1QR4A

Two fibronectin type-iii domain segment from chicken tenascin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
175
structure length
175
Chain Sequence
b'DNPKDLEVSDPTETTLSLRWRRPVAKFDRYRLTYVSPSGKKNEMEIPVDSTSFILRGLDAGTEYTISLVAEKGRHKSKPTTIKGSTVVGSPKGISFSDITENSATVSWTPPRSRVDSYRVSYVPITGGTPNVVTVDGSKTRTKLVKLVPGVDYNVNIISVKGFEESEPISGILKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (TENASCIN)
molecule tags Structural protein
source organism Gallus gallus
publication title Purification, crystallization and preliminary crystallographic studies of a two fibronectin type-III domain segment from chicken tenascin encompassing the heparin- and contactin-binding regions.
pubmed doi rcsb
total genus 28
structure length 175
sequence length 175
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qr4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qr4A01
2PXYA 4JFFA 5DJCA 4RZCA 2APVA 5I8OH 3TFKD 2HVKA 5AYUL 3MZTA 4G43B 1FNFA 3G5YA 4YDLB 5CGYD 2VDQH 4PIRF 2NY0B 4PRPD 1PQZA 5JXEA 3BGMA 1UM6H 2EEBA 2WWKT 4BM7A 5I1IH 4GW1A 2Q7YA 3LN5B 3MV9E 4RAVA 1A7NL 4XPGL 5C0BB 3CK0L 4KDTC 4JGJA 15C8L 1NPUA 2Y7QB 2PN5A 3S37L 2H32A 5ABDE 5L9DL 2XTJB 1JZ6A 1E6JH 3KHOA 4QYOA 5F3HB 4IIQB 2YEZA 5J6GA 4KPHL 4HD9A 4JCMA 5CBEA 5J57B 1M4KA 2FCBA 3C9NA 3WV0A 3EJZD 4ODXA 3UAJD 5KTEH 4AH2B 1I3UA 3MRRA 4HXAL 4Z7VE 1N4XH 1AJ7L 4F7PA 3BDXA 1A14H 2XRAH 4GW4A 3WO3B 5CZKA 3AFLA 4AMKL 2OR8A 5DRZB 1IMHC 4PRAB 2ZCHL 3HMXL 4FZEL 1YNLL 1N8ZB 4K7PX 4KQ4L 5HGGS 5K59F 4LPWA 3H6JA 1YY9D 5DJ8A 1WGOA 1QO3B 1C12A 3ARBD 4MAUL 3V7MA 4G6AD 1AD9B 2YKLH 5D7LB 4Q9BA 4Y1AE 2HFFA 3I6GB 1XR8B 2OL3H 3I3BA 3U9PH 4HLJA 2YUXA 1AIFB 3MFFB 1E4WH 3CFJB 5L9DH 4LK4A 4YXKL 3M17B 4XHQA 3SO5A 4PJGF 3RWCA 1KGCD 4KPHH 5I8CA 3GSUB 1RUQH 3IJSA 2BSRA 5D2NA 1NANI 4X7TA 2R39A 3ULUC 2IANB 4N5ED 3CCHA 4ELKA 1SJEA 3UTSB 2NY4B 5A2LH 4OIIH 4OCSL 1AHWC 3ZKND 1YEEH 4LSQH 4LQ1A 4HFWB 4POZC 5IW1A 1WJ3A 5ICXB 4ZS7H 4JR9L 3HAEA 3P11H 3X14B 3IF1A 1HDMB 1MI5A 1YNLH 4ZTOH 4UV4L 1P9MA 4AT6A 2DQDL 1A6AB 4NRZA 5KVEH 1DSFL 4X6CA 4AK1A 5I73B 2NX5A 4MS8D 1QLFA 1MH5A 3SDXE 3QDMB 2YKLL 4L4VA 2XYCA 3ARXA 1PY4A 4UTBH 1NC4A 3CU1A 4U1LA 3MXWL 2UVEA 3ZO0A 5IK3A 1YDPB 4PGEA 1K5NB 2DWDA 3U9PL 4G6KH 1JE6A 1U8QA 1RVFH 2Z93A 3MODH 4MJ5B 2F15A 1MFCL 4JFZL 4U1GC 3EYVA 2H1PL 5E99H 2EH8H 1RIVH 4HGWB 4P5MA 4NO3A 4PRBA 4MAYA 4PFEA 4RX4D 4PR5A 1HHGA 5I1EH 2AP2A 1Q0XL 5GGUA 5KAQG 1S9YB 4Y0GA 1QKZL 2AV7A 4HKJA 1OAUL 1Q1JH 4FFYL 5E1AA 3LSOB 4WI4A 1T04B 1B6UA 2Q3AA 3TBYB 3V8OA 5EN2B 3C2AH 5IVXF 1MEXH 4S1RL 1JBJA 3UROR 1OF2B 1HHJB 1KNOB 1DBBL 3VA6A 2NY1D 1Q0YL 1AGEB 4O2CB 3KYAA 4Z7VF 4ESKA 2XKNA 4K3HA 5K9JL 1WAAF 1NEUA 3W9DA 4HS3B 4YDVB 1PD6A 2A77H 3EHBD 4DVRL 4LPYA 4YHPB 2BX5A 3WFBL 5IEKB 3MREA 4NNYB 3RWEA 1DP0A 4Y5XA 3OXSA 4Y5VC 5HSFA 3IF1B 1S9KC 5DSCB 4RFNB 4QHMA 2N4IA 2B1HH 5IROC 2B7DT 5INCB 3VW3H 5GIRA 5ITFA 3NBNA 2DQTH 1NDMB 1T7YA 1U3HD 3G6DL 5EB9A 1A9EA 2EECA 1DANT 4JZNA 3EDDA 4XNXL 3L5HA 2WP3T 4MXWH 1EH9A 3VH8A 3TN0B 2XZCH 4KK5D 2AJSL 1ZOXA 3MRNB 3IAQA 4UOJA 3C2AL 4X8JA 2KBGA 5TQ2L 4OT1L 2GJZA 3DROB 4OI8A 4ZUTA 4LLVB 5FB8B 1CQYA 1ZSDB 4P5TA 3VWJB 3DSFL 2IC2A 1NLDH 4D9QD 1WVZA 4LLWB 3L3HB 2G9HA 4X6BA 2FNBA 1U3HA 4I48A 5IIEB 4J3WA 5ID0B 3DETC 1R0AH 1XGQB 3BIBX 1CK0H 2VDOL 3TZVA 2X9YA 3VFMA 2FDBP 4LCUA 2F53E 1AKJB 1OGTA 3MBXH 3DECA 4WHDA 1KACB 4NUJB 1FNEA 1I8IA 3M8OH 4LCYA 5CMAA 4MA8H 5DC9B 5HHME 4BKLB 1IAMA 1AY1L 5IBUG 2B1HL 4G9FE 3PHOB 4XCNB 5J12C 1LEIB 3VW3L 3DX9A 3QCTL 4R3SA 4F7TA 1FGNH 4JDVB 1BIHA 3MBEA 1NBZB 43CAA 3U0TA 3KYNA 1W72L 1P7QA 1ED3A 3VFTB 2PTTA 3MRHA 1M71B 2E3VA 4P5KA 2QQNL 3BGAA 4F15C 1EZVX 2V5TA 2OQJB 1WLHA 3B5HA 1U8KB 3QI9B 4PP2A 4I9WD 3L1OH 4FMFA 2H8PA 3LKQB 5KBNC 2N7AA 2EE3A 2C3XA 2EDQA 3L3IB 4PY7B 4LMQI 1RZGB 2GAZB 5JR1H 1RJZA 1U0QA 1P7QD 3OB0K 5IVXA 1DFBL 3FB5B 3NA9L 5DGQA 1INEL 1E4KC 5IHBA 2R1YB 4EXKA 2E7CA 4WWKA 1S7XA 2BVTA 2ESVA 5IV2A 1KB5A 1NBYA 4N0YH 2BOCA 4CVZB 4LRIA 1DANU 2AXGA 4GRWH 3KXFD 4PS4H 3BEWA 3HG1E 3MRPA 2CLRB 1AY1H 3WEXB 3JWDC 2DQJH 3MLXL 2QHLA 4HZLB 2A73A 3QCTH 4C56B 3LIZH 4PJXF 3CXDH 4FXKB 4GSDH 3EFDL 1JUFB 4WWKD 4F2MA 4H88L 4IRSD 4HH8A 4QXGL 2DDQL 4P46D 1FZMA 4NGHL 4P57A 1ZGLP 4MZ3A 3UTTA 1FNSL 5C07B 2NY0C 4JB9H 1DTUA 4JDVA 1FFPA 4WU7B 1ZTXL 5DVLA 4WW2C 3LMJH 4DZ8B 2YA1A 1DFBH 2EO1A 2AV7B 2BY1A 4WHTA 2X4OB 5INDB 3R0NA 2GSGA 2UVFA 4U7SA 2PCPB 2BVPB 1BF8A 5D96B 3H0TA 1CFVH 3D3VD 5JO5A 1RJLB 2CRZA 1BFOA 2ZUXA 5C0IA 4E9LA 3LN4B 4S2SA 2DN7A 4ONGH 4R4FL 1GIGH 1YPZE 2UYLA 1PDKA 3HUJB 2DQEH 2OP4H 1AGEA 2DBLH 2X41A 2VL4A 2CKNA 4P23A 4PG9A 1FC1A 5B38G 3EGSB 4N0RA 1GPOL 2P5ED 2WQRA 1NMCC 1QSEB 5CEZD 3O6FC 2NR6C 1I7UB 4R4BB 1OW0A 2AQ3A 1TETH 3GMPA 3OB0H 5E94A 3EO0A 2NX5D 1OB1A 3IETB 1C1EH 2DDQH 5FOBA 2APFA 4OF8A 4PJBA 4Y2DD 4AT6B 1DVFB 1KB5H 4HUXA 4I0CC 1EERB 4KMQA 3H0TB 1FNEB 1FNSH 1II4E 1XCQA 4KRPB 4NBXB 3O2DH 5T1DH 3SGEI 4HPYL 1TIUA 3MCKB 3E6FB 1P4IL 2QKIA 5JDJA 1DLHA 3FFCE 2N1KA 5KVFH 1NEZG 4DGIL 1GZQB 1NFIA 1UM5H 3L7EB 4R97B 2RB8A 1BHGA 2CQVA 4JQIH 5FCUL 3WJLC 1FZJB 1Q94B 5A16B 2BY2A 4EEEA 3P77B 5TF1L 5F93C 4PBXA 4YHYB 5EZLA 3WS3B 2XWJB 4K9EH 1GIGL 3IDYB 1XF1A 2DQEL 1ROWA 5T1MA 1FO0L 3PWNB 4UT9L 4WU5B 3NFNB 3BRFA 3LDBB 4KH2A 2CDGA 2Q8AH 4FQLL 1HQRA 1K4CA 2P5WA 2JLLA 2Q3ZA 4KY1H 4L3EA 3ARDA 5EZJB 5DMGD 4HMEA 3MRIA 1F58H 4YC2C 4JLRA 4GS7B 1JF1A 4LCWB 2A83B 3WXWH 3OR7B 5F70A 3EYOA 1CE6A 3RKDD 3C8HA 1MJUL 2Q1EA 3BPNC 4ODHH 4EVNB 2ADGA 2WBKA 1J86A 4OZHA 2LVEA 2ATPB 4Z78A 4OLUH 4Z77A 5T1DL 4X6DB 2VZ1A 2R1XB 3EOAA 4CUCA 4DN3H 1FYTD 4YHZH 1XIWD 5FGBC 4CRPA 3TNMA 4CVXB 2HTLC 4IMLA 2WINA 4OD2A 3TNNA 1P4LA 5MHSD 5GS2D 2H26A 4P2QB 4F9LC 4GW5A 5IW6B 2QLVB 1TNMA 1J8HA 1AGDA 5F1IB 1LVEA 1H8NA 5HI3C 2EYTA 4QWWC 3QUML 4LIQH 5EDXA 3FN0L 3T0VA 1F3DH 1EK3A 4E41D 2XTJC 5J1AB 4HH9B 1QSEE 5BW7A 2JJTC 5HY9A 1BQHG 3QZWG 3QHTC 2VLLB 4OFDA 1RZ7H 1KCSL 2E9IA 1A4JA 3U82B 1YEFL 3IDMA 5F7WC 4X8JB 5GS3A 4NQED 3ZYZA 2C1OA 3MCG1 4PRIE 4KV5E 1NAML 3BJ91 1MIEH 1EUUA 4OCWH 4JDZA 5JQ6L 2NY2C 3X17A 4HGMA 4BFEA 1BX2B 2FJGB 4LLQA 1ITBB 4QF1A 5E2WH 3GRWH 4G8FA 3BP6B 3VDAA 1J0HA 4JFDA 3P4OB 5BQ7B 5C09E 4Q9QH 1TQBB 3K7UA 1S9VB 3KPOA 4YXLL 4HEME 4HPOH 1H3PH 3VMOA 3BSZL 5EU4A 1BZ7B 4PJAA 2PW2A 3EOTL 1JNJA 3ARVA 2E6QA 4PB0L 2F54D 1FPTL 4JFEB 1ZS8A 2A6KB 5L6YH 4LIQL 4CAGA 1KTKE 4OM1H 4K7PY 5IVZA 3X13A 1TLKA 2YXFA 4K3GA 1RZ7L 3U0PB 5T3XD 3QDAA 3QSKB 3E6FA 4DKAA 1CR9H 4HLZH 1IL1A 4I9WE 4LF3A 2YUWA 4U6XB 1OT1A 1ZHKA 3V0VB 1NCCH 5F9WC 5TGBA 3ULUE 2YD8A 3V52H 1GGIH 1NAMH 1EJOH 3D2UD 3IU3B 5MERB 3IDGA 3FN3A 4F37K 3EYQC 3B9AA 4NQUA 2Z35B 4MD4B 5TQ0L 3VFOA 2DQGL 3NA4A 4WUUB 4CJ1A 3UYRL 3QEQB 1NCBL 2GJ6D 5FO8B 1EXUA 2NYYC 2ZG2A 3OG4B 3WHXA 5DSCA 1T5WA 4JRYA 4UOW0 1WV7T 1HWHB 3W2DL 2F58H 3B9KD 3GSOB 1FFNA 2R69H 3MRJA 3WUZA 4N8VG 1BX2A 5A40E 3ARDC 2E9WA 3VWKA 1R3HA 1QG3A 3U30B 3VI3E 4MZ2A 1T4KB 1W2KT 4XNUH 3G6JB 5L2KB 4OZHB 1N5YH 2NZ9C 5DHXB 2VSDA 1CE6B 5TE7H 4XP9L 3KJ4C 4QXTA 3O4OC 1CR9L 2W65A 3QNZB 2GKIA 5EUKA 3QG6B 5HHNA 1NFDB 3MV7B 4FTVE 5EFIB 1N26A 1FRGL 2AJ3B 1HYRC 1T7VA 5F1NB 5ANMA 1V8HA 2X2YA 5CZXC 4ZAKC 5JZ7C 4BFBD 3K1KC 3Q1SL 1M7IA 2VAAB 4QOKA 2QADC 1PW3A 2FO4B 1EMTH 3QEQE 3VJ6B 2XA8L 1LP9F 5E8NB 1I8KB 3QPXL 4UDUA 2PW1A 5FKAB 2ARJB 4ODWA 2DQGH 4LLYB 5F21B 1ES0B 1QD0A 3UYRH 3MMEA 5FGBA 1OWRM 3T8XA 3SY0A 5DHVA 2GFBA 1X5GA 4M5YH 3V0AC 1N7ML 2F58L 4KQ3H 2B5IB 1LILA 4OZGE 5E24E 4MNGB 3BUYA 1KENH 5EUOB 1D5XB 3PXHA 3RWIB 4TOYH 2BDNH 2UUDH 1NFDA 1ZA3A 1QACA 3OGCB 1PVHA 3QIBC 1WTLA 4JPWH 4D0BB 5ANMB 1YZZA 3TESA 3LSOA 4OFYD 4OGZA 4DGVL 3FFCA 4MQXC 4XNUL 3BP6A 1HILA 3MPCA 4YH6A 2X89A 4MCYA 3DV4B 5EO1A 4ZUVB 2XPGA 3CIQA 1XGUB 1J12A 4NQDB 3GB7B 1MWAB 1K9TA 1OB1B 3ARGC 2XZZA 5GRJL 2BCKA 5MI0B 5HI5D 1GXEA 3VXME 3GIZL 3O81A 3CFEA 3CUPB 5CEXA 1ACYH 3FT2B 1OPGL 2M1KA 4ALAH 1NGWB 3MRLA 5FGRA 4ONHB 5DURB 5CHNA 1PKQE 1AD9A 1I1RA 3B83A 4YPGB 1PJ9A 4HWBL 3SCMC 4F57L 3ZZ1A 5ENWA 4XCEB 4ACPA 3ARDD 3UJJH 2MPAH 4KJPD 2EDHA 3NH7H 4QXUL 1Z5LA 5B3JE 4WV1C 1IL1B 3W5MA 4K7PH 5CAYB 4XNYL 4U1SB 4JPWL 5CLTA 3ZDYF 1XCTB 3S36H 3P9LA 1ZANH 3SE4A 2B1AL 5L2KD 1X7QB 3IJSB 1AR1D 1JI1A 1ADQL 3MRFB 4NQCE 5CBEB 5FFLA 3IAPA 4BSVB 5C3LD 3GIZH 4U1NB 3ETBF 1OT2A 4KRPC 3TBSB 4N0UB 4HCRL 2YSSA 5IP4A 2R23B 2I9LB 5GS0C 2V17H 5SWZB 4ALAL 4ODTL 2BVPA 5DHYA 2J6EL 4ZUSA 2EDJA 2F19H 1PLGH 1PQZB 5GJSH 3G6AA 4MQTB 1L0XA 1YMMA 1VDGA 3KPMA 1TJIL 4YHLL 2OTUB 3O3EB 2BNUB 4TSBH 4NQSB 2GIYA 5EO0A 4CN4A 5EOQH 2DLTA 3C8KB 1U92A 3QEHB 4K7PL 4RMTA 5IB5B 4PJDE 4N0CD 4PJCB 4TVPH 4PPTA 5I19L 2GTWB 2YSSB 1TNNA 3CSPA 3RWDB 3TC9A 1PSKL 1IAIM 1KLGA 3AY4C 3KNBB 3DUUB 5CCKL 4XC3L 5BW7C 4OZFG 3V6ZB 1VADA 4K71C 2EIDA 4X7EC 1QHOA 1CYGA 2UZIL 2ADFH 3P4MB 1Y6KR 1K8DB 3KWWB 5CZVL 1HIMH 3DPBA 3RUGF 4U6YB 1KCUH 3DMMD 4HDIA 4P9HL 2Q86B 4NM4L 4FP8H 3VFVB 2FWOB 4Y4HC 3N1PC 1QVOB 4OZIB 4Y4FA 1P53A 1MHPL 4LPXA 3G5ZA 2JJVA 4F9LA 3GMOA 5D7LE 2UYLB 1NGZA 3W9EB 5GJSL 1DL7H 2ILLA 5EZLB 3WS3A 5DFVD 1J0ZA 5ACLA 4ZOEA 4JRXE 1A1OB 3U4EB 4G8GB 3KPLB 4OCXH 2YZ8A 2ZUSA 2WIIB 3QQ9D 4U1NA 4UOW1 3BIKB 4TSBL 3ECBB 2BHYA 3GSWA 1CICB 2VC2L 3DMMA 4AYFA 1CXKA 5LAXB 4RMRA 4XNMA 3PGDB 1CLZL 1CXLA 2JIXD 3MRIB 3LS5H 1FAIH 2VLJB 3JZ7A 5DVNA 4OCRL 3U7WL 3PWJB 5EZJA 5C8JB 3EBAA 3T4YA 3WNLA 4PGBB 3BP4B 4OQTL 4GUPA 3GSNB 3K74B 2R2EA 1EGJA 5T1KD 3U36B 4R3SB 3LEXB 1C5BL 3RVTC 3X3FL 2ADFL 2HLAB 3IT8D 1FJ1B 2LABA 5HDBF 3CLEL 4FQHA 1DJSA 3CFBB 4KKAD 4WFGE 3MZGB 3TN0A 2CKBB 4H5SA 3DLQR 4FP8L 3BPLB 4U1IA 1V5JA 2BSTA 3ECBA 4C55A 2AAVA 2NXYC 1BFVL 3GBLA 2XXCB 3L5XL 2DKMA 3EJJX 3NIGE 4KRPD 3O6FA 5LBSL 2ICCA 4BH8A 3ARED 4QRSA 4Z7WE 3D2UB 3ZE0E 3BPCB 5BRZB 2HMID 3VWJC 2DM7A 4AJ0A 5AD0A 4GRWF 3MJ7B 1D6VH 4KKBD 2R2EB 4PLNC 4GG6B 3EHBC 3V5KA 1UXSB 3MRFA 2FWOA 3O0RH 1S7UB 3RY6C 2D0GA 4JM4H 1A1MA 5B39B 3SE4C 3IAGC 3FT4A 4Y5YC 4JPVH 1G84A 4FZ8H 4ZQKB 1GGUA 4OQTH 1C08B 4GRLA 1A9BB 3REVB 4RMUA 3LKSA 5FYJL 4IRZH 1T04A 4X6EA 4U3HA 4WTWA 3GO1L 4MJIA 1D7FA 3ZYOA 5IF0A 3A67H 5EC1A 3GBMH 5DHVH 3VGFA 3SQBA 4RGMC 2D9QB 2BVQB 4EN3B 1EJ6A 3KLSA 4IOSD 4A2MA 2JK5A 3HZMA 1BFVH 2VSCA 4KDVA 4GRLD 3CVIL 4MD5A 3L5XH 2C1PA 3PWLA 4LCIH 2YRPA 2RQ8A 1EV2E 5JPMA 4ZS6C 5HVHB 4LPUA 3N50A 2DQIL 4RQQB 4NNXA 1CT8A 4CADB 4LQFL 1JZ3A 4XP4L 1LK3L 3RZCA 5D7KE 3QDMA 3MV8B 4UT6L 3RWJB 2JJWA 4LSSH 1G9ML 4XTRC 5CKAA 1VFAA 1ZHNA 4OUUB 2ZNXA 3TYGL 3FOLA 4YZFE 1RULL 1ACZA 1XMWA 2ZSWA 3FQRB 3TJHC 2GK0B 4X9BA 2WSKA 2HTKC 3FFDB 3O3BA 1AP2A 4R7NA 4JAMA 1NMBH 1SJEB 3HLAB 2Q76B 5C9JB 5GSRB 3VE0B 3LRHA 5I71C 4JY6A 3HC4H 3QFJB 4XI5C 5JOPD 3VXRA 4G6FD 4M7ZC 2YPLE 4JFEA 5HJ3A 1L9MA 2EDKA 1KCRL 1UC6A 4ZFZA 1U95B 1BFTA 2FL5A 1U36A 2BNQB 2KDGA 2VH5L 4MA1B 3HR5B 2DQHH 2AGJH 3GKWL 3SQOH 3UJTL 1D9KA 4XNQB 2ZUUA 3KGRA 1X5HA 4WW1B 3UDWA 5J11B 3BX7C 2ORBL 1P6FA 3O4LB 1S8DB 3QNZA 1T3FB 2R1WA 2W65B 3MLWH 5F6HJ 7FABL 5CS7A 3VXRD 1VFUA 1DBAL 3MLUH 3RI5K 3SKJH 4JFED 4R2GC 1MVUA 1YQ2A 3UO1L 1ED3B 1RK1B 3OKDA 3O8XA 5DJXA 5MENE 1CWVA 5I74B 2KL6A 4UTAH 3KPNB 2MWCA 1J5OH 3CVHB 4O9HL 5L88L 1QLEH 3ULVD 3PWVA 5E8EA 3BHBB 3ESVF 1VFBB 3TH3T 4PJFE 3B2UC 1S9YA 4RDQF 5MEPB 4JVWA 5C08A 4APQA 1XIWC 3GSQA 5F72S 2Y25A 3LEVH 4MA7H 1U93A 4JKKA 4XAWH 2D9CA 4NZUH 1H15B 4OZ4B 4RBPK 4XNQA 5CHNB 4LSVH 5A1AA 2BFVH 2YPVH 2Y4SA 5ALBH 5GJTH 1A6VL 5D2LE 1NGPL 5JHDE 5JUEH 2P4AB 2VH5H 1W0WB 1AKJD 4KRLB 3LQAL 4A6YH 2C5DC 2A9ML 3UJTH 4W81A 5DZLA 4HSQA 2R4RH 4J3UA 3EFFA 5FB8A 4P2CG 4AQOA 3MUJA 3PL6C 5KG9B 5DEFB 3DARA 4QTHA 1C8PA 1KFAH 2X4UA 1MWAA 3FRPG 3NPSC 3MUGA 2YD6A 4J6RH 3QWRD 5HHOA 1MFEL 2BC4B 3GUTB 5DJCB 3SKJL 1OAQH 4XVTH 2E7BA 5FUCE 1BVLA 1U8HB 3OJ2C 4IJ3B 1U8MA 5KSBB 1DDHB 5I1LB 1BZ9B 3AS0A 1J5OL 5GIRB 3HB3D 1MHHA 5FA4B 4FFZL 3D85A 1XIWB 3CX2A 4MDJB 5FM5M 3LEYL 2DLFL 2WBWB 2BNRE 1HH6B 3P9MA 3UC0H 3LEVL 1RQ5A 2Y6SC 4PRPE 3RX7A 1S9XA 4ZODA 4YZFF 1MQKH 1BAFL 1I9EA 4OGXL 4YWGH 3DX7A 4JREB 1UKTA 1ETZB 3HUJF 3JXAA 4TSCH 5SX5H 5GZNC 5GJTL 4LOUC 2AV1A 1LO3H 1IE5A 3LZFL 2X05A 1S7RB 5HHMB 1KCVH 4FQJL 3VXPB 4GRMA 1CU4H 1S3KH 3LB6D 3QUMB 4ENEC 1NEZA 3BGFC 1XCTA 3T2OA 5CD3B 1G6RL 3QUYC 4I3SH 1S9WB 1GC1L 4OF7A 2LU4A 3O11A 3VWJD 4U3CA 4U1JB 5EBWB 5JOFA 1K6QL 4HGWA 2Z91B 4JDTH 2JCCF 1ZWIB 2NNAB 3P0GB 1FVCA 4FFZH 3EDKA 4X99A 3DIFB 4MS8C 2X70A 2UZYB 2CMRL 1NCDL 3LEYH 2GTZB 1J1PL 2DLFH 2VOTA 3SDDB 4HKZA 5I16A 3UYPA 1I85C 3TBTB 1YYLL 4MXVF 1ZGLA 3MCKA 4LSUL 2H32B 1EEQA 5FF6A 1R3KB 1DQTA 25C8H 4G6JH 3C09B 3FQTB 4J3SA 5FYKU 1A3RL 5H35B 4G80B 1CU4L 1FO0B 1WIPA 3NPZB 3ZYJA 4B41A 2R0WL 3WKML 1RZKH 4NYLA 4WU7A 3FT4B 3GMQA 5HI4C 2IPUK 3HR6A 1X4ZA 5I8KH 2FSEA 3GNMH 1C08A 4NT6B 3E8UL 1X4XA 3N9GH 2AS5M 4OKVA 3KNBA 3VXUA 3MJGX 3V79C 1KXVC 4Q6YA 1XGRA 2NW2A 2HJKB 4ZNEE 4N9OB 3UPAA 3PWUA 5ESVB 5FCSH 5D7SH 3CX5J 2R2CA 2FB4H 3FO2A 4NZRH 4FXKA 1IVLA 1J1PH 2ZKHL 1XGTB 3WIHA 2UUDK 5B22A 2HFEB 2DQCH 5DK2B 1J0KA 4HWUA 4GBXB 5DMKB 3H9ZA 2BSTB 1FLRL 4QYOB 1E4XL 3KS0J 1ZVYA 1QEWA 1CFTB 1IGJA 3VFNA 2WQ8A 1KELH 3OKOA 3VFOB 2YPKB 4OD1H 4YUEH 4JFDB 2I60L 2A1WL 5K59E 2BC4A 4FHBD 5F9OH 5KSBE 1KLGB 2VZUA 3NZ8B 4JKPL 3NCFB 4FMKA 1TQCC 1B6DA 1A6UH 3ILPB 4BSWB 4NWUH 1OTTC 3MRQA 5CLWA 3PWJA 3SDXB 3HNTL 2DS4A 2FGWH 4MNQE 2KH2B 3RZWA 4LKXB 5C0FA 1W8OA 4OZFH 3FQUA 5M94B 4MX7A 5E4EB 2EDXA 3KS0H 4P4RA 3QDJA 4GS7C 3LPFA 4LIQE 3MNWB 4POUB 3BZ4B 3U0TB 3V6FA 4OAWB 5D7SL 3UTZA 1BBDH 5EPMB 5MEOA 1F4YH 3DETD 4HK3J 3UTSE 4RRPA 2IANE 4OZGA 4Y19A 4LLMB 5I15L 1UFUA 4NKQB 5KSAB 3J8F7 2DM2A 4ISVA 4EI5D 3BPCA 3BXNB 4Y4HA 4G6ML 2OTUA 3O3EA 4BH8B 1IM3A 3LN9A 3D69A 1I7RA 1N5AB 4TQEH 4YHNA 1J10A 4U0QB 4HEPG 1SYSB 2B39A 1T1XA 4MX7B 1CBVH 3B2VH 4NCC1 2R2BB 2CDEA 2GHWB 1Q72H 3RWDA 1L4IA 4O2FB 3DUUA 4FQ1H 2HLAA 2J3SA 5CEZE 1G7JB 4XNZC 2B2XH 4AEIL 1R3IL 1R5WA 4JQXA 4YAQA 3MRDA 3WHE0 3OKYA 1FLTX 1WWWX 1KJ2H 4ZUVA 3OJMB 3SE8H 3VU2A 1N59A 1DQJA 4B5EA 2Y72A 3LKPB 3TJEL 5AUMB 5GGSA 3VGEA 1GOHA 1SMAA 3OKMA 5DJDB 3O6FB 4WIQA 1AKJA 4XP5H 3ZDZF 4JAMB 2QADB 1OARL 2MQCA 2OR9L 1FSKC 1QPPA 1U8NA 2FR4B 3QDGD 3MBEC 3DUHA 3I50L 3GMMA 1HCVA 3KPLA 1IGFL 4AEHH 4PJEB 2AJVL 3PIQA 4PP1D 2ATPA 3UBXB 4FQQB 1G9NL 2AQ1A 2XTJE 3FO9A 3MNZB 4MA1C 3GFUA 1CCZA 5HVGB 2X4PB 3OPZH 4X4YA 2BOBA 3OF6D 3B2VL 1MRCH 1PBYA 4GUPB 1Q72L 2D2OA 3ILQC 5FDWB 2BVEA 3QDGA 3JTSB 1U8PA 3MV8E 5T1LA 4CMHC 1C5CL 3O9WB 1F42A 4OQ1A 4WEBL 1W72A 3VXMD 2I25N 2GSIA 3T3ME 3TT1H 5IJKA 2Z8RA 1MRDL 4U7MA 2YPLA 5E8PA 5KSBF 3BP5A 3BI9X 4OI7A 3TLRA 5EFIA 1KJ2L 1AO7E 1WBYA 4XVUC 1ZHBA 4KTDL 1V7NL 1GH7A 4Y5XB 3ZTNH 3FZUC 3QJFA 1JIBA 3KPTA 1QLRA 5EOCH 2XWBA 2CR3A 2Z31C 1MCEA 4PLJC 3VFMB 3VG0L 3H9SB 3W0WA 2DJ4A 5HVHC 1BOGB 2D0FA 2GITA 4HWZB 3QEGL 1OWWA 1C7SA 4JPKH 1HKLH 3WIHL 4WW2B 2ZSVA 3F7VA 4J4PA 2PO6B 1UZ6E 1N0XH 3M07A 4WY7L 1YMMB 2XZAH 4B53A 5DQ9B 4EI5B 4EN3D 4DGYL 5C0AB 4Z7QF 3MRCB 1CTOA 1FG9C 3LKPA 3OPZL 1JGEB 2D7QA 4O5LH 4P9ML 3O3DB 5IB4A 5F7HA 4XPHH 1MCDA 3CMOH 1R6VA 2FEEL 4GKZB 3JWOH 3VXRE 5JW5B 3EYFB 3O11B 3GI9H 1Q9LA 4OJFH 1OM3H 1KF9B 2XPGB 4H0GA 2DKSA 1MRDH 1D6EB 4TUKH 1BJ1H 1JZ2A 5DMIH 5F6IC 3RTQB 1GGCH 3GSRB 4PJFB 5KZCB 3GSVB 1V7NH 2GI7A 3OV6A 3VGAC 1FZKA 1KULA 1N5AA 3SCMA 1RHHB 3IFOA 5AWNL 2XICA 2X4TB 2ZG3A 4D9LH 5I18H 3RVUD 1LEKA 4Y16A 3RGVA 1NGZB 1MREH 4TUJB 3QUXA 5AZ2H 3S4SG 3WS6C 5I17B 4QNPF 4YPGA 1F6AB 3WFCL 3OKLB 3D6GA 4OLZL 3BKYH 4NNPL 4IDJL 3W39B 2F74A 3VFWA 4MB3A 4GG6F 5DQJA 5IB2A 4RGOL 3MACH 4GRWB 2GEEA 1D9KC 2JB5H 5HHVL 1U8OA 3BDYH 1NANH 1B4JH 1G6VK 5CILL 3W0WE 4OJFL 1RZKC 4Z7VA 2DICA 3S6CA 1SBSL 2ICWI 3TFKC 1UJ3B 3WXVH 1X5AA 3L95A 1IQDB 3WLBA 3HS0B 4XVSH 3CSYA 1T66C 2WZPD 5J1AA 3K2MC 4NUJA 5F88A 2FZ3B 1YQVL 3MO1B 2CRMA 1JWUA 5I76B 1FL3B 4J1UA 3SGDH 2LU3A 3ESUF 5H94A 1AD0A 3C60B 3TBVA 2DLIA 5FYKE 4KAQH 4D9LL 5I18L 1JHTA 4APQC 1KJ3H 5GS1B 3MRDB 3S4SB 3SDCD 3BMWA 4R9HA 5MERA 1CF8L 3QCVL 1OP3H 1EAPB 3LDBC 4MD4A 4JFFE 4J3TA 1D5IH 3O6ML 5EU4B 1ZLWH 1G7IB 1GJIA 1WEJL 4KI5C 3CH1A 1OAKL 1R3LB 3GSNH 3O8XB 1LGVA 1A5FL 3OR7A 5JLZA 3NMEA 1ZT4A 4K8RL 1EO8H 2FSEB 1I8LA 3R06B 2NY2D 2OSLA 3TIDA 1MCSA 2PXYB 4JQVC 1ZS8B 2A6KA 5EO9B 2QQKH 2ESVB 5EWIL 4IRSB 4XCCH 2OZ4H 2QV2A 2B4CC 5EZIH 3VRJA 3VWKB 3CVHL 2XZQL 3PGFH 1GGTA 5DZOA 5GS0H 4KXZH 4KV5F 2VABB 5F7UA 2XKNB 3GHBL 2ZZUT 2EH7L 3RDTB 1FZJA 2FECL 4KAQL 2K1MA 2P8MA 3IS1X 3W9DB 5CBAB 4K9EC 2V9QA 5K9OA 1AP2B 4R7NB 3ARTA 4KROB 3JWDH 2VXQL 3L3KB 2Y06H 4JREC 4WUUA 4QCIB 2AK4B 2J8UA 4CKVX 4XMKL 3A6CH 1QFUL 1R3JB 4GXUN 4CDHA 1WEJH 4Z7WB 1FCCA 3LCYA 1JHLH 2EXYC 1O7VA 2WWMC 3OJDB 4HUXB 1F2QA 3WL9B 3BQUC 3AS2A 4PGCA 4HIIA 4YR6A 4F8QA 2QQKL 1D5XA 2YD2A 4N9GA 5T33H 2QTEA 1CFNA 1TVDA 4XBEH 4O00A 2CUMA 1OGAD 4Z7UB 1B4RA 1HHIA 2W1NA 1PKQA 4LLUB 5ESAA 1BEYL 3NABH 2AXFB 3STZA 2BCKB 2DMKA 1TTFA 3KXFA 2F5BL 1JF5A 5HPOA 3H7LA 4Y4KC 2HVKB 3SGKC 3PL6D 1AE6H 4UV7L 4D3CH 1XGYL 2Y06L 1MFBL 5JORB 4JKLA 3K8MA 3SDCB 3OG6B 3V0WH 4JLRB 2KQNA 3G04A 1W8NA 4XMKH 1QFUH 3HZYA 1BLNA 3GKZA 3PABB 4NQXB 3PE9A 1UVQB 1QRNA 5ITFB 1L0QA 3QDGB 3NCYS 3UTSA 4KVCL 5SWSB 1JJUA 3QAZC 1KJMB 2VLJD 3S3PA 3BP7A 2FATH 5EORH 4ZS6D 3ULSB 4ZAKD 5GGVL 1PZ5A 2OTPA 2J5LC 2Q7NA 3D9AL 2M2DA 5IG7B 4K8RD 3VD3A 5EU6E 4DUVA 3W0WD 2V7HA 5SWZD 3OAYK 3QO0A 5CJBA 4L4TB 4O02H 3UTTD 5FUZH 1WBZA 2SEBB 4QCIA 3E2HB 5GS1A 3T0EA 1LNUB 3S4SA 5DLMH 1UM4L 5DD6B 5F1IA 4O2CA 32C2A 3VD7A 5DF0A 1I7TA 3CXHK 5IK3B 5ID1A 5L7XL 3SE9L 4HUNB 2HJFB 3AXLB 5EU3B 4OZ4A 5CSZA 1SVZA 4L4VD 1LDPH 3RIAK 1EO7A 1TTUA 4KKLD 1UENA 3FB7A 1IQDA 3WLBB 3PDOB 5BVPL 3V6OE 4ZFGH 1CLYL 5TDOA 3CFBA 4UBDC 1EGJH 2G5BA 3U0WH 4YK4C 3WJJC 1KPRB 1HHGB 4F9PA 4I5BA 4G3YH 1NFDE 4KZDL 2OMBA 1GAFL 3C5JB 4RAUA 4MVBD 1QRNE 1ZHKB 3N0PB 5LXGH 2PO6D 4RX4A 2DTSA 4ERSH 4F7PB 1UWEH 3RA7H 4PP2B 4HW6A 3DMMB 5E8OB 5SWZE 5F71A 5C92A 4ZXBA 2C3HA 2NXYB 4EKXA 1FZOA 3ULUD 1V05A 1M7DA 2VRAA 4NO2A 3QG7L 5D8JH 1OP5K 1UZ6F 1FH5L 3TCLB 3V9FA 3MJ6A 3QUXD 4IS6B 2HG5A 1A3LL 5MENA 4EI6A 1BZQK 5DDHB 5DLML 2AJUH 3GJFK 2BHUA 2YD1A 2PKDA 4YBLC 3ROLB 4MJ4A 1F4WL 2Z8WC 3DUSB 4GMTL 3HAEB 1IM9A 3BE1L 2QQLL 2FX7L 5BCAA 4RZCB 2VTFA 4KJPC 3U7AA 1X3DA 5I75B 3GGWA 2FEEI 2FLRT 2H9GB 4WHYG 1WC7A 3D39A 4PJFF 3O2WL 1CLYH 1YEHL 4K7FB 1PX3A 2F74B 1OD9A 1DUYB 1F8TL 43C9B 1MFAH 1DCLA 5C0FB 4R8WH 4JPIA 1N3NB 3MRBB 4JE4B 3MV8D 1IM9D 3MBEB 5IMLB 3ARFD 3MRNA 4D9QE 4DEPB 1UWEL 3RA7L 4XBGA 4X5WB 3OXRB 4K3JH 2BNRA 1OAZH 4PB9L 3CFIC 5IESH 5B3JF 4ZO8A 1KN2H 3FHQA 3PWPB 4FNLL 1S5IH 1DBKH 1FH5H 1J87A 5BOPA 4KTEH 2AKRB 4WI5A 3GMNA 4Y1AD 3ZT6A 4JO4H 1MHCB 3G04B 3TT3H 1CGTA 5GHWH 3E3QC 5JHDD 1GZPB 2AJUL 3RAJH 3DOSA 2DWEB 4HWZA 4WUKL 4RMVA 1BFOB 3QIWD 3BGMB 5E2UH 3BPOC 3IYLW 3FB5A 2VKWA 3ULVH 4I2XA 2OJZL 1MAKA 2VQ1B 4CU7A 1FC2D 4WI2A 4X98A 3KLHD 1JK8A 3ZT5A 4PRNB 3MQIA 4R96B 3VRIB 1JNNH 1XAUA 4YO0A 3WE6B 4NN7C 3KPSD 3EAKA 5SWQB 3PXJA 4ZUUB 2WLZA 2YPLB 2L4OA 1YPZF 1I7UA 4R4BA 3VFWB 1E28B 3O4LD 4KJQD 2G75B 3JBG7 1IBGL 3O45A 1YECL 5HYJB 1JYXA 2YS4A 2YWZA 4F9PC 1I9RH 1UCBL 2Z92B 4M61A 1FFQA 4KK6D 3IDNA 4O51A 3DBXB 3HMWL 2GT9A 4UNTA 4CGTA 4NYLB 3DHMA 3AM8A 5E1AB 2R0ZH 2G5RA 1KN2L 4GQ9H 5CWSA 2CK0H 3RZCC 4XZUA 3EZ8A 4MJIE 4GG6A 1IFHH 3C6SB 3T3MF 4CVWA 2X4QB 4HKXA 5D7IF 5I73C 1MLBB 1OCWH 1X44A 3MLSL 4JGUA 1YMHA 3SCMB 4QHKI 2B0SL 1UEMA 4BUHA 3IDXL 4GJTB 2CO7B 5E08H 5E6YA 1TVHB 4XBPB 3MNWA 1AXIB 2PXYD 2X1QA 2YD4A 4DQOL 4LDEB 4ENED 4LCCC 4OZHE 5I8EB 1JP5A 3V4PL 2WUCL 5CUSH 1T0NB 4X83A 1QLFB 5LCVL 3SE3C 1JNNL 4I0PA 3TWCL 1A7PL 4NM8L 1T21B 4PJAE 3HPJA 1JGLL 3J7HA 4M1DH 3QQ3B 4OI9A 4WV1B 3Q6FA 1YEJL 3NZ8A 4UDUB 3S34L 4P2OD 1TTGA 3L3DA 4O2EA 4K2UH 2FH8A 2EDWA 3NIFE 2I9TA 3SBWA 4HV8A 1MJ7H 2VR9A 4P5MB 3T1WA 4RMWA 1Z3GL 4ZFFB 1LD9A 3UTQA 1E6OH 1KG0B 1QNZH 1EHXA 1IFHL 1B0RA 4W4OC 4D0CA 5T3ZE 2BY0A 3BUYB 3MJ9A 1OCWL 2PYFA 1BMGA 5DEFA 1I1AD 2YK1L 1KBGH 5F1SA 3U4EA 5D2LA 2X4OA 4HJGB 2AEPL 3STZB 4JFPA 1BFSA 1JPGB 2A6IA 2D7OA 4MQXD 3ZMRA 1ONQA 5IEHA 4JZJB 1CD1B 4DQOH 5BMFL 5I74C 2A9NH 2YBRB 3D0VA 3ZE1F 2Y36H 5LGJA 3ZKNC 3QIWB 1V3LA 4KHXH 2VLJA 2XN9A 3FB8A 3TCLA 2QSQA 3F58H 5LCVH 3BVNB 2AJ3A 3L5WA 4Y7MA 1M05B 1S78C 2XRAL 3VXSE 1LE5B 3QIBB 3H3PL 4GKSB 3HI6H 1HINH 3FO9B 3CSYB 1EBAA 4P23D 5F9DC 2VWEE 3RWFA 1GYAA 1KPUA 5EIIA 5GS0D 5KG9A 2X1WL 1GZPA 1KB9K 3TBWA 4WVRA 1IAKA 5DS8B 1A21A 3KPMB 2V2WB 1H3UA 4AIZB 2R1WB 3LQZB 4HUVB 2HRPL 4CMMB 1SM3L 2ZOKA 3RVWC 4WW1A 1OL0A 5J6GB 2P1YA 2BSRB 4HWBA 1YJDH 1CGSL 3DRTB 4NZTL 3RFZC 4PJHA 1MAML 5GSVB 1QBML 1I75A 2FIRT 3QIUC 3CZFB 4YHOH 2P49B 5D96C 5ESQB 4OD2B 5D9SA 5MEPA 3LQMA 4NCDA 1MCRA 3LHPH 2FIKA 4NRXA 5FO9A 4Z7WA 3H3PH 3TIDB 1HN1A 3HN3A 3VG9C 4RGNE 3U0PA 3HCVB 4U7KA 2W59A 4CJ0A 3QQ4B 4G7YH 1HINL 5I1CH 1QO3A 5SWSA 1MCWW 3CDGB 2P5EA 5FYJE 2VO5A 1YUHB 3P11L 3TJHD 4ZTOL 3NFSH 5K9KA 2P5WD 3GMLA 4L9DA 5KVEL 1DSFH 4YBQC 2NMSA 3TVMD 5C0RL 3HZVB 5I1GH 4IS6A 1J11A 4NN5B 4OCNC 5I1IL 3H9YA 1SEBB 5HI5C 3QDHA 3QEUA 3A6BL 4OAWA 3MXWH 4NO3B 3UTZB 2DL9A 5DQDH 2AABL 4JRXD 5HYEA 1A7NH 4XPGH 4K3DL 2MFNA 1YJDL 5JPMB 5K9QI 4M93B 1NL0L 1JVKA 1NLBL 3QR2A 3L6FB 5ID0A 3BIAX 2ZSVB 3F7VB 1HHKB 4R4ND 2HT3D 4HKZB 1CN4A 3TVMA 4KJYA 1FV1B 2ITCB 3ARFA 5I75C 5ESVA 1A14L 1ZT1B 1QKZH 3FOLB 4JRXA 5HGDB 1MJJA 3T65B 3PHOA 1RIHH 4TNWK 4AMKH 5C0CB 3VDCA 1S7QA 3G5VA 4Q7DA 5BVJA 5HGAB 4LGPB 5I1CL 2FYYA 3FFCB 1YNTA 3HMXH 1LDSA 3DV4A 5EO1B 3VFNB 1DBBH 1T66D 3QEQD 4CVUA 2YPKA 5E4EC 3PV6B 5E94B 3K0WA 1S7RA 1MSPA 2DQFA 1TZGL 4LU5L 3ALPA 2RR3A 1I7TB 2B4CL 1HQRB 1U8QB 4QHMB 3HI1A 2F53A 2A77L 5LGJB 1CDJA 1RK0B 2AABH 5FA3B 1JWSB 1DQMH 2NTSP 1FG2B 1CDHA 1ZAGA 5DHVB 4YHIB 6FABH 2YA0A 3KPSA 5AD0B 1CD8A 3CLFH 4DKFH 2YN5A 1OGAB 2UY7A 2YZ1A 1NLBH 4YXKH 3PWPD 2VLRD 4QRPB 3NAAH 2LAGB 5E6IC 1BP3B 5J11C 4Z78B 4C83B 5LGHL 1RUQL 2FX9L 3HUJE 4D0CB 2F9BT 4HFUH 3T0BA 3G6DH 4O58L 4ZQKA 1A0QH 4DN4L 1I4FB 4OV6F 3WCYA 1OF2A 4EBQH 4XNXH 4WGWB 5D1QC 4OB5H 4MXWL 2Q6WB 4J12A 1ZHNB 4KZEH 4JY4B 2XZCL 4HBCH 2NZIA 4E41A 1JNHB 4P4KA 4ZS7L 1HI6A 1UQSA 1FBIL 3KPSB 3NCCB 2GK2A 1T6WA 4KRMB 2HTLD 3B3IA 3ZE2E 3I2CL 2B4CH 4RFOH 3KPPB 2O26U 4ODXB 1R0AL 5DO2D 4P3CH 1DE4A 1G0YR 4PJDA 3OAUL 5EBGA 3KR3H 5FO8A 4JFDD 1KPVA 3IDIB 5EU5B 4JGMA 4JM2F 3VGBA 3GSWB 3GZKA 4KKNA 4G6KL 1K85A 1KTLA 1AD0B 3C60A 1LO4L 1Z2KA 4P4KD 3TBVB 3IJYA 1XCQB 4KUZH 1JPSL 4JFZH 3RVVC 4R2GD 2DIBA 4DJMA 4RFEB 3QO1B 1CXFA 1LP9E 5JHLH 4PGDB 5EOTB 2R0KL 1N8ZA 1MHEB 4JRYD 1I9IH 1FGNL 1HYSD 4LCCA 1RUKH 2VDPH 3G5XA 4UQ3A 3QQ3A 2JIXA 2D7TH 4UDTA 1Q0XH 3VMPA 3MOBH 5DZNA 2I07B 5I1LA 4NO0A 3RWIA 4N0CC 4R4NC 4XXCC 4Z7OE 2QQNH 1A1NB 1P5UA 3QH3B 4NQTA 4LSRL 4JG1H 2Z92A 4QRQB 4PJDB 1H5BB 1QP1A 3MLTB 5DURD 1I8MA 1UH2A 5I66B 1Q9OB 3W39A 2D31B 3VD5A 4X7SH 2C1PB 3ZDYE 2DIAA 4XI5D 3M17A 2R56L 4NKIL 5F96H 5KANI 4RFOL 1PY9A 3D2UA 5FM8A 5HJ3B 3SDAB 3EYUH 3U46A 4P2OB 2FL5B 3KR3L 4IRSA 1EDQA 2W07A 2DMCA 1CDYA 4ELMA 2OXGA 3JV6B 4DKEL 1JPSH 4I0PC 1LP9A 1LO2H 5GGQL 4X80L 3V6FB 5JHLL 2DQJL 2H2SD 4Z18A 5IMOB 5HGAA 1GOFA 3AB0B 1I9IL 5DK2A 1B3JA 1XGPA 4KI5D 1G1CA 4G9DA 5TDNB 3PWVB 1MJ8L 4MNQA 4DFIA 3CXDL 2VXVL 1UZ8B 3IFNL 4NC2B 3S35L 4YXHL 1AHWA 1TCMA 1TZHA 3H42H 1QRKA 1JTOA 2CSPA 1YEDA 4PREA 2XQBL 2P24B 1J1XH 2JKXA 2AEQH 5IB3A 1NLDL 3FOMB 3WFEL 3KPRD 3PNWA 1AQKL 1CDGA 3QQNA 4RGNC 4JHWL 1MIML 5C0BA 3DUSA 4H5SB 4Z9KB 3T0EC 2IQ9H 4WFFD 4NBZB 5E95B 5IW3A 2C1OB 3AS3A 4Y2DA 3RUGB 1QBLH 3NCJH 4MXQD 1BBJB 2ADIA 3MA9H 4YDJB 1QBBA 1TCRB 2VDML 2IBBA 5SWSD 1JHKL 3CAFA 4IRJC 1PYWA 2XN9E 3KYOA 4E42A 3KPSE 1JPFA 3UPCA 1RIUH 1Z9SA 1AFVL 5DTFB 5C0BD 1AGDB 1VB9A 2YC1B 3ZL4H 4O2EB 3S35H 5JW3L 4NPYB 5KW9H 2NNAA 3RUGE 1A1MB 3IS0X 1T2JA 1S7SA 5I17A 5ANME 4X4YB 4XCNA 3HZVA 5D70L 4NSKA 5HTSA 3WFEH 4Q9RL 1YEIH 5JR1L 4KK5C 1RUPL 4JHWH 3NVQA 4L8DB 1DQQA 3OZ9L 3QO1A 2VMFA 5H2BB 5BJTB 4LLQB 1I1FA 5FGCE 2WV3A 1UM5L 1G7HA 2IQ9L 4GRMB 1ORSA 5GPRA 3KPQB 5GGTL 5KOVC 1A6ZA 3RJDA 4TSAH 3DYOA 1T83C 3BH8B 5IKCB 1JHKH 3EUUA 3NIGF 4TULL 4QWWD 1E27B 1ZWIA 2Q8AL 3B5TA 2JB6B 1Z9MA 1KPRA 5I30L 4Q9CA 1A9BA 4GRLB 3QNYA 4S1QH 3RP1A 3O8XD 4XNMB 1SY6A 5DVMA 5IJVB 2X10A 5GQBA 1IT9L 4ODUB 1EO5A 2ATKA 5DVOA 5C09A 3S96A 4RCAA 1QRNB 3DYPA 2BP3A 2EYRB 1FP5A 1BGXL 2P43B 1RY7B 1FL5A 2EICA 2RCSH 1LQSR 1YEIL 3S9DB 2P8LA 4TPRL 1ZTXH 3BDBA 1O7SA 3UDWC 1IM3B 4G80A 5DC0A 1B2WH 4KK8D 4EXPX 3CFKB 2P8PB 5C7XH 5JPNA 3K81A 5FYKD 4PP1C 5L2JB 4POYA 5E8NA 4JO2L 2PW1B 1M7IB 2VAAA 4QOKB 1RZJL 2ERJC 3HG1D 3L3JB 2EIEA 4CN1A 1YEDB 2X70B 4BZ2H 2FJFB 4MMZC 2WBJD 3LV3A 2ZUQB 4LSPH 1MWAL 5EN2A 2VQ1A 1TETL 1VPOL 4RA3A 4Z0BH 5T3XH 4E5XA 4JFXA 3V4VH 2BMKA 2BNQD 5BVJB 2XFXA 1C1EL 2NX5E 3QIBD 4OCWL 5GS1C 2XQYG 3CFCL 4RWHA 5J9PB 4WNQB 1U92B 1YA5A 1ZA3B 1NSNL 1P5VA 3OGCA 3MGOB 4H8WH 3BEWB 4QT5B 4MDIB 1BGXH 3C60D 2IH3B 5J1SC 1ZLWK 3UBXI 3WEXA 3MGTA 4NIKB 1DUZB 2AK4A 2J8UB 4TPRH 1Q9WA 3IGAB 3OKNA 5EBLA 2ZJSH 5F97E 1B2WL 3U2SB 4N5EC 1NBVH 3GHEH 1BQUA 1TXKA 2WWKO 5DD3L 4JM2B 4PJ7B 3RWCB 4PJ5D 1U93B 3HR5A 5IT2L 3QBTB 1E4XI 2VDNL 1ZLUH 3SKNB 4U4BA 3S88H 3X12A 2E8YA 1FN4B 2V2XA 4KMLB 1MJJB 3CPLB 1FO0H 4L9LA 3T65A 1IEBB 2Y1VA 4O2FA 4M1CD 4H0IA 3QDJB 4PRIB 4BZ2L 2DKUA 2Q20A 1MFNA 2PNDA 1JYVA 5EO0B 2W0LA 5JXEC 4JN2A 4HWEL 5C3TA 3NTCH 1V7ML 2Z8SA 3B9KA 5C0BE 1T03L 3DURB 4G8GA 1F58L 1NH6A 3FL7A 4JFYB 3VWKD 1GHFL 3UXFA 1RURL 3F6LA 4OLUL 4DTGH 5TE6H 2HN7A 1UKQA 4XC1L 1IKFH 2RHEA 3UBXG 4YHZL 3SDYL 3TN0D 4AG4H 2AK4E 1NBVL 2NY6B 3I6LE 4WCYL 2Q86A 2CRYA 4HDIB 2MCPL 4JJ5A 1KPVB 3IDIA 3I6LD 1CLCA 1BJ8A 2Y5TA 4JY5L 5BO1L 2AXJA 2EDRA 3R06A 2VDNH 3P9WB 4KK6C 1KXQE 1IGCH 1CFQA 3PP3H 3S88L 1P7KB 1WF5A 2PTTB 5C0CE 1JWUB 3MLRL 2Q87A 2FJGA 5DJAB 4L4TA 4LHUG 5LQBL 5ITBH 1MCKA 4Q2ZB 4LLDA 4M7LL 1FE8L 1YY8B 2XQYK 4XP9H 5I1JL 5KN5A 4FTVD 4I2XE 1YUHA 3DRQA 3MV9A 1FRGH 3QWOB 4L3EE 1KOAA 4WFGD 2P5WE 4HMCA 2ICEB 2IJ0C 3B2UD 3MR9B 3ME0A 3RL2B 5JIKA 3T0EE 3H3BC 3PNWB 4I3RH 4M6NH 1OTTD 3FFCD 4DTGL 4YXLH 3WBDA 3CK0H 15C8H 2H2SC 3BSZH 2I24N 1MCCA 3U46B 3MJ9L 4WCYH 3Q6GH 2MCPH 1FIGL 3WHE1 4Z76B 3LN5A 4RAVB 3EOTH 3RPKA 4JFPB 1JFQL 2HT4D 3MJ8B 5KTEL 3QUKB 5KSUB 1FVEB 4JHAL 1IGCL 1N4XL 4YDLC 3JWNC 3HC3L 1A9EB 2R4SH 2ICWB 3MLRH 4PJ9B 1MCNA 2FEDD 2CLZB 4M7LH 1T3FA 3MFGB 5E9DE 4LSDA 5CEYA 1Q9LB 3GSXA 4XWGL 1VENA 3MGOA 4U1JA 3CSBA 3DTXA 4Z95L 3QUYB 5T3XE 3GJFA 1N2RA 3V7AE 1NCCL 1R24A 2IG2L 3RBGA 1QOKA 5J06A 4PJXE 1GGIL 1CD9B 1FGVH 1KLUB 4MAUH 1VCAA 5FUOL 5IBLC 4OKDA 1GGBL 5TPWL 3K8LA 4FG6D 4NNXB 3AREC 1QHPA 1E4KA 5E00B 1X5IA 1ACYL 4M6NL 4P2RD 2DM3A 4ZO7A 4PJGB 4LVNB 2FD6L 5D1ZC 1AH1A 2V2WA 4LVOC 1ND0A 5FYKL 9CGTA 4EI5A 1AGCA 2OS7A 2X4NA 8FABB 1YDPA 3ILQD 1FIGH 3PV7A 4KKAC 4N9GB 4S2SB 1JFQH 3QZWB 4OGAD 2YOCA 4QXTB 2HMIC 5J9PA 4PBWD 4JHAH 4XNZB 3T0DA 1OP5H 2PYFB 3O6KH 4GKOA 2R4SL 4FABH 4BH7B 4M7LT 5E9DD 4NHUB 2IFGA 3TH2T 3D18A 4OIIL 3V6OA 1CZ8H 1VGKA 3VFSA 4WI3A 5IVXE 4ORZC 1FNGA 4PJ8A 4PBVC 5TE7L 5DD0L 2V5SA 4HIXH 3U79A 1ADQH 3TVMB 2VDKH 4JZJC 4UV4H 5ID1B 2ITDB 2BK8A 2DQDH 4M8VA 2XKSA 4G8EA 3HA0A 5FUOH 3Q1SH 4Y89A 5F9JA 4PYGA 5J0BA 2D4DA 1PEWA 2GFBB 1MI5E 2OX5A 5DEGA 1KT2A 1U9KA 5J13B 5B3NA 1S7WA 4M6OH 1Q94A 5A16A 4DFHA 1RVFL 1PZ5B 1MFCH 1XR8A 1T80A 3KYMA 1RIVL 2J8HA 2V7NA 1DVFD 1N7MH 4MD0B 4LF3B 1U58B 3SDAD 3I75B 3ZTJH 4J8RA 1Q8MA 5I1EL 4G7VL 5EOQL 3MYZA 3O6KL 4BK4A 4FFYH 4F2MB 2HTKD 3JWOC 4TVPL 4PGZA 4EZMA 1MEXL 5T1LD 1Y18A 5E2JA 1W0WA 4XC3H 4GKSA 3EDFA 1VGEH 3S3SA 3M45A 3ALWA 1T1ZB 4OLYL 4UAOB 4HJ0C 1SJHB 2ZCLL 2R9HC 3C9NB 4G9FA 2OJEA 5IR1B 1UJTA 3D39B 3MUY1 3D85D 3HE7A 5IB1A 4B0MM 3WJLA 2X09A 5H2BA 3WFBH 1JYNA 3DO7B 3BXNA 1B0GB 1P4LB 1YY9C 5T1KA 1X5FA 1BZ7A 7CGTA 2H41A 4LVNC 4U6HA 4X5WA 3I02A 3V4UH 3UX9B 1KEGL 2BVQA 4EN3A 1U8OB 5IBTL 5DMGC 1IRAY 1H8SA 1SEQH 3VGDA 4I4WB 4MYWB 1T1WA 2VLLA 4QXUH 5GRYA 3TO2A 5HYJE 2O61A 1IEHA 5HYSA 1J0IA 1L7TH 4FQCH 2J8UF 3HE7D 3MRLB 3LS5L 1VADB 1VA9A 4TNVK 3OR6B 2B1AH 3EOYG 4F7EA 4MJ6B 2BOBB 4EJ1C 1K4CB 1UH4A 2DJUA 5E70A 2HH0H 5DUBA 3FMGL 1YEGL 3QUZA 1VGEL 3SDXA 4QKXB 1D5MA 4OLWL 1KXTB 1A7QH 3U48A 5CD5D 3EOBA 5D7IB 4ONFL 12E8L 2CR6A 2E7LA 3G08A 4F37F 5CSZB 4ORGB 1ZHLB 2O5ZH 3MBXL 3WLWC 1BIIA 1F3DJ 4QTIH 1HCFX 1WSST 2HT3C 3M8OL 2R1YA 2P47B 4MA8L 5LBSH 4IMLB 4KVNL 2X7LB 1T0MA 2UV3A 2A6JA 4OZIF 1U3HB 1YYMH 5IBTH 1T1ZA 1SEQL 4PRHA 4XTRD 2NW3A 1QFPA 4AM0A 1R5VA 3N1QC 3I6KB 3C6SA 1KPUB 5EIIB 4PG2A 3EJZC 3PDGA 4FQCL 3ILPA 3VXSD 3LEXA 4TVPE 4HH9A 2QSTA 4FZ8L 3I9GH 4OLEA 2W38A 1VESA 4W6XB 5CCKH 4GXVH 3HKFA 5JIHA 1BD2E 3LKNB 5F1NA 5GZOD 4YFLF 3MSPA 2IPTL 5JW4N 2WNGA 5SWQA 1BJMA 4OIBA 1WZKA 1LK2A 4X9HA 5SV4A 1JGVH 3VGGA 3GBML 3F7YB 1LMKA 3D18B 1JGUH 1MHPH 1QFWL 4BFGA 1KJ2A 5KS9F 4N0FB 1QA9A 2O5ZL 1RZGA 3QPQD 4PS4L 3T8XB 1WZ1H 1ULVA 4WJ5B 1EX0A 5BV7C 1G7LB 4JFDE 1JWSA 2PF6A 1LD9B 1NCNA 1IEBA 3MROB 5SV3A 3RTQD 5KZCD 2IAMA 1FN4A 5FECB 4XP4H 4RAUB 3MYJB 4OD3H 3SKMA 3TA3D 1J88A 3FQWB 1FAIL 2QJDA 3BUTA 4LOUD 5DJZB 4DZBA 1NBZA 1G9MH 5IB4B 3WFDL 1QSVA 2VIRB 4LPVA 1UCTA 2C9AA 1R5WB 3FJTA 3GJFB 4NGHH 4TNVF 4CL7A 1HOCB 2BXZA 2DLHA 1MHEA 4PJAF 3UP1A 4YFLI 2JTDA 4ZPTA 1C5BH 3IGAA 3OKNB 4KXZI 2E7HA 2NXZD 4L5FL 2HJFA 3AXLA 3ZLQC 2B20A 3EYVB 3LMJL 4ETYA 3BZFB 3ULVF 3VXOB 4NQSA 3OKMB 1PG7W 1MUJB 5T5NG 1MCWM 3TA3A 3HC4L 1CFSB 5C0AD 1JGUL 1QFWH 2QBWA 3UTTB 1UKSA 2H2PC 4HV8B 3MV7D 1WIUA 4KK9D 5FO7B 3T1FA 4DVBB 3QXWA 1SVCP 1EXUB 4OFVA 4ONGL 1T5XA 2E5EA 1PFCA 2EZ0C 2MHAB 2J88H 5HDQH 4Y19D 3FQWA 2AGJL 5DJZA 3NOIA 5D7IE 3BZEA 1QFHA 1S9XB 3ULSA 3MLPA 2P5EE 1HDMA 2ZP0T 3PG2A 4WO4B 3O4LE 5GZND 1J1OL 3P30H 3IFPB 4S1SH 4LBEB 4O4YH 1IAII 1EFXB 3DBXA 5C0AA 1U6AH 4U2YA 2RJMA 3V0VA 3KPQA 4AY0A 5F89A 5IWLA 4YE4L 2BNQE 5C07D 3MR9A 4WI6A 1KB5L 3QG6A 4IRZL 4WENB 1G6RB 3G08B 1VFOA 4U1KA 5D2NB 2JF1A 4XXCA 4JFQA 3HB3C 4HPYH 4NQVA 5IEKA 5HYQB 5DR5H 1KTRL 3ET9F 1P4IH 4HHAB 3FB7B 5D1ZB 5F7LB 3EJYC 5I71B 2ZUTA 2E9JA 3O3AB 5GGRA 4FXLA 4XAWL 3K2UH 5FKAA 5ISZA 1FCGA 5GRXG 1RPQA 1IZJA 2CLVB 3IJHA 4LSVL 2K7PA 5TF1H 3NIDE 3VFRA 1JV5A 2HLFC 2J1KA 5H94B 4J23A 4FFWC 2DOCA 5HDQL 5DRNA 4MXQC 3VXTA 4C54A 2A9MH 3UJIL 1NAMA 4M8QB 3RVXD 3C5ZA 4FQLH 2NY4D 3VFPA 1J1OH 2NY5C 1ZSDA 4KY1L 4P5TB 5HYSG 1KFAL 4S1SL 4O4YL 1LK3H 5A2KH 3T77B 2X6MA 5I0DA 4Y2DB 5DUPL 5E8EB 2R2HB 3BO8B 4M3KB 3DYMA 1W0VB 3WXWL 1A4JB 1MCOH 3SJVB 4JJHA 3TYGH 4X7CC 1MJUH 4FXGB 3RX8A 1ZT4B 2FJHA 4QHNA 2IEPA 1MHCA 3BAEL 1ZVHA 1RU9L 5INCA 1OTSD 1AQDB 1HZHL 1T2QL 1KCKA 2J7LA 2P45B 3L6FA 1WCQA 1OW0C 5IOPB 4HLZG 4L3EB 1NMBL 3HCVA 2NXZB 5F1OB 3F8UB 2VDLH 3K2UL 1IGIL 2VABA 1BM3H 4P99A 1IAOB 1BAFH 4YWGL 3INUL 2VZTA 1YMME 4K55A 2Z8VC 4X4XA 2IWGA 3FT3A 3GJEA 5A2IH 1MI5B 1NCWL 3EO9L 2CD0A 1KCVL 4FQJH 4D9RE 5HI3D 4A6YA 5JHDB 5J6HA 3OAYH 3FN0H 1S3KL 3UJIH 5GGVY 5HYSB 5SX4I 3U2SA 5M95B 3HLAA 4GRLC 3HPLA 4HC1A 2EC9U 5LWYH 4KGLA 2ORBH 1FVCB 1YEFH 3SO3C 4I3SL 4XGZA 3P2TA 1HEZB 4LARL 3VXOA 3VRLF 1F97A 5CIPA 3RQ3A 3MLUL 2NY5H 4BYHA 3GI8L 2W60B 3UO1H 3S97C 4UTAL 4YLQT 5E2WL 3GRWL 5EH1A 3RL1B 5MENB 3G6JA 1RU9H 1FNHA 5C0JA 3ELAT 4MVBC 3O3DA 4H8WC 1H3PL 4V1DB 5D72H 4TNWF 5F3HA 3MC0A 1J0YA 4RQQA 2FBJH 3MYJA 4J1UB 4N90D 4P4RB 3U1SL 4PRHD 1BM3L 1G9NC 3QDJE 4NZUL 1WFNA 1Q9WB 3S98A 5C86A 1KGCE 3ZE2F 3TO4D 2YPVL 5ALBL 25C8L 4PB0H 3D0VB 1UQSB 4HG4J 4P59H 1NCWH 2NY3B 3EO9H 3PGCB 4LLYA 3H9SA 4NOBA 3W0WB 5IVOA 3VI4F 1JNHA 3FO0H 1QR1B 2R4RL 1G6RA 1UB5B 4HUUB 4PJ7E 4JFQB 5E2TL 1TJHL 2QR0A 5ACZA 3P73B 1MHHB 1G7QB 1MUJA 4NN7B 3DXAD 4JVPA 3OMZA 4HAGA 5FYJD 3GJFH 3HZYB 3OKKB 4M4RA 1MFEH 2WP3O 4KJQC 2EDTA 4K94C 4JN1H 2GQHA 3CC5A 5EU5A 3TV3H 3EYSL 3LKNA 1GC1C 3F65A 4GBXA 3ARGD 5TQ0H 1CICD 1WUNT 5I2IB 1JPGA 2C3WA 2IAND 3RIFK 2NY6D 4JO1H 4JZJA 2HRLA 5FDYA 5CD5C 1LO0H 3RIAF 2A6IB 1T0NA 2FBJL 5B8CA 3CFJA 3QRGH 4ODWB 1U8LB 2PTVA 3W2DH 4OSUH 4M7KL 3RHWK 3RTQA 3JV5A 5HYIA 2F54B 3BH9B 1WBYB 4TSCL 5E6ID 2I60H 3D48R 3IVKA 1ZA6A 4P59L 4S0SD 3P40A 3QQ9C 2CIIA 4KC3B 2OR7A 2FZ3A 4IIQC 1IGTA 4LSTH 5GGUB 2OLDA 2NZ9D 5E2TH 4NWUL 4LHQB 4W68A 4N8VA 4UILL 3HNTH 5BZDA 4HS6B 5DFWH 2FGWL 2X4PA 4YHYC 1MLCA 3QRFM 1IGYB 5CZXD 5E6ZA 4R97C 5E6IA 4UINL 4ZDHA 3GSNA 3TV3L 3EYSH 3QUZB 4PJ9A 5EULV 1EMTL 2XA8H 1L7IL 2A74B 4PGEB 3QFDB 4JZOA 4P23B 2R29L 1A6PA 1TVHA 4A6YB 1FFOA 4BJLA 5E1HB 3VA2C 2JK5B 1F4YL 3R0MA 3C8DA 4PLKD 1LO0L 3L3GA 4U1IB 3THMH 4ORGA 3QRGL 5M7QA 3EO1A 4BFIA 4KQ3L 4GQPH 3MBED 4N0FA 4LSUH 4PRHB 4JFYA 4EUPA 1KENL 4MWFB 4PJ9D 5I1KH 5KJRH 1HH9A 2WW8A 3HRPA 2W60A 1KIPB 1FFPB 5DRZA 1OSPH 4D8PA 3ZKQD 2I5YH 4DGVH 3GSRA 1ZLSH 1PEZA 5DI8B 2XG5A 1IEAA 1FORH 1H3TA 1NAKH 3PP4L 1OLZA 1RZKL 1F6FB 1S8DA 2HJLA 4UILH 5GRJH 5I8KL 3GNML 1GSMA 4ZUUA 5CJ5A 4CW1A 3HUJA 4LLVA 1G7IA 3FT3B 3GJEB 3RUGA 3OXRA 5A2FA 1DLFH 2CK2A 1BBJA 2ADIB 1YEKL 3QXDA 2IMNA 4PRPA 4QHUA 5FYLD 3ZKSD 2R29H 5KSAA 4C56A 4DCQA 1NGXB 1J8HB 5IHUH 1OP9A 1B0GA 3SE3A 5BS0B 1T0MB 4HWBH 2DQCL 3UAJC 3IJHB 5TJWK 3FB6B 1N64H 4M6AA 1NGYA 2AW2A 1CFSA 1JV5B 1BWMA 3HRZB 1A7OH 1IC7H 3HZMB 3HNVL 4JHZA 2HT4C 3NH7L 3WIFB 5IB3B 4JRXB 5HGDA 5F6IB 1K2DA 2MKWA 4XNYH 2ZWLT 4LNRB 4Z77B 2I5YL 1QSED 3VD9A 2XN9D 1ZLSL 1KSRA 3ULUL 3L5IA 1FORL 1CFQB 5IFAH 5I9QC 2ZPKL 1JWMB 3IXTB 5F6HI 2C3VB 3LKSB 1H5BA 2PYEA 3MLTA 1I8MB 4YQXH 4PRDB 3QHFH 5FYJU 1QRND 2VXTH 2WK2A 3UZQA 1QFWI 3UTSD 5F7KC 4WFHE 1JPTH 4GKNA 1RUML 4WU5A 5IFHL 3S37X 3RWGB 1KYOJ 4OF5A 2DYPA 2F19L 2VISB 3D3VE 1AXSB 4QRRE 2QR0B 3B9EA 4RIRB 3GIVB 5HDOA 2DI7A 2BVUA 4MAYB 4NKDB 1IGTB 3QEGH 1NGQH 2DTMH 3RKPA 1TDQA 1EBPA 2LTQB 4R90L 2YA2A 4HK0B 3ZDXF 2AJXL 3DURA 5AYQA 4S1DC 4QT5A 4DGYH 5IR1A 3VXUB 3S96B 3IFPA 3G6JE 3WFHA 2DIJA 5T1LB 4P9MH 2V6HA 3QFDA 5I19H 3MLZL 1HHJA 3ZDXE 3HNSL 3O41A 3KLAB 4P4KC 4PJ9C 1BQLH 1CVRA 5DUML 4Y16D 3RGVD 3QNXA 1UB6A 3ALXA 1INQA 3T4YB 3CFKA 5JPNB 1EEZB 3T3PF 5CZVH 1WWBX 3SGJC 1RHHA 3IFOB 1IQWH 3K4AA 4HF5H 3PDOA 3RGHA 3TA3B 1ZLUK 1KCUL 2NTFA 4P9HH 1KN4L 4HFWA 4NM4H 1IGML 1RUMH 4YGVA 4WUUE 1B0RB 3ZKXB 4M93C 4UB0H 2VZ3A 1FNGB 4PJ8B 4HIEB 2GUOA 3ARZA 5KSVA 2W0PA 4JM2D 1OARH 2AV1B 3FTGB 4YHMH 1UACH 5AWNH 4FQXD 3I3EA 4YBHA 1HXYB 1UH3A 2X4QA 3I50H 2AJZB 4OCXL 2HT2D 3MLVH 2KZWA 4AEHL 4U1LB 4ZUWA 1DN0B 4E5XB 1IZKA 2VQTA 4Z7UA 2O5XL 3A0OA 2YD9A 4PTUB 4LLUA 3WDIA 2BVOA 4R2GB 2AQ2A 1EVUA 1P1ZB 4XPFH 1FIEA 1DR9A 4JFEE 2BJML 3OKKA 4NHCL 4PD4K 1A4KB 3LH2L 1AQDA 3T2PA 1BOGA 4LP4A 2NY7H 3DHJA 5DD1L 5FXCH 3SOBH 3DGCR 2FX8L 4PYHA 4WO4C 4XP1L 2CJUH 2NY1C 3IB4A 1IGMH 3WN5A 3DVGB 3BKJH 1AC6A 4LASL 2W0FA 4F33A 1YPZA 2CDFB 3IFLH 4LCYB 3BQUD 3M1BB 3VG0H 4P48A 4YHML 4ETQA 2Y6SD 4YFEA 4PY8J 1NBYB 1CGWA 4ZSOE 1W72B 1WFUA 1N6UA 4Y1AA 5DWUH 4RAHA 2HWZH 4PTTB 2G60L 1CF8H 1L9NA 5FKPA 1A2YB 3O0RL 1A7BA 4EDWH 4YEEA 5CSGA 3MTRA 4XMLL 1UZ8A 1WIOA 3CFDA 4LKCB 2A6JB 1RUAH 5E9DB 1R5VB 5D7KD 1S9WA 3U83A 1TJGH 2OMNA 4NFBA 5I0ZA 1KJVB 4HJ0D 1KV3A 5IW1B 3CCHB 4P5TD 3O4LA 5EOCJ 3A67L 4GH7B 4LLAA 3CDGA 4L29B 2LV4A 2FX8H 4WUUD 1AR2A 4XP1H 4NFCA 1J18A 4JHBA 4Y88A 3CDYA 3L3OB 5K9OB 4IBLT 4NCC2 3BKJL 4LASH 4MA3B 5EZIL 4ZOBA 2VLKE 3DX7B 1JN6B 2BNRB 3CVIH 1MCIA 1XZ0A 2APBA 2EZ0D 3SGKA 5IB1B 5K93A 1EHAA 2HWZL 4YGAB 3BKCL 4HX1B 4U1MA 5F7MC 2H3NB 3JWDL 4NO2B 1QUNA 3BPOB 3FT2A 1F45A 2ICEA 4LQFH 1KUMA 2O93L 4M7JL 1CXIA 1Z9LA 3RL2A 4XMLH 3QH3A 3TPKA 2DMBA 1MPAH 3BT2H 4LKXA 1D5ZA 1UA6L 1Y6MR 1CL7L 3HS0A 2VLKA 3OB8A 4LHUB 1NFDF 2JB5L 4I0PD 4IRJA 1RULH 5HHVH 4C56D 4L4JA 4H25A 2FIKB 4HS6A 4OM0L 4I77H 4HKJB 5C2UB 1P7KA 5FGSA 5GS2H 5T33L 2VIRA 3I75A 1C5DB 4GLRH 1B0WA 1MCHA 3U7YL 2AK1H 4CMMA 3WJJA 3O4OB 3E6HB 1BEYH 1KTDA 5F7EL 2XY1A 5IMLA 1NC2D 2DQHL 3VFUB 2DD8H 2GK0A 3KPPA 5BZWB 1QSZA 4GXUM 2GTWA 4JKMA 1HSBB 2DAVA 2XTJD 2VKXA 2VDRH 3FAXA 2PYED 1CL7I 4M62H 4EI5C 2Z4QA 3QFJA 4EQ3A 4RWYL 3MXVH 5CFHA 4OKVB 2CRIA 5C09B 5F8RC 3STLB 2EYRA 5C2BH 4K8RH 4V2BA 3GUTA 1CDIA 2AXHA 4Y5XC 2MNUA 3KJ4B 1ZEAL 5D71L 4I77L 1EFXA 1CXHA 3GK8H 4AEFA 1NDGB 2P42B 4HXBH 4Q97A 3DVNA 2ADJA 4LAQH 3QFJD 1U8LA 3L3DB 3MJ7A 4XPBL 1Y6NR 3KPRA 1KIUA 4IOIA 1Q9OA 2AK1L 3QUXC 1K4DB 2QHRL 2FRGP 3H9HB 1NGPH 5JUEL 3SE9H 2DQFB 2PUQT 2DD8L 4OFYA 4FQ2L 1WWAX 5EA0H 1LDPL 1X5JA 3SDDA 4ZXBD 2X89D 5A2JH 4P2OC 3STLA 5BVPH 4H0HB 1YN7B 2VDRL 4M62L 2VXQH 2NX5B 1Q38A 4UAOC 3WN5B 1EGJL 3QT2A 1DBML 4HKBB 1GCFA 4RWYH 2VAJA 4J6RL 4R26L 3A6CL 1T1YB 1YMHB 5I1HH 4UI2A 2Y07H 1NDGA 5FK9A 4S11A 2PXYC 4MAYD 5CD3A 1FSKB 3DGGA 3PF2A 3HG1B 3SKOA 5E8PB 3MUZ1 4K94L 3MA7B 3QZWA 4ERSL 3SGJA 1IKNA 5DJ2A 3O8XC 3T08A 5CEZL 5I8EA 5EBMB 1HHIB 1ODAA 3GK8L 4GW4B 3WDHA 1UXWB 4WFEE 4DAGH 5HPMB 3D39D 3PJSB 3L3KA 1IC1A 3QG7H 4GG8B 5L8KB 2IGFH 2NY2B 4ZTPH 5MI0C 4U1MB 3IRZA 3BIKA 1F5WA 2E7MA 3QCUH 5FHBL 3MMEB 3WUWG 4P46C 1A3LH 4HX1A 3ABZA 4OV5B 3GSQB 1RK0A 5FA3A 4PJAB 3D69B 2AJZA 4TRPH 3NABL 5CGTA 3LZFH 1JMXA 4GMTH 5IBUB 4JQVA 4YBQD 4KDTA 2FX7H 1IAOA 4FQ2H 5EA0L 3K8KA 3WIFA 2FH6A 4Q6IC 3X14A 3GBNL 4ZFFA 4JANB 2VLKB 4M5ZL 3RVTD 5FIEA 2XKUA 1MCPL 5CEYB 2APWA 5BRZD 3UTPD 1ZHLA 3RPIB 4LRNH 4R26H 2WIMA 1GC1H 4JDZB 4ODUA 5JHDA 3PWPA 4Z7NE 4G9FB 2C3VA 2FHCA 4R8WL 1K6QH 4JRWA 4CNIB 2IFFH 3BN9C 1EZVY 3QWOA 4PRDA 3O2DA 1KB9J 3MUGB 1JUFA 4W4NA 4K94H 1FYTB 1B9ZA 4NRXB 4ZPVA 3FCTA 4WHCA 5CEZH 3DVIA 3D9AH 5F44A 2JELH 5IESL 2LU7A 4NPYA 5BRZA 4L8CA 3RNKB 4GBXC 1MVFA 4MSWA 4P3WA 1YYLH 4XWOC 3TH4T 4FA8A 3QCUL 4K23H 5FHBH 3BWAB 1U91A 3QEQA 3GMMB 4B7LA 5K9KB 4JO4L 5I76A 2CGRH 1RFDH 5HHMD 4G6JL 1S7XB 2FEDC 5IV2B 1YNTB 1JMZA 3ULVC 4G5ZL 5J89A 3UPRA 4QLRA 2H9GA 1SY6L 3O3AA 2OK0H 4ZSOB 4CVZA 1A3RH 3LD8B 2F53D 3VCLA 1DQQB 1J8HD 2CKBA 2IBGA 2VN7A 2ZOLA 1D5MB 3TBWB 3GBNH 4KUCF 4Y19B 1V3KA 4M5ZH 3WKMH 2GT9B 3MOQA 5IHLB 3NACH 5HHQA 5CJQL 3C5ZB 2PETA 4OZFB 4MLSA 4KJYB 4I13B 4KJWC 4PG9B 5GGTA 2YEZB 3DRTA 3SEPA 2XN9B 3KYKH 5EZOL 3C09C 2D7MA 3MRMA 2J8UE 3C6LA 2WIIA 1T1WB 3TO2B 4P2RE 4P2YA 4J2XA 4LEXL 5FEBA 4NZRL 4F7TB 2IQAA 4N8CH 3ROLA 4M48L 5D8JL 5ICZB 1CE1L 5T3ZL 1U8IB 4MLIA 3NGBC 1MOEA 3SDDC 4HUMB 5IOPA 3SGDI 5B21A 4P2OA 2CPCA 5E08L 1IKNC 1S9VA 4OZGB 1CLOL 4LFHG 3FQNB 1SYVA 5ILTH 2EYSB 2BRQA 5ICYB 2QQLH 5IQ7L 3FQRA 4WW2F 2R0LL 5DMKA 1MRFL 4AZ8A 2CH8A 3PHQA 3JUYA 1CFTA 1IGJB 2VQUA 4JKPH 5HPMA 2HKHH 4PJCA 1INQB 4HQQH 3PWNA 4RA0C 1OQOA 4OTXL 4UIMB 1EHLL 2I26N 1KIQA 1XR9B 5E00A 3H8NA 1U95A 2COQA 3EO0B 3BZEB 3VFGL 2CLRA 4GMSL 4U1GB 4NT6A 2IF7A 4UU9A 4QOKD 1SBBA 2YD5A 1OAZL 4PB9H 3GGWB 3QIUA 4UNVA 4XPAL 4LVHC 2V5MA 4M48H 4U6VL 1DBKL 4OZGF 3G6AB 4JANA 4KTEL 1NEZB 2YMXL 1OVZA 5IWLC 2GJ6A 4NFDA 1NJ9A 5F3BB 5I1AA 1DN0A 3B43A 5CGMA 5GHWL 4N0UE 1H0DA 5MP6L 2W92A 2HFEA 1JTTA 4A2LA 1CLOH 3LS4L 4M9OA 5AZEL 4WI8A 5ILTL 3B3IB 4QHUB 2P8PA 2W9EH 4WEUD 5HI4D 5BMFH 4ZUTB 3P0VH 1UWXK 3IKCA 2BRRH 2Q8BL 5IQ7H 1U8KA 4NQCB 2Y36L 3HPJB 3FCTB 5H37H 4MJIB 1XF5B 1BWWA 2F53B 5IROA 5E8OA 4RMQA 2EYTB 1WK0A 2GTZA 2ZCKH 4HQQL 3LPWA 4NRYA 5D6CB 4FG6C 3D87B 5IMKB 1PGRB 3KLDA 3V6ZA 1EHLH 4L8SB 1J0JA 1IBGH 2DJSA 1BVZA 1WWCA 3P73A 4NO5B 5D7JC 4L1HA 3G5XB 1E27A 1T83A 3VFGH 2AEWA 3SE8L 1RZFH 4BKLA 4L4TE 4KROD 3AAZA 2XT1B 1HQ4B 5DYOA 5AYUH 4GQ9L 4C4KO 4XPAH 2CUIA 1PKQB 5ESAB 3DSNA 5CP7A 4YHKH 5CP3H 3JV4A 3WIIL 4DWHA 1IGFH 3L5JA 5F9AC 5DD6A 4LLWA 5BS0A 1G7HB 2X44D 4JZOB 3S37H 2YUVA 3KXFE 4YHOL 4RDQG 3DI2B 2HFTA 2VNCA 1B88A 4NZDA 3V4PH 1AXSA 5JZ7D 1J8HE 3S35X 2NR6D 1F11B 2L7JA 5IKCA 1P9MC 4L8CB 4F7MB 4PGBA 1AJ7H 2XNAA 2IQAB 3RVXC 3F6IA 4NM8H 5HVWA 1YC7A 1R3JA 3VH8G 3TT1L 4G7YL 5DUBB 5E8DL 4U31A 2GY5A 5IHZB 2VL5B 5FYLE 2A0LD 3VXPA 3MRPB 4L3ED 3CJJA 2ERJB 3MV9B 3SDXF 1OGAE 2X4UB 1KJ2B 1E6OL 1QNZL 4H20L 4PJ5B 1I7ZA 1N59B 4XVJH 1FVDB 3RWGA 2ZUWA 1G1YA 2OL3L 3VXNB 2YK1H 1KBGL 1I1YA 1N0XL 1HSBA 1CIDA 1QSFB 3FONA 2X4SA 1XIWA 4MDJA 2G2RA 4OLXH 4P57B 2OZ4A 4ZG1A 1ZVSB 2GY7B 3L9RB 3WHXB 4I48B 4V1DA 4MJ6A 1NGXA 3C5SA 5DRXB 5ETUA 4PJBF 3CMOL 3F58L 5ISZB 5DS8A 3WYRA 4XCYB 5L2KE 3C5JA 2PR4H 3GI9L 5L2KA 5C0GA 2W9DL 35C8L 1R3HB 1WZLA 5JO5B 3HC0B 2A73B 1T0PB 1EAPA 1T4KA 5TGBB 5KN5B 1P2CA 1QR1A 3MV01 4JR9H 1M6OA 2VLRA 3G5ZB 1L6ZA 4V1DD 1GGCL 4L9LC 4P9HC 2NY1B 2D03L 4LU5H 4H20H 1EA9C 3D3VB 1UYWL 1P6AB 1ZVSA 2AKRA 2CXKA 3H2WA 2UWEB 3QIBA 1T20B 1YMMD 1QQDA 3ZSSA 4N1CA 2Z31B 2AJYL 4PV9B 2P24A 4IHOA 5KS9A 2F54E 1I9JL 3WFCH 1ES0A 2H1PH 1SQ2N 4QHLA 2EH8L 3WO4B 3SDAA 1C16A 1MF2L 4LRIC 3BKYL 4NNPH 5ALCL 1MCJA 4XAKE 4XH2A 3RY5A 1JRHL 1JNLL 3BKMH 3BWUC 4PJ5A 3C6LD 1CGYA 3MRGB 2EE9A 1KJMA 2PR4L 1JPST 5DJ2B 4U1HA 3OQ3B 4KZEL 2ZSWB 1R3LA 4XWOD 3IVKB 4HBCL 1W0YT 5ECJE 4P5TC 4PLJD 1UWGH 1FO0A 1WTGT 4S1RH 5ADOL 5J6HB 4AL8L 2WBJA 1AGFB 4Z8FL 5ESQA 2FHBA 4J3OC 3DO7A 1FBIH 1XFPA 1N6QH 2I9LA 1MCBA 1C7TA 2F8OA 2UZXB 4WI7A 5BS0E 2BNQA 4G8GD 1H3XA 1VERA 4KTYA 1UYWH 1VHPA 3I85A 1NMAH 3EIFA 4Y19E 5DQDL 5F7DA 5DRWA 2AJYH 2NY3C 4K3DH 5FOJA 3WD5L 5J12B 4XBPA 5F88B 2VXUL 3F7RA 1F6LL 3VFTA 3HI5L 2MKLC 4HIEA 2GJZB 1HNGA 2VL5A 4ETQB 3DIFA 4MDIA 2R0KH 3N1GC 1JRHH 3P4NA 1RZIA 1JNLH 3BKML 3TBYA 2R2HA 1BVKB 2VDPL 3GSNL 3OAZK 4NHUA 1XF4B 3UYOD 1K3ZA 1MFDL 4R0LA 5C07E 2XTLA 4BZ1L 5IJKC 1E4JA 3QXTA 1MY7A 3BESR 3SHSA 1RIHL 3BRDA 5CWSB 1X6LA 4PJ7F 2V2TA 1JCKA 5IBLD 4OT1H 3TYFA 3CGTA 4AL8H 3BH9A 2OZ4L 3FZUD 3ARDB 2BVOB 3DSFH 4FN0A 3X11B 2H45A 4QRPA 1A6WH 1TZGH 5DEGB 5F96L 4X4ZA 3KDMB 4JG0H 4X4XB 2EH7H 2DLEA 2BXYA 1CK0L 4F58L 5D1XC 3QAZB 1ZGLM 3MOAH 6CGTA 2F8XC 3WDJA 2V7HB 3I6KA 4WEMB 4Q74A 3WD5H 3CLFL 4DKFL 5E5MA 4QGYA 4E41B 4L8BA 3GEWB 1I3GH 5GGQH 3P4OA 4UIKH 1U8HA 1L0YA 5E7FA 3KVQA 4Y4KB 4KKBC 5DJDA 3VXUD 4KKCD 4OGYL 1BVLB 1KC5L 1U3YA 2APTA 1BECA 4BZ1H 3MCLL 2VXVH 3IFNH 4EBQL 3HHRB 5CIPH 4LDLB 3SJVA 1AO7A 4YHIA 3Q3GA 4M1GL 3U36A 1KIQB 1XR9A 4UNUA 4LHUA 5D1XA 2EEDA 1MQ8A 5T1MB 5TH2B 4IHOB 4MJID 3L1OL 5KS9B 3P9MB 5GRWA 2Z31A 1BD2A 1TZIB 3UBXA 5BS0D 5DJAA 5DJYB 5GRVK 4RBPH 4XX1G 5BV7B 5D5MA 2EDFA 4HZLA 3LKOB 5FYLL 3NA9H 1C5DA