY 3VMNA 2KKQA 3VFVB 5CJ5A 1J8KA 3NGBC 5C70A 1WTLA 7FABH 2B0SL 4JRYD 1FL6A 5I71B 2IQAA 4XH2A 5HHQA 5IB2B 3VWJA 4MA1B 3V6ZA 4U1JB 2ZNXA 3QULB 3MJ6A 2DL2A 2PO6A 4K3JL 2DMBA 2P24B 3BMWA 4BK5A 5D1XB 2HG5B 4NZTL 3V5KB 1NGXA 1XH3B 5T1KB 1OAQH 3GUTA 3L3OB 3RNKB 4PV8B 3IXAB 5JW4R 1QNZL 2VDPL 3TBYB 3QJFA 1H3VA 4IOFD 4QRQB 5IT2H 3SKMA 1F45A 3E2HC 3SCMA 2OMNA 4GG6F 1I3RA 3EYOB 1F3DH 1MHPH 3PXJA 4LEXH 3HRZA 3LKRB 1FFNB 5K9JL 3CFEB 4OZGA 4HWZB 5FA3A 1NFDE 4YGVA 4YDLB 1PZ5B 4RMSA 1OVZA 3X11A 1R0AL 5IW3A 4EQ3A 1YN6A 4ODTL 2YPVL 1IM3A 2JJTC 25C8L 5FIEA 5GS0C 1TIUA 4N90E 4I1NB 1T20B 1U41A 1EMTL 1AXSA 4QLRA 1MJ8L 4M43L 4HIEA 1T22B 1QYGL 4GKOA 5F9JA 1RZIA 3VH8B 1IGML 4ORZC 1C16B 3D69A 4GXVL 3MLYH 5D2NA 4PPTA 5T33H 5GGRY 1AI1H 3FQNA 3VJ6A 5JHDB 4ZAKC 1F90L 3K2MC 4KAQL 3VFWB 1KJ3L 5C09E 3W9DA 1GHFL 4JGUA 1T89A 2DQTL 1EVUA 2FZ3A 3EO1B 3E1F1 2Q8AH 4XCEB 1AD9A 3ARVA 1ZGLP 3BIKB 2X1OA 1CR9H 1RJYA 1BBJB 5MP6H 4QHMA 2QLVB 3LHPH 4QCIB 2J12B 4JAMB 3T0EC 2X70B 4GH7B 5IVNA 4U6XA 2PXYC 3KYNA 4XNUL 3QXVA 1NGWA 3LKQB 4K3DL 4RZCA 5D1ZC 2HJKB 3VMOA 3U4EA 3GSNH 3MUGA 5IR1B 3WS3B 1WCBA 1MJJB 3QHFH 2B1AL 3LPGA 1VESA 1T2XA 1IRAY 2BFVH 4HKBA 2VH5H 3VGFA 2BY1A 3KS0H 4UAOC 3MROB 3HTLX 5HHXH 4GW4A 2R0WL 4JFHD 3VFOB 4DGVH 1H3XA 3VFPA 2VDNL 4N0CD 3EDEA 1G9MC 3RL1A 2D03L 5EO1A 4XPBH 1EERB 1JL8A 2BSTB 3MJ9H 4KRPC 5I1AA 1D5MB 5FGSA 2Y5EA 3ME0A 2VLRB 5DUBB 4PY7A 2DLTA 4G5ZL 2YRLA 3RQ3A 4JY5L 5IHUH 4KQ3H 4GKNA 1YNKL 5DVKA 3BZEA 5MEPA 2XTJB 4XP5L 3WSQL 1RULL 3IFPB 1IJ9A 5KVGL 1R5IA 1T1XA 5T3ZD 5DMGD 3BESR 4NT6B 5DVNA 4D3CH 1X6LA 3JSSA 4JDZB 3C09B 4LCCA 4JKKA 2X6MA 4IMLB 4LVNB 5EO9B 2HRPL 5E9DE 3C5JB 4X99A 3I6GB 1SEQH 1Q9OA 2ZUUA 3TC9A 4I0PB 2NY5H 4Y1AD 4FQ2L 5KTEH 5GRUL 4Z9KB 3DUUB 1QR1B 1R5WB 4ZUWB 1CDIA 4R90H 3UDWC 4MJIE 4JREB 5E2JA 3RWFA 5ESAB 3BZDA 2PYEB 2VDKL 5J12C 5SX5K 1GPOL 4KJQC 2Y6SC 3MGTB 5KS9E 4KFZC 1DLHA 2ZG3A 2A6JB 3OG6B 4Y2DD 3VMPA 3K8MA 3F5WA 5TE7L 1FNSH 3TIDA 5EDXA 3SKOA 2X05A 1BQLL 2NXYC 1DN0B 4EN3B 3FCTB 4HGKC 2HTLC 4KXZH 4C4KT 1P69B 4OUOA 3QXDB 5DHVH 3H3PH 1EAPA 4PJ9C 3QIUA 1I1AB 4OJFH 3RZCB 3QUMB 4YO0A 4G8GB 1XR9A 1BREA 4H8WH 3JWOL 3ZSSA 5DJAA 5T3ZH 5ACZB 4MYWB 3T0WA 3U30B 3U6RB 2H6PB 4WO4B 1MJ7L 4H0IA 3GJEB 3C8HA 3TO4A 1B0WA 1VFOA 4YXKL 2H32H 4QRTA 4AEHH 1PSKH 5JA8B 2AXFB 4ZTPH 4PJCB 5GZOC 1JWMB 1S9WA 4GJTB 5C0NC 4QXGH 1X4XA 2GFBB 2E9WA 3P77A 3PWPB 3IDXL 1AFVL 3BWAA 3RX5A 2VQUA 1JGUL 3F7VB 4QTIL 4U6HB 3ARBB 3U4AA 4IEFB 4EI5B 1E4JA 4MLIA 5EU5B 1MFBL 1F4XL 1HSAA 1XCTA 1R3LB 2D7NA 3BZFA 4PP2B 4S11A 3CFDA 3Q2CA 1W2KT 1CFQA 1BIIA 2XKUA 2WINA 1E4KA 4QRPA 1TZHA 4MNQB 1A6TA 3C60A 1LE9B 4P2RB 1T7ZA 5LXGL 5D1QD 4PJ5A 4LSRL 1NUFA 2F8OA 5D7IB 4ACPA 2P8PA 3FFDA 2FX9L 4JPIA 4XBPA 4MSWB 1HXMB 4FP8H 3EHBC 4L1HA 4PRIB 1KELL 4F7EB 3BHBB 2V6HA 4L8BB 4NJ9H 3O3DB 4E5XA 1D5XB 2I9TA 1CDGA 1UH2A 1C1EL 4Z77A 3S37L 4KMLB 3WJJC 1ZLVH 4WU7B 4MD4A 1F2XK 4P59L 1OGAD 1DZBA 1MF2L 1UM6H 3RVTD 4WFEE 5JIIA 3KG5A 1AQDB 3VXME 5LQBL 1G9NH 1FIGH 2WWKO 3LPWA 4PTUB 2NY3D 2RCSH 4M7KL 3KXFD 1DBAH 2HMIC 3O4OB 1HWGB 2HTKC 4YUEL 3TO2B 5E1HB 5DD1L 5GXBB 3GMOA 1U3HB 4LLVB 2R4SH 5TF1H 4X6CB 1GC1H 3Q0HA 1B90A 1F58H 4TNVK 1Q9LB 4N8CH 2C9AA 3MRMA 3TNMB 4W4NA 2DM7A 4NRZB 1OLLA 4ETQA 1DBMH 1KJMB 2AJZA 5DD6B 3DLQR 5C08D 1BAFH 2MWCA 5FYLE 4YHYC 1CK0L 2OX5A 3BVNA 2C3HA 1N5AB 3QUYD 4PJHE 2GQHA 5ALBH 1MLBB 1JGDB 1VACA 3BGFC 4O02L 1EHAA 2ZUQB 3FAXA 4HUWA 4U1SB 3WLBA 1X5AA 4XXCA 4K7FA 5DD0L 5BS0A 5ILTH 4PRBA 3T1FA 5IW1A 2UYLB 1VSCA 1BBDH 1MCRA 1JZ4A 3QDGA 5FXCH 1TCRB 1P5VA 2J6EL 2BSED 5JPMB 5F96L 4PRNB 4F7MB 3A6BH 1KYOK 4YBQC 2DOCA 3UC0L 2NX5B 3MRKA 4JJHA 4OZHB 5T3XD 3U9PL 3WNPA 1Z5LB 4RAUB 2VC2L 3QZWB 3KPLB 3QNXA 5FHBL 1VFAA 4LLMB 5DRZA 1HILB 3O8XB 2EDNA 3FKUS 4UBDC 4PRHE 1BVZA 4NO2B 3SO3B 2CLVA 1H0DB 3D18A 4TVPH 4J4PA 1JRHH 1GVIA 3MOAL 2O5YL 3EOYG 1CGWA 3JVGC 3Q3GB 4DQOH 2Z92A 1FFPA 1TJGL 4LEOA 1P6AB 4ODUB 1JCKA 4JQVA 1RURL 4P2OB 1AY1H 4Y1AB 5IVXA 1EFXA 5FUZL 3W5MA 3EKCA 2EH7H 3KWWB 4ZD3L 1PQZA 4GKSA 1MUJA 1RZKH 2FIKB 2BOCB 3FQWA 1R3IL 5DJCA 1ONQA 4OZ4B 1OP5K 2VIRA 3QUXB 2DBJA 5HJ3A 2BY0A 1AE6H 2QHRL 5D6DA 3O11B 3TBSA 3JTTA 1S9YA 1J5OL 1QRNA 4OIIH 2DQEL 1KYOJ 4MB5A 3QPXH 2LABA 2B5IB 4N0FA 4NQDA 5F7EH 1UC6A 4S1QH 3KPRE 1CGXA 3FFCA 1BJMA 5F7WC 3MUZ1 4AMKL 5T3XH 4O5LL 1X7QB 4L9LA 3TBWB 4HKXA 1Q1JL 2AQ3A 4GW5A 2VE6B 4M7ZC 4JN1H 3PQYA 1QBAA 5J0BA 5C92A 4QF1A 1AP2A 2BSSA 2E7MA 3HB3C 4MJ4A 1PG7L 3REWB 1T83A 4ZFGL 2CMRH 5HVHB 5IQ7L 1MCKA 4M5YH 4LIQE 1NAKH 3CVIH 3QXAB 2V7NA 2AJVL 4IRSD 4HXBH 5CJ8A 3UPAA 3VDAA 3ESVF 5HYQA 4C58B 1A6AA 3REVB 7FABL 1SM3H 1KNOB 3L9RA 2ADFH 1N0LA 1P1ZA 2YSSB 5B39A 3ZLQC 4BFBD 5IBUB 1JN6A 3PDOB 2A6DB 5MHSD 2NZ9C 2VDLH 3K4DA 3DECA 1HQ4A 3C9NB 4AQOA 2A77H 4G6AD 2D0HA 3MGOB 1OAQL 2HFFB 3GGWA 1I75A 3LN9A 3GI9H 2O93L 2DQFB 4ELMA 3CK0H 1HQRB 3OJVC 5IT2L 3RPKA 3IDIA 5KANG 1AGDB 3H7BB 3SDDB 1MHPL 1JNLH 4LEXL 4OCMC 1I1YB 4WI7A 1ZTXH 3HC0A 1H5BB 5D71H 5GGVY 5GPRA 3FRPA 4Q6IB 3VW3H 1KACB 5E4IA 2V5YA 4RQQB 2Y23A 3O9WC 4NCC2 2X9YA 1OGAB 5ANME 3RDTA 3TN0B 1XGTB 3S5LA 5F9OH 4Z0XA 4XT1C 3MLVH 1PBYA 1J86A 4W68A 1LEKB 4P5TA 5JXEA 3OHXA 3ARDC 2NY3B 4DFHA 1UB6B 1X5JA 1NC2B 3O3BB 3UBXB 1QQDA 5CSZA 2WWKT 3MLYL 3GMLB 2H41A 5T33L 1A9BA 1AI1L 2I26N 5HD8C 3KJ4C 4RNRA 2ZOKA 4HQQH 2VQ1B 3SDCB 1MRCH 3BPLB 1LE5A 5D5MA 1JPST 1X5ZA 2Q8AL 4L3CB 5C0BE 2OS7A 3RVWD 1CR9L 3EGSB 4FFWC 5CJBA 5MP6L 1A8JH 2EE2A 1YJDH 4Y16B 3LHPL 2FB4H 4XP1H 1FL3A 1ZS8B 4NSKA 4DGIH 4LSVH 5C0AE 1GCFA 4O2FA 5LAXB 2C3VB 5L2KE 2J8UB 2EXWD 5DK0B 3GSNL 1CGTA 4G7YH 3QHFL 2JCCA 1M71A 1RIUH 2BFVL 4XWOD 2VH5L 3QIBD 3IFOA 5HHXL 4NNXB 4DGVL 4JKLA 4L3EE 2QSVA 2R8SH 1NDGB 5CHNB 1A47A 1MEXH 1SHMA 2F74A 2EDHA 4D0CA 4XPBL 4R0LA 1K4DB 1W0VA 2APWA 4PLOB 5IBTH 1IZKA 4W4OA 2NTFB 3WN5B 5JOPD 5MEND 5F3HA 5IHUL 3W11D 3DETD 4KQ3L 4L8SA 5CSGA 2X4RB 3O2DH 4Z7QF 3MFFA 5ISZD 3ZE0E 2RAMA 1Y6KR 4JFOA 1G7QA 2GT9B 5KVFH 3EO0B 4YAQA 3ULVE 4HUKB 1C7TA 3ABZA 1JHKH 4D3CL 5LG1A 1SYSB 5DJXB 5BCAA 4S1RH 3KPMA 4JY6A 4KUCF 2DI9A 4PJXB 4X4ME 5FO9B 1CN4A 3LKOA 3D0VB 3VXPB 3V6OC 1QFWH 1PKQE 1SEQL 4M62H 1CLZL 2NY5L 3NCYS 5KTEL 2R23B 5BV7C 1FN4A 2E3VA 3VWKD 3PV6B 4FQXA 5J6HA 4R90L 1F97A 4IRJB 1AH1A 4Y5YB 3N1QC 1OAUH 4WJ5A 1KIRB 5E8OB 4F37K 4WW2A 3MO1B 3LCYA 4P0DA 1GXEA 4F7TB 1FNSL 4M8VA 2XN9E 5HGAA 4L5FH 3BOVA 3GBNH 1CGUA 3RI5K 2V17H 3J8F7 3CGTA 1U92A 2ITDB 5J57B 5I1KH 2W9DH 3VXSE 3UTSA 3H3PL 5AAMA 3OQ3B 3VXQB 1N64H 5KW9H 2FO4B 3MR9A 5DYOB 4OJFL 4QT5A 5GQBA 4EXKA 2JK5A 4F58H 5KSUB 1MQKH 4H8WL 5DURD 5T3ZL 2WV3A 1LGVA 1VFBA 4XPAH 1DUZB 3MYZA 1V8HA 2A9NH 5TDNB 1T21A 1P7QD 4AEHL 1PSKL 2GIYA 3P73A 4ZTPL 2FR4A 3CH1B 5FB8A 3FO0H 3B6SA 4QXGL 2SEBB 3WUWG 3X12B 5BW7A 1KXVC 5FCUH 4K7PX 3QEQB 4RRPA 3LKNB 1DBJH 5KZCB 5HHOE 3RNQB 1VEPA 5CD3B 5EBMA 3OAZH 3TCLB 3VCLB 1CFTA 1S7WB 4XTRC 4MNHA 3C6LA 4AIZA 1T4KA 5DTFB 4K23H 2P47B 3VFNB 4NC2B 1NEZB 5CEZE 4BUHA 1VKXA 2YUWA 2CO6B 1MH5A 1J10A 1EUTA 1H3PH 3PNWA 5L2JA 1J0IA 4XHJD 5BZDA 4U1KB 4FP8L 3LKPB 4CVZB 5T1LA 1M7DB 1RZJC 1AHWB 3R8BB 1T7VA 2YWYA 4NJ9L 1CICC 1EXUA 5KOMC 1RUQH 3TH4T 4Y5VC 3RGVB 2COQA 4PP1D 1WBYA 5MEOA 1P4IH 1UM6L 4Y4HC 3WV0A 5B4MC 1TZGH 4HZAA 5EBWB 2FEDD 3VXRE 4PG2A 5E5MA 1G9NL 5L8KB 1FIGL 3BKCH 1OD7A 2RCSL 3GJFK 1F02I 1DBAL 1HCFX 3NCYP 2APXA 1NEUA 1KPRB 1IEAB 3NMEA 4BK4A 1TTUA 4MGXA 5EU4A 2R4SL 3ULVC 5TF1L 1AXIB 1GC1L 2CXKA 1F58L 1KLFA 5MERB 5EOCH 4YJZL 1ZSDB 1A3RH 3X3GL 2RJMA 4N8CL 3PHSA 4UILH 4HS6A 3KPSD 1R24A 1DBML 1BAFL 1D9KC 4E41D 2VB5A 3BP5A 3K1DA 4CDHA 5C2UB 3QJHA 5ALBL 3WO4B 3VI4E 5GISH 5LJYH 1VCAA 5IB4A 3QIBB 2XZAH 5ILTL 3FN0H 4N0RA 5JLZB 1BBDL 1YQVH 3ILQC 4MJ5B 5D7JA 2KDGA 5F9WB 1YNLH 2VLKD 5DJ6B 4DZBA 3P11H 4ZAKA 2VLJE 3A6BL 4ZDHB 4IIQC 5IFJA 4M1CC 1QSFB 2DIAA 2JB6B 4Z78A 2Z31B 4WFHD 3T0EA 2BP3A 3EFDH 4WDIB 1XGUA 5ISZB 4H26B 4WFFE 3TZVD 3MX0A 4DKFH 5D1ZA 4C55A 2L7JA 3BPNC 3LQAH 2AW2A 2DM4A 5DGRA 4TVPL 2A0LD 1JRHL 3TBTA 3MBEC 3NFNA 4AZ8A 2WIIA 1I7ZB 4D0BB 3CU1A 4DQOL 3P0YH 3JV4A 5KVEH 4UUJA 1VERA 1A1NA 2CDEB 1AY1L 3H42H 4ZXBB 3VWKB 1I8KA 2EH7L 2W65A 4OF8A 1IEBA 5AD0A 1RZKL 5J6GA 5CD5D 3U9UB 5KVMC 3FT3A 4KVNH 3ZE2F 1S7RB 1QEWA 3SJVE 2NY1D 1AE6L 4AEIH 4P3DB 4Y19E 4AT6A 3FQRA 4NKMB 4FZ8H 1WIUA 3P4LA 4OIIL 2OJEB 3QPXL 4RDQF 2AJUH 5F7EL 4XPHH 4S1QL 3DX6A 3R1GH 4XCNB 4KUZH 1K4CA 5JNYB 1SJHB 4JFFD 3T77B 3P4MB 4NN5C 4JQXC 1C7SA 3HLAB 2DYPB 3MRQA 1MREH 4JN1L 3VFMB 2ICWJ 4YHIA 4NQSB 5F8QC 5DURB 4LHUB 4LGRB 5C0DA 5CJXC 3UDWA 2CMRL 5HPMA 1EEUA 1ZVSB 1P7QB 2OTWB 4M5YL 3MRJA 1NAKL 2RFXB 3CVIL 5LKNA 4JEGB 1U8JB 3WJLA 1XF1A 4HXBL 1T6VN 1XF2A 4JFYB 4NQCA 3OJ2C 4QHLA 1AO7A 5EIIA 1F3RB 2AI0H 4ZFOB 5KSAD 2OI9C 1XZ0A 5J3HC 1SM3L 4MS8D 1Q94A 3HUJB 1WIPA 2ADFL 15C8H 4FTVE 1KUMA 4R97B 4KJPD 2P8MA 3PWJB 3D0LA 3S97C 4TTDD 2VDLL 4PJ9A 5E6IA 1FZJA 4LRNH 4WU5A 5BRZD 2A77L 3D48R 3RWHA 3OPZH 4K9EC 1OP3H 2QBWA 3AUVA 2W0FA 3KNBB 4J3OC 3GI9L 2OSLB 4JY4B 1FVEB 3CK0L 5DJ0A 3DGGB 4POUB 3UZVB 5E00A 5FGBC 4G8IB 3CCHA 1XGRA 4Z7WB 1JNLL 1ZTXL 2NY4C 4PJDE 3QFDB 5D71L 3NIFF 3PWUA 1I7TA 2M8XA 3VW3L 4KJWC 1UM5H 1U0QA 4MZ3A 4K8RD 5F9OL 2ZPKH 3MLVL 5C09A 3ARFA 4HHAB 1BZ9A 4MDIB 4JDVB 4M48H 2DLHA 1MLCB 3BP4A 2VSCA 2IBZY 4ZUTA 1S7UB 3GSQA 4LRIC 4XX1G 4JM2B 5ITFA 3WLWC 4PV9A 5I2IA 5IJKA 5I8EB 1YUHB 4HCRA 4HUMB 1G7LB 4LP5A 1HH9B 1JWUA 4L4VE 4NN6B 3OJDA 4Z7NF 4AY0A 4HFUH 2WW8A 5GIRB 5DFVD 5CFHA 2H26A 1F11B 1NCCH 1XFPA 2WZPD 4HQQL 3EIFA 1MRCL 2QV2A 1NCTA 3DIFB 3TYFA 3N0PB 3KPSB 5D93C 1PJ9A 3WHE1 2Q6WB 4ONOA 4HJGA 2ICEA 4E41B 1YJDL 1BD2E 2FB4L 2MQCA 4CW1A 4XP1L 3WJJA 3ARTA 5A43C 2ZSVA 1NANH 5K9OB 1T7WA 4DGIL 4LSVL 4N9GB 2UWEE 3UBXI 3EFFA 5C0FA 1Y0LA 32C2B 3CFKB 4HJ0D 4RX4D 4YZFE 4F33A 4L9DA 2MNUA 3CSYA 4HAGA 1A7QH 4I77H 5C0IB 4N0UE 4WI5A 5IJVB 4FQHB 4G7YL 3RPIA 3I6KB 4ZFZB 3MCLH 1RJZA 1B6DA 1C08B 1QFWM 1RIUL 4LCWE 1OTTD 3R06A 3HZKA 2X1WL 5E8EA 4LLUB 1TPXC 4HEME 1FHGA 4HZLA 5B8CC 2R8SL 2YA0A 3BP7A 1ITCA 1MEXL 2VISB 3LS4H 1JPFA 4FMFA 5J8OA 1YEKH 2OBGA 5IBTL 4WUUD 4WWID 3T0DA 3RWCB 5HHVH 2E9IA 3L3JA 1HOCA 3HPLB 5FO7B 4HWBH 5H94B 4JRWA 5HHPA 3HAEA 3O2DL 3E8UH 4TUJB 4UV4H 4HW6A 4PJEB 5HYJA 2VITB 1NFIA 4HV8A 5KVFL 4YPGA 1B4RA 1JHKL 1P84K 5KS9A 1JWSB 4JPWH 2DS4A 3DRTB 1AKJA 2V7HB 1G7MA 5D7LD 2J4WH 1I4FB 3HS0A 3OZ9H 1QFWL 1EA9C 4LLYB 5FUOH 4GUPB 2C1PA 2CLRA 4M62L 3ALWA 4KC3B 3V6FA 4GT7A 1J88A 4J3TA 4J3UA 3QUKB 3KVQA 5DQDH 2PCPB 1OAYH 3TCXA 4AM0B 1CIUA 3QQ4A 1BVLA 3MRDA 4YDVB 1OAUL 3PWNA 3VD7A 1F00I 5JHDE 1CF8H 3G5YB 1J8HA 2V2XB 4JFFB 3CPLB 4P46D 2QADC 4P23C 4OZFG 1TDQA 3JVGA 2J5LB 4L5FL 4U1GC 3UPCA 1NC4A 1GOGA 1LILA 1AIFB 4OAWB 1UEMA 2XNAA 4GBXB 2BVOA 2V17L 1G7HA 3NAAH 2OL3H 4MCZA 5GGTH 2IH1B 5A2LH 5I1KL 2W9DL 4HMDA 4G6JH 4MVBC 5ICYA 5DMIH 5H35A 4QY8A 1N64L 1NUDA 5KW9L 4F58L 3DO7B 2GK2A 1U8HA 1MQKL 3DBXA 4QRSB 1DN2A 1P84J 2MMXA 1P53A 2CUIA 3PABB 2BXZA 3OKMA 4XPAL 4M61B 4OTXH 2A38A 2A9NL 5KSAB 1OD9A 4FS0A 4JHWH 4WW1A 2BNQB 5E5UB 3D3VB 3BGMB 2OM5A 3NTCH 5D70H 2H45A 1LO4H 3FO0L 3PP3H 1AGCB 5FCUL 3IVKB 3D25B 4AJ0A 3VG0H 4DK3A 2VLRE 1DBJL 4CNIA 2RIKA 3MRFB 1PZUB 1I7RA 3B43A 4BQBA 3JTSB 3P4NB 3K2UH 5IBLC 5I6XC 3ZT5A 3CDYA 3RHWF 4F2MA 1E6OH 4OD2A 1TETH 1JGVH 3CU7A 4K23L 1EO8H 1YEIH 1WTGT 4NM4H 4YK4C 4BFIA 4DUVA 3RVUD 2Y7QB 5DVLA 5EH1A 3ZL4H 3VXMA 3ZKND 1H3PL 2CDGA 2P8LA 3QCVH 1KPVA 3BXNA 3GMRB 2GJZA 4G8FA 1B6UA 3HCVB 5I71C 4KV5F 5DS8A 4MA1C 3WHXB 1RUQL 3D9AH 3VE0B 1JTTA 3MRIA 5D1XC 1K2DA 1P4IL 4WTWA 1TZGL 1H15B 4WUKH 4HBCH 5FYJE 1WWWX 2NNAB 1FE8H 3T2OA 3BKCL 3FRUB 3NIDF 2X4PB 5J1AB 4MA3B 2XKSA 4LPWA 3HN3A 3TVMB 1MCBA 1HDMA 4X80H 4CMMB 4PJHA 3U7AA 5I1DA 4DW2H 2OTUB 2JJVA 1ND0A 4OZFA 1IAKB 4YDLC 1LO3H 4HK0B 3O9WA 5EOCL 3ZDXE 1A3RL 5FM4A 1NMAH 3VXOA 4UILL 3D87B 2XFXA 4G8GE 2D7MA 4P99A 4E42A 2OJZH 3GB7A 5DZLA 1BEYH 3ARDA 1KB5H 4NP4H 2OXGA 2D0GA 5J1TC 4NHUA 4JRYE 2KZWA 5GISL 5A3IC 4PJCE 5JO5B 1K8IB 2XZAL 4QHUA 3LRGA 2Q8BH 4DVBA 2EYSB 3FN0L 3SPVB 2F15A 3AREA 1YQVL 1YQ2A 4PRHA 3B2UD 2GSGB 4GRLA 1YNLL 3P11L 4YNYB 4B41A 1J0YA 4QRRB 1BFOB 3K4AA 4WUUB 3S4SB 2R2BA 1U95A 1KJVA 5HGHB 5EOTA 4QOKD 4PRAB 3ILPA 5IMLB 2MTPA 4L4JA 1OP5H 3M17A 4G9FD 2X7LA 4P2RE 5IMMB 3NCMA 4GKZA 4DKFL 1U8OB 2ADGA 1QSVA 1VENA 1S7SA 3LQAL 5JPNA 4LARH 1BLNB 4PJGB 1JF1B 4PRIE 5D7LB 4P5KB 1KFAH 2XV6B 3P0YL 5KVEL 5HHMB 5TDPA 4MWFB 8FABB 3RAJH 2BVQB 3H42L 4LBEB 1LD9A 4PR5B 1HINH 1IL1B 4LCUA 5JW4M 1WAAF 4KVNL 3G6DH 4LPVA 1MI5A 1XF3A 1I1FB 1RUMH 1J05A 3BDXA 4AENB 4ZFFA 5A16B 4WWKD 4R4ND 2DWEB 1S9VB 4OFPA 5EC2B 1H3UA 4AEIL 4P46B 3RUGB 3C8KA 2MKWA 4FZ8L 4X4YA 2XTJC 4OI8A 1CDCA 1HI6B 1U93A 3L5WB 2AJUL 4XPHL 4RFEA 1XF4A 1QO3B 3R1GL 4X6CE 4BM7A 5JQ6H 4KUZL 4MAYB 3C09C 1CDUA 4G6MH 4YIQA 4LVNC 4PRPB 5D7KE 3V6OA 2BZDA 1MREL 2BERA 1QPXA 1P9MC 4I0PC 3S36X 3LV3A 5ESQA 2WIMA 1XCQA 4Z7VF 3HNTH 3T1WA 4JREC 2HJFB 4JN2A 1FJ1B 2BDNH 5ALCH 5CGTA 3RL2A 4JFHE 3FB7A 4C56D 2EXYD 2HVKA 2I5YH 3DVNA 1BX2B 4JZNB 5C0EB 5EZLA 4ALAH 3QO1A 2AI0L 4LSUH 4NDMA 1JNHA 4NKOA 4W6XB 1KJ2H 4G6FD 4KKCD 1HH6B 1E4XH 2NX5E 4EN3C 15C8L 4OZHE 5HDQH 4KROB 2IH3B 1X5LA 4PJ7B 2R2HB 4LRNL 2G5RA 1I1AC 1NH6A 1YDPB 1OGTB 4PJ8D 1MVFA 3OPZL 5T3ZE 3RZCC 4F8QA 3EYUH 3U30C 2EDFA 4IS6B 2YOCA 3BUYB 4WO4C 4NGHH 3OR7B 3QEUA 3NIGE 3ROLB 2A1WH 1ZA3B 4NZRH 1BZ7A 2ZNWA 1FGVH 4X0KB 5IQ9A 4Y1AE 1BOGA 4JLRA 4NQEA 1UM5L 1WT5C 3GSRB 1RQ5A 1YY9C 5F7FA 5GRJH 4I13B 5HY9B 4NBZB 4WIQA 2PW1B 3MNWA 4LASH 4CKVX 4Y5XB 2O5XH 4N68A 2ZPKL 3TYGH 4NRYB 3U36B 4CU6A 5C1MB 2R39A 3ARBC 3QDMD 4EI5C 3IJSB 2FJGA 4L4TD 4M48L 5C0BA 3TA3A 4JVPA 3FO1B 5T1MA 2DM3A 3AC0A 1FL5B 2BNRA 5HBBA 2YRPA 2J88H 1T04A 3QI9D 1MCIA 4O58H 3LB6C 4HFUL 4M00A 5L2KA 5KG9A 5EN2A 3RP1A 4MDJA 3BQUB 3D2UA 1I85C 3NFPA 1NCCL 4P2QD 4NPYB 3OXSB 4ZUVA 2BHUA 2ARWA 4B50A 3FJTA 3U0PB 1CICA 4Y4FA 3W0WD 5I8CA 3VXUD 4K94H 4NO3B 2VLLA 5L0QC 4L3EA 4LLWA 4YHNB 4EUPG 4G3YH 2X4TB 2EDLA 4OZIB 1AGFA 1IC5H 1HHHB 4Y4HA 2R1WA 2AABH 3EYVB 4M8QB 3VFUA 5I76A 2DJSA 4KI5D 5JW5A 4I77L 1A7QL 2QKIB 5I1LB 1MHHB 1W8NA 1FLRH 1MCQA 1Z3GH 2VZ3A 2K9UA 3T0BA 3MCLL 2PYFA 5ICXB 4KJYA 3O4OC 5SWQB 4GAGH 4QXTB 2PETA 5C0GA 5JORA 1WISA 3PIQA 4NHCH 4XC1H 4GXUM 4APQB 3UYRH 1U3HC 5FKPB 3FQUB 1TNMA 3QNZB 1M7IA 3LS4L 4UQ3B 1YEKL 3MMEA 5DK2A 1UB5A 5I19H 2V2TB 4X4MA 1VA9A 5GJTH 1I8IA 2V9TA 2EYRB 2B20A 5HHVL 4HF5H 3AB0B 2NY5C 4BJLA 5K9QI 1BQHA 3WFBH 4ODBD 4HWBL 5GGUA 3UTZB 2FBOJ 4P5MB 3PWLA 4U2ZA 3TJHD 3E8UL 5GS2D 4UV4L 1UG9A 2ZUQC 3H0TA 5GGSY 1WFTA 5E2WH 3S36H 4JPWL 1FZOA 1WWBX 1OGAE 1DEEA 2FJFB 5EORH 5DLMH 2J4WL 5JDSB 4IIQA 3U2SB 1KJ2B 1FYTA 3ZE2E 3OZ9L 5FUOL 2EDRA 3ARWA 4OFKA 2VN4A 3L3KA 4JFDD 1TVHB 4U7KA 1NJ9A 5DQDL 1D5IL 5DXWA 1WBXB 3GRWA 3TNNA 2N4IA 1OAYL 5ID1B 1P7HL 3V95A 1GYAA 4HIJA 3VXSA 3O4LA 1HKFA 3LQZA 3O8XC 1EHNA 3K3QA 4TVPE 2Q7YA 1AGEA 4OD1H 3SO3C 1MFDH 2XA8H 5HVGB 4NKDB 4RAVB 1ZGLB 2OXHA 1CF8L 4HGMA 2G9HB 3MBEA 4GW1B 4ZPVA 3CVHA 5HI5C 5HYSB 1A1OA 5SWSD 4NQVA 3UXFA 2D2OA 5HI3D 4IDJH 1MFCH 4LPTA 2EDBA 1TITA 5SV4A 3WFDH 5B38B 2XWJA 3TH2T 3HE6D 3F7RA 4P2OC 3T4YA 1EZVX 3NAAL 1K3IA 2OL3L 3BW9B 1HE7A 5GGTL 4NN7C 4CBPA 1DVFB 5ESVA 1LNUB 2GK0B 5DQJA 5HDBF 4G6JL 3A0OA 3IU3B 5DMIL 5GS2H 3OKEA 1RMFH 1OW0C 4ETYA 5DJDA 1RZ8A 2J8UE 2H3NB 5IM7A 4D94A 2IPKA 5E08H 3QUXC 3T3MF 1DQQB 4K71B 1QR4A 4FG6D 3F58H 3KDMA 3BH9A 4MZ2A 4OTXL 3DTXA 4F8TA 5GGSA 4JHWL 1JFQH 3OAYK 5DJZA 2B5IC 3NTCL 4PGDA 1R3JA 3OKKA 2VR9A 3IDNB 1LO4L 5D70L 1E28A 3WE6A 5I0DA 5DD5H 3CLFH 1GZPA 3S34H 5E70A 3VG0L 1JHTA 4JQXA 2D4FA 4MJ6A 1SJEB 4ZMAT 2KZ1B 5IEKA 1TTFA 1QBLH 1P7KA 3VWJD 3G9VA 4ISVA 4CRPA 3G6JF 3K2UL 4FFYH 5CJXA 2J1KA 4U1NA 2PO6D 3L95B 1E6OL 4L29A 1TETL 5F7DA 5HVHC 2OLDA 1JGVL 4KVCH 3CLEH 1EO8L 1RZGA 1YEIL 4NM4L 3GJFH 3O41A 4L1DA 1G9NC 4OCYH 3CZFB 3HZYB 3ZL4L 3NACH 4O2CA 5ID0A 1BPVA 5F93C 3VXRA 1QVOA 4U7MA 4PJXE 2M26A 2NY7H 1A4KA 3QCVL 1BFSA 4G42A 5GRZA 1JZ6A 2I25N 1FC1A 3SCMD 1T6WA 3QDMB 3SDYH 3D9AL 3BRFA 1GC1C 4ODVH 3BJLA 3G9AB 4FQJH 2B4CC 3LD8B 5FOBB 4FQ1H 5EUOB 4BFEA 1G7JB 1V3MA 2XIDA 4LSDA 4WUKL 2LU3A 4HBCL 3QI9B 1MNUH 2VZTA 1R3HA 3RWGB 1FE8L 4Z7NE 1K5NA 3FT4B 3BRDA 3A67H 1IAMA 4Q7DA 3UP1A 3LEVH 5FGBA 4X80L 1JI1A 4LAQH 5C6PB 3SDDC 3BISA 3HG1D 3OX8A 1H5BC 2X4UB 3KPOB 4DW2L 3W0WB 4YBLB 3VXUB 2XXCB 4Q6IC 3G5VB 1NDMA 2VZVA 4NUGH 1LO3L 4O2EB 1YN7B 3D85A 3FO2A 1S7VA 3H9SA 2A83A 1NMAL 3TN0C 3F7PC 4R8WH 3RVTC 2VLJA 3QUZA 3TM6A 1YEDB 2FGWH 2Z8WC 1Y18B 2OJZL 5I17B 5EC1B 1BEYL 2E8YA 1KB5L 3IJHB 4NP4L 5F1NB 4XWGH 1UT9A 3VFTB 3I85A 2NY3C 4LRIA 1NFDB 1YMHA 2E6JA 4LSPH 3I75A 2C26A 2Q8BL 5SWZB 5DJYB 2DRUA 4MQ7A 2ZUYA 3LN4A 1WWCA 4JKWA 5FV2A 3SGDI 4RA3A 4UDTB 3QEQE 4W6YB 2LVEA 4H1LG 3MLUH 3SDCC 2Y5TB 3BPLC 1FZMA 1HHJA 4J6RH 3DX8A 3MNVA 3QPQD 1P2CB 4XGZB 4Y16C 4NFBA 3TBVB 4HX1B 1RZKC 4Z7OF 4PJFB 5J56B 1IGTB 3HZMA 5IEHB 4U1LB 5BJTA 4MCYA 2DJ4A 3AXLB 5DI8B 1DQJB 5D2LB 3V0VA 4D8PA 4LCYB 3SJVA 1P4LB 1KT2A 1A3LH 3MRBB 4LARL 4I5BB 3R0NA 1N0XH 1KFAL 4Y19A 3THMH 4EVNA 2HFEB 3U0TA 2IJ0C 1CE6A 3RAJL 4HUUB 3QO0B 3Q48A 5LVEA 4FXGB 5B8CA 3V7AE 1HINL 2BVPA 3AVEA 4K3GA 2H8PA 5JIKA 3G6DL 4EI6A 3MLZH 1RUML 1WK0A 3ZHLA 5JOFB 3QRGH 4OKDA 4X6EA 1KTDA 5FECA 4JE4B 4TUOA 5IUSA 3GJFB 1SMOA 2KUTA 5CBEB 2N7BA 3WFEH 2IFFH 5JQ6L 3KR3H 1RZFH 5HGBA 4G6ML 1G7IB 1LEIA 5F88B 1O0VA 3DXAB 2CK0H 5D9SB 2A6KB 4O51A 2Z91A 2V9QA 1YY8B 3K46A 5ADPH 1T5XA 1ZGLM 3OKYA 1XEDA 4O9HH 3KYAA 3RA7H 4FTVA 2ITCA 3C6SB 3ZKMD 3HNTL 1NBQA 1INQB 2IG2H 4IRJC 1XIWB 5EU7E 2BDNL 5ALCL 4Y5YC 3VGDA 3GIVB 1NBZA 2CIKA 5T1DL 4UOW1 1VEOA 3S7GA 3UJJH 3NCEB 2I5YL 3OKNA 3ULUE 3FZUD 1UJ3B 4ALAL 4P23A 4LSUL 1UYWH 2BCKB 2EEDA 1JZ7A 4R26H 1CD1A 5JOPE 1KJ2L 1QSFE 1FL6B 4JFZH 1E4XL 3CFBB 3FB5A 3IDMB 2IQAB 4H1LA 4N1EA 4PJDA 4XH2B 1L0XA 5HGGS 5HHQB 4OCSH 5HDQL 3B5GA 3I6LD 5ISZE 3AGVA 5TGBA 5CZKA 2B2XH 3QISA 4PS4H 4TYUA 2ATPA 4P4KB 1AD0A 1NGXB 1HK6A 3EYUL 2I60H 1KEMH 3CIQA 3MRPB 4XZUA 3IRZA 1E27B 4BSVB 4NGHL 5HGDA 3QJFB 5E4EB 1SVCP 2VNCA 2ICWB 3O6LH 1IQDB 2A1WL 4MX7A 3SKMB 4NZRL 4Z7VA 1FGVL 1A6WH 4QRPD 4Q9QH 2AEWA 3HRZB 2ORBH 4LKCB 2FJHB 9CGTA 4AIXA 4L4VA 4YGVB 4PJ5D 4L8DA 5GRJL 3EYQC 3OBAA 4KGJA 4LASL 2NY6B 2A74A 3NZHH 2O5XL 3TYGL 1YN6B 4G6AC 5EPMA 2BC4B 4OSUH 2DI7A 1NL0H 3BFOA 3ZYIA 3D39B 2OZ4A 3T4AA 3DV6A 2NY0D 3A6CH 1BP3B 2DIJA 4Q6YA 4CADA 1SY6A 2AKRB 4JRXA 5BXFA 2J88L 2UWEA 3VGHA 2HT2D 3GMQB 3HG1B 1N59A 4LP4A 1Q9KB 4O58L 4HH9A 5E95B 4N0UA 5DMYA 5JW3H 3VJ6B 5T5NF 5CKAA 3W9DB 1QFPA 1AHWC 4POZC 5IB2A 4Z7UB 1OQXA 4K94L 3QULA 1MIMH 1QSEA 1RJYB 4MD0B 3VD4A 1OPGH 3RGVC 4X6DB 2GITA 2P24A 1I7UA 1KOAA 3GK8H 5D1XA 3SDXF 2HG5A 2HLFC 3KHQA 2AABL 2DMKA 1XH3A 5JHLH 2PTVA 3CXHK 2CO7B 5K93A 1ZEAH 3NA9H 3PP4H 3L3OA 1FLRL 3IXAA 4PV8A 1Z3GL 1H8SA 3TBYA 3T3PF 2IANB 5F1IB 4QRQA 2ZOLB 1WCBB 2DQDH 3KYOB 3HUJE 3EYOA 4XNZB 4GAGL 2J8HA 4GG8B 3UPRA 1FFNA 4IOIB 3KLDA 3CFEA 4NHCL 3RVWC 4M02A 4XC1L 3MJ7B 1T5WB 4HWZA 1IBGH 3UYRL 4HG4K 5BS0D 2FNBA 4MQXD 3P0VH 4GW4B 5HYFA 2AK4D 5H2BA 1PZ5A 3B83A 3PWVA 4R6UA 5I19L 3QDGD 5IFHL 4HS8H 5GJTL 3SKUD 4C54A 1DQDH 4GQ9H 4HF5L 2EXWC 4PY7B 3S8WA 3P9LB 1WLHA 2GSIB 3WFBL 1T20A 3WO4C 4Z7WE 5K59F 4F3FB 4OBRA 5MEPB 3VH8A 1SBBA 5CGMA 1S9KC 4XWOC 5GGRB 3QIBC 4OGXH 5E2WL 2YBRB 2ENYA 2DL9A 1KTKE 1R5IB 3S36L 1RPQA 3HE7D 3KS0J 1F4WH 4J4PD 5EORL 5DLML 1BVKB 5F9WC 5JHDA 3ULUC 3VFWA 1WAAE 1YEHH 3CXHJ 3EO1A 5CLWA 3IJYB 1T2QH 4GAYA 3EAKA 5B3NA 1BBJA 4RGND 5IIEA 3CJJA 2Z31C 4HLJA 2NY2D 4QCIA 3M07A 3DETC 4JAMA 1EFXD 2C3XA 2BVUA 2X70A 3U1SH 4GSDH 1SMAA 3LKQA 2XPGB 4M5ZH 2HJKA 4HG4J 4OD1L 3DX9B 1MFDL 2XA8L 4HWNA 3OMZA 4PB9H 4X8JA 3QAZB 5TH2A 2C1OA 3WS3A 3QA3B 1MJJA 3F5WB 4OGAC 3KPSE 1DE4A 1A1MB 1LP9F 1MFCL 1CQKA 1JP5A 4IDJL 1QRND 5F7NC 3WFDL 3IF1B 3MROA 4E41E 2IF7A 4HLZH 1EJOH 3VFOA 1OB1A 3F62A 4ZXBC 4NOFA 3VWKC 4HUXB 3FFCD 2X10A 2F53D 3L3HB 2ZP0T 2FECL 1RMFL 2BSTA 4JFED 2Y07H 2QSTA 1D5MA 1WICA 1IT9H 5FO8B 1LO5B 2VLRA 5DUBA 5E08L 12E8H 4YO0B 1ZT4B 1DCLA 3F58L 2YXFA 1KF9B 3MYJB 2R9HC 2DBLH 4FFVC 1JFQL 5L88H 4X7SH 5E2VH 2BX5A 3IFPA 4XI5C 5HPOA 5DD5L 1BFVH 3CFJB 3CLFL 3OKLB 3S34L 1G6RH 4IMLA 5EO9A 2YZ1A 3C5JA 1TFHA 3I6GA 3RKDD 4HKJB 1QBLL 3I3DA 4I0PA 2LVCA 1GRWA 4FFYL 1QR1A 3BPCB 1GIGH 2HN7B 3B5TA 3KPRB 4KVCL 4PJEE 5ESAA 3CLEL 2PYEA 3IKCB 3G5XA 2R56H 4OCYL 3NACL 2A6JA 1JE6A 2NY7L 3B9KD 3UTQB 4EJ1C 1OOAA 1SBSH 4XBPB 3BEVB 3WFHB 3BMVA 4V2CB 1Z0MA 3ZTJH 1PYWB 1TVDA 1DN0A 4EN3A 3SDYL 4X7CC 4JG1H 4R97C 1X9QA 2EDYA 3T2NH 3LDBB 2YPLA 3QXDA 4ODVL 2NY0B 4FQJL 4Z77B 4PJAF 2K7QA 4FQ1L 3S35X 3WO3B 4F7PB 3RDTD 1J11A 1IAIH 3CAFA 4N0YH 1PLGH 4HSQA 4JHAH 3SGKC 1MNUL 1LO0H 3QUMA 1JPTH 5ERWB 4ODHH 5ACZA 4KI1A 4JFFE 4P5TD 5JXED 4MXVF 3A67L 2H6PA 4WO4A 2VDMH 3LEVL 4XHJC 2I07A 4LAQL 4KK8D 3RTQB 1DUYA 4PREA 4JPKH 4PJCA 1CCZA 5EZOH 3ZYJA 1WT5A 4KKLD 1N7MH 5DFWH 4NUGL 2GFBA 1IM9A 3PWPA 3OSKA 1U8MB 5I30H 3GSXB 4R8WL 3F7VA 3ARBA 3FONA 4EI5A 5EU5A 1N6UA 1LVEA 2FGWL 4MMXC 2XZCH 1R3LA 4XWGL 4M6OH 4PP2A 2P5EB 5SV3A 2VWEE 2YN5A 4JM2C 3GSWA 4YFLI 4LSPL 3D3VE 1VACB 3BD4A 2EYTB 4MNQA 3JZ7A 5ANMB 1LE9A 3L7FB 4P2RA 4WGVB 3UYOD 4NN6C 4KKBC 3UROR 2W60A 1OP9A 5D7IA 5IW1B 1FFRA 2AK4B 2HJLB 1I85A 3RVVD 4MSWA 3OGCB 3QDGB 3MLUL 1Q0YH 3MRRB 4PRIA 3SE9H 4J6RL 4F7EA 3BHBA 4QGYA 5C9JA 1KULA 4L8BA 1WUNT 3O3DA 1D5XA 3TT3H 4OFYA 1GGCH 1UFUA 4WU7A 2MFNA 5FUCE 5DUPL 1S5IH 2BVYA 3QNXB 4IDLA 5DRZB 2BNUB 1AQDA 3MJ8B 4EZMA 5LBSH 3GKWH 5I8OH 1KPUB 1G0DA 3E0GA 3MOBH 3HE7B 1A3LL 4PTUA 2VDQH 3MV7B 5DJ2B 2AV1A 1N0XL 3V9FA 4X7TB 3THML 4LHJB 4WHCA 1DP0A 3UO1H 1JGEB 4OZGF 3TO2A 1YEEH 4LAJH 4RGNB 1U3HA 1BM3H 4LLVA 3MC0A 2DQCH 5GSVB 2NY2B 1G6RB 4X6CA 3BI9X 1MUJB 1Q9LA 1Z6JT 4LKXA 3FQWB 3TNMA 3JWNC 4RWYH 4PLKD 2QQKH 1CXFA 3MLZL 4NRZA 3I3EA 3RVXD 1KJMA 1KTRL 2BY3A 2VIRB 5JUEH 5B21A 2A0LC 1FO0A 5E99H 3QRGL 1N5AA 1JGDA 3B8YA 3JTTB 4FQXD 4I8DA 5GGVH 1YECH 3O3EB 4C83A 1JIBA 2VAAA 3WFEL 4EDXB 2NQCA 2IFFL 4C59B 2UYLA 1WC7B 3KR3L 1RZFL 2F8VA 2GJJA 3QXUA 1TCRA 2F53B 4XXDB 5HDBE 5CD5C 3RWDA 5JPMA 4F7MA 4L9LB 4JFEB 4QHNB 2CK0L 5D6CB 5ADPL 3VRIB 3F6IA 3BN9C 2ZWLT 2NX5A 4KKAD 4O9HL 3RA7L 3T3ME 2HYMA 4KDWA 4OZHA 1FNEB 1Z5LA 2BSSB 2W1NA 4RAUA 1EFQA 3QZWA 2IG2L 3KPLA 3S3JA 3UTSD 4LLMA 4LSSH 1J9CT 2VXVH 5CP7B 2W07A 3O8XA 1B4JH 1ZAGA 3M8OH 4PJIA 4NO2A 1VADB 3DV4B 3N1PC 3ROOB 3UJJL 1H0DA 1PKQB 4BH7B 2AJYH 4TOYH 4QRRE 4WUUE 1UYWL 5HI4D 3S35H 1VEMA 4R26L 2J5LC 3Q3GA 4OCNC 4ZTOH 4JFZL 4ODUA 1L7TH 2BVTA 4P2OA 4OCSL 3IS0X 4GBXC 4YR6B 3KWWA 4BZ1H 1WFUA 2B2XL 2FIKA 2BOCA 4WI9A 1EHLH 4PS4L 2N7AA 3GZKA 4CMHB 1OW0A 2BRRH 5IESH 4OZ4A 2YC1B 1HHIA 2Q87A 2I60L 3QUXA 1KEML 1U8NB 2V5MA 4PJGE 3O11A 5D7LE 1UENA 2WBWB 3B9KB 3QXWA 1JZ2A 4DKAA 3O6LL 3CX5K 1NAMB 5KSAC 1U8QB 2VWEC 5HHME 5FK9B 1A6WL 4MS8C 4Q9QL 3P4OB 1L4IA 2ORBL 3HC0B 4OF3A 2HRLA 4LVEA 1LO2H 2J2ZA 2JJWA 2YS4A 4GRWF 1XGQA 5F89B 5BOZG 4OIAA 3LMJH 3NZHL 4OLVH 3S37X 2WQ8A 3TBWA 5JQHC 5T1LD 4Z0XB 3PDDA 2VE6A 3CC5A 4OSUL 1OWWA 5F7LB 1NL0L 1RUAH 4Z0BH 3C5ZB 1R3KB 3SY0B 3V8OA 3W2DH 3RUGE 4NQXA 3WNLA 3REWA 5GSRB 2ICWI 1BJ1J 3A6CL 2W0KA 2VZUA 5FUCC 3QXAA 5CIPB 2UZYB 4U3HA 2WLYA 5IV2B 3DPBA 1CT8B 5HHOB 2RB8A 4WI8A 5JW3L 1PW3A 4J8RB 4PRPE 2ZOKB 3REVA 3SGJC 4XNXH 1LE5B 5DVMA 4GG6B 1B88A 4ODWB 2Q20A 2YSSA 4NYLB 1MIML 3MV9A 3FO9A 3Q6FB 1LK3H 2Y1VA 3D6GA 1OPGL 2A6DA 1OHQA 3VFGH 3CX5J 1UWGH 3GK8L 1YA5A 3E6HB 1T80A 4N1CA 3C9NA 4XBGB 5JHLL 3MGOA 2AXGB 2HFFA 1K8DB 1ZEAL 2X4NB 3NA9L 3PP4L 2DQFA 3W5NA 2DDQH 5DFVC 1HQRA 2WBJB 3OR6B 3TVMC 4JR9H 3H7BA 2DQDL 1NMCB 3SDDA 4Z5RB 1C12A 3V0AC 1H5BA 5D4QA 1IBGL 3CSBA 2UVFA 3P0VL 4GLRH 4PJ7E 4Z7OE 1XT5A 4RQQA 4LF3B 5D7JD 1OGAA 5F72S 3TN0A 3VGAB 1XGTA 2Z4QA 4ZAKD 4HS8L 1NCUA 5CP3A 4YWGH 1DQDL 4GQ9L 1LEKA 2EDQA 1MCSA 1NCNA 1IEHA 2P7TB 1A6UH 2MQ0A 2QSCH 1ZA6B 3T0ED 2C5DC 1UB6A 1NC2A 3O3BA 4UTAH 3UBXA 5ENWA 1OTTC 2P1YA 1L0QA 4OGXL 4JFOB 1G7QB 1QLRB 4MMZC 4YAQB 2ZUTA 1BQSA 5DDHA 3MREB 1MRFH 3ULSB 1F4WL 5DMJB 1FNLA 2IADB 4U0QB 2VQ1A 3SDCA 3KPMB 4OM1H 2HWZH 1YEHL 4P3CH 4L3CA 1T2QL 4WCYH 1KIPA 4KWUA 2A2QT 4Y16A 3MXVH 5BVPH 1ZS8A 2BJML 3KLAA 4N8PA 1GZQB 3H7LA 3U1SL 3AMKA 3KYMB 2OK0H 4QNPF 3QYCA 4Q9RH 3QBTB 4GSDL 2C3VA 4KRPD 5LAXA 1KC5H 4M5ZL 2J8UA 4GMTH 4PB9L 5DK0A 4WJ5B 3KPTA 3OAYH 3W39B 3RHWK 2LU7A 3CSGA 5CINL 3DRQA 2PTUA 3GSUB 4NNXA 1EJOL 1FV1B 2E7CA 4P9HC 4UT6H 1WBZB 5FAAA 3ZE1E 1NDGA 5H37H 5CHNA 4OZIE 1U92B 2CJUH 1PG7X 1ZT1B 4WI6A 3LN5A 1K4DA 3O3UN 2Y07L 4WEUD 1IT9L 2CUHA 3MJGX 12E8L 2NTFA 3V5DB 5KAQF 1EPFA 2ARJA 3O45B 4P46C 1FSKB 2X4RA 1VFBB 2DBLL 3QDJB 4I3RH 3BD3A 5L88L 4X7SL 4PGEB 2F19H 5E2VL 1NSNH 2GT9A 4YC2B 1JZ3A 4KJQD 3EO0A 4MA7H 1BFVL 1S9XB 1SYSA 4G9FE 4MAYC 4NQCD 5DJXA 1G6RL 3EZ8A 1AO7D 4S2SB 4NIKB 1G9MH 4PJXA 1IAIM 3GIZL 3D0VA 3VXPA 2YMXH 1S7QB 5CWSB 2AK1H 3VRLE 1KSRA 2NXYD 1S78C 2V5RA 2R23A 2HTLD 4XMLH 5I1JH 1GIGL 2FX7H 2UY6A 3PV6A 1FCCA 3V4UH 4X83A 1UKQA 1PFCA 4IRJA 4PJ9D 4JDTH 5E6ID 3CDGB 5FF6B 4AIZB 1G9EA 1T4KB 3H9HB 2R2EB 2R56L 1KIRA 4Q58C 5E8OA 3MO1A 4LPYA 3CFIC 1ZMYA 4LGPB 1SBSL 1CFNA 4CJ0A 4N90D 4V2BA 4BZ2H 2ZCKH 4X4ZA 2XZQH 3I9GH 5INDB 5IVXF 5KBNC 4JG1L 2O26U 5GZOD 4QGTA 1YPZF 3T2NL 1EXUB 5CEXB 2ITDA 2CKNA 4KROC 5C0ND 3SOBH 3ES6A 1M7XA 3PDGA 3VXQA 2CRMA 3CDFA 1IAIL 4XRCB 2G75B 4N0YL 1PLGL 2FO4A 1CS6A 5DYOA 1ZHKB 2HFTA 3QG6A 4JHAL 1LO0L 5KSUA 3LZFH 1JPTL 3ARFD 3RVUC 4MXWH 4ODHL 3V5HB 3PGFH 5CEYB 3HNSH 4J1UA 2YEZB 2VDML 4I2XB 3IDJA 1DUZA 3PG2A 5TDNA 5DZNA 4JPKL 1IGCH 5EZOL 4LFHG 2W0LA 1N7ML 3X12A 1QACA 2SEBA 2IAMB 4RMWA 2AXJA 4JO1H 2P43B 3QEQA 5C07B 5I30L 4Y5XC 5FYJU 3LKNA 1KIUA 1N2RB 1A64A 3EHBD 4R2GB 3RNQA 3SO5A 1T1WB 2XZCL 1LDSA 5C0JB 5CD3A 3FOMB 4M6OL 1EEZB 1T3FB 1S7WA 4XPGH 4R96A 3S3PA 4XNQB 1CZ8H 3DO3A 4NO0D 3VFNA 1UADC 4NKIH 1U36A 3UTTD 1FH5H 3QNYB 1KCUH 2Y9RT 3BQUC 5D7JB 1NBYA 4JM4H 4U1KA 3MV01 1OARH 1OLZA 1Q0YL 3LKPA 4CVZA 4DZBB 3SE9L 2HMID 3IDGA 1G6VK 1AHWA 3GM0A 4XBEH 3WUWB 5M95B 4PBWD 2ZSWA 3TT3L 1GGYA 1OTUD 1V5JA 4FXKB 3T8XB 1GGCL 3LIZH 2YA2A 3RGVA 5F1KC 3L5HA 1S5IL 1NMBH 2FYYB 3BP6B 1JUFB 4TSBH 5EBWA 5LBSL 3GKWL 5I8OL 4ELMF 4NRXB 1MCCA 3MOBL 3O2DA 2VDQL 5JTWA 1BD2B 3DVGA 3RBGA 3QDME 1ZHBB 4X6FA 4F57H 3UO1L 1KPRA 2ZJSH 1IEAA 4L4TE 3QP3A 1YEEL 1QZ1A 5HYJD 1BM3L 4APQC 2DQCL 3U79A 2X4SB 3H6JA 1P6FA 5MERA 1IEBB 5HDLA 3HR5B 5ICZB 4RWYL 2QQKL 5JR1H 4X9BA 4JZOB 1UZ6E 5E94B 2Y25A 3AB0C 4LCWB 4YBQD 4G9DB 5JUEL 3MRLB 3QEHB 5E99L 3MOQA 5E1AB 5SX4H 4I3SH 3C5SB 3BIBX 3QIWA 4S1DC 4JO4H 5BVJB 5A2KH 1GGTA 1YECL 1AQKH 1FFOB 5GGVL 3W0WE 4M1DH 3VXUE 1MWAH 3F12B 5EUKB 5JLZA 4NCC1 1PX4A 3BT2H 4IBLT 4M3KB 2IALB 1J8HD 5D5MF 1IGJA 4ZDHA 4ENEC 1RD6A 4KI5E 4WHTB 1QFOA 4H0GA 4GO6B 1NC4D 1F5WA 1O7SA 1QSFA 2JB6A 5F21B 2Z31A 3TV3H 1U2CA 4WDIA 3DSNA 2P5WA 5ISZA 4H26A 3IGAB 4LSSL 2VXVL 5HPMB 1B4JL 5SWZE 3M8OL 3MRJB 3OAUH 4KUCD 5F8RC 1QP1A 4Y8DC 2AJYL 4NQCB 4TOYL 4QHLB 1AO7B 3EJYC 2JCCF 1OP3K 3S35L 4ZUSA 1I7ZA 4D0BA 1MCPH 3P0GB 2VLME 4D9LH 4URTB 5AWNH 3KPNB 5CUSH 3PGDA 4ZTOL 1Q94B 2KQMA 1E6JH 1L7TL 2CDEA 4PJFE 2ATKB 4ZXBA 3VWKA 3FOLB 4BZ1L 2P8MB 3MUY1 1DVFC 1ADQH 3R0MA 1EHLL 3U9UA 5E6IB 3AAZB 2BRRL 2P48B 3EDDA 3OJMB 4HIIB 5IESL 3O6FD 4G7VH 3NBNA 1S7RA 4YLQT 3MLWH 5D2LE 2EXYC 4JZJB 4XAKD 3VI3F 1Z9LA 3MA7B 1L9NA 4K71C 4P3DA 1KCLA 3HB3D 5DJ0B 2Z93A 4G80A 4NKMA 4KK5C 3CCHB 3SDAA 4OGZA 2OJEA 4JFDE 3VGEA 3DHMA 1VGKB 3B9VA 3PWUB 2RBLA 1LO2L 4LSTH 4XCNA 4YPJA 3VXMD 5JNYA 1SJHA 2H9GB 3LMJL 3T77A 1U8PB 3P4MA 4MA8H 4OLVL 2VDRH 3QQ3B 5GJSH 1WQVT 1TQCB 2DYPA 3HLAA 4V1DB 1LEGB 3KGRA 3ARFB 4HS3B 1RUAL 4Z0BL 3VFMA 1C8PA 4NQSA 2FO1A 4LHUA 3OGOE 3OKDB 3W2DL 4DWHA 2H2SD 4ZUTB 3ZKXB 3LKSB 2Q1EA 35C8H 2NZ9D 5I2IB 1ZVSA 2D9QB 2OTWA 43C9A 1CYGA 2RFXA 1BFTA 5C8JB 2AJ3B 3O2VH 4WW2F 1U8JA 3DUSB 4JFYA 1HYSC 4P57B 4OGYH 1W0WB 2DTMH 5FYLD 4ZFOA 3DXAE 4XNXL 2EE3A 4WENB 1KG0B 3TYFB 5DRXB 3BYTA 3AS0A 5DRNA 3LY6A 1LK3L 3WMSA 3PWJA 3VFGL 2ZSVB 1UWGL 3LD8C 2DQGH 3NABH 1CD9B 4D2NA 4NO0B 5C0CB 5C0FB 3QI9C 3KNBA 4LHQB 3KJ6H 3CSYB 2OSLA 5IG7B 3UTTB 1FVEA 4OCXH 2DDQL 3ARDD 4KH2A 3RPIB 3T65A 3DGGA 4JR9L 1RJZB 2WUCH 4G8IA 5IKCB 5CJOH 1C5DB 4Z7WA 4OUUB 4ZO9A 1XR8B 4K7PY 1MWAB 3QFDA 1FC2D 3HZKB 2GJ6B 4YBLC 1ES0B 3L3DB 3ARED 3O2WH 3D5OF 4I18B 4PRHD 1JZ5A 5BO1H 4CJ1A 4GRLD 5HD8D