1QR6A

Human mitochondrial nad(p)-dependent malic enzyme
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
551
structure length
551
Chain Sequence
EKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALIC ENZYME 2
publication title Crystal structure of human mitochondrial NAD(P)(+)-dependent malic enzyme: a new class of oxidative decarboxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 186
structure length 551
sequence length 551
chains with identical sequence B
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 1999-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1qr6A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1qr6A01
1OFGA 1ZEJA 2IZ0A 4M49A 4ITUA 1M6WA 1ISMA 1JW9B 3PYMA 5COAA 2DM6A 5JAMA 1DLJA 5BNFA 1QSGA 2WYVA 5KVVA 2IODA 4P38A 1MC4A 1KBZA 4CR6A 3R0IA 2LDXA 1GEGA 3E9MA 5ENDA 3ASVA 2EG9A 3LDHA 4NJOA 4BO9A 1EE9A 1VLLA 2B5WA 2B83A 5A3JA 1LUAA 1QORA 4JIGA 4J1SA 1A72A 3EK2A 1SPXA 1YRLA 1RPNA 2QIOA 3D3WB 5T57A 1GFSA 1SO8A 2CF5A 3FNHA 3OA2A 1XU9A 3ON5A 5TIIA 3KYDA 3GGGA 1SB8A 4WCFC 4CM8B 3BIOA 4TRJA 1YQGA 4XGKA 1PR3A 1PWZA 3QV1A 5TGDA 4EDFA 3P5SA 1VE9A 1L7DA 4E5YA 4JN6B 3FD8A 3I52A 8ADHA 5K6AA 3ZNNA 1QV6A 5JDCC 2QRLA 1MXFA 2C5AA 3QIVA 3DWFA 2FWMX 2RIRA 4GX0A 2EKQA 1K6XA 1I2ZA 1DEHA 3K30A 2QQ5A 4XDZA 3WYEA 1U3TA 3N74A 4Z3DA 2X0IA 3ZWCA 4IJUA 4BIIA 1IHXA 4E5PA 1NAIA 1PZHA 3EHEA 2O2SA 2PKQP 1DIBA 1NTOA 2UYYA 4NK4A 3WDSA 2VZ0A 4BO7A 1Y9AA 2P2SA 3RIHA 1WLYA 5CDUA 3RCBA 2V6MA 3RFTA 2A94A 5CAEA 1HLDA 3LC2O 4IY1A 1DRWA 1E6EA 4WECA 4BO6A 1YBVA 4F46A 3GN1A 3TFQA 2Y1CA 3GNSA 4MVJM 4BMNA 2BMAA 4IS2A 3EC7A 2AEJA 4L4XA 3GPIA 1J6UA 4N54A 2HO5A 2Q2WA 2PR2A 3ABIA 2X5OA 3LYLA 2X22A 3QWBA 1NQAO 3DEYX 3H7AA 1LC0A 3FBTA 3ZH2A 1EFLA 3OIDA 1UDAA 4B4UA 2ZCUA 1DJQA 5THKA 3F9IA 3NGXA 5KVSA 1M75A 2JAPA 4FB5A 1XEAA 1JQBA 3F4BA 4YAEA 2DQ4A 4RF2A 5G2OA 5A9SB 1O5IA 1H6AA 1PJ4A 2D1YA 1EDOA 1LRLA 4E13A 3ZI0A 1BG6A 1PJLA 1PZFA 3A1NA 1DB3A 1LBEA 4HP8A 5L51A 5TNXA 4MVJA 3I5MA 3GZ4A 2A92A 3TZHA 2AEFA 4B4WA 3OF2A 4MKZA 1WXDA 3M6IA 3HDHA 4PG6A 1EQUA 2GERA 4TVBA 3I9OA 3UOGA 3PHIA 3RUEA 3JV7A 5L7YA 3V1YA 1DC5A 1E7SA 4U6QA 3BXXA 1Y1PA 5CHEA 1YOVB 2OBYA 4QECA 1OAAA 4OQYA 3DZIA 5A9SA 2FR0A 2CMDA 2C07A 4Q3NA 1Y5RA 4E2ZA 3ZWAA 1LJ8A 4I1IA 4Q39A 1RM5A 4NFSA 1LDNA 3B1JA 3O8QA 1XU7A 5T6BA 3GZNB 1Z7BA 2NACA 1QYVA 4GLOA 3U0BA 3V2HA 3QY9A 1IZ0A 2O3JA 1HEUA 5L45A 5DCUA 3V1TC 2P9EA 3G1UA 3I9KA 4CJXA 3Q2IA 4BNVA 4AFNA 5JDIA 1GYRA 4IZIA 4PLZA 3DDNA 3BHIA 3MZ0A 4DC1A 1CIVA 4DWVA 1ENOA 1GZ3A 4IS3A 4YVFA 4E2YA 4Z6KA 3WTCA 7ADHA 2O4CA 4J1TA 4Q3BA 1LQTA 5G4KB 3PWZA 4CM4A 2DC1A 5JW6A 2GRAA 2Q4EA 5MGBA 4DC0A 2PZMA 2NU6A 4QEDA 2I99A 3VZQA 1MG5A 3GC6A 1EQ2A 1RJWA 1HE2A 1E5QA 2PA3A 3IUPA 4KTTE 3QQPA 3PJGA 4QFDA 1NP3A 3ROKA 2VOEA 3E48A 3GPDG 3LF1A 1XR3A 4M8SA 3WLFA 2HDHA 4CMKA 4HWKA 1VJ0A 4KQXA 3AI2A 1M66A 4CMCA 4QXMA 1XCBA 2NM0A 1UP7A 4PLHA 3EVNA 4NJMA 1BXGA 2GYYA 4Z3KA 1ZFNA 3TPCA 2J8ZA 4CLXA 1NR7A 4Y67A 3TF5A 4W7HA 5DN9A 4B8ZA 2YV1A 3WLEA 2EP5A 3DOOA 3VPFA 2VHVA 1X7DA 1E6UA 4NNJA 1EUCA 4YPOA 5L53A 4WUVA 3BYZA 1A9YA 4CM3A 4H15A 3JQCA 1NX6A 4RVSA 1PS9A 3JTMA 3QSGA 2GO1A 1MXHA 2FPGA 1TB4A 5BNTA 4J1QA 1GQYA 1PU2A 4TROA 2AEMA 3M2TA 4NFHA 3GF4A 4HFNA 2EGGA 2VWGA 1NPYA 4A7PA 1P0CA 3P19A 4UVIA 2ZTUA 4HXYA 5IDQA 4RLSA 4GX2A 5ITWA 4NU6A 4TWRA 4XEHA 2VNSA 5CDSA 2JJYA 4URFA 1S6YA 1K89A 1T4DA 3GOHA 3W1VA 3HB4X 5HWSA 2FZEA 5KVCA 3DZGA 4MKRA 1NHGA 2AXQA 4DREA 4NBRA 1MC5A 3RVDA 5ITVA 1VJ1A 7MDHA 1A7AA 4WLVA 4GQAA 2AW5A 4ESOA 4N5LA 2FR1A 3ZGYA 2YV2A 4N5MA 3PHGA 1IE3A 4OGWA 4LVUA 1XQ6A 3D3EA 5COQA 1BDMA 3OJOA 4N7RA 4BUCA 3STHA 3QWFA 4OKNA 2ZK7A 3S2IA 5C7IO 1XYGA 4YACA 2B69A 4Y6PA 1HE5A 3OECA 4XRRA 5GY7A 4NH4A 1WNTA 3TOXA 4PN3A 1Q7CA 4U7WA 1FJHA 3S55A 1BHSA 1DHRA 1NXQA 3EZLA 3KSUA 4RCVA 2QRJA 3RQSA 4L74A 1HDCA 1GPJA 1IPEA 1IPFA 2YFQA 3Q1LA 4F3YA 2PTGA 4J2OA 2Q49A 3DONA 2XOXA 4R54A 1LI4A 1ZIDA 4MVJI 5AQ1A 2J5QA 4FJ1A 4DRYA 1ISHA 3V1UA 3AUUA 1JAXA 3BA1A 1X0VA 4D44A 4JJFA 1I01A 2QZ9A 1DAOA 3IS3A 4J9VA 4RVFA 3W8DA 3ZWWA 1HDXA 1FDSA 1CWUA 4WCDA 1AXEA 3AFMA 3CEAA 4D42A 2EF1A 2H1SA 4XGNA 1RYEA 2PNFA 4DL9A 1N5DA 3H2ZA 5L4LA 2X9GA 4RF3A 1LXCA 3VZRA 3TWOA 3K31A 3PHHA 2GF2A 2O3RA 4IJKA 4ZQBA 3HNPA 4XZ3A 1P1HA 3O4RA 2E49A 2GPTA 3B70A 4PCVA 4CMEA 3PWKA 5HA5A 4KUHA 3PQEA 3MJ4A 2AMFA 1ZO8A 2O7QA 2BI7A 1HLPA 4XIYA 4NFYA 1SZJG 1KVRA 2YYYA 2PD3A 1E3JA 5BSEA 2YZ7A 3DAFA 3BMQB 4DLBA 3DBHB 3AU9A 4KP7A 2BGLA 4YCAA 3ZV6A 1Y5MA 1NM5A 3Q3CA 5A9TA 4E0BA 4DBZA 2PD6A 4JBIA 4RPLA 3JYQA 5G0VA 2ZJ0A 2AQKA 4IDEA 4NBWA 1UR5A 4JP3A 4Y6RA 4CM7A 4RL6A 5CDGA 4DIBA 3L6OO 3JQ7B 1JTVA 1FDWA 3OICA 3LC7O 1H9BA 1PTJA 9LDBA 1UXJA 1Y9EA 2B5VA 3DQPA 4LVCA 4MIYA 3BMOB 3GVCA 3JQ8B 1P0FA 4JP2A 5IG2A 4IXTA 3X2FA 3BZUA 1Z45A 3PZBA 5HTOA 2Y99A 3WG9A 1LLDA 4Q9NA 4A0SA 5HM8A 3PHJA 1GR0A 4DQXA 2HUNA 2Y66A 5T67A 1J5PA 3VH3A 4PRKA 3D64A 1IULA 1Q7BA 3FI9A 4FGWA 4IDDA 3TZKA 3GR6A 2GUGA 1KEVA 4DPLA 5C7LO 2HMUA 4OHUA 3PWSA 4IDCA 1C1DA 1LA2A 1Y8RB 1QV7A 4RVUA 3GEDA 3VTZA 1AN9A 3G79A 1Y8QB 3VH1A 1YL5A 3L9WA 1E7YA 1AUPA 3H2SA 4IMPA 3F1LA 4ZRMA 4JJIA 1LEHA 3PTZA 4HADA 4BO0A 4JQCA 1U3WA 1GPDG 4BNUA 4Z0TA 3QJ5A 3MWDB 2O3SA 3PQDA 2O23A 3RUIA 3WXBA 3WJAA 3D1LA 4KMSA 3DBRB 2FZWA 2GN9A 3AY7A 3DAPA 1A71A 3OQ6A 4FS3A 3V2GA 4JCOA 4WEOA 3BMCB 2V6FA 4HNHA 1NNUA 1H5QA 3UHAA 2QYTA 5L7TA 5CG2A 2Q45A 1WDKA 3DOJA 2X0RA 2IEBA 1FMCA 3VZSA 4BNYA 2BF7A 4OO3A 4MIEA 3KYBA 3E6AA 5K0ZA 4R1SA 2NVWA 5A06A 3A28A 3Q0EA 3PJDA 3BTSA 1E7MA 2PKQO 3GEGA 3PDJA 2RHRA 4IINA 4P8RA 1T25A 4FOOA 5TSDA 1YJQA 2OFPA 3VZPA 3I9MA 5FYDA 3RUAA 5JAIA 1HF3A 1DJNA 4PLYA 3ST7A 1ADCA 3FN4A 3BMCA 5T5QA 3AFNA 3DZKA 2D2IA 2PV7A 2ZB8A 2I76A 2Y0CA 1D3AA 4FFOA 1DAPA 2EERA 4Y9DA 4L9RA 1EMDA 3W6UA 3GUCA 4B79A 1KVQA 2NVUA 4RDIA 5I7SA 5C37A 4GKVA 1NQ5A 1I2CA 4BNNA 4ALKA 1U8FO 2NTVA 1EZ4A 5A1TA 3HZZA 1NFRA 5L95A 4ZQHA 3UCXA 3ZWXA 1FXSA 4ZVVA 2OHXA 4CLEA 3E1KA 5JAZA 3NT4A 1QYWA 3UCFA 3ZN2A 3ZU5A 3ICPA 3BHJA 1SB9A 2C54A 4EBFA 2WWRA 4FC6A 5JYEA 2C29D 3RKRA 1KC3A 3ROPA 4CMHA 3N7UA 1R4MA 2VWHA 2ZB7A 3PIIA 4RDHA 5I8WA 2Q3EA 1CETA 3WTBA 4RVDA 5F1OA 3U4IA 1F8FA 2JAHA 4JK3A 4L8VA 1O0SA 3ANNA 3WNQA 4B8WA 4EUFA 3RUDA 4UVHA 3WGHA 2DBRA 1PS0A 2EV9A 1O89A 4Z0PA 2SCUA 4Q3AA 2DBQA 3U4CA 3NGLA 4ZN6A 4GL4A 1CEQA 4CLOB 2YHIB 3OIGA 4DA9A 3GRPA 4HBGA 2Q1UA 4GWGA 4E3ZA 4BMVA 3ANLA 1OOEA 3H9QA 1U28A 5DBGA 2J3KA 5HRUA 2PZKA 3E8XA 3ZNQA 1M76A 3ZV5A 4I9HA 3CMCO 4L76A 3RASA 4EEZA 2CF6A 2QX7A 1DC6A 1ZXBA 4CLOA 1E3WB 1ADBA 1KY5A 1YB1A 1JU9A 4OH1A 1LDMA 2WYUA 2OZPA 5FI3A 3RWBA 4DPMA 5GMOA 2W90A 3D4NA 3HJAA 4DLLA 1N1EA 1ZK2A 2B0JA 2DBZA 2Q99A 4UVEA 2X58A 1E92A 3GT0A 4ILKA 3LLVA 1R37A 3SXPA 4BS9A 2GLXA 4YJFB 4BGIA 3FHLA 3B6ZA 3FWZA 3L07A 4PLCA 3TFOA 3PGJA 3K2BA 1YL6A 3PIDA 3RFXA 2DUWA 3QHAA 1F0YA 4XD2A 5L3ZA 4BB5A 1PJQA 1Z7EA 2P5UA 1CERA 2Z5LA 3QLJA 2NLOA 3FR7A 3ETGA 3SJ7A 4JBGA 1EVJA 4II2A 4E12A 2C82A 2AQIA 2FOIA 3JD0A 4D3FA 1A5ZA 1YONA 1ZEMA 3QP9A 1X1TA 4J7UA 3LT4A 1ZSNA 4L0QA 4PLGA 5CG1A 3GGPA 4RGBA 2VUUA 2FSVA 5FFFA 5KNLA 3V2UA 3IL2A 3DHYA 2X6TA 4YJFA 1NPDA 1DLIA 3GVHA 3GHHA 4UREA 2F00A 3VVBA 4TRMA 4MVJD 1N92A 5A5FA 3EW7A 1C1XA 3QVWA 1BWSA 3EUWA 1C3VA 4WE3A 4FJ2A 4UEJA 3WBFA 3TN7A 5I7FA 1IZ9A 2X9NA 4DIOA 3OIFA 4Z9YA 4AJEA 2FMUA 2ZTVA 3JD2A 2WD7B 5I8ZA 1RM0A 4DXHA 3KETA 2GD1O 1I3KA 3QVXA 2Y67A 1MB4A 4GAEA 4J7XA 4I9NA 3PPIA 4RPKA 4KZPA 2XPCA 3F3SA 1SC6A 4OAQA 5JE8A 1TEHA 4W6ZA 2NU7A 3UF0A 1HT0A 4D41A 1B16A 4NI5A 4WPGA 3I9JA 5KKCA 3RUFA 2J3JA 5HS6A 1FK8A 4WCFA 4HUJA 2RHCA 4PVDA 4I8XA 1AE1A 4Y8VA 1UP6A 4CV2A 1ZJYA 2VRCA 1K6IA 3WSWA 1MFZA 1SCUA 1N2SA 4YAIA 1BVUA 3SLKA 1B3BA 3JQ6A 2ZJ1A 5JDCA 4Z9XA 4Z0HO 4BGEA 4DLAA 3JQ9A 4A03A 1NQOA 1AGNA 3DMTC 4AVYA 5IXYA 1S7CA 4WLFA 4ZQFA 3WYCA 3ROQA 4IIUA 3UW3A 3NX4A 5U4QA 3KYDB 2VWQA 2NU8A 3H3JA 5U1PA 2ZB4A 4B7XA 1Q2XA 3BTVA 4GX5A 5F1PA 1BXZA 3DFUA 3ONFA 3SLGA 3JYPA 3PXXA 1G0NA 2C2YA 4TRRA 1NWCA 4CMGA 1DFGA 1B8VA 4R1NA 5EQDA 1PX0A 3NAQA 3PJFA 4M1QA 3WWYA 4BNTA 2DTXA 4UVGA 1LSSA 1WDMA 1WZIA 2GN4A 3JQFC 1CRWG 2CUKA 2ZIZA 2QRKA 2YW9A 1OC4A 5FWNA 2X86A 1ZMTA 1U7TA 1R12A 3GN2A 4ZICA 2QZZA 1H0KA 3RI3A 6LDHA 2F1KA 2OL4A 3LU1A 3ZHXA 4K6CA 2CDCA 4D0RA 4R1TA 4O6VA 5TT1A 1NFQA 2YQ4A 1JKJA 4PG8A 3IP3A 3GQVA 4WASA 4CR8A 1TI7A 4FIZA 4BNJA 5K9ZA 3RJ5A 3GNQA 1ONNA 5C5IA 4NG5A 2O50A 1UXKA 2CD9A 4YT8A 1LU9A 3JD1A 2UVDA 5CPFA 1LRJA 3OP4A 1R0SA 3NDIA 3GEMA 2DLDA 4RQUA 1B2LA 2WMDA 4WOJA 2Y0DA 5A9RA 2NWQA 1TT5A 2EKPA 2Q2VA 4BO5A 2VTEA 3AOEC 2GZ3A 1XSEA 2OUIA 2Z1NA 3N58A 3PLNA 4FD3A 4W9NC 1QMGA 2VNAA 3MJTA 5T64A 3TSCA 3RD5A 3H5RA 2R00A 1D7OA 5I9LA 1ENPA 4U0KA 2CDBA 3HG7A 1ZW1A 2IYOA 1LLCA 4L4SA 1T24A 5THQA 1VRWA 1I36A 3IUSA 1PL6A 2AQHA 4CM6A 3WQQA 4BKPA 2GN8A 2OO5A 3NTRA 4J1NA 4OIMA 2DTDA 2X9VA 4LN1A 4BOYA 4C7JA 4MIOA 2PZJA 4PVCA 3TJRA 2Y05A 1ISGA 1VPDA 3GGOA 3RU7A 4J7CA 1QR6A 3L4SO 4K28A 4R01A 5JYDA 3CUKA 1R6DA 1RM4A 1NR1A 1TA4A 2O3TA 4CODB 5AXBA 1HETA 3O8QB 4CUJA 3WGIA 3MJSA 4IDFA 3U4HA 3O03A 1BDBA 2E82A 2IE0A 2GSDA 3PQFA 4NQZA 1Z73A 4HV4A 3ETEA 4UUNA 1VL0A 1YVEI 2W4QA 3C7AA 3HADA 4Z9FA 4BHTA 1O9BA 3LSYA 5A05A 1OC2A 3OEWA 1PJ3A 4ZA2A 1BGVA 1ZK3A 2DT5A 3DBVO 4X54A 3U62A 2I67A 3SEFA 1DFHA 4CV0A 3ZU3A 2X0NA 5TJHA 1YB5A 4YWJA 3RBXA 2BI8A 1V9LA 6ADHA 3DR3A 4CM4B 4UEKA 1CYDA 4J4HA 3DZHA 3PYXA 4ZJUA 1PR9A 1U1IA 4IQGA 1NAHA 5TRTA 4NHEA 2VOJA 1JKFA 4J4BA 1RYDA 3PLRA 4CQMA 3GUYA 1Z74A 3F47A 5ILOA 4R9SA 4R5HA 1V3UA 5KJ6A 3TZCA 2VHYA 2VYNA 1KYQA 3JQAA 1XDWA 3VPXA 3WSVA 2DVMA 1BXGB 4NJMB 1T2CA 2O3UA 5I7EA 3S2GA 3UFXA 3A9WA 4DMMA 2VTDA 1I30A 1K6JA 1W6UA 1MLDA 1NASA 1UJMA 3DL2A 3GA0A 1QRRA 5KVQA 1C14A 1O6ZA 4EITA 2FN7A 3E9NA 5TQVA 1V35A 5TLSA 1D8AA 2IZ1A 4ALJA 5G0SA 4WOKA 4WGGA 4QUKA 4ALNA 3Q2KA 4RF4A 2C5EA 3DHNA 4A73A 2Y1FA 4CMBA 4DPKA 3BMNA 3A06A 4PLPA 2P9GA 2NUAA 3FNEA 3OJEA 2PLAA 4Q3CA 3I23A 3ADPA 2YJZA 5ER9A 5F21A 1L1FA 1SMKA 4YQYA 1ORRA 1LDYA 4BO4A 1BVRA 5AOVA 2IYPA 1AHHA 3CE6A 2VN8A 4WLUA 4R69A 3FPCA 4FW8A 4UUPA 1P1JA 2IEDA 3RUCA 2AA3A 3ZV4A 1KEWA 2EJWA 8LDHA 4XX0A 3PFFA 1HE4A 4FSHA 1MV8A 1QG6A 1PL8A 3JCZA 1VSUA 4BKOA 1XQ1A 4IPTA 4E2WA 2W2KA 3G0OA 4FCCA 1U8XX 3ZWPA 2Y93A 1OI7A 4H16A 5TJ9A 3LZ6A 1ZSVA 3P7MA 4C4OA 3C3XA 4UAGA 2R6JA 1CQIA 2VQ3A 3K9QO 1T26A 2GASA 1U4SA 3U49A 5JDIC 4J90A 1XIVA 4YT2A 1DBVO 4CMIA 2ILTA 1I33A 3G17A 2YUTA 5ENVA 3DFZA 3DMYA 1HKUA 1UXHA 3PK0A 3JYNA 3DTYA 1LDEA 4N5NA 3IOYA 3ZWBA 5CEFA 5AVOA 4PLTA 5IN4A 2HCTA 3TZ6A 4M55A 2P91A 2VUTA 2YFHA 4HNGA 4UEOA 4RVHA 1HZZA 1A9ZA 1GUYA 1WW8A 1FDTA 4RF5A 1DSSG 1GV1A 3HWRA 1CJCA 4A27A 4JBHA 4G5HA 5JO9A 3DZFA 3NTQA 4D46A 3AI3A 4HFMA 1AXGA 2I3AA 3ADOA 2C59A 3GHYA 3QWHA 1QLJA 5T8KA 3SBOA 1C0PA 1HDYA 4PFJA 4PZCA 4DUPA 3GH3A 4OMUA 5JBIA 5DP2A 1ENZA 2Q46A 1U5AA 4ND1A 2IRWA 1UZMA 3I9NA 2DFDA 2NTNA 3KTDA 3BTOA 2JD2A 4UUOA 4CL3A 3HB5X 1KERA 4AG3A 1GADO 3JQDA 4J49A 2YQ5A 4JXKA 4D45A 3U4DA 2XXBA 4A2CA 4I5DA 2HLPA 1U9JA 4RPGA 2ZTLA 4ND2A 1R66A 1E3EA 1ZZEA 2DTEA 2UAGA 3E5MA 5JY1A 1PZEA 4MVJF 3C1AA 2EW8A 1JVBA 1E3SA 3OETA 4YJGB 3WIDA 3AM5A 5LDHA 1BW9B 4ROSA 5A02A 1VKNA 1M67A 1EUZA 3GVXA 3U5TA 1MA0A 1L7EA 2YY7A 4EGFA 1ZUD1 1LLQA 1ONPA 5TS3A 4R51A 1ZSYA 4F45A 4I5EA 1CF2O 3NJ8A 1LSJA 2P68A 4M86A 3GMSA 5KIAA 2C7GA 2X23A 4DVJA 3NDJA 1GEEA 4YRDA 2HK7A 4YJGA 2A35A 2BFPA 3WNVA 1BW9A 4K1LA 5U9CA 3O9ZA 2EHDA 4M89A 3ZWMA 1YXMA 3D4PA 4GVXA 4BQPA 2HMTA 4TKMA 1NVMB 3TL3A 5H81A 1HZJA 4RO0A 4BO3A 3TNLA 1N9GA 1X0XA 4LRSB 3EYWA 4IQ8A 3TDKA 4U5QA 1DIHA 1VI2A 3JQEA 5JCJA 4J2HA 1KY4A 2VT3A 3RROA 4E5NA 4PIVA 3F5QA 2WEKA 3ZHYA 4LCJA 1LRKA 1C1DB 4YJDA 3VVCA 4GX1A 5CPBA 4R41A 3W8EA 2I9PA 1T2FA 3WFJA 4ND4A 1VC2A 3PYLA 3W8FA 4CLHA 3BTUA 2HK8A 3NTOA 3K92A 2B4QA 4FC7A 4EYEA 2AG8A 2GZ2A 2VYVA 3IJPA 4JGBA 3I4CA 2GGSA 4XQ9A 1KC1A 4CR7A 3QW2A 3KZVA 5J23A 3FRJA 1NFFA 4BB6A 1T2EA 2FSSA 3U9LA 3RC2A 3WJ7A 4E5KA 5JPIA 2OMEA 1LNQA 3B20A 2Y68A 1LSOA 3H6KA 5EL0A 1GU7A 3A14A 1UXIA 1VJTA 4E31A 2CDAA 2J3IA 1YDEA 3GAZA 1HL3A 4A5OA 4AJHA 4YT4A 3MTGA 4CQLA 1P1RA 1JA9A 1GDHA 1DDOA 4RZIA 5DNAA 3VPGA 4CMEC 2WJPA 1GYPA 1YL7A 5COBA 1ZMOA 4WNCA 4OXYA 2ZB3A 4ONEA 3GMDA 3O38A 3KVOA 1QP8A 4XYBA 4CLRA 3GY0A 4CL8A 1HYHA 1ZH8A 4BO1A 3UCEA 3HUDA 3FTNA 3WGOA 2WYWA 4XYEA 5IDWA 5TT0A 4LK3A 3JD4A 2I3GA 1P31A 2B35A 2NVUB 1ZJZA 2J5KA 3V5NA 3ULKA 1K0UA 1ENYA 3AOGA 1H9AA 1E5LA 4CM9D 4IZHA 4XIJA 5DOVA 1H6BA 4J0FA 3WGZA 4ZQGA 2Q4BA 2H9IA 1ML3A 1KOLA 3ANMA 5JFOA 2VRCD 4Q3DA 3T7CA 4FFPA 4BGVA 3H8VA 3RC1A 3HN2A 1U2GA 3E18A 4IXWA 2ZYGA 4IIVA 2VWPA 4J43A 1ADGA 1R4MB 3V8BA 5KOIA 4L4RA 4IUYA 4H3VA 2RBEA 3WX0A 2B36A 2X8LA 3HDYA 3OH8A 4PG4A 1SNYA 3CZRA 3DZBA 3S2EA 1GQ2A 4BNLA 1PEDA 1H6DA 4D7AA 1EVZA 4FR5A 4QSMA 1P9LA 1F8GA 1H94A 2C0CA 1UDBA 3AU8A 4CUKA 2FPIA 4I08A 3ETDA 1M2WA 3ZW8A 1YBMA 1GCOA 4W82A 3TQHA 1PQPA 4LW8A 5JAQA 4M54A 4NMHA 4BMSA 5DT9A 4OYRA 4IMRA 3AM3A 1A4IA 3DZJA 3ZWNA 1U7HA 4RZHA 4BNXA 4BO8A 2POQX 1HTBA 1B14A 5KJCA 3UVEA 2OOSA 2G82A 2WDZA 1ZBQA 2E48A 1OZAA 4EJ0A 3I1JA 2JL1A 2PK3A 2GN6A 2PY6A 1D1TA 3C8MA 4FOSA 4ZRNA 2A4KA 3EZYA 1I3NA 3Q9UA 3C24A 4R68A 4U0JA 3EY4A 5JMWA 4D79A 2O48X 4MDHA 1B15A 5A04A 1T2AA 4J3FA 4B3IA 3OMLA 1IL0A 3NV9A 5ICMA 4Q3EA 3OM9A 1KETA 1ZK4A 1A4UA 1I8TA 4GGOA 2B37A 4FQ8A 3G49A 1U2DA 5JC8A 1B7GO 4PG5A 1U4OA 1T1RA 1P45A 5IZCC 2PZLA 3DO5A 3UUWA 1B0AA 4QFCA 3HDJA 3FNGA 2Z95A 4L75A 3KOUA 4B3JA 4J6FA 4AJ4A 4B7CA 1LDGA 1XGKA 5L4SA 4IDBA 2O4UX 1CDOA 3HDQA 1HYGA 3MJEA 3RFVA 1HDRA 1K2WA 3IMFA 3L4BC 3R6DA 4MVJP 5ICSA 4IJVA 2D4AA 1YB4A 4BNGA 1C1XB 2DU8A 4W99A 4YJHA 2W2LA 3QA9A 2O7SA 4RVGA 4KOAA 1YJ8A 3S2FA 2CY0A 4RJTA 2V6GA 3ZHZA 1SEVA 4E33A 2WTBA 3GNTA 4PZDA 5JCXA 2HKIA 2CSUA 2PFGA 3AJRA 3PJEA 4FFMA 3VKVA 4J91A 4EEXA 4GI2A 1O95A 5B4UA 1X7GA 3H5AA 5F1KA 1VL6A 4YTEA 3FR8A 4XCVA 4YAGA 3OSUA 3GDFA 2AG5A 2VRBA 5KTKA 4EW6A 2C7VA 2QG4A 3DMTA 3R1IA 4BVAA 4EZBA 5IZ4A 1K3TA 3PFWO 3Q11A 4MP3A 4ZHSA 2GNAA 2JKVA 1T1SA 2QYSA 5EMHA 4EI2A 3HN7A 4AJJA 4NDNE 1U3VA 4WCFB 5KKAA 4AJIA 3RUHA 2JCXA 4FN4A 4XYLA 4E5MA 2JHGA 5DF1A 1VL8A 3KV3O 1DHTA 3INGA 5JC1A 4ZU3A 4KWIA 5A03A 2AE2A 3H9GA 3CKYA 4TKLA 3K6JA 3VAZA 2BLLA 3IQDB 1A7KA 2QW8A 5G0UA 4HKTA 1QYXA 2EWMA 2FP4A 4EUEA 1E1NA 5IFLA 5G4LA 4CM9A 4LMRA 4CQMD 2I65A 1IUKA 3KSZO 3ZHBA 3QWAA 2VYND 3JQFA 3JQAD 1PL7A 4Y98A 3W4IA 3UN1A 2LDBA 2Y1EA 3CTMA 2FPPA 1LSUA 4BKQA 3MOGA 3OQBA 5DBFA 2RCYA 3WWZA 2ZYAA 5JY6A 1D4FA 2P4HX 2H63A 1IB6A 1ISIA 4XGIA 4DYVA 2D59A 2GCGA 2IZZA 1NPTO 1TXGA 3KYCA 4OL9A 1NWHA 1PQUA 3IKVA 3MCVA 1BSVA 1Q7GA 3WQRA 3L6EA 1PSDA 1UXGA 4M87A 4QO7A 2BD0A 4ZQEA 1B8PA 1ADFA 5CFZA 1X7HA 1C0IA 3DBLA 2DAPA 4OSPA 2EEZA 4YYZA 4FPXA 3AOEA 1UAYA 3HFGA 4LSMA 2ZCVA 4YXFA 3CPSA 1EDZA 3QVSA 4NBUA 2PGJA 3NKLA 1SBYA 1UUFA 1YH3A 1R0KA 1EBUA 5EESA 1YKFA 4G81A 3CMMA 4ND3A 4XDYA 4R9RA 4YB8A 3F1KA 1HRDA 2HU2A 2PH3A 1G1AA 2ZATA 2TMDA 1GZ4A 3H65A 4CUZA 2NQTA 3WFIA 1TT5B 3LLSA 1IY8A 4WLNA 2HJSA 4JJGA 4YRBA 3IC5A 3PVZA 4XJTA 1UP4A 4ID9A 4BNWA 3NYWA 1E3IA 3P2OA 1UDCA 5FI5A 4BNFA 1PGNA 2QHXA 3VOSA 3GG2A 5CEEA 3JQBC 3R3JA 4E21A 3WICA 2P4QA 5G0TA 4MVJG 2HMWA 3ICCA 3AUSA 2EXXA 3OJ0A 1HDZA 3AY6A 3CSDA 1VKOA 1XG5A 2X4GA 4YDRA 2BGMA 4GGPA 3TL2A 2X5KO 3LVFO 3B1KA 3JQ9C 3RAJA 1HSZA 3ASUA 3PGXA 2VHWA 4DQUA 3ZWVA 4A26A 3RU9A 5BNIA 2Q50A 3D3WA 4GMFA 2JCYA 3ZCXA 1PGJA 2WE7A 4WNIA 1YQXA 1C0KA 4CM8A 3NDRA 4KUGA 1WZEA 4OJNA 3TRIA 3GDOA 3E82A 1I2BA 5IJZA 3WBBA 1A27A 1I24A 2X7HA 4CPDA 4IJWA 2P5YA 4NBVA 1ZCJA 4FGSA 1GQQA 4OOEA 1I32A 1XWFA 3H5NA 1R15A 1SOVA 1XA0A 2Q1SA 1DFIA 4RQTA 4LCEA 1PJSA 2VHZA 4F6CA 3SX2A 3LC1O 4ALIA 3DOCA 1Z75A 3H3FA 1GTMA 1MX3A 3KEOA 2IDZA 4UVDA 2NU9A 4BKRA 3DXFA 4AJKA 4YT5A 5K6AC 3KLMX 1I0ZA 4GPD1 4MVJH 3F46A 3GK3A 2EKLA 5EQFA 1J49A 3F4LA 4KDEA 1UH5A 5ADHA 1PZGA 2DBVO 2OXIA 1E77A 2P9CA 2G5CA 2G0TA 4MPDA 4WK6A 4YBZA 3VKUA 1HSOA 4CQMB 1P74A 4P22A 3MOIA 4AJLA 2D5CA 4CM1A 5L4NA 2CVOA 3LT0A 2UDPA 1MP0A 3H9EO 5DCWA 4CV1A 1GUZA 3JQAB 3ZU4A 2Q1WA 4RORA 3H9UA 4XR9A 3NJ4A 3F5SA 1LTHR 5EINA 5DBIA 2BKAA 3FPLA 4CMAA 3SJUA 3NUGA 4O0LA 2XF8A 3C7DB 2X1HA 1U5CA 1VSVA 1E7QA 3RJ9A 2DKNA 3D4OA 1KS9A 4JLWA 4W7IA 1VM6A 3FTPA 4MVJE 4PZEA 3AK4A 1B26A 3HE3A 5JS6A 3KLPX 5EIOA 2RH4A 3BMNB 2R2GA 2C2XA 1V3VA 4YEDA 1WPQA 2R00C 4J0EA 4QO8A 2HK9A 5JMPA 3CXRA 5AXDA 5JCJD 1DPGA 5L40A 2VHXA 3EVTA 1EEHA 3NEPX 1P1IA 1Z82A 3EAGA 1NYTA 4OXNA 2AE1A 3CIFA 3P2YA 4FFNA 1KVTA 4NZ9A 4DMLA 2BFAA 4WKGA 1DRUA 4LRTB 4TQGA 4AJ2A 1YOVA 4WLOA 1W73A 3C1TA 3GFBA 1GYQA 3M1LA 4WJZA 1W8DA 4PG7A 4E2XA 1DIGA 5BSFA 3Q9NA 1X13A 3LQFA 1EK5A 1N7HA 3D5TA 1XLTA 3DHEA 4BKUA 5BSHA 4IQ0A 2VYVD 3AM4A 4YRAA 1NQTA 1U3UA 3GZNA 2W2KB 2H5LA 4E4YA 4B4OA 1SAYA 1ISFA 4AJNA 3W4JA 3K73O 4AJ1A 2HJRA 3I83A 4XJSA 3S1LA 4E30A 1B3RA 4J4TA 2JFFA 2HMSA 4P4LA 1I3LA 3ENNA 4CMIB 3HSKA 1C0LA 2WM3A 2DUUA 3GVPA 3K96A 4DBVO 4OSOA 5LDGA 4O63O 5G4KA 2PWZA 3UGKA 1QLHA 1RKXA 5LC1A 1PJBA 1ZXLA 4E32A 4PLVA 3IIEA 4IM7A 1P1KA 2DPGA 3D7LA 5DCYA 4IGFA 4BL5A 1BXKA 2NQ8A 1G0OA 1GL3A 4UULA 4H7PA 1X15A 4EJMA 3PEFA 3RC7A 4HX5A 1FDUA 5LCXA 1P33A 2PGLA 3D5QA 5A3VA 5TX7A 4OKIA 4U6SA 3KM0A 4O1MA 5IDXA 3GVIA 5B4VA 1KVUA 4NBTA 1JAYA 3QVOA 4P4GA 3KUXA 5JSFA 5JXWA 1O94A 4G65A 2Y1GA 1MGOA 1P1FA 1YDWA 3E9QA 3T7EA 5AXAA 4IGEA 2G1UA 4Y6SA 3ORFA 1T4BA 1EVIA 5MDHA 3WQSB 1PJ2A 4F6LA 3SC4A 4GMGA 3ZV3A 1YE3A 1GD1O 2HAEA 2I6TA 2JFGA 4KUEA 3RBVA 3VDQA 4K6FA 1EVYA 5KCZA 1LDBA 4UUMA 3GLQA 3IKTA 1KVSA 1GCUA 1WMAA 1DIRA 1P3DA 1K5HA 1V8BA 2VZ9A 4DTIA 3ENKA 4XR4A 2EGHA 4AL4A 5F5LA 4IDAA 1HWYA 3A4VA 4HY3A 1W0CA 1Z6ZA 3MEQA 2FY8A 3ROMA 1YWGO 4MP6A 4OM8A 3OFSA 4R16A 4JX8A 4BNIA 2WSBA 4BV9A 4TRNA 3WR5A 2ZKLA 1FF9A 3ONDA 2DPHA 5EN4A 3IAHA 1HXHA 4AJOA 2EW2A 3WB9A 4KDFA 2FRDA 2G76A 1ZVMA 3MTJA 3C1OA 1PGPA 5ER6A 3AUAA 1N9GB 1AHIA 2B4TO 3KO8A 1Y6JA 1WAMA 2OP0A 4BV8A 1R16A 4GSLA 3ITKA 5I9NA 3S8MA 3ZWOA 1EBFA 3ONEA 5TC4A 2BGKA 4G2NA 1E3LA 2JCVA 3F6YA 5EPOA 1PS8A 1PIWA 3H9JA 4NPCA 4C7KA 5ES3A 1DO8A 1E7WA 3WYBA 3CZMA 1PJTA 2EIHA 4PGFA 1J0XO 1MFPA 4CM5A 5FEUA 4RV9A 3WMWA 1NVTA 1ONOA 2UUPA 3LT2A 5T8KC 1JVSA 1HYEA 3VDRA 5CEJA 3QWIA 5IXSA 1RWBA 2DFVA 3FWNA 2G17A 5EJ2A 4XQEA 4E6PA 4FDAA 3PZRA 1GAEO 1WWKA 3OBBA 2NVBA 1H6CA 5DZSA 3HFSA 5IDYA 1RM3A 5EERA 2J5RA 3I6IA 2V7PA 1FDVA 2Y1DA 4R4JA 1V0JA 4TSKA 1EK6A 5C3MA 1E0DA 3T4EA 3W4KA 5TF4A 4O59O 9LDTA 5ILGA 4L73A 5GZ6A 4YAKA 4INAA 3C7CB 3WGQA 2C20A 1HDGO 1UZNA 4CQLB 5B1YA 2W2LD 1GY8A 1H2BA 1X14A 2Q1TA 2TMGA 1R4NB 1D1SA 2W8ZA 2D8AA 4MJLA 5BQFA 2E4AA 3U3XA 5A4DA 1X1EA 4XQCA 2D5AA 4CLRB 2Q2QA 3KRTA 3RC9A 4AJPA 1NHWA 5KJ1A 1NVGA 3DC2A 1BMDA 4NR0A 3BMQA 1ARZA 3M2PA 3DBHA 1N7GA 4U8GA 4B4VA 1GUFA 5F3RA 5HS4A 2GDZA 2X5JO 1E7RA 2AQ8A 4IDGA 1YQDA 2I5PO 3X2EA 3UAGA 1R4NA 3AI1A 4KTVE 1MG0A 3JQ7A 1WDLA 2CNBA 1H93A 2FR8A 4BQRA 1M6HA 2BFMA 4I5FA 2Z1MA 2OGUA 3WGGA 1YO6A 1F17A 1I5RA 3BMOA 3M1AA 3JQ8A 3NT5A 4O5OA 5AYVA 3TZQA 4DYDA 1V3TA 1J4AA 2J6IA 4GVLA 5CDYA 5FF9A 1H2HA 4JNKA 4PLWA 3I9LA 2GZ1A 5I7VA 1TT7A 4GH5A 4CV3A 1EFKA 3I4FA 1QYCA 3L9XA 4K9DA 1T2DA 2W98A 3ZDFA 2EP7A 2Y0EA 4D43A 1B8UA 1YS4A 3JSAA 5BSGA 2ZTMA 1QKIA 5L7WA 2E37A 2E6UX 3EMKA 4BNKA 3W6ZA 5JLAA 1Y8RA 2WE8A 2JHFA 4D3SA 2ZYDA 1DRVA 1W4ZA 5KJFA 4LISA 1Y8QA 4QT0A 4R3NA 2XXJA 2VCYA 2UV8A 1E1KA 1PJCA 3B1FA 3GDGA 4LMPA 4B3HA 1JKIA 2BHLA 4NK5A 3WGYA 3CINA 4TZTA 4B7UA 1DOHA 4W4TA 4EJ6A 1JWAB 2IXAA 1UAGA 3EDMA 4ALLA 2RAFA 5KJEA 3QVTA 2IXBA 1HDOA 3DAGA 5IAAA 3DBRA 4BNMA 1TVEA 1WVGA 4R5MA 3GG9A 3JQGB 1WP4A 3VHRA 4ZGWA 3HQ4O 1LQUA 1YBAA 4QX6A 2WD8A 1Y7TA 3KBOA 1XHLA 4XKJA 2A9FA 4FJ0A 3L0DA 5GZ3A 4R1UA 4PLFA 5DULA 4S3MA 5B4TA 3DB2A 4KQWA 1N1GA 2V65A 5IZCA 4BO2A 1PWXA 4GSKA 3FNFA 3VPHA 2VUSA 3KB6A 4XB2A 3HHPA 2NADA 2RH8A 1F12A 5DP1A 3KSDO 4DQVA 1QYDA 1ZK0A 3JQGA 3I3OA 3ITDA 3MJCA 2AHRA 3ZW9A 1E1LA 4JROA 3L4BA 4IBOA 3VH2A 2JD1A 2VT2A 4TZKA 2HMVA 5F5NA 4MKXA 3K5PA 1P77A 1NBOA 3E03A 3ZNPA 5CDTA 2BRUA 4GWKA 4YR9A 2D0IA 4OOFA 4OQZA 4A10A 1EE2A 3IDSA 2NV6A 1OMOA 5L9AA 2O3QA 4HFRA 2YV3A 3INRA 1PGOA 4RPJA 1LC3A 3AUTA 3PP8A 3MJVA 3NRCA 1QXSA 4LSWA 4EUHA 2BH9A 4N18A 1OBFO 1IYZA 3KHUA 3ZWYA 2NTJA 3MWEB 1ISJA 1DIAA 4MINA 1DC3A 1LLUA 4YJHB 2PD4A 5H83A 3LK7A 4K26A 1GZ6A 1UZLA 3WGTA 4D3DA 3ZZNA 5G0WA 3R3SA 2BELA 4XRGA 4R3WA 1SEPA 3U09A 1JDJA 3SVTA 1E6WA 2XAAA 3SC6A 2B4RO 5AXCA 2JFHA 1N8KA 3PRJA 3CH6A 2BFOA 1XKQA 1PGQA 4NU5A 4GLLA 1LX6A 2YHIA 3JD3A 2CVQA 4MO2A 2H6EA 3FSRA 4MP8A 4QQRA 1XELA 3GRKA 3L6DA 4HFJA 4WLEA 2HRZA 3KXDA 1DXYA 3K8ZA 3OJLA 1CQJA 3AW9A 1O8CA 2Y1OA 1PQWA 4XA8A 3VH4A 1DC4A 3LF2A 5CP8A 3UKOA 3FCOA 1E1MA 2ZQZA 3OJFA 3RBZA 3INTA 1G6KA 3GAFA 4J16A 2CFCA 2ET6A 4XQGA 4XWYA 5DDIP 5JO0A 5DOZA 3KEQA 3UH1A 3BHMA 3I6QA 3G3EA 4OXKA 1IOLA 1Q0QA 3FBGA 4BGUA 1E3WA 2YDYA 3JYLA 1MUUA 1P44A 4II3A 4LGVA 3TOZA 1F14A 5B37A 1ZK1A 2FHSA 2VZ8A 3PI7A 3O26A 3IJRA 2HRBA 4DGSA 2OBNA 2CVZA 4YQZA 5C7OO 3BAZA 3Q6IA 2UUOA 2ZQYA 3WIEA 1ZNQO 4CMJA 1JWBB 1KEUA 3RKUA 3JYOA 1Q1NA 4FFLA 4YAJA 1ID1A 1ULUA 1Q0LA 3E5RA 3D0OA 2PH5A 3GFGA 5BR7A 4GBJA 5IN5A 1JLLA 3QRWA 4MOWA 3OHSX 4FFRA 1TLTA 2PGDA 3H4VA 4NIMA 4RLHA 5B12A 5GZ1A 3C85A 4RPHA 4XYMA 3VC7A 2I66A 3ZNOA 5KWEA 2CZCA 3KYCB 4CLDA 4ND5A 2YHUA 5JNLA 4DIFA 4XB1A 3WS7A 2V6BA 1KIFA 5I9MA 3NT2A 1I3MA 1F06A 4QTZA 4FBGA 1V6AA 3UXYA 1SOWA 3T4XA 1EUDA 2NNLD 3COSA 4KWHA 2JD0A 2EJVA 2NSDA 3DBLB 3DTTA 3LT1A 3PHLA 1KEPA 3AY3A 2OP1A 3VTFA 1ZKMA 4ZD6A 1R0LA 3QE3A 4I9UA 1IHYA 1BRMA 3FF4A 5BT9A 4TMFA 2OORA 3RSHA 3ZU2A 4WEQA 4S1VA 1I10A 2WD7A 1YGYA 4XYGA 3JQBA 5IF3A 4TVOA 3UICA 2GR9A 4P4NA 3VPSA 2X0JA 4BNZA 5A5EA 2J3HA 1ULSA 5HBRA 3WOHA 4BNHA 3PDUA 3L77A 1GV0A 4AICA 2D3TA 1BTOA 4I5GA 1HE3A 3K2EA 2HSDA 2HQ1A 2PKRA 2O2YA 3OA0A 4D0SA 4YA6A 4PRLA 1JN0A 3G1TA 5H82A 4GKBA 1WMBA 1Y81A 2YDXA 3IP1A 4J9UE 3OQ1A 4ALMA 3EGOA 3WMXA 3AWDA 1Q0HA 4W9NA 3OEYA
chains in the Genus database with same CATH superfamily
4AO6A 3EQ6A 1M6WA 2REXB 2CJPA 3KLNA 3PYMA 5FXMA 5JAMA 2YUIA 2ZVJA 2FPMA 1XQVA 2XVAA 1MC4A 1KBZA 1JH8A 2LDXA 2MMCA 1MU0A 1AN0A 5ENDA 3LY8A 4MS4B 4YONB 5J3JA 3STYA 1AUVA 3LX8A 4BO9A 5FOWA 2JLZA 2WSSA 1GIAA 3PDCA 3AY0A 4YYEA 2NUTB 4J1SA 4L0DA 4ZPJA 2CLMB 2ST1A 1JHYA 2YBEA 3UJAA 2D7JA 1NQVA 3ZKWB 1NRJB 4MQMA 3UGTA 4BLTA 2RHGB 3H0CA 3MJRA 1J2RA 2XT9A 1SB8A 2B0CA 3BIOA 1EFVA 3A1DA 3TKAA 3MS2A 3W2GA 5IBPA 2IF0A 3HCRA 4O08A 1RAIA 2YHAA 1DOZA 4EDFA 1VE9A 3CF4G 4YJ3A 1QCZA 3FD8A 4A6DA 4CE6A 3H13A 1QV6A 1OKKD 5KNDD 1R6BX 5K09A 2CLFB 2G4VA 5AOAA 2C5AA 1OX5A 5DYTA 2IEIA 3R9WA 1JFLA 2FWMX 2CNWD 2RIRA 4UJ3A 4IX9A 3E23A 4HATA 4GYJA 2A33A 1K6XA 3EWIA 1I2ZA 4ZT4A 1DEHA 2WMNB 3CVJA 4DUGD 4XDZA 3WYEA 1U3TA 2F43A 4Z3DA 2X0IA 1YAJA 2B6HA 3ZWCA 5JSZB 2CXRA 2OXCA 2W4MA 5FTWA 2QR3A 4EA7A 3L8YA 4X8MA 5FR2A 3HN6A 4REQB 4YASA 5B3AA 2A9KA 2H9AA 1NW8A 3D3KA 3WDSA 4O2LA 2P2SA 4PYRA 5J1SB 3EEYA 4WY8A 3JS5A 4HWPA 5CDUA 1FP1D 1D03A 2Q4RA 4OBXA 1W4BA 2O07A 3ZY6A 4C6TA 3RCBA 3RFTA 4UAJA 3RS3A 5CAEA 1UMCA 2R5WA 1EFPB 1U31A 1YUBA 1R8SA 3ZX4A 2C4KA 3TFQA 4TTTS 1XZLA 4MROA 5BN5B 5HK8A 1LFDB 1WS6A 3LS2A 1TZCA 1MJGM 4MVJM 1XL1A 3E4DA 4EB6B 4R71A 4RPIA 5DFAA 2OM6A 1GXSB 1Z62A 3B3JA 4L4XA 1NXTA 4AP5A 4AZVA 2AG6A 2PBRA 1G20E 3EGXB 3J7TA 4N54A 1UAAA 4L0CA 5GM1A 4EFLA 3SZOA 1X3SA 1Z7GA 1KP2A 5EHGA 2PRJA 3ZDCA 2H1WA 3H7AA 1LC0A 1QRAA 2O7RA 5M7EA 4BWGA 3OIDA 3NS7A 1ESZA 1UDAA 2JFVA 1DJQA 2QYHA 3A8TA 5THKA 1T3SA 3SOZA 4KG7A 2BBWA 1PT8A 4F2GA 1GPAA 2BE9A 4YCSA 5JISA 4QDKA 1GARA 3AP1A 1XLUA 1KYVA 4HEA1 4WRRA 4C08A 1N75A 1QQ6A 4WXYB 2WTXA 1BX0A 1KEKA 2O2CA 4YAEA 2GN2A 2OD2A 1PJAA 2JEYA 1H6AA 3KBBA 4M76B 2HM7A 4QPZA 3I73A 5G1NA 3I5AA 4KJZA 4QOEA 1DAEA 2WG2A 4Q82A 1VRVA 4OQDA 4P9NA 4MQBA 4QXPA 4AJ9A 4YHHB 2FDCA 4AY6A 5E2IA 1Q0ZA 3KPVA 2VP9A 3K4HA 5EIBD 3HY6A 4QREA 2FUKA 1D9XA 4DCGA 1HLFA 2PGAA 2HIAA 1CZRA 3CLKA 5SYNA 3LM8A 4PS0A 3EFHA 3ODPA 3BOSA 3CUTA 3HDHA 6GPBA 2WJZB 2WU3A 1F2UB 3PC8C 2R6ZA 3JVEA 3PRYA 5IVDA 3RHZA 3CGWA 3ZHTA 3TLMA 3F7NA 5CHEA 5IVIA 5JJCA 1OAAA 4HQKA 5JH7A 1SXQA 3OUZA 2JZOA 4GOJA 3OZEA 4B8YA 4UTPA 1XCLA 1H1LA 3VAAA 2B34A 4I1IA 4L15A 5K3FA 3MWJA 4ZCLA 4NFSA 2JIDA 1XC7A 2XJ9A 3B1JA 1N34B 2IE8A 1ETHA 1ZJ4A 4LZZA 2J7PD 3O8QA 5T6BA 3GZNB 3VNVA 2C9CA 1EAMA 1E2FA 2NVOA 2Q8NA 4D0NA 4LMBA 4R8SA 2WF5A 2GZDA 3CW8X 2BDTA 3NFRA 5DCUA 2Q7OE 4FQ7A 4WQMA 2Z9DA 1SVSA 2ALJA 3BXPA 3G1UA 1RRGA 3ADCA 4BNVA 3LDGA 2WFZA 1W5FA 3FLEA 2PLFA 1YRYE 3N75A 3MRSA 4IZIA 3V46A 3DDNA 3MZ0A 1T0JB 4DWVA 1CIVA 1U0OC 2WJAA 3H5VA 4D4JA 4IS3A 3OCZA 2RH5A 4KWEA 3RRFA 4Q3BA 1IM2A 3PWZA 4S04A 5K0NA 3MB5A 4G8JA 3B3GA 3HKEA 3KB2A 5EWLB 1P29A 3FHJA 4WZAA 1E5DA 5F2OA 2PA3A 4FMBB 1KL7A 3OPVA 1K27A 3B53X 3PD1A 1NP3A 4EX6A 1K1EA 2XUGA 3HB9A 2VOEA 1RXIA 3GPDG 1XR3A 3WLFA 2OWEA 1H85A 1VJ0A 3OCCA 3AI2A 1M66A 3A05A 4CMCA 4EHFA 4KHPB 1XCBA 2D13A 1KDZA 3BSYA 1T5BA 2E55A 4QBGB 2ZI5A 3LLMA 3EVNA 4NJMA 1BXGA 2GYYA 4R8KA 1ZFNA 4Z3KA 3HZHA 1GCIA 1ZM9A 4HZGA 4YP5A 4B81A 4IICA 5J40A 4EF6A 5A6VA 2J5BA 3H19A 4M60A 1L7NA 4B2YA 1JT9A 1W0KA 3DKIA 5JXGA 1WB9A 1K4YA 2ZEJA 4JXZA 1FS6A 1GQOA 2MMGA 3L7KA 2VATA 3NAGA 4Y67A 2I4OA 1G7RA 4MRSA 4RV4A 4ZQCB 3WLEA 3TLCA 2FSPA 3VFDA 3VPFA 2B8EA 5HCIA 1XTIA 1I51A 2GBCA 4ZYZA 5BR8B 4NNJA 1EUCA 4RESA 4CRWB 1ZQ9A 2AIRA 1UKEA 4HNSA 4P98A 1B6GA 1H4VB 6NULA 4M9UA 4X1KB 2R0QC 3BKXA 2MR6A 2ZR9A 3DTNA 1VG8A 4NHOA 3O8CA 1A9YA 1F4LA 3QSYA 1M8PA 2FFAA 3JQCA 3QY0A 3CB4A 1JFSA 2H7CA 4FU0A 4LJ6A 4TQUS 1MXHA 1TB4A 3ZLUA 5BNTA 4DIUA 3OE1A 5TGTA 2AEMA 3JRWA 3M2TA 3ORHA 3K7EA 5AKYA 4IHAA 5LD2C 3O9MA 3QFTA 2VWGA 3U17A 5BSWA 4FMCF 4NJEB 2ZTUA 2QUBA 1SXJB 1T10A 3W8RA 1U02A 1SBCA 3MMNA 4MUAA 2WSIA 3HXOA 2P11A 1OWMA 3M9XA 3NBUA 4L3OA 4QUAA 4XEHA 5HFNA 4CQNA 2B1JA 4KRXA 1T4DA 1FQOA 4HH0A 2GK4A 3W1VA 1ND6A 5ABPA 5DTEA 4LJKA 1YFLA 4DV2B 2VJCA 4DREA 2AFIA 4NBRA 1MC5A 1ZX1A 1VJ1A 3N70A 4FOTA 2C7RA 4WLVA 1YS6A 1Z4MA 2AW5A 3N2NA 4ESOA 4N5LA 5E95A 2QLNA 4YP7A 4N5MA 5HJ5A 3E2MA 2Q3CA 5HE9A 5DRTA 3AETA 3BL5A 3FCUB 3VX4A 3FZQA 4AMGA 1X1RA 1W4LA 2BTEA 2CNLA 3HR8A 1QKJA 1FYVA 4JUFA 4BUCA 1BRTA 2FU5C 4OUDB 3VR5H 3THXB 3I04M 3PQ7A 4OKNA 4TTJA 3S2IA 3R4CA 1FRZA 3OECA 4XRRA 3EG5A 4HH4A 4MKGA 4OCZA 4QARA 2A14A 5HJ2A 5BUCA 2GNOA 3DVLA 4LJSA 1DIOB 3DB1A 1BYIA 1R5OA 2KMLA 1CFJA 3DXZA 3MW8A 4J0JA 3PENA 2KM1A 4EIWA 4KE9A 4DSTA 1PQ4A 2O2GA 1DHRA 4S24A 2JFYA 1QM5A 1SHZA 3CWQA 1DG3A 3KSUA 3OU6A 3OZTA 4RCVA 2W2PA 4P7FA 3HCCA 1MOSA 1IPFA 1DAMA 2WM2A 4LEIA 4F3YA 4Z51A 2IW3A 5KOHB 3BEOA 1IWPB 2HU5A 1Z12A 1I5OA 3DONA 1VRCA 1II9A 1LI4A 2DPLA 2IU3A 2V9PA 3P0FA 3PUIA 4BE4A 5BNZA 4B3CA 4OIFA 2W93A 2Q6VA 3SX0A 4AWAA 3Q72A 4D9EA 3TL6A 4P3YA 4KXYA 1Z08A 1JAXA 7REQB 2XZOA 3KXPA 4F21A 1C9DB 2I2XB 3LUHA 1YACA 3ZWWA 3W8DA 3K0KA 2IVZA 1HDXA 1FDSA 1CWUA 2Q0HA 3IEIA 2TS1A 5LP1A 1N5KA 2AOXA 3F2IA 3LYAA 1F7UA 4D42A 2H1SA 5JH7F 2IYEA 3KQQA 4FZVA 3FVRA 4MMXB 5BV7A 5GIOE 3HBMA 4JUCA 4RF3A 1LXCA 3TRHA 4ZCPA 3ORSA 4BU1A 5K3OA 5IKPA 2ZVDA 1TIBA 2O2EA 2V8BA 4MUBA 2V4UA 3K31A 3Q5GA 4LA4A 4IJKA 1QB8A 3KVNA 3NO4A 3QPAA 4N5HX 3K0AB 4XZ3A 1I0IA 3VU0A 4TTVA 5HA5A 2UYHA 3WP1B 3MJ4A 1QX3A 5ECGC 3RV4A 5KTSA 3C3DA 4HWOA 2ZRIA 2O7QA 4NBLA 4YN3A 1KVRA 1KMHB 2P2YA 5FO1A 4B73A 2YVKA 3KR2A 3AXSA 4UU0A 3SVZA 5FCDA 3AJ9A 2XGSA 3DBHB 5CDFA 1J24A 2X0EA 1YS9A 4MJ3A 2MYUA 4RD6A 1Y5MA 4KQFA 5EG5A 4QKQA 4E0BA 2W2QA 3BWVA 4UAUA 2J1LA 4Q7LA 5IAGA 2LBPA 1BMQA 1SHUX 2HXSA 1UR5A 2GO7A 3B2NA 1W7AA 3D6UA 1RYYA 1E18A 2QTTA 3MXTA 4DLWA 4LF7B 3K6KA 3O9VA 1BWQA 1PHPA 3L6OO 1NBAA 1P2BA 2VDKB 4MXDA 3TRJA 3DEZA 4DR5B 1RRMA 2F9FA 3QM1A 4M0FA 3WYFA 1E4YA 1GITA 3PUKA 5FTLA 2UXBB 2PWBA 1H9BA 1PTJA 3DQPA 3L7YA 5BMVA 3G89A 1WXXA 3GVCA 3GRZA 5DISB 2QJTA 3PFKA 1D2EA 4W5QA 4IXTA 4MDYA 4FSXA 1Z45A 2CXOA 4AZ3B 5DBOA 3SN6A 4B09A 3Q85A 1LK5A 4A0SA 5BSTA 2ZUTA 2AG0A 1L5HB 2RGNC 4FYYA 3W6NA 1KI6A 1GR0A 2WYIA 3PV0A 3C97A 2HUNA 5T67A 2ZSHA 2V1UA 3EPHA 4V39A 3EB9A 3D64A 2O8VA 3I39X 4Z7JA 2F1JA 1N2XA 2GUGA 4E3WA 3NOXA 4J3JA 2IOFA 1UINA 2HMUA 2XKJE 3PWSA 1HTTA 4F9TA 3S8EA 3VTZA 4RVUA 1NN3A 2R8OA 4Q4LA 2YWRA 1ZCBA 1M0WA 1D4OA 2FUG1 1BGXT 1X7ZA 3O83A 3OTIA 4ZRMA 3F6RA 3F1LA 4D97A 4D6XA 4PHCA 4Z3OA 4OBWA 4BO0A 4DLPA 3D54D 2GFHA 5KAPA 3PNOA 3UAXA 1DUVG 2QLTA 1U3WA 1VHTA 2YR0A 4EKIA 3G8BA 4A8PA 5C51B 1GPDG 1Z2NX 3FM9A 3A6HA 3ZWOA 2ECQA 1KWGA 3FUUA 2J3MA 4BNUA 2HWUA 2JKYA 4E5SA 1YJBA 2O23A 3KAPA 3IUBA 2VQFB 3D1LA 3G0HA 1R1DA 4GMHA 4O25A 1KA9H 1A71A 1LW6E 2QDKA 4AC9A 4BU0A 4C05A 2YHBA 3BF8A 4EPWA 3BMCB 1CUIA 4NS4A 5AVVA 1H5QA 2C2OA 1WDKA 2Q45A 3N2GA 3QFFA 2X0RA 2YKGA 4P92A 4GXTA 4TLEA 2DERA 4MR7B 4IUCS 3CRMA 4OO3A 3P45A 3OPMA 3HXKA 4S1NA 3KYBA 4KIFA 2JGJA 3KS9A 3E6AA 3UAVA 3HJNA 4R1SA 1J00A 2NVWA 1FTYA 3A28A 3Q0EA 4IRMA 1ZVVA 2O2ZA 4V24A 1AO3A 4Q6WA 3MWDA 5DHQA 4L2IB 1JJAA 1MJ5A 1R18A 1JHMA 1S0UA 3ACBA 1MB9A 5TSDA 4ZJYA 2XLBA 1ZH6A 1RWQA 1RZRA 5AKXA 1DJNA 4GYWA 3ST7A 1E2LA 1U8UA 1YRBA 2UUAB 4MQLA 3EULA 4IWYA 2PV7A 3IPXA 2JFUA 2ZB8A 4OY3A 2P6UA 1KAHA 2I76A 2Y0CA 2PMDA 3D8TA 2R3SA 3E4CA 2D2EA 3GYGA 3OZRA 3QUQA 3TUJC 4GEKA 2Q21A 1AQLA 1G38A 5G02A 1EMDA 2LIVA 3GUCA 1L5QA 5LP6A 1H0SA 2NVUA 1UKVY 1E1RD 2PYZA 5KI6A 5BUQA 3VR2D 5C37A 1CUGA 1MJNA 4QGHA 2J09A 3MS7A 1U0FA 4QOIA 4B74A 5FA6A 2WABA 1EA7A 1EZ4A 1OIWA 2FCRA 2NTVA 2O6LA 3B6KA 3DL0A 3HZZA 4G1EB 4IOLA 4YRRA 1FFXB 5GOTA 5L95A 2O8CB 4L7VA 2ZS8A 2C61A 1Q44A 3KCQA 2CL6X 4PNZA 1K06A 2XITA 4ZREA 3F9RA 1Y1RA 3ZWXA 4CLEA 2WQZA 3RODA 5EQTA 3SS9X 4TYWA 4TMYA 2ORVA 4Q7QA 2NXWA 1E1CA 2F3TA 3ICPA 5BWBA 2IYQA 1YBFA 2C54A 1A69A 1ELOA 2WSSD 3ELYA 5E9JA 2B2CA 2ZJ7A 3EFBA 4CMHA 5I8WA 1R4MA 5EIXA 1WPXA 3NKVA 1E69A 3TE6A 4C01A 4HXGA 1K7YA 1H42A 3CA8A 3RPEA 1GRRA 3M0EA 3U4IA 4KACA 3WI7A 3U19A 1B4DA 3WNQA 1E9RA 2Y9PB 4FONA 1XEWY 3RUDA 4B8WA 3WGHA 2DBRA 4UDXX 2IX9A 1I7QB 5K0CA 1JDBC 4IIDA 1II8B 1Y37A 1TZ2A 2OLEA 3QGMA 4FLMA 1MZPA 1PRYA 1N78A 2GJSA 4F2DA 1QQ5A 4CLOB 2BFDB 2YHIB 1N2JA 5DI3A 1ZP6A 3ICQB 5KAMA 2Q1UA 1NNI1 5FA8A 1H1TA 1N6HA 4ARBA 1JHVA 5L51A 3TD9A 4MB0A 1NVEA 1H2FA 4BMVA 2Z6AA 3A10A 1OOEA 2VP4A 3H97A 5CBPB 3H9QA 1Q0RA 2PZBA 2OEPA 1ADJA 3PA8A 2J3KA 5HRUA 2PLNA 1JFFB 1Q3HA 1M76A 3MINA 4LWPA 1GG5A 2XLCA 4NZMA 1U0EA 1R0CA 2HK6A 2YXBA 3PG5A 4EEZA 2GBPA 2XCQA 2ZIUB 2ZAMA 2ZRQA 2JG3A 1HNNA 1DXOA 2HA3A 1KY5A 5FUVA 1YB1A 1LFAA 4OH1A 1T29A 2YYZA 1G42A 4MS3B 5ALOA 2H29A 4G01B 4MUHA 3WB1A 3ZK8A 4DPMA 1WG8A 2PSSA 5GMOA 5AKKA 1SU7A 3KNZA 1TQ2A 2VF4X 2DBZA 1SGWA 2B0JA 3AQIA 4KKXB 4ZV9A 5C31A 2DB3A 1DARA 1E92A 1TM4E 2Q9CA 3PNQA 3RTEA 3GT0A 3L8FA 3LLVA 4ILKA 3ESCA 1ZR2A 5T3UA 4FNAA 3EDCA 1R37A 3SXPA 2C1EA 3HXQA 2O8BB 2NTEA 5JAOA 1X8LA 2PLRA 2XH8A 1J1UA 4EJSA 2H16A 2PVPA 4A6PA 3I0NA 4CKCB 5JAHA 3PGJA 3W5DA 1IDN1 1XAIA 1Z7EA 1TFRA 2NLOA 4K8RB 5FUWA 1FFYA 4FFVA 3SJ7A 4E12A 2XVYA 1XMSA 3G9UA 4HH1A 1UZAA 1XZFA 3ZE8A 3ZVMA 2AZTA 1NVVQ 4HN9A 1ZEMA 4QQKA 5JTTA 1X1TA 1K8ZB 1GTRA 2V4ZA 1WXEA 1T0PA 1WHTA 1XXHA 3GGPA 2VUUA 3L7NA 4UBIA 4B6OA 3IL2A 3NC0C 3PPWA 1C7JA 1FLVA 2CCGA 1DV1A 2X6TA 1YRAA 3H5WA 4UUBA 3HEMA 4FX2A 4A0QA 2CUTA 2IITA 3KFVA 4OHKA 2F00A 1U1GA 4F84A 3AEYA 1SK9A 3RIXA 3P8ZA 1S89A 5IVPA 1GKUB 2OR3A 3KJEA 3QOXA 2C9DA 1PV4A 2JI4A 3QVWA 4ZGBA 3WWCA 1J56A 5AM2A 4C2BA 4RTKA 4FJ2A 3IURA 3K9FC 3TN7A 1AK1A 1DINA 3D81A 2ZSEA 4BZPA 3EQ7A 2X9NA 1BEEA 3C3KA 4JLUA 1Y4AE 1K8QA 4RGYA 4Z9YA 3BWMA 1G3MA 2W6PA 3JD2A 1ZGAA 2AOUA 4KQCA 4OXQA 3BSWA 4DXHA 2ZBPA 4FFDA 4F8YA 2YN0A 3PDIB 3W3ZB 3QVXA 4GAEA 4J7XA 3KUUA 2VK4A 1SCUB 3OUUA 5IWAB 2W6QA 3D0RA 4Y6OA 1I4OA 4RPKA 1CY6A 4LNHA 2XPCA 3MCAA 3SIPA 4ZYTA 4OAQA 1QE0A 2ZSKA 5JE8A 4DDKA 2H07A 4W6ZA 2WIDA 3CZCA 2NU7A 3WA7A 3LBHA 4KAFA 5ALMA 3Q10A 5CT6A 2O5RA 3TLBA 4TWAA 1B16A 4BAGA 1KO8A 2V03A 4HH3C 4JI3B 3EJ6A 1D2AA 3L7OA 4Z8XA 4J16C 1DBQA 1QO7A 4G5FA 2RHBA 1BWRA 1L6IA 2AFHB 2CLDX 4KGVA 5LNK6 2ACEA 1AV6A 3AGPA 1UP6A 5EWMA 2A9QA 1OX4A 1MFZA 3FCAA 3WL6A 1N2SA 2W43A 2NYRA 3AUJB 3DFMA 1Q7EA 4FKZA 4JSYA 4RADA 4Z9XA 2F9LA 4PWYA 4Z0HO 3AB3A 1T5OA 1MAVA 1U9ZA 3DMTC 3RVJA 4LFBB 3PQ3A 3ECCA 1Q84A 4AVYA 5A0TA 1NT2A 4PSAA 1S7CA 3EFEA 3W9BA 1CEEA 2YS6A 1XNRB 1EDDA 3IP5A 3UW3A 2XE6A 1TLFA 2CCKA 4G36A 2VWQA 2XMDA 4FLEA 1GHTA 2NU8A 4CEJA 3FWPA 5U1PA 2E4WA 2JIMA 2QRMA 2ZANA 3A6LA 3EZ9A 3L6RA 4W1RA 5CX1A 4B7XA 4X85A 3IV7A 1ORTA 2J6BA 1RRCA 4LBWA 3LGAA 4YP0A 3ONFA 4A8TA 4CTKA 8GPBA 3MTIA 1PJZA 1W0KD 4R2LA 5GVSA 3C87A 1E60A 3Q41A 2Z58A 2AUMA 1RXYA 3F8WA 4G0YA 1YR6A 2C2YA 2WHPB 1DOAA 4TRRA 1NWCA 2ZT7A 5F52A 3ZCTA 1SQ6A 4I4TB 4AIRA 1R9GA 4NXMB 5T4HA 4HMOA 2BYTA 2XTNA 4X7PA 1PX0A 3Q12A 4RSGA 1JG1A 1ULZA 2W48A 4OPMA 2JCBA 1EGVB 2GEBA 1WDMA 3VR3A 2WF9A 2GAFA 2ZIZA 1SHTX 2QRKA 1Z2AA 1OC4A 1BN6A 3Q7IA 5IAKA 1MAUA 3T5MA 3LCVB 1MPXA 1ZMTA 3NH9A 5FWNA 4KR7A 2HU7A 1ZY2A 4PQYA 5F77A 3FH0A 3STWA 2CB9A 2EJUA 3EXHC 3F6CA 4YUAA 2QX4A 2DR0A 2CDCA 1CUVA 3GIWA 4K6CA 4R1TA 4MWOA 5CYFA 5FV4A 1IXKA 1KI1A 3BD7A 3DUFA 2M2IA 1NQXA 4MR8B 1F3LA 4Y2YA 4YMWA 4UNQA 1AURA 1IEQA 2HJWA 3U3JA 3PUXA 2PVSA 4M83A 4KV9A 1TI7A 2J4FA 2XNDA 3DG9A 3V4OA 4BNJA 5K9ZA 2XKKA 3RJ5A 1C4XA 5IX8A 3GNQA 4K5QA 1JIXA 4P5EA 5C5IA 3CH4B 2OGSA 1JMKC 4NG5A 4TL8A 1O97C 2CD9A 4YT8A 3NZEA 1MH9A 4PV7A 1UPAA 2VDMB 4IGAA 4CFYA 1LRJA 3TTWA 1R0SA 2ASVA 3GEMA 2JAOA 3NDIA 4INJA 3WWOA 1G20A 2WMDA 2H4FA 2QP4A 1GL6A 4IILA 4YFYA 2J0SA 5C8YA 1L2TA 4K2HA 1SULA 2VTEA 3AOEC 2GZ3A 3PC8A 2QT1A 3QKIA 3R9KA 1AZTA 1ZH4A 3C3MA 3T5DA 1JHUA 1RPAA 4DG9A 3OY7A 3LY7A 3LDAA 1QHHB 1TYDE 3PLNA 2QGZA 2R1ZA 2VNAA 1TJYA 3Q2OA 1E2HA 2E89A 2ZRKA 3B51X 2QT0A 2R7LA 3P9NA 3G59A 4MV0A 4UMFA 3UA4A 3WHKA 3TSCA 1FCJA 3SYTA 3A9VA 3IMCA 3RD5A 4AG5A 1D7OA 1ENPA 1FSSA 4U0KA 2HDOA 1VL2A 3HG7A 1LLCA 2VJQA 4L4SA 4U9HS 4F9EA 4RDXA 3A6KA 2NX2A 3VO8A 1I36A 4AO8A 3QU4A 3M6AA 1F8XA 4WBNB 3MK31 2QNIA 4GPTA 4QBKA 3NMUF 5BPFA 3M5DA 1HFWA 1N0UA 1G7SA 1RLTA 2GN8A 4J1NA 5DNDA 3VHXA 2DTDA 1R8QA 2FRXA 2X9VA 4BOYA 3NOOA 2YRXA 3O2NA 4C7JA 3A1VA 2N9UA 3B9BA 3P9SA 3P9RA 4NV3A 3RW9A 5C8VA 1OJLA 1VPDA 4BV2A 1PG5A 1RS0A 1TM2A 1QR6A 4J7CA 2QS9A 1IVNA 2XNKA 2O3TA 5K1ZA 1CY8A 4YHBA 4IDFA 3E5NA 2TYSB 3UJ9A 5C32A 1VMDA 3D8UA 4D25A 4NQZA 4HV4A 4BLWA 1VL0A 3OE5A 4EO9A 2HH9A 3L7DA 3PA6A 3LSYA 1SUDA 1UADA 1GKYA 3THOA 1Z29A 4G1FA 4Y9RA 4NE7A 4PZUA 4KPUB 2ZTSA 3CGGA 4TQAA 1ZNYA 3BFJA 3OEWA 3I12A 4H1HA 2OYRA 1PJ3A 2WV7A 1ZK3A 3FZGA 4KNWA 1U9IC 2I67A 3TR0A 4CTJA 2ZJYA 1Z16A 1QPGA 2G9VA 4URUR 1AGPA 2X0NA 5TJHA 3NKFA 4YWJA 4Y1RA 2WIAA 3CRNA 2VHEA 3DR3A 3AHJA 4KEAA 5E1BA 1UBRS 3JZDA 1U0TA 4L4YA 3RGGA 3PYXA 3RYIA 4RTPA 2HXGA 4MHSA 1GPMA 1UKZA 2XMSA 1KO7A 5NLLA 7ABPA 4NHEA 2FWAA 5ESWA 3NVMB 1JKFA 4EPXA 4O4HA 3THWA 1E4EA 3PLRA 4ZZ3A 4X60A 1Z74A 3AB8A 3MUFA 5ILOA 4R5HA 3BD8A 1MX9A 2WB4A 1B6TA 2VYNA 1KYQA 1SHKA 1U1DA 3O8BA 3E5HA 1KH2A 1M1YB 2C3MA 1RSZA 5E4JA 2GCOB 5B1HA 1SPBS 2A6PA 5CH5A 2QPAA 2H2HA 2I7CA 3AEUA 3NJRA 3R7DA 4C4AA 5I7EA 3V4LA 2ODEA 3BULA 4DCNA 4TTPA 3DE1X 3MMZA 1VMKA 4MR9A 1NASA 3DL2A 5EMNA 3UO8B 4G0ZA 3V8VA 1I7DA 1JEDA 3C4VA 3KJZA 5KNBD 4M9RA 1FS4A 5ITZA 3FVTA 5D3MA 2P3QA 3CKLA 2PA0A 5AJYA 5G0SA 5DIZA 2HV9A 2F55A 4ALNA 3GUUA 2H4WA 4H4CA 4A73A 4MVYA 4DPKA 5ITVA 3HR4A 1EP9A 1EWTA 1WKBA 4Q48A 1U7DA 4I1VA 1NW6A 3P2IA 4GO1A 2X2EA 2WWHA 5IK2A 5I7WA 4OFXA 3WA6A 2H18A 2YFKA 1Q5PA 1WU8A 1BFKA 2YJZA 2PRSA 3ADPA 4MYTA 4CF7A 1L1FA 3U60B 1U5BB 2O20A 5FBRB 2C9BA 5AOVA 4TXJA 3UV6A 5I4IA 5AI4A 5DK4A 5HIJA 2HW8A 1AHHA 1GFZA 5BRAA 1RIFA 3MLAA 3R8FA 4J75A 4L9WA 3RUCA 4NCNA 2EJWA 5A6SA 4QLBA 4G1MB 4HMQA 4HWGA 4RGVA 1HDIA 2CZGA 1CUYA 4F9FA 5JQGA 3ORYA 2JIQA 1HE4A 4KO3S 4FSHA 1MV8A 1QG6A 1Y0BA 3JCZA 4RK1A 3R2JA 5IRCD 5BWNA 4GD3Q 2DHRA 1W9HA 4HDKB 4PTYA 1N6OA 2OGZA 1GUDA 3L79A 2IXGA 2PQ0A 4M1SA 3T1VA 3V4SA 3WAKA 1YTUA 5KNDH 3EAFA 2OTCA 1ZSVA 1XWWA 2PYDA 3P7MA 1LZLA 1QV9A 4P08A 4F7WA 2ZT5A 3C3XA 2QORA 3NB0A 1M83A 3TMYA 4NYJQ 2VQ3A 3D5EA 3DWIA 1T26A 2YXEA 3HP7A 3U49A 1VLQA 3ND8A 1QZXA 5JDIC 1XIVA 1DX4A 3QEMA 3WL5A 4YT2A 1M0EA 4Z1OA 3IMEA 4XEUA 5AHKA 1I33A 3QLVC 1WHSA 4EB6A 5TVGA 4J1TC 2H2AA 4UM9B 2FMTA 3BHNA 3JYNA 1FJ2A 4AXBA 1FB5A 3V7UA 4N5NA 3UKJA 2QN2A 3I2JA 3LO8A 2P1RA 2C5FA 3L0SA 2XI4A 2H4XA 2ZITA 4PLTA 3TZ6A 5C8YF 2B7LA 5CB8A 2O1EA 2XXAA 1RZRD 2J45A 4UEOA 5D51S 3T3DA 4P0PB 3I2HA 1LTKA 3N0XA 3Q98A 3FF1A 1FDTA 3WWPA 3AWIA 1C5KA 4MRVA 1FS5A 4BXOB 4RF5A 2A9PA 5I9SA 4OB8A 4QODA 1ONBA 4GOLD 5EE1A 1KYWA 4D46A 1EP1B 1EX7A 1CCWA 2WDPA 3GHYA 5K7SA 3Q7EA 3I5XA 1LPNA 1QLJA 2QJOA 2O9JA 1HDYA 2ZSJA 3ICOA 2FN9A 4M9CA 4PZCA 3VU3A 2ZUWA 1GFWA 2GEVA 3GH3A 2HWYA 5DP2A 2Q46A 3RT1A 1YQTA 2ZDQA 1FFHA 3AVVA 3M33A 3EH2A 1UZMA 3RK0A 3RV3A 5BURA 4CF6A 1UC5B 3HB5X 2G40A 1GADO 1KU0A 3JQDA 1K08A 4JXKA 1J0AA 1XU4A 4WI1A 2JLYA 1ZPDA 2PMFA 1IOVA 1THTA 2HSZA 2WKPA 3DVAA 2ZTLA 4X1OA 5E7IA 4BN5A 1JIQA 2YOHA 2Z2JA 1UMBB 3U3MA 1W34A 1Y4ZA 5JVDA 2DTEA 2JH9A 2XB4A 5E3HA 4MVJF 1PD1A 2EW8A 1SU8A 4K9NA 4LRUA 1G8SA 4UNPA 1VBMA 3AM5A 2FUNB 3I04A 4K9QA 4ND8B 2CYAA 2IKSA 4HPWA 4DB2A 2AC4A 3UG7A 5KYUA 2OSBA 3SQNA 2R6DA 2I7DA 1JR3E 3GVXA 4AM8A 1GU1A 1PAUA 2PWAA 2RI1A 2YY7A 3GA7A 2R8EA 1AUXA 3BJZA 1Z6PA 3SYLA 1YU6A 4I5EA 1CF2O 3G2QA 3HP4A 3NJ8A 4RANA 1G18A 3GLFB 1MOPA 3C45A 4TVSA 3ESYA 1PT9A 5KIAA 2X23A 1N1MA 3TCNA 2D7CA 1CUBA 4MLZA 3NDJA 3GLGB 3F74A 1EVLA 2HK7A 2BFPA 3U7QB 1Y3IA 3AF2A 2BI4A 3W2IA 4CDMA 3DSRA 5D3QA 5KSYA 1LF5A 1IJBA 2GM5A 2K7ZA 2GPBA 3S2ZA 1P5FA 2C5LA 2EHDA 3ZWMA 1OXTA 1YXMA 2V0CA 2DFLA 2O2JA 4JI1B 5KU1A 1YK1A 2QE6A 2QVZX 1UQTA 2XMGA 3EGVA 1Z34A 3S2SA 5EZ6B 3H2IA 2PH7A 3ZY2A 3TNLA 4TV9A 4WBSA 1N9GA 1X0XA 3FWHA 3ZE1B 1VI6A 2JA2A 1ZD8A 3ZV7A 5B64A 1V5WA 3FDZB 4U5QA 1DIHA 3UMBA 4DIEA 3KAQA 5JI2E 5LYJF 3F6PA 5K2MA 2F1IA 1BIFA 3H4IA 2RGXA 3K2QA 3F5QA 4MV8A 2YNMD 4DDHA 3VSEA 2O2HA 3TXXA 3V4ZA 3W8EA 1GDDA 2Q3LA 1XRSB 4FBLA 1CNEA 2HT6A 2V7QA 1IU9A 3A7DA 3DCNA 1UPFA 4OJMX 2VQSA 3RVKA 4FS8A 4JLNA 3WFJA 5AVUA 5JZMA 2C42A 4RIEA 3IIMA 1V39A 3ODGA 5FQNA 5DNUA 1NT4A 4TTSA 3W8FA 4CLHA 2WU0A 3PC3A 1VYVA 3B78A 3FYDA 4FC7A 3CR7A 1YJAA 3RQIA 4U7JA 4XQ9A 2FPXA 1JAZA 1CLUA 4LRXA 3QW2A 1IIRA 1N5LA 3FRJA 4BB6A 1ZJWA 3TB4A 5A4FS 5FLXA 5EOVA 2FSSA 4B3TB 1CUCA 3U9LA 1KHHA 1FDRA 1TO6A 2OMEA 3EEQA 1LNQA 1Z5GA 4G89A 3VMFA 1ECJA 3B20A 3BK7A 3HLYA 4QEZA 2OG1A 3A11A 3MILA 4OAPA 5EJFA 5FYQA 1VJTA 1O5OA 1NE7A 1UBKS 2WJGA 4N41A 4TLLB 4K9KA 3MTGA 1IHPA 4RZIA 1DDOA 1X42A 4I50A 1NF3A 1V1RA 2WJPA 1YL7A 2OENG 3HYCA 3L02A 3ZE0B 2ZB3A 2M1XA 4XH9B 4OI4A 4EMBA 3UJDA 3A6PC 2D0DA 4CLRA 3HBJA 4BZXA 1DX6A 3PE3A 1DU4A 1T9BA 2X15A 2Z2YA 4BO1A 2YWDA 3FTNA 4J94A 1ZD3A 4QTTB 1Z7YA 3WGOA 2WYWA 4XYEA 2AN4A 5P8WA 5IDWA 5EZSA 1FYWA 1UZUA 3ZHRA 2I3GA 1PFGA 3I6YA 3T5GA 3G0GA 5F2EA 1ZJZA 4C7MA 1UT8A 2P9TA 3IE1A 1N8SA 1GR1A 1D0IA 1QLWA 4POAA 4MKHA 1YVPA 1H9AA 1Y3FE 3HMQA 4NONA 5AKJA 5AW5A 4KRFA 4XIJA 2JGKA 3WGZA 1FSZA 2FGJA 3RVSA 1IN8A 4AX8A 4RHXA 2YMMA 5HJ7A 2GF9A 1DAHA 4US0R 1W2WB 3L84A 3TIGA 4D9MA 3R7LA 3TLGB 1ML3A 2FZ5A 4LZAA 5AM1A 1U9CA 3H8VA 1D6NA 4B6RA 1QVAA 4OK6A 5JJ5A 4RDCA 3FUWA 2ZYGA 2IPNA 4WNYA 4OI1A 2VWPA 5B2EA 1ADGA 1JSCA 3B3AA 5D3KA 4DNFA 5KOIA 4D9FA 1DP4A 1YA6A 3DDUA 1OBCA 3TG2A 2B36A 5JECA 3OH8A 1L5KA 2C2WA 3CZRA 1JYFA 2ZWPA 1GQ2A 2BCEA 4MA5A 5D8DA 4KQ1A 4FYMA 4X6LA 3GP8A 2R85A 4RPCA 4FR5A 4D7AA 1RPZA 3W78A 2UZ3A 4EYQA 3CLRC 3AU8A 3MB8A 5ALZA 3VO2A 4CUKA 4EHBA 1GZUA 3MD0A 2J0UA 5LZ7A 1JHOA 2HJ9A 3PVSA 4GP7A 5ALRA 4AUNA 1M2WA 3D2CA 1J90A 3MELA 3G7SA 2C77A 1YBMA 2EX4A 4F4UA 4ROTA 3T5BA 4D9BA 1KI7A 1POWA 4YJ2F 1JQ3A 2QLMA 5DT9A 4LDZA 3P9XA 4JL6A 4OYRA 1IRXA 3THRA 3DZJA 4F5DA 1SVOA 4H6PA 1I6WA 1U7HA 2CCJA 4JCCA 4RZHA 4A6EA 4BNXA 1KZGB 1B14A 5E9AA 3L4JA 3EWSA 2D00A 1CR1A 3Q4GA 2OOSA 2WDZA 3VR3D 4UOEA 1G66A 1CW2B 1XK6A 5B2ZA 3UWKA 4IP0A 2NZWA 1JPVA 2YC4C 1ZAKA 1RQ7A 1USIA 1W5BA 1X77A 3GARA 3OCUA 3PR3A 1FTNA 5CCXA 2PY6A 2RKOA 1RYFA 2XCOA 3U7GA 2F7SA 2B5OA 1P7VA 4WTOA 3Q9UA 4A36A 4X61A 4LNUA 2NZYA 1AM4D 1YZKA 1X7WB 3FGOA 5JMWA 4Q9DA 2C83A 4GXNA 1T2AA 3G7UA 3HSSA 3KB8A 5T4FA 3T12A 2DF8A 1JJ7A 2Z04A 3D6FA 1IL0A 5C0OE 3AEKB 1QANA 2O14A 4B3DA 1Z35A 1NYLA 2V0NA 3NV9A 4KXMA 4Y2GA 4BMDA 1V2HE 3KOWA 4H0NA 3WLOA 3CVOA 5DTRA 2C3UA 2FWJA 4Q01A 4WVFA 3D2LA 3RRYA 5JWHA 4TV9F 2YV4A 1KJIA 5C35A 1P81A 3G2JA 3KHKA 3KL4A 4FQ8A 4L28A 4UM5A 3I45A 3G8DA 3IOCA 1PE0A 2E87A 2PS9A 2XTMA 2ZE5A 2PTHA 3A2NA 5BT8A 4ARCA 3WGLA 2X76A 1DAFA 2HD4A 2PZLA 3DO5A 1IUPA 1ZD1A 1YCDA 5B1IA 2R751 2G08A 2Z95A 2FX3A 4B3JA 2DXIA 1AD2A 3OQHA 4AJ4A 3BXFA 2I1WA 2HJVA 2NUPB 1JEQA 1XGKA 4HTFA 5I48A 4IH4A 3AIMA 1CDDA 5LZ5A 2OZLA 1G55A 3A1UA 1CE8A 3MJEA 4KR0A 4WADA 4ADSG 4YAUA 1IQRA 1E8NA 1HDRA 5J2TB 3HCDA 4DVGA 2WT8A 4LYYA 4MVXA 4BLUA 4P4SB 5M04A 3TGLA 4QNRA 1SCKA 1C1XB 3FLMA 1U99A 2XWSA 2YWGA 1U7UA 3DEAA 3QA9A 4RVCA 1GL7A 5DEOA 1GOTA 1YJ8A 3SF0A 1JHRA 4RJTA 3ZHZA 3F9CA 3VPBA 1SEVA 1XP8A 4WD3A 3UMGA 3GNTA 1I5EA 1SIOA 2C5SA 1YA8A 4WXHA 1LBSA 4XGQA 2KYRA 4UKDA 1ZNXA 4GZ5A 3VKVA 1HMYA 4CEIA 1IN7A 1PR4A 5E6UA 2YJTD 4EEXA 5T41A 1O95A 1TW3A 3B2QA 1RHMA 4G0MA 4CYMA 5AUQA 2VXYA 3FR8A 8AT1A 2OO7A 1QS0A 2VRBA 1RZ3A 3D6VA 3UJ3X 5D86A 1G7CA 1SFRA 4EELA 5KTKA 4DDMA 3L0OA 5CLHA 4H2DA 1S01A 1W94A 1A5AB 2QG4A 3DMTA 3LRTA 4BE9A 4BVAA 1K3TA 4EZBA 2XYQA 4YCMA 5F2NA 5IZ4A 4LX0A 121PA 1IJFA 2CFTA 4O1HA 2GNAA 1YIOA 1VHJA 1T1SA 2JKVA 2QTMA 2OT3B 3LCUA 4LHXA 3V34A 2ZCJA 4GI5A 5KKAA 1Y89A 4AJIA 3VC2A 2HZ7A 1YFJA 1W4RA 4NZNA 2AUNA 4MKIA 2JHGA 1M54A 1W4AA 4FZ3A 4MPPA 2JDID 4ZU3A 3T1HB 1J39A 2P0YA 3ZTWA 4RXUA 5A03A 5B6PA 3QF4A 1PNOA 1VYTA 2CC2A 4TKLA 3KOXA 2BLLA 4Q1BA 4RNDB 1ZISA 1Z2OX 3SF8A