1QR6A

Human mitochondrial nad(p)-dependent malic enzyme
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
551
structure length
551
Chain Sequence
b'EKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSVFLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRSEYDSLLPDVYEWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MALIC ENZYME 2
publication title Crystal structure of human mitochondrial NAD(P)(+)-dependent malic enzyme: a new class of oxidative decarboxylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 186
structure length 551
sequence length 551
chains with identical sequence B
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 1999-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1qr6A02
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1qr6A01
3MJSA 1ADBA 2NM0A 1FXSA 4W9NA 3LYLA 2NQ8A 3PK0A 3TZKA 1NR1A 5KCZA 5T57A 2QW8A 1C1DA 1LSSA 2VUSA 1MA0A 2ZTMA 3DBRA 3E9MA 3RUAA 1N7GA 2G5CA 1G1AA 4INAA 4R5HA 2CSUA 3WYCA 4WLVA 4R3WA 4Z9FA 4NJMB 1EDOA 1FDTA 3VZRA 3TJRA 4UAGA 2W2KB 3Q11A 2EP5A 5TF4A 1N92A 5JDCC 1AXGA 2CD9A 2EW8A 4R41A 1KIFA 2O2SA 5TJ9A 2ZKLA 4PN3A 5DBFA 1PWXA 2QX7A 1EUCA 3DBVO 3EVNA 2FMUA 1V0JA 4EEXA 1DXYA 4J0EA 4Z3DA 3B6ZA 4PLCA 4ILKA 2GERA 2Q2WA 4FFMA 1U28A 1VPDA 3IL2A 1Y7TA 2Q1TA 3RD5A 3H3FA 1C0KA 5JCJA 1VJTA 3E5MA 3JSAA 3KSZO 5DCWA 3WMWA 1BRMA 4J4TA 1UUFA 4J7CA 4R69A 1M67A 3I5MA 2LDBA 3V2UA 1Y9EA 1XEAA 2X86A 3DTYA 1LLCA 1TT5B 1QR6A 1DJQA 3I9JA 4GMGA 4BQPA 1B26A 1A9YA 1H6DA 2AQ8A 3LK7A 2WWRA 3HUDA 1WW8A 4YACA 3GT0A 2AW5A 1IYZA 4GGOA 3RAJA 4L74A 1F06A 2WSBA 3JQFC 3PQFA 4IGFA 4UEKA 2P9CA 3PJFA 4XQ9A 5CHEA 2HRBA 3RC1A 2W2KA 1FDSA 5FEUA 3GHYA 4B4OA 4QECA 5JYDA 4R1TA 3UKOA 3TPCA 4Z9YA 4I5FA 4AVYA 4R1SA 1NAIA 2RHCA 3MWEB 4L8VA 3KETA 3ZNPA 1XIVA 5JDCA 2HMWA 4W82A 4YBZA 3FPCA 2Q1UA 2WTBA 4E2ZA 3KM0A 1YL7A 5IZ4A 3RBZA 1ULSA 2X5OA 5T67A 3MEQA 4MO2A 2YDYA 4J90A 4A27A 3NGLA 3KRTA 3TRIA 2DTXA 3RC7A 3AI2A 3H3JA 1EFKA 3CXRA 5L53A 4F6LA 4GX2A 1ZFNA 1PJTA 1TT5A 3AI3A 4II2A 1J5PA 3WQSB 3E1KA 3K8ZA 3CZRA 4A26A 1S6YA 2QG4A 3R3SA 3WJ7A 1T26A 1E7MA 2AQKA 2GR9A 1ZMOA 4UVDA 4IINA 1Q2XA 5JY1A 1RKXA 3CMMA 3WDSA 1BTOA 2UV8A 3AI1A 5G0SA 4BNNA 2J5QA 2ZTVA 3EUWA 4WOKA 1GFSA 1B7GO 2FSSA 4OKIA 5G0WA 4FJ0A 5BNFA 3JYOA 2V6MA 4NDNE 2UUOA 4ALKA 4J3FA 3K9QO 2IE0A 5FI5A 3JQFA 4P8RA 1U1IA 4TKLA 2XXJA 5I7EA 2GN4A 4KUEA 3JV7A 2OOSA 4D3SA 3P2OA 4Z0HO 2OXIA 2JFGA 1H94A 1YB4A 2ZYGA 2GD1O 3Q2IA 1BDMA 1YDWA 1Z74A 4B79A 4FBGA 3EDMA 3NT4A 2R2GA 2PNFA 1D1TA 3G1TA 1Q1NA 4BNFA 3AUAA 2GUGA 2RH4A 5JYEA 4N18A 1KVRA 2O2YA 1VJ1A 3AK4A 4IMPA 5BSHA 3IMFA 3TNLA 3OA2A 3UF0A 3PJDA 3ZHZA 1PR3A 5IF3A 3U0BA 4EYEA 3P19A 4JK3A 4JJIA 4HFMA 2OP0A 1UDBA 1ARZA 1R0LA 1PGPA 2NNLD 1I36A 1H2BA 4BNLA 2YJZA 3OIFA 3UCXA 1VRWA 1E7YA 1LJ8A 2FPIA 3JYLA 2YDXA 4FOSA 1PZFA 3KYCB 1U5AA 3GUYA 3AU9A 2OO5A 4TRNA 2O48X 3FHLA 3M1LA 4RDHA 5EESA 5H81A 3E9NA 3FSRA 3KLPX 1GQQA 1M2WA 4AICA 2VHYA 5DULA 1NAHA 2OBNA 3D3WB 2LDXA 4J0FA 4NR0A 3GG9A 2NU6A 2J3JA 2D5CA 1ZBQA 2BH9A 2DT5A 3TQHA 1C1XB 4KMSA 4BB6A 2HMSA 3RKRA 1FDWA 4LGVA 1PQWA 3D1LA 5IG2A 1GEGA 4RZIA 1IB6A 1CQJA 2GN9A 5L4SA 3RUCA 1KVSA 3RKUA 3K31A 1CIVA 4XDZA 1PS9A 4ALLA 2GDZA 3NJ4A 4CV1A 2W4QA 4YJHA 4D42A 3CH6A 3KUXA 2O3SA 3VDRA 1TT7A 4GX5A 2O50A 4AJ4A 1KC3A 4F6CA 1TVEA 2W90A 3KV3O 3WQRA 5IFLA 5L40A 2GLXA 3OJLA 1E3EA 2V6BA 4NQZA 4IDDA 3ZNNA 1IY8A 2P2SA 3KEOA 3RI3A 1NNUA 3WR5A 1H93A 2Q3EA 4E32A 1E7SA 4B4WA 4BOYA 3Q9NA 2V6GA 1ZH8A 2QRJA 5JAMA 2VZ8A 1UAGA 3U4DA 2GO1A 3R1IA 3DO5A 3CMCO 4CM4B 1EVIA 1HE3A 1HDOA 2X9NA 1YBVA 1UH5A 4M49A 1C0PA 3KYCA 4CMJA 3X2EA 1LDBA 2E37A 2QZZA 3QQPA 3A4VA 4Y9DA 3W4KA 1LTHR 4BO0A 3HFGA 1ZSNA 4AFNA 3IDSA 3KSDO 4H7PA 4IMRA 1Y1PA 3H65A 5KKAA 4YT4A 3D3WA 2RIRA 3N74A 1FF9A 3P7MA 1UXHA 5CEEA 3TFOA 3RFTA 4RLHA 1C1XA 3RJ5A 3W1VA 3FN4A 1PIWA 2G17A 3B1KA 2HKIA 1VM6A 4BS9A 2ILTA 1KERA 2DUUA 2NADA 1LDNA 1LLDA 3OQ6A 4QO7A 5EPOA 1NYTA 3D4NA 3GN2A 3A06A 3IP3A 1V35A 2QHXA 5LDHA 3NDIA 3NDJA 1U3VA 5C7OO 3ICCA 4AJIA 1T2FA 3GDOA 1PJCA 3H4VA 2ZTUA 4NU6A 4XEHA 4CM1A 1LQUA 4CM4A 4IZHA 1HETA 4DLBA 1LI4A 5L4LA 4DIBA 3F1LA 3NT2A 4R54A 1SMKA 3JQAD 2Q2QA 1HWYA 3QVWA 3DAFA 2ZK7A 2D2IA 4NI5A 4DMMA 4GWGA 4WK6A 1P1IA 3S2EA 1O89A 1WLYA 4Z0PA 5TIIA 1EMDA 1U4OA 1HTBA 5GY7A 4M54A 5IZCA 2Y0EA 4DIFA 2I9PA 4ZQFA 1DFIA 2C2XA 3QRWA 3TL3A 1XWFA 4DUPA 1PTJA 3ENKA 3VC7A 5ITVA 4WNCA 3ZV6A 3WIEA 2FOIA 4OXYA 4YQYA 1EE2A 3IJPA 3FWZA 2AXQA 1EK6A 1P31A 4XDYA 3WX0A 2B37A 3HN2A 3AOGA 2PR2A 3L4BC 4J4BA 3LQFA 4NNJA 5L7TA 3LVFO 1JAYA 4FD3A 4WECA 3GNTA 5THQA 3K30A 5T6BA 4E12A 5CPFA 4M1QA 4OGWA 4B4VA 1CETA 1HEUA 1LA2A 4FFPA 4BQRA 4AJJA 1P33A 1EFLA 5F5LA 2RHRA 2VHWA 3JYPA 5F5NA 1WAMA 2WD7B 3LZ6A 1LDGA 2OHXA 4LCEA 1NWHA 4XYBA 1V3TA 3AUUA 3Q1LA 1LU9A 5JDIA 1C14A 1N1EA 1CERA 1DRWA 2P68A 3PHJA 2BI8A 1MXFA 5IN4A 1EUZA 1Q0HA 2AG5A 1YS4A 3TDKA 4PZCA 4WOJA 3WGHA 4BKOA 1I32A 3GEDA 1YB5A 2WE7A 2C0CA 5AXDA 4F45A 3F4BA 4E3ZA 3U09A 3M2TA 4K26A 1U7HA 3RBXA 5KJFA 5JSFA 3OIDA 1U3WA 4H16A 1B3RA 4MP6A 1WWKA 1BXZA 5MGBA 1GYRA 3TF5A 4HNHA 3EHEA 1ISFA 1JQBA 2JCYA 4OMUA 4BNUA 4Z6KA 1E3SA 5U1PA 3KO8A 1KEVA 2CDAA 1HDYA 3MCVA 3DL2A 5LC1A 3DZHA 1OOEA 4DWVA 1YJ8A 2GN8A 1YB1A 3COSA 4J2OA 1U2DA 3GNQA 4E2XA 2Y0CA 1U7TA 3PYLA 4PG4A 3L4BA 3GF4A 3S1LA 1JAXA 1P74A 3GVCA 4KTTE 1OC2A 4E2WA 5A9SA 1TLTA 4TZKA 4U6QA 2WD7A 2YV3A 1ULUA 1EVYA 3FR7A 3LDHA 4CODB 1GD1O 1N9GB 1MC5A 1PJ4A 2Q4EA 3AOEC 3GAFA 5T64A 1GPJA 1O6ZA 4OSOA 2DU8A 1HDRA 1BMDA 1I0ZA 2PH5A 3DWFA 3C85A 4RV9A 3FTNA 2CNBA 4P22A 3LSYA 4A5OA 4PZEA 3LF1A 3C7DB 3N58A 1QLJA 5A02A 2POQX 4Y8VA 5TGDA 3BAZA 3F47A 3GFBA 1Q7BA 2VNSA 3H9QA 1AGNA 3SEFA 3L9XA 4WEOA 4IJUA 2YV2A 4L0QA 1HT0A 5DBIA 3AY6A 1MGOA 4TKMA 3OJEA 5IN5A 4ND4A 4D41A 1PSDA 3DFUA 4IS3A 1DIHA 4A2CA 4EITA 4R16A 2VYVA 4ALIA 3ETEA 4E13A 3JQGB 5TT0A 2BFOA 3WWZA 4Q3CA 1UZNA 3BHMA 3GGPA 4TVBA 4E5NA 4CQMA 4FGWA 1SOVA 1B8VA 1TI7A 3HB4X 3IP1A 5HBRA 5EJ2A 4FJ1A 4Z0TA 1XDWA 4CR7A 3QWHA 2HLPA 3BTSA 3SXPA 3JD0A 4XIYA 3GEMA 1YOVB 1JWBB 2HQ1A 1EEHA 1ENZA 4WLUA 1I2ZA 2IXAA 1UP7A 2NVUB 1WVGA 4FGSA 4UEJA 1MX3A 5CDYA 1U8XX 5B4VA 3BMCA 2Q2VA 4CMEC 4E5PA 4PLZA 1DC4A 4W7HA 1GY8A 4TZTA 1NBOA 4JBGA 1XGKA 3DZGA 2VT3A 3OM9A 4UEOA 3WBBA 3NT5A 3RROA 3DTTA 1GZ6A 5DP1A 4E5YA 4PLTA 3S2FA 5B4UA 4MP8A 5JMPA 2PY6A 1A7AA 2FZEA 3DAGA 3KLMX 4DA9A 1OC4A 4IDFA 3ITKA 1QLHA 2AEFA 3JQGA 3GC6A 3F1KA 2DAPA 5DCUA 1LBEA 4ID9A 1H5QA 5GZ6A 1L7EA 1ZK3A 2VYND 1YVEI 2Y1OA 3EW7A 3HDJA 3W8FA 3QHAA 4QFDA 2C20A 4AJHA 4LCJA 1YOVA 2VHZA 5LCXA 1JKIA 1R4MB 1ZJYA 2E82A 3ZHBA 3FRJA 1XR3A 4L9RA 1K5HA 2NVUA 1PZEA 4M86A 5EQDA 4YJDA 2UYYA 1P0FA 4ND3A 3E9QA 2UAGA 4EGFA 3WOHA 5EIOA 2VNAA 1P45A 5AYVA 2AQIA 3PHHA 4KTVE 2JD1A 4BNVA 4R4JA 3KZVA 3GA0A 1J49A 1UXJA 1SOWA 3C1OA 4ROSA 2PKRA 2ZB7A 2DPGA 2VWHA 4A10A 1H9AA 4JN6B 3E5RA 4OO3A 1UDCA 1YDEA 5HA5A 4CMEA 1P1FA 4TMFA 5FFFA 4QXMA 3LT1A 4CM5A 2W8ZA 3K2BA 3DMYA 3D5TA 2CDCA 5HWSA 4J49A 5DOVA 2ET6A 1M6HA 3VZPA 1RJWA 1O9BA 4WUVA 1PWZA 1LUAA 4G5HA 4TSKA 5B4TA 1X15A 3UICA 3WXBA 1F17A 2E4AA 2QZ9A 2H5LA 3GH3A 4K1LA 3RIHA 4BVAA 3C7CB 2PZLA 3GVXA 4XYLA 6ADHA 5T8KC 4BNJA 1C1DB 1Y81A 3Q9UA 3Q6IA 3QE3A 4PLGA 4E31A 2VHVA 1R4MA 1YH3A 3H5NA 3MTGA 3X2FA 5TX7A 3ROMA 1C0LA 2DFDA 2SCUA 3PVZA 4AJOA 3OSUA 2ZCUA 1GR0A 3BYZA 1LDMA 3JQDA 1B14A 4AJ2A 3IUPA 1XA0A 1YWGO 2B36A 1K2WA 3HNPA 3STHA 4DVJA 4PVDA 1XQ6A 4JP3A 5DOZA 4CMBA 5ITWA 2IRWA 1P1JA 3AY7A 2BFAA 1ISMA 5DZSA 3O03A 2HAEA 3INRA 3W4JA 3KOUA 2P5UA 2NVWA 1DRVA 5IDXA 1DHRA 1ML3A 2VWQA 3OJFA 2CVOA 3E8XA 1SZJG 1MP0A 4DBZA 3DOJA 1I10A 2FR8A 4RF3A 4LW8A 1YBMA 5A5EA 3TOZA 4EUFA 1KC1A 2IZ0A 3VPGA 3NEPX 3PFFA 1FDUA 2P4QA 4RPHA 3WJAA 2HMUA 5DNAA 1NP3A 2NU7A 1NQTA 3GUCA 2XAAA 3PHIA 3ON5A 2HSDA 4RQUA 4BNTA 4MVJE 4CLEA 5CDUA 3W6ZA 3QSGA 4CMKA 5A04A 4EEZA 5JAQA 3U4IA 3B20A 2XPCA 5HM8A 1Q0QA 4MKXA 1SB9A 4N5NA 4Z9XA 2IEBA 1F8GA 4M55A 1I5RA 4JP2A 4BNIA 4YR9A 1MB4A 1KOLA 4A03A 2RH8A 3FBTA 1RM5A 5T8KA 4BNYA 4Q39A 2DTDA 3CZMA 1SBYA 3PHLA 3CIFA 4E30A 4GBJA 4M8SA 3UW3A 2H9IA 2JCVA 1E3WB 2UUPA 1T25A 1U4SA 3BIOA 1Q7GA 2Y68A 3PHGA 3H8VA 1DAOA 2EEZA 2OGUA 1DIRA 1PX0A 2J3IA 2JAHA 1I8TA 1HYHA 5DN9A 1ISIA 1XCBA 1HSZA 1R0SA 4BMNA 2HCTA 5U4QA 2NLOA 2JHFA 2GZ3A 4FPXA 1P3DA 2YFHA 3OMLA 1IZ9A 3EY4A 2VQ3A 4OOEA 4II3A 1Z45A 1E7QA 4QQRA 2C5EA 3RUEA 3UAGA 2JFHA 3AM3A 4MINA 1OI7A 2ZJ1A 1IPFA 3VTFA 7ADHA 4XYEA 3U3XA 2BI7A 4AJKA 4CL3A 1G0OA 1HLDA 1OFGA 1WMAA 4AJLA 1T2AA 3PJGA 3ZWWA 3BXXA 1X7GA 1JTVA 3WTBA 4PRKA 1KEPA 4I5GA 4YAEA 4RORA 1GYPA 4CUKA 1JVBA 1TA4A 2W2LA 3KYBA 1E3WA 3NTQA 3P5SA 1E92A 1ZNQO 1BVRA 5EMHA 2R6JA 3PEFA 5IAAA 4GVXA 4GH5A 2PFGA 4ZVVA 4CM7A 2EW2A 1AXEA 2EF1A 3JQ6A 4K6CA 2BHLA 4MJLA 5JO9A 6LDHA 4NBRA 3GLQA 3FF4A 2NQTA 2PGDA 4YTEA 3ITDA 1FJHA 4E4YA 5AXBA 3TN7A 5CDTA 4EDFA 1QMGA 5CAEA 3CINA 4HFRA 5ENDA 1HE5A 3WFIA 1PZHA 5F3RA 3GFGA 1LSJA 4R9SA 4XQEA 4J6FA 4NPCA 5JAIA 2G1UA 3JD2A 3I9KA 4LRTB 2RBEA 4JLWA 2EG9A 1VL6A 4CR6A 5CEJA 4CLRA 3MZ0A 4J4HA 1RM4A 3L6OO 5KJ1A 3LF2A 2Q45A 2FR1A 2IYPA 3KYDB 3JQBC 4CM9A 3ZV3A 2DUWA 1H6CA 4YVFA 1JWAB 3H9JA 4B3JA 3VZQA 3D4OA 3CUKA 3U49A 2JHGA 4QFCA 3HDQA 1SEVA 4OQZA 4LN1A 4I5EA 4DIOA 5A3JA 1SCUA 4X54A 1EZ4A 4G2NA 2PD6A 2TMGA 1HF3A 1PEDA 2ZCVA 5IDYA 4BKQA 2J8ZA 2Q49A 4L73A 3IKVA 2FP4A 1B16A 3GDFA 1J4AA 5AXAA 5C3MA 1H2HA 4XQCA 3SVTA 3WMXA 2CVZA 3AFNA 1X13A 3QLJA 4J1TA 2D8AA 3BTUA 4LSWA 4YAGA 3KHUA 3PQDA 4NBWA 4NZ9A 4FDAA 3INGA 3A1NA 2VWPA 1QYCA 1HDZA 2CZCA 4DQUA 2AEMA 3JQ7B 3I6IA 1UAYA 3GN1A 1K89A 1E0DA 1YBAA 1QXSA 3FPLA 1XU9A 2Y1GA 4YJHB 1IULA 4ND5A 2DBQA 3MJEA 4CLHA 4OHUA 2UVDA 1GTMA 3GAZA 5L51A 4AJNA 1F14A 1WP4A 2BD0A 2HMVA 1JKJA 1GV0A 3KYDA 4Y98A 5L45A 5KVQA 1VL8A 5DT9A 3UCEA 1P77A 3K96A 1DBVO 3WNQA 4IDEA 3P2YA 5EN4A 1UXKA 2HU2A 1V9LA 8ADHA 4U8GA 4EUHA 3JQBA 3GEGA 5J23A 1F8FA 1UP4A 1KEUA 3OH8A 4PG5A 4ZRNA 5CG1A 2OBYA 5K0ZA 2P9EA 3WLEA 2VOJA 4BO6A 5ICSA 5JCXA 1NPYA 5L7YA 4ZJUA 1PGQA 1BSVA 3IUSA 4DLLA 1U2GA 1XSEA 3GMSA 3ZN2A 2J3KA 3G49A 1VSUA 2CVQA 3RWBA 4RJTA 4C7JA 1LDEA 4FIZA 2F00A 1C0IA 1K6IA 1OAAA 3IAHA 3LT0A 1ONNA 2XOXA 5G0TA 4CJXA 3G17A 2EJWA 2O3TA 1K3TA 3JQ7A 4ZD6A 4J16A 4YAIA 4NK5A 5B37A 4CV0A 5HRUA 1E6UA 3F5QA 4D79A 1PJ3A 2E6UX 1U8FO 1N5DA 1UP6A 1GAEO 1WZIA 3RUIA 4OXNA 4B8WA 5LDGA 3BMOB 3ROQA 3WGQA 4PLPA 4BNMA 2A9FA 4NBUA 5G4KB 4OIMA 4D3FA 3OJ0A 1A5ZA 4S3MA 2VZ0A 3FR8A 5H83A 4DXHA 3VH3A 3WGIA 5BSEA 4FQ8A 3C8MA 4JJFA 4NK4A 1MV8A 2C5AA 2ZTLA 2EKPA 3RQSA 3WTCA 2QRLA 4MVJA 1I3KA 1X0XA 2PKQO 4EW6A 2HK8A 3PI7A 3ST7A 1W4ZA 1ENYA 1JW9B 1I30A 1WNTA 2IXBA 4P38A 1I3LA 3WYBA 4DYVA 3PIIA 3E03A 4IXTA 5C37A 5IJZA 3O26A 4LRSB 4WCFC 3TWOA 4HWKA 1ORRA 1NX6A 1WXDA 3PDJA 5F21A 4E0BA 2DTEA 3UH1A 2WMDA 2O4UX 1E1NA 2VTEA 3NAQA 4JCOA 4RGBA 2IEDA 1FMCA 3HDHA 4CLXA 2EP7A 4I8XA 4IQ0A 3VVCA 4WCFB 3VTZA 5HTOA 4NIMA 3HG7A 1IL0A 1E5QA 1QV7A 3OFSA 3F9IA 3UCFA 4IQGA 4EJMA 5L7WA 1PL6A 3DXFA 1T1SA 1DIGA 3D3EA 4FFLA 2Y66A 4YA6A 1M66A 3N7UA 3O9ZA 2X0NA 3QV1A 3U9LA 3DONA 4IJVA 3PWKA 1Y9AA 1B2LA 3GRPA 4JGBA 4DPKA 5A1TA 4YWJA 3KTDA 3H5RA 2CUKA 3BMOA 2ZQYA 1NFRA 5G4KA 4R01A 3SBOA 3ZWOA 5ICMA 2VWGA 1ENOA 2JD0A 5A5FA 1M75A 5IXSA 4J2HA 1A7KA 4BIIA 2JFFA 4ZQEA 3RU9A 2PZJA 2YV1A 4GWKA 3BHIA 4HXYA 3ADOA 1K6XA 1NVTA 3ZU5A 1E6EA 1PQPA 3JCZA 2DQ4A 3GPIA 4KWHA 5TT1A 4E6PA 5F1PA 3PPIA 3WLFA 2NV6A 2O3UA 3QVSA 5JLAA 3RFVA 4D0RA 1BXKA 2BGKA 3RCBA 2OMEA 3LLVA 3MJ4A 3OA0A 3S2GA 3ZNOA 3CSDA 4URFA 1EE9A 4WCFA 1GUZA 3AUTA 1GU7A 4GAEA 2J6IA 3ZWBA 4HV4A 3ZHXA 4AJPA 1EQ2A 5L4NA 2EV9A 3RC2A 1PS0A 4RVHA 4NG5A 3IS3A 5KJEA 3C7AA 1RPNA 1CEQA 1N7HA 4OJNA 4BO1A 2VRCD 4QO8A 2Q99A 2PTGA 1YE3A 4I9UA 1V3VA 1YL6A 1RM0A 3WSVA 3OICA 1NTOA 2A94A 4WNIA 5CPBA 3OEYA 4C7KA 4BO2A 4ZGWA 5A9SB 3JD4A 3FCOA 4MVJG 5TS3A 3HSKA 3QWIA 3O38A 4EBFA 4Q9NA 3DZKA 4ZA2A 4XGKA 4D3DA 3ZWYA 4DRYA 1BW9A 2O3QA 2NWQA 1W0CA 2PKQP 3GDGA 3NDRA 5I9MA 4J9VA 4JBHA 3H2SA 2DC1A 2X5JO 1PGJA 3CTMA 4WLFA 2ZYDA 3HDYA 1QORA 2AE1A 4IM7A 2DM6A 2NACA 2VN8A 2X22A 5A05A 3FI9A 1L1FA 1YONA 4HUJA 1NPTO 4GX0A 3VPSA 4CQLB 3DFZA 1Y8RB 1XHLA 1WZEA 5CP8A 1HRDA 2NSDA 2IDZA 2FN7A 2B4RO 3CKYA 1YJQA 1PL8A 2C59A 2C7GA 1E3JA 1ZUD1 2X0IA 3W8EA 4JROA 2VUUA 4IS2A 1PZGA 2I67A 4BHTA 4CM6A 4RPJA 3R6DA 3NYWA 5ES3A 3FD8A 1X7DA 3R0IA 2X5KO 4L75A 4CQMB 2TMDA 2DBVO 3E6AA 1ZMTA 5F1KA 3BTVA 4NU5A 4IPTA 4CLOA 4Q3BA 1GZ3A 4NH4A 1GDHA 2J5RA 1YQXA 1QYDA 4B3HA 4EJ0A 3ZWVA 1NR7A 3ABIA 1GQ2A 1QRRA 5TLSA 2B69A 2Y1DA 4BKUA 1R16A 3ZH2A 3DB2A 1DJNA 1YQGA 1LRLA 3RFXA 5AXCA 2Q4BA 1KBZA 1Z73A 1TXGA 5DDIP 4BGVA 2I6TA 4RL6A 4PG6A 2Y1EA 5JCJD 4A0SA 2YQ4A 1IOLA 1BHSA 4YRBA 3BMCB 3D5QA 5CDSA 3RU7A 1ZEMA 1BG6A 4BO3A 4CQLA 3O8QB 3SJUA 1Y8RA 4R51A 4RVFA 4B3IA 2HJSA 3VKUA 2OP1A 3OF2A 1VL0A 2V7PA 4RPLA 1XU7A 4I9HA 3FNFA 1MG0A 4D7AA 1QYVA 1T2EA 1NFQA 2BLLA 2G76A 3ZDFA 4O6VA 3HADA 3E82A 2FSVA 3G0OA 1GUFA 4HY3A 3GVIA 2EHDA 4ONEA 3V2HA 4F3YA 1ZZEA 5KVSA 2BF7A 2YYYA 4QUKA 4R9RA 3NX4A 3W8DA 3BMNA 4W6ZA 1R66A 4KZPA 2FPPA 3PRJA 5F1OA 4BNKA 1E1MA 5TNXA 5COBA 1ZEJA 3AWDA 3OEWA 4U0JA 4GSKA 1CDOA 3HQ4O 1YQDA 2D3TA 3DZBA 1IPEA 4FB5A 5KKCA 1A72A 1G0NA 2VUTA 2P9GA 4IXWA 2WEKA 3DBHB 1Y5MA 4TROA 8LDHA 1I33A 3MTJA 3FTPA 2WM3A 1MG5A 4NBTA 5A9RA 4J7XA 3IJRA 3EVTA 2OUIA 3A28A 3EAGA 3AOEA 3PTZA 3JQ8B 1BGVA 3RASA 1NQOA 2GSDA 3IQDB 4Q3EA 3DHEA 4YRDA 1HZZA 1RWBA 1CYDA 3O8QA 3TZQA 4DPMA 5TJHA 3U5TA 3BHJA 1T1RA 3DC2A 1X1EA 3TOXA 4P4GA 4E5KA 4B8ZA 1E3LA 3SLGA 4J7UA 1HDXA 2X0JA 5L95A 4S1VA 5A9TA 3Q0EA 3GGOA 3NUGA 3LT2A 1WDKA 3B1JA 5KVVA 4UVHA 1NQAO 3V1YA 3ZCXA 4BNWA 3EZYA 3MOIA 5ER9A 4CV3A 3LLSA 1ZW1A 4RCVA 1ZK2A 4IZIA 3TFQA 4D0SA 3B70A 3NTRA 3PYMA 4YXFA 4XR9A 1O94A 4ALNA 2DPHA 3FNHA 3QVOA 4BV8A 3H7AA 4E2YA 1VLLA 2Z95A 1HKUA 4C4OA 3D0OA 3AM5A 1PJSA 1KEWA 2VRBA 2V65A 3I9MA 4XZ3A 3WGOA 3DBHA 3VHRA 4MIYA 1U5CA 2Y05A 4GX1A 3I4FA 3LC2O 4LVUA 1E3IA 1PU2A 1WDMA 3EGOA 4RF5A 2VCYA 3DQPA 2ZJ0A 1LX6A 1NXQA 2HRZA 3QWAA 3WS7A 1ZSYA 3JQ8A 3ICPA 4FJ2A 4HBGA 3ENNA 4MPDA 1P0CA 1A4IA 4MVJI 3M2PA 1KETA 4FR5A 4ZQGA 3MWDB 3ETGA 4OKNA 4NMHA 4GSLA 3JYNA 3I1JA 3KSUA 1NPDA 4YB8A 3ADPA 3GRKA 4L4XA 5GZ1A 5GMOA 4TRJA 1Y5RA 4IDCA 4HFJA 5IDQA 4PLVA 3QW2A 2OFPA 1ZSVA 1HSOA 5HS4A 5K6AC 1LRJA 4WASA 3G3EA 5JY6A 1S7CA 2B35A 4B7CA 4BGUA 3WWYA 2Q46A 4JNKA 1T2CA 3VPFA 1I2CA 4BNXA 4CM3A 3HWRA 3TSCA 4KWIA 1RYDA 3DMTC 4RF4A 1DOHA 1MC4A 4WE3A 3E48A 4Q3AA 4J43A 3ZV5A 3AJRA 1Z82A 3K2EA 4N7RA 3WGTA 1D8AA 3GPDG 2H63A 2AHRA 3W4IA 4O5OA 4J1NA 3JQAA 4R5MA 1YKFA 3DZIA 4A7PA 1KY5A 1C3VA 3OETA 2DBRA 4H3VA 2ZYAA 4A73A 2JAPA 1Y8QB 2Y99A 2NTVA 4OQYA 3INTA 3EYWA 3NRCA 2B4QA 4YT5A 3AFMA 4UREA 5ILGA 4O59O 1GYQA 1HE4A 3OBBA 3QVTA 2PGJA 3WICA 2QYSA 1ZCJA 2I3GA 5JE8A 1EVJA 4XIJA 3SJ7A 1PR9A 3K6JA 4PLHA 2YHUA 1O95A 1N1GA 1QYWA 2IZ1A 3GVHA 4GL4A 1JDJA 4PLWA 4HP8A 2VT2A 4PZDA 2EGGA 4HKTA 1YRLA 3MJVA 4YJFB 4ZQHA 3PLNA 3H9UA 2UDPA 5K6AA 3RVDA 1UXIA 4DQVA 4PG8A 3ORFA 1WPQA 5COQA 4CMHA 4YT8A 3EC7A 4AG3A 2Y1CA 1R0KA 2X6TA 5T5QA 1O5IA 3TL2A 4ALJA 2PK3A 1DLIA 3GGGA 2YQ5A 3L0DA 3DMTA 4OSPA 1ISHA 1P1HA 1BWSA 2FHSA 1W6UA 2HO5A 5DCYA 4XQGA 4WLNA 5FF9A 1Y8QA 2CDBA 2Y0DA 4KUHA 4OM8A 5ILOA 4O63O 4BKPA 3M6IA 1MUUA 3VPXA 2PD3A 2RCYA 4D46A 5BNTA 2EERA 3OP4A 3NKLA 4XJSA 3DOOA 4QX6A 1EQUA 2J5KA 1KY4A 4D44A 1P1KA 3S55A 5TRTA 5BSGA 5L3ZA 2C54A 4UVIA 3L6EA 1ONOA 1ZXBA 1TEHA 5KJCA 1WMBA 4B7UA 1ZIDA 2I5PO 3ASUA 5DF1A 1A4UA 4CUJA 4GKBA 4N54A 1M6WA 3JYQA 3JD1A 2YUTA 4YJFA 2GN6A 3ZGYA 2NU9A 1VJ0A 4CMGA 1PGOA 1QV6A 1MXHA 3G79A 1UJMA 4O0LA 5DP2A 1XG5A 2AEJA 4BGIA 1I3NA 3CE6A 1QYXA 3GZNB 4HNGA 1E1KA 4CLRB 3BA1A 1Z75A 1O0SA 3UGKA 3K92A 3U62A 3BMQA 1LEHA 4UUPA 1JVSA 1DC3A 1DLJA 4J9UE 4UVEA 3UXYA 4HADA 1UDAA 2GPTA 2X8LA 4RVDA 1ISJA 4XGNA 4Y6PA 4XCVA 4F46A 3OJOA 4D43A 1P1RA 3T7EA 1P9LA 1GV1A 4DTIA 3T4EA 1L7DA 3RUHA 1LDYA 2JJYA 4IIVA 1LC0A 3C3XA 1H6AA 4AJEA 1DFGA 4KOAA 3S8MA 3QJ5A 1VKOA 4IGEA 3WGGA 4ND1A 5DBGA 3PWZA 4NJMA 1F12A 4PRLA 2B0JA 3PXXA 4UUOA 3ONDA 3QWFA 3H2ZA 5G4LA 5I9NA 2WYVA 1RYEA 4I08A 4PG7A 5B1YA 1I3MA 1OMOA 4W7IA 3SC6A 2GYYA 3AUSA 5AQ1A 1D4FA 4I1IA 1E5LA 3OHSX 2O3RA 3GZNA 2FRDA 5U9CA 3HHPA 2EWMA 1JN0A 3WFJA 1Y6JA 4IY1A 2P91A 2D59A 3IC5A 2PV7A 3WG9A 1ZO8A 4OH1A 3D64A 3MJCA 5KIAA 5HS6A 3ZV4A 5TC4A 4XA8A 4K6FA 4ITUA 4BO7A 3ZNQA 4BMVA 3PLRA 3LU1A 3KVOA 5JNLA 1E7RA 1SEPA 4DLAA 2E49A 1B0AA 4WEQA 2WJPA 3DAPA 4GI2A 1PL7A 4W99A 2Y67A 2E48A 4E5MA 5I7VA 1JU9A 4K9DA 5C7IO 1XLTA 4TVOA 1PQUA 3B1FA 1GEEA 1SC6A 1XYGA 4GKVA 5KTKA 4MDHA 1CF2O 1Z7BA 2C7VA 4IQ8A 3RC9A 1U3TA 4IUYA 4XYMA 4MKRA 1ONPA 1YL5A 4RLSA 4IJKA 1B3BA 2A4KA 4UULA 2FPGA 4MVJF 4YDRA 1EVZA 1VC2A 2NVBA 4RVUA 3D4PA 1D1SA 4UUNA 3V1TC 5BQFA 3EZLA 4MIEA 4Q3DA 2VYNA 2HMTA 1GUYA 1CQIA 2GZ1A 2PWZA 4W4TA 3NGXA 4ZN6A 3QWBA 3ONEA 3HJAA 2NUAA 2Z1MA 1VSVA 4CR8A 1BXGB 2J3HA 4IBOA 2EXXA 3ANNA 4PLYA 4EJ6A 4N5LA 3WIDA 3Q3CA 1LSUA 2X7HA 3I23A 1QSGA 4DGSA 4DC1A 1TB4A 4ESOA 1VKNA 3FNGA 3TZ6A 1IZ0A 4NFYA 4K28A 4I5DA 3WGZA 4P4LA 1GQYA 2BGMA 2Z5LA 4KDFA 2VTDA 1ADGA 2PH3A 4TRRA 1DAPA 1IE3A 1ZK0A 3W6UA 2GZ2A 2VOEA 4CL8A 5C7LO 1HL3A 2VYVD 3AU8A 3VAZA 1ZKMA 4XB1A 1UXGA 3ROPA 4JIGA 1U9JA 1R6DA 2I65A 4NFSA 4CQMD 1AHIA 2I66A 3GG2A 3BTOA 1DB3A 5CG2A 4UVGA 5IDWA 1ZJZA 4XWYA 3PZRA 2JL1A 3C1TA 2YW9A 5EERA 1R4NB 2DFVA 3TZHA 4PGFA 3UFXA 1KVQA 4XD2A 2JKVA 1DEHA 4IJWA 1D3AA 3L6DA 3I3OA 5I8WA 4KQXA 4FCCA 1XQ1A 3ZU3A 2ZB4A 1AUPA 3PWSA 4J1SA 1DPGA 4E21A 1I2BA 4P4NA 1B8PA 1NHGA 3GK3A 1BXGA 3ZWAA 3GNSA 2EKQA 3ONFA 4BMSA 5BT9A 3VDQA 1KYQA 1UZMA 3JTMA 3WBFA 5IXYA 2DVMA 2EKLA 1IHXA 3WB9A 2WE8A 5BSFA 3GHHA 2Q1WA 4GLOA 1A71A 1DSSG 1PJ2A 5JMWA 1EBUA 3U4HA 1K0UA 4FN4A 2XXBA 4MP3A 2FR0A 7MDHA 1I24A 4KQWA 1R37A 3VKVA 4EUEA 5JXWA 5KJ6A 3QA9A 1LC3A 3KBOA 2D4AA 2NU8A 3I6QA 1PJLA 3QY9A 3SC4A 5ADHA 1LXCA 4G81A 1R15A 1PJQA 3HFSA 3MOGA 4LISA 3C1AA 3IOYA 1Q7CA 3VH1A 2PZMA 3WYEA 2P5YA 1R4NA 3K73O 2RAFA 1HYGA 3HB5X 4M87A 1GCOA 4CMCA 4J1QA 1V8BA 1YGYA 1HYEA 2Z1NA 4LK3A 5IZCC 2WYWA 4YPOA 4WGGA 2CF6A 3PYXA 1KVTA 2HDHA 1GCUA 4RVSA 4BUCA 4LVCA 4H15A 3R3JA 5A3VA 2ZATA 3GMDA 2GF2A 5G2OA 2FY8A 4JQCA 1NFFA 2QYTA 2H1SA 2D1YA 2YY7A 3E18A 4WJZA 3DHYA 3VH4A 4WLEA 1T24A 2A35A 2BRUA 2WD8A 4GQAA 4Y6SA 2FWMX 1BW9B 3PP8A 3JQ9C 3JD3A 4MOWA 1UZLA 1O8CA 3F4LA 4RQTA 2JD2A 2C2YA 2QRKA 3KB6A 4OL9A 4TWRA 5A03A 4CM8B 4AL4A 5CFZA 3WQQA 5JDIC 5JC8A 5KVCA 2C29D 4AJ1A 4FS3A 3VPHA 2OL4A 2GASA 1PGNA 2WYUA 3HZZA 3UHAA 2O7QA 4FFRA 3EK2A 3ROKA 4WPGA 1EBFA 1SB8A 1K6JA 5BNIA 2ZQZA 2G82A 3V8BA 2CY0A 1GZ4A 3AY3A 3PJEA 4PVCA 1SPXA 4YYZA 2DLDA 4CV2A 3KEQA 5FI3A 1N2SA 1X14A 4QEDA 1NVMB 1AN9A 1DC6A 2C82A 4JXKA 4Y6RA 4GLLA 4TQGA 3NV9A 1G6KA 2DKNA 4DYDA 2IODA 3RUFA 4BNHA 4YAJA 2X4GA 2AG8A 1V3UA 4CMAA 4ND2A 2AA3A 3L77A 4CLOB 5C5IA 3GQVA 4NJOA 1H0KA 2Q1SA 2GNAA 3Q2KA 4R1NA 3I52A 1CJCA 4BB5A 1A27A 4U0KA 2X58A 4U7WA 1PJBA 4YJGB 1DDOA 2NTNA 3ZI0A 5AVOA 3OIGA 5ER6A 1HZJA 3ZHYA 4L4RA 4XKJA 1XKQA 1E77A 1QG6A 2BMAA 4DREA 1E6WA 5I7FA 4FSHA 2W98A 4CM8A 1T4DA 2EIHA 3DEYX 4D45A 3JQ9A 1B8UA 5L9AA 4M89A 5I9LA 1LLUA 5JS6A 4TRMA 4Q3NA 3L4SO 1XELA 2AMFA 1EUDA 3UVEA 1CRWG 5COAA 3V2GA 4XRGA 4NBVA 2Y93A 2AQHA 1ZVMA 2ZB8A 4E33A 1UR5A 1HE2A 1H9BA 3H9GA 3GZ4A 3F5SA 4FW8A 1ADCA 2ZIZA 3F3SA 1X7HA 3GOHA 2BGLA 2FZWA 2YZ7A 5TQVA 4N5MA 3KXDA 3BMNB 2YFQA 2QIOA 2CFCA 4YEDA 1F0YA 2I99A 1JKFA 4UUMA 5BR7A 2G0TA 2GGSA 3DDNA 1ADFA 3IKTA 3ZZNA 1E1LA 1JLLA 4GVLA 4DQXA 2HK7A 2H6EA 4YJGA 1B15A 1DFHA 4MVJH 3ASVA 1NASA 5H82A 3QVXA 1KS9A 4FC7A 5THKA 4GGPA 4IDBA 4FOOA 3O4RA 1YO6A 3GR6A 1W8DA 4MKZA 4PLFA 3I9OA 1AE1A 4XGIA 1LNQA 1HLPA 2Y1FA 3WSWA 2IYOA 1FK8A 2B5WA 2Q50A 3V1UA 4BL5A 3H6KA 4CMIB 4U6SA 3ZWMA 1T4BA 4RPGA 3JQCA 4BO9A 5JW6A 3ZU2A 1NQ5A 3H9EO 2V6FA 4L4SA 2PLAA 3DBLB 4Z3KA 3WNVA 4XB2A 1HDGO 1LRKA 4PCVA 2PA3A 1MFZA 1IUKA 2W2LD 4KP7A 4ALMA 4B4UA 2D5AA 5G0UA 3VOSA 4BGEA 2I3AA 5KNLA 3TZCA 3M1AA 3ULKA 3I9LA 2EJVA 1FDVA 1W73A 1Q0LA 4FFNA 2HJRA 3ANLA 4BO4A 5JAZA 1OZAA 3FWNA 2WDZA 4MVJM 3LC1O 2IZZA 5I8ZA 5JPIA 3RJ9A 2C07A 1ZK1A 5FYDA 1MLDA 1RM3A 4JJGA 3VZSA 4YAKA 1T2DA 2F1KA 3MJTA 4XR4A 5KWEA 3CEAA 3PGXA 1NWCA 2X9VA 1ENPA 4KDEA 1N9GA 4HFNA 3A9WA 4CMIA 4WCDA 1ID1A 2OORA 4DBVO 4ZHSA 3ZWXA 1X0VA 4XRRA 1P44A 4IDGA 4CM9D 1JA9A 2AE2A 1WDLA 4OXKA 4LMRA 4DPLA 3PQEA 4ZRMA 3DBLA 3V5NA 4DL9A 1GL3A 3JQEA 5AOVA 2CMDA 4XYGA 2XF8A 4YT2A 5A06A 3DOCA 2BFPA 4JX8A 5JFOA 4WLOA 5A4DA 4QSMA 2DBZA 1N8KA 3DHNA 5KOIA 3H5AA 4PIVA 1ZK4A 1LSOA 9LDBA 4XJTA 4YCAA 4IIUA 3ZWNA 1Z7EA 1NM5A 4B7XA 9LDTA 2YHIB 4JBIA 4LMPA 1DIAA 3SX2A 5CEFA 3JQAB 1HXHA 2A92A 2PGLA 2OZPA 1U3UA 1CWUA 3BZUA 3GVPA 3AW9A 2GCGA 3OQ1A 4RDIA 5CDGA 2X9GA 1DO8A 3RSHA 3ZWPA 1BVUA 4ZICA 1D7OA 3DZJA 2R00C 3PDUA 4WKGA 3UOGA 4CUZA 4FC6A 1J0XO 3ZU4A 1HDCA 4G65A 5B12A 1SO8A 1PS8A 4I9NA 1YXMA 4NFHA 3I4CA 4RVGA 3ZW8A 3G1UA 3LC7O 2HK9A 2I76A 2X0RA 1SNYA 3UUWA 3QP9A 3FBGA 3F6YA 4RF2A 2B83A 3A14A 3QIVA 3HE3A 2JCXA 4QT0A 1J6UA 2ZB3A 1BDBA 3WGYA 1GPDG 1DRUA 4DC0A 2BKAA 1QKIA 5EQFA 3HN7A 3CPSA 3IIEA 3FNEA 1LLQA 4ZU3A 3S2IA 4RPKA 1DIBA 2X1HA 1R12A 1EDZA 5MDHA 1E7WA 2CF5A 4BNGA 1LQTA 4XX0A 4MIOA 3UN1A 1EK5A 1IHYA 2YHIA 3GY0A 5JC1A 1NHWA 1X1TA 2BFMA 1ISGA 4NHEA 3L9WA 4BV9A 1GADO 4W9NC 4DMLA 2EGHA 3OECA 4YQZA 4BKRA 1ZXLA 3AM4A 4R1UA 5GZ3A 1SAYA 5I7SA 3VH2A 4LSMA 4OOFA 3U4CA 1VE9A 4R3NA 5K9ZA 3L07A 4GMFA 2O23A 3PFWO 5EL0A 1OBFO 4ZQBA 4OAQA 2VZ9A 4CLDA 4FFOA 3K5PA 5ENVA 5EINA 4OYRA 4CPDA 4BO5A 4R68A 3T4XA 3I83A 4J91A 4EZBA 2R00A 3DBRB 3LT4A 2PZKA 3RBVA 4Y67A 4YRAA 4IDAA 4KUGA 3EMKA 2GRAA 1DHTA 1H6BA 3DZFA 3PGJA 3ETDA 4RZHA 5JO0A 2X23A 2VRCA 3OQBA 4HX5A 4RO0A 4MVJD 3ZW9A 2O7SA 1VI2A 1I01A 1DC5A 3ANMA 2B5VA 4PFJA 1A9ZA 2PD4A 3D7LA 3PZBA 4U5QA 3VVBA 4BNZA 3NTOA 1MFPA 2P4HX 2O3JA 5FWNA 3ZWCA 4BO8A 3NJ8A 2O4CA 2QQ5A 5JBIA 3C24A 4O1MA 1NVGA 1M76A 5G0VA 3RUDA 1KVUA 3SLKA 3BMQB 2NTJA 3PIDA 2HUNA 4L76A 4EI2A 4QTZA 1QP8A 3T7CA 2VHXA 4MVJP 3F46A 1Z6ZA 3I9NA 3DR3A 2D0IA 5TSDA 2B4TO 1V6AA 4GPD1 1AHHA 2BELA
chains in the Genus database with same CATH superfamily
5IVHA 3HVIA 4PYMA 1CB7A 3PPVA 2C5FA 2NQ8A 2WG2A 3Q7QA 3TZKA 2G71A 3IBYA 3W3AD 4DJEC 2MSLA 1YJBA 2ZSJA 2VUSA 1VTKA 5DX1A 1FQKA 3RUAA 3EQ7A 1G1AA 2BJVA 2N0SA 1P7CA 2D2FA 4Z9FA 2BFBB 4B6OA 4MS1A 3HUUA 1PBNA 1TM7E 2HF9A 4C05A 4XLZA 1NBMD 2ZYUX 3ABZA 4HDMA 4UM7A 4W8OA 5HOQA 5E6RA 4INPA 1GFWA 5DPMA 5AVWA 1TCVA 3OTHA 3VZRA 4IXNA 3Q3HA 2BEUA 3FWPA 3CB2A 4OB6A 3TJRA 3RUPA 2BUCA 2NW6A 4V3BA 1LWOA 4Y6GB 1QS0B 2CD9A 5E1BA 4PSAA 3LKVA 2Q4OA 1A77A 2LR0A 3OFND 2O2SA 4PZ0A 1ULAA 3TCXB 2DWQA 1UKYA 4PN3A 1NW4A 4CTJA 4O4HA 2QX7A 1EUCA 2A88A 3DBVO 3LL4A 2FMUA 2WG0A 3ET4A 1AY0A 4EEXA 2C1ZA 3B6ZA 3VSEA 2X0KA 4PLCA 2FVXA 4XPIB 1Q1EA 2CLLB 1OE0A 5IT9A 2WHRA 1R27A 4C87A 1Y7TA 2B6NA 2PV0A 2QTLA 3EA0A 1OU0A 1SZCA 3OSZA 4IG9A 4WX2B 3BICA 3H3FA 5JCJA 1MJHA 2C99A 4QXAA 1TW3A 4H17A 3KSZO 4I7EA 4NYMQ 3ETHA 5DW3A 4X00A 1UUFA 3BRSA 5EE1A 4CL0A 1M67A 2BR5A 2GESA 3OPYI 1SU7A 2MMGA 3LS2A 1MEOA 1GPH1 1PT6A 3A3PA 4L8LA 2OHJA 4RANA 3V2UA 2QN6A 2DEUA 4MWZA 3LXXA 4E07A 3RSLA 1FSFA 1TT5B 3DTYA 3I9JA 1OWPA 3PFBA 3KD2A 3CNNA 2VDKB 4L72A 5GM1A 1Z8FA 3VTFA 4AM8A 2WHYA 4EVIA 4ZVNA 2VI5A 4Q7LA 4CN8A 2F8LA 2ECQA 1WF3A 4ZIRA 4K8OA 4QYIB 2O2IA 4IVPA 1YR9A 3AY0A 3OD5A 4P2GA 2YZ2A 2XB2A 4L74A 3RUIA 2EFJA 2I4LA 4OK3A 3PJFA 4XQ9A 1L5NA 2B1JA 2HRBA 3PDIA 5DYNA 4B81A 1E2JA 1XTQA 2PO5A 2W2KA 1KSGA 3VR4A 4D9MA 3VC1A 1V5EA 2ZT8A 1TAUA 3C3YA 5JYDA 4LCBA 3MIIA 2WMNB 4M83A 2ENWA 3HDTA 5DGXA 1L1QA 4JP5A 1SG0A 1CQIB 4MQMA 4AVYA 2XX3A 3HVJA 2P9FA 2GVNA 1XIVA 2V8OA 2NUAB 2O6LA 3FPKA 5DI9A 4DJTA 3ZQKA 3DVAA 2Y71A 3AKCA 1Z0SA 3PNSA 4MWEA 2N9UA 2JGNA 4JOCA 2VC2B 4UU0A 5DHFA 5GOTA 3BFPA 4PPGA 3RBZA 4S1WA 3WV4A 4B2IA 2O05A 3MEQA 4MO2A 2YDYA 1NMSA 4J94A 2QY9A 4I99A 3O6VA 1R0BA 1CJMA 1QH9A 2QXUA 1P29A 3FAKA 1I7SB 3RTAA 1UBKS 5D3ZA 5AKEA 4UM8B 5FEMA 4ZCIA 3EIEA 1H8HA 4AYXA 1QOQB 3AI2A 1CZLA 3D2LA 3DDCA 3H3JA 1Z4LA 3OU6A 3QX8A 4IG4A 2G4CA 3BF8A 4KGZA 3TTSA 3UXMA 4II2A 2D74A 4YUYA 3RSGA 3WQSB 2YX1A 3DHVA 3K8ZA 1OZFA 1AGYA 2LD4A 2QG4A 5D01A 1W0KD 3V8RA 2AQKA 2GR9A 1OASA 1M1YB 1ZMOA 2J07A 4IINA 1A98A 2FPIB 3BSSA 2IXGA 3CMMA 4IKEA 1UPFA 3C3PA 3WDSA 2HLNA 1NVBA 3AI1A 3DLHA 2ZTVA 1JLHA 3HY6A 1UMKA 2VDQB 3RU2A 1U2GC 3TXAA 3MWGA 4OKIA 1ZJ5A 1OLUB 5KYTA 4MHOA 4Y2UA 2FWBA 1H4TA 1XUOA 4ALKA 1DJLA 2GO7A 3R7NA 4FFDA 5FJJA 1E1DA 3LI2A 5CYOA 1J2RA 4JUIA 5FI5A 3U48A 1G4UR 3L0PA 4PSDA 2HW8A 2I8CA 3P9IA 2XXJA 2UUAB 5D1NA 4B5KA 3JV7A 4OFWA 2OOSA 2A9RA 2JFBA 2ZB2A 5I7WA 1LY1A 1CVIA 2JFGA 3M4ZA 1EFRD 4EHNA 2ZYGA 5LN1A 2J08A 1BDMA 1RWKA 1YDWA 1C3OA 3OKFA 2NU6B 1GPBA 1M2JA 3HS3A 3LFUA 4FBGA 4KN6A 4K6MA 3L8DA 1U7DA 2ZI4A 3CX8A 2C2ZA 2E87A 5GONF 3ZGXA 1TEXA 4BPBA 3G1TA 1D1TA 2NYAA 3IMGA 3QBDA 1SUWA 5EIFA 2Z9CA 4XVUA 5JYEA 1UFOA 3CC8A 1E3QA 3DWIA 3LP5A 4HAZA 4N18A 2O2YA 3AK4A 3OT1B 3MGGA 1KWGA 3O4VA 1XD8A 2C4VA 3OPXA 3CKLA 1T5BA 5IF3A 4F8YA 3P19A 4P54A 2FN4A 5CLQA 2J9YB 3SQNA 1JHYA 2CLMB 2NU8B 2N42A 4BPRA 1UMBB 1SIWA 4MKFA 1RAAA 3UV6A 2WT8A 1VRWA 4DIMA 1LJ8A 2RGEA 3TAUA 1OI2A 1V4VA 1ABFA 3JYLA 3M70A 5BR8B 2YDXA 3ZLBA 3QFRA 2QN3A 4HO1X 1JSZA 3AR9A 4GKAA 1N2ZA 1M7BA 2PBZA 3FFTA 3KYCB 1KH1A 1SJ9A 1U5AA 1ECFA 2P30A 3GUYA 4KVAA 1RTTA 5CVEA 3SX4A 2QN9A 3EGWA 3RJMA 2O1XA 4MV1A 3TQOA 4MDYA 2Z57A 4DNQA 1E3TA 1ZZGA 3GT3A 4AY2A 2HJGA 4WFIA 1KO5A 4JB0A 3T9CA 1NAHA 2OBLA 3UANA 2FFJA 1FUEA 4L50A 1WXXA 2A5DA 2B2CA 2AC7A 2MSDB 3R3ZA 3H2YA 4TYWA 2D5CA 2DT5A 3CZ9A 5K20A 1COZA 3A6FA 4LNHA 4BB6A 2HMSA 3NTLA 1MPXA 1NIPA 2G8LA 2XCUA 4M88A 5DI3A 2H52A 4ITVA 1KVSA 1U2QA 1C0EA 2D1FA 1TQ6A 2YC2C 2ZJ4A 3K31A 3C8ZA 3OZRA 4EA6A 2AEEA 2P6NA 4DSZA 4CV1A 4V0MA 3IE1A 3NJ4A 4XWKA 4YJHA 1JI0A 1CP3A 1Z3IX 2LXNA 2R97A 3PT5A 3CR3C 1QUFA 2AN4A 1TT7A 3RM3A 1WUIS 4AJ4A 1FVHA 1KC3A 4MHSA 4F6CA 2QX4A 2VLIA 3KV3O 1M2NA 3FLAA 3RHFA 4DS3A 3WQRA 4C7XA 5EZYA 3ZNNA 4IJQA 1J97A 4UEQA 2ZBDA 4IDDA 1IY8A 2P2SA 3Q7IA 1EFDN 1Z9BA 2FZVA 3QELB 3EGDB 4RXTA 3AETB 5F1YA 3AL0C 1QHIA 1FX0A 4M36A 2XLBA 5LLDA 1UAGA 4O8ZA 3JARA 2BP7B 2XCIA 4R8VA 1XALA 1JAZA 1XZDA 1E2FA 3CMCO 3UA3A 4KVZA 4DDHA 1Y6FA 1UH5A 1R0YA 4M1ZA 4OREX 1E6LA 2D0DA 2XCSB 5CGQB 3A4VA 2ZRIA 2ZT7A 3HV0A 4Q37A 3SICE 4O25A 4ZO7A 1ZSNA 3GXBA 4R71A 4OM7A 3LHKA 3FWHA 2QUJA 4HDNA 3UYLA 4DLWA 3LECA 3SGLA 1GNQA 1C7ZA 3D3WA 4YT4A 2CHUA 2FE4A 4UHHA 2W2PA 4LNUA 1FF9A 5CJPA 1IU9A 1SBHA 1Z4JA 1YK0A 5EP2A 4B46A 1C1XA 2V3VA 4ML3A 4CKEA 3BDVA 5DNVA 4MUIA 4HNAA 1PIWA 2PFSA 4HMOA 4ND6A 4U7PB 4DZTA 1GTSA 4B3RB 1Z4PX 1G55A 2GH1A 4JSYA 5BUZA 2AC2A 5FBVB 3ESBA 2NO1A 4M1WA 2QVLA 1T8RA 3QEOA 1EZZA 3LKDA 3MLBA 4TSRA 3SC2B 4HDOB 4V1CB 5FNZA 4RKRA 1LDNA 1FUKA 3OQ6A 5KSYA 4DLPA 1F51E 1R6AA 5ERXA 3RHTA 1BVHA 5IM4A 3AJ9A 5EGNA 4YWHA 4C0LA 2XXAB 2A3NA 3R77A 1RAHA 5LDHA 2NYVA 3NDIA 1Q1QA 2AFHA 3MYRA 2DWOA 2XIQA 1P2UA 3E0XA 2B99A 1H66A 3P4YA 4R9NA 3P9QA 4WNYA 4DT1A 3H4VA 3PUVA 5D85A 3ZC3A 2QENA 4G4SP 2XYPA 4MAMA 4R1MA 1HETA 3CLVA 1HFEL 3MM4A 4DLBA 5CFRA 4RA6B 4UMVA 5CFOA 1C29B 1LZLA 4C22A 4Q7KA 4DIBA 1J99A 2ZR8A 3M6FA 4BP1A 4LJ4A 1HWYA 3QVWA 4H1HA 1LNSA 3EASA 2DLCX 3IUEA 3M7IA 2D2IA 4PQFA 2GZSA 3OQIA 4K7JA 4L3WA 1P1IA 3OPQA 1WLYA 4K3VA 3B7WA 3K1TA 2XMDA 4QJ4A 5GGXA 1HTBA 3AUXA 4GOKA 5ALMA 2XRFA 1DV2A 2I9PA 2MYUA 3E9CA 1QVWA 3QRWA 4JUCA 1XWFA 3NKFA 4EJ2A 1PTJA 1AQUA 1WV0A 3A6DA 2RG7A 2OK7A 4PNPA 4OXYA 1QHFA 4G41A 2H57A 4IFTA 4C3VA 3BFVA 1HG1A 1U2DC 3FWZA 3OZBA 4JLKA 4KXQA 4F2DA 3ER6A 4XDYA 4EFDA 3HN2A 1CUHA 3AOGA 4B82A 3LQFA 1JSCA 2C9YA 4G9BA 4KG7A 4NNJA 4RUKA 5B3JA 2R6DA 2RGBA 1XZKA 1JAYA 2PT9A 1XFDA 3DNFA 5DWVA 5THQA 3K30A 4LHSA 3SIWA 3SVZA 4JBWA 4M1QA 4OGWA 1T9GS 1CETA 5IBCA 2WSSD 4BQRA 4POOA 4AJJA 4TWAA 5AKLA 1EFLA 5C3UA 4AZTA 1AH2A 2C57A 4OU5A 4MRSA 1IXYA 3LZ6A 1QHGA 4ARIA 4LCEA 1Y1SA 1G9SA 2RK3A 3TI9A 1JJVA 3AUUA 3N7AA 4TKVB 2JIQA 1ZVQA 4UZEA 5DNWA 3VNAA 4C4TA 2YZGA 2C88A 2GNOA 4BJ5A 2P68A 3MFYA 5BQOA 1HOTA 4BX8A 3HXQA 1MXFA 1YQ9A 4EL5A 3A25A 4TKUB 4EP1A 5AUPB 2AVDA 3ANSA 3GEDA 2DFTA 4OAOA 3CZPA 5TQ2B 4HPXB 2CEKA 1JDVA 2JS7A 3ZEIA 2C0CA 5CXSA 2QL6A 4ZAVA 2QZ4A 3A6ZA 1RLMA 2C84A 2J1LA 3BUSA 1CRZA 3RTCA 4M9RA 4E3ZA 4MXDA 4ZMSA 3N76A 4ECEA 3NH6A 2QGFA 5CVVA 3IPCA 3L0ZA 3HBLA 1REQA 4ISCA 4MR8A 3OEEA 3RS0A 1U3WA 2WWGA 4H16A 5C1IA 3PA6A 4MEJA 4QDUA 4ENSA 1WWKA 1BXZA 2GTIA 2WWXA 2ZU6A 2CB9A 2ZRHA 1EHCA 4ZV7A 1N5IA 3W34A 4C7OA 1RSZA 4BNUA 3FOZA 3DR5A 1T6BY 1CUJA 3O7WA 1OX5A 3RYHA 4UNRA 2XE7A 4EW2A 3H7IA 4DWVA 2IYNA 4KOEC 1YB1A 2VO1A 3G0CA 2YXBA 5LWHA 5EKUA 4QA9A 2Y0CA 2Q5CA 4DWJA 1XQYA 1QAMA 2M32A 1C4OA 1M7GA 2YHBA 5JNSA 1YQQA 4KTTE 1G1MA 4E2WA 1RZRD 2I4NA 4TZKA 4U6QA 4Q3LA 2XE4A 3TAXA 1ULUA 4JJKA 4YAFA 2PUTA 3LUJA 4H9GA 4N7MA 1KAOA 5AKYA 1GD1O 3QXHA 3WWDA 3QOFA 4KXUA 2YYZA 1LBIA 5GVSA 1M2HA 1P75A 2P0YA 3OAAD 2IXDA 2J5XA 3G5MA 1X3LA 3Q8KA 2OR3A 1HDRA 5G3YA 4U4AA 1HNNA 5DHUA 3NM4A 3FTNA 1Z88A 1GUDA 1E59A 2WWIA 2X9LA 4BLWA 4DA7A 1K4MA 1WG8A 2AWNA 4AKEA 5LOVF 1N0WA 4FILA 4W1RA 5JR3A 1Z34A 3DGFC 3SHOA 2DGDA 3W3AH 1VHDA 3BAZA 1JYEA 3F47A 3KWFA 4L16A 3RLIA 4AMGA 1Q7BA 1BKYA 2VNSA 3P27A 4WBNF 2ZDQA 1XJ5A 3C6MA 3SEFA 3U81A 2CW5A 4L0QA 4L5BA 3AESB 5AK5A 3DPUA 4DMHA 5LNK6 2PRKA 1U9IC 4M0EA 2GPYA 1KAQA 4YC7A 2UYGA 2CMHA 4IS3A 1YFLA 1NW7A 2QTBA 3E5NA 5B64A 1JNXX 1DIHA 5EIXA 4LRUA 2ZETA 1VDZA 3Q6NA 3NOVA 1PJZA 2O5RA 2RKWA 2VYVA 3SJBA 5ICFA 1EXDA 1C8KA 3W5HA 3QYJA 1ETHA 4NBSA 5UKDA 2BFOA 3HABA 4JSRA 4PZLA 2P9TA 3SBDA 3P9CA 3WWZA 1ZP6A 1UZNA 3BHMA 3P9ZA 3L82B 4AUMA 4OQFA 1RWVA 4I0WB 5AW0A 3SHFA 3U17A 5EJ4A 5ALJA 5HBRA 5KX5B 3EXIB 4YY3B 3DO6A 1Z5ZA 1XDWA 2CB0A 2R66A 1L5LA 1YI0A 1GU0A 3U3ZA 1GLVA 5KNDH 3OM1A 1UOQA 3GEMA 3Q85A 1CUVA 4BN4A 1Q21A 2GAFA 5B7NA 2R6HA 3QMWA 3TIIA 4Y7CA 1X2EA 3OZSA 2NNWB 4WLUA 621PA 1GAJA 1QKKA 3CRW1 3NAZA 4KN9S 1O97D 5HJ2A 1UP7A 1OBCA 2P2YA 5BRNA 2V7BA 4AF7A 5A71A 5MFPA 4UEJA 5AO9A 1U8XX 1ZD2P 4ZCSA 2Q2VA 4CMEC 5BN4A 3F8WA 4MUMA 2WMOB 2O7VA 1MA3A 1DC4A 3OKPA 4W7HA 2JLRA 3SFTA 1AF4A 2X9QA 5T6MA 3VYSB 1YHZA 3FFBA 1NE7A 4UEOA 4H1TA 3T7AA 3NT5A 1JFRA 5CK4A 1NATA 1QCDA 5K03A 2A33A 5D51S 5EFZA 3T9BA 2OYCA 1QVRA 2OV3A 2HRQA 3GB9A 3HO6A 4IZ6A 2E21A 4A2QA 3S2FA 3HWWA 2BSAA 4MP8A 5AJZA 1YJCA 3B89A 2GCNA 3VYUB 5CT8A 1ZX1A 2FZEA 3VJKA 1HA3A 1JQ5A 3BKXA 2WIFA 5F73A 3TIXB 3TQTA 1OC4A 3OZFA 2IYTA 3ITKA 2AEFA 4L57A 3U5ZB 3S70A 8OHMA 1VJRA 2RFLA 3ZBUA 4LE2A 1SXJE 3CCBA 4OX9Y 4AURA 2JCBA 2PLRA 2V7TA 2J3DA 1H5QA 3TR5A 4XQ0A 2XCQA 5AW2A 1H0HA 4UTXA 1YVEI 1EZ1A 3PPXA 3RDPA 4DCOA 2XVZA 2VPXA 1JA1A 2AOVA 2C20A 3A0UA 1YOVA 5KNCH 4B6PA 2ZT6A 3OLCX 5LCXA 4QAJA 3D9QX 3M9LA 4DV5B 3SFZA 4JB8A 1ZJYA 1WHSB 1AT1A 2E82A 3P9YA 1H2RS 1J00A 2IBMA 3VJLA 5I3CA 3G8AA 2NVUA 3N0WA 5CUQA 1Z22A 2HO4A 4X93A 4YJDA 4P34A 1AUVA 1YNSA 4EGFA 3E9QA 4MRVA 1W88A 3NCTA 4V38A 4YK7A 2VNAA 5CIWA 1COWD 1Z5UA 1GLNA 4WKPA 4KTVE 2JD1A 4YRLA 5CB4F 4ZVRA 3TRKA 3KZVA 2XKJE 3GA0A 1J49A 3WYNA 3ZUPA 4RV4A 3ORYA 2D7DA 4AS1A 4O2RA 1H9AA 2RHWA 2DCMA 2FR8C 4JN6B 2WOOA 2PRSA 4HRAA 5CTAA 5FXMA 4ZGGA 1UKCA 4B3GA 2Q4RA 4XIFA 3PR3A 4D82A 2X3UA 2R2AA 4LDJA 1YS2X 2H4YA 2L42A 4RHFA 1QK3A 3FHOA 4K6KA 3UGJA 5CT9A 3QLVC 5HWSA 4J49A 1QH8B 2ET6A 1XX6A 2ID4A 3H05A 4HL6A 4YR7A 1DU4A 2ONYA 3ZZ1A 1UM9A 2TRSB 1PWZA 2GHTA 1LUAA 4A8JA 2O8VA 4BQSA 4G5HA 4TSKA 1WZ2A 5B4TA 5C51B 3WXBA 3EVBA 2E4AA 3DOHA 3CEHA 3B1YA 3RIHA 1RKVA 4R2KA 3ABQB 1T29A 4DFDA 2IYUA 2PZLA 3OKCA 5A7FA 1P2DA 5BT8A 1C1DB 1MU0A 2CV2A 1R0CA 3CX4A 1RHMA 3X3HA 1O4WA 3LPCA 1SIBE 3AB3A 3KDSE 4PLGA 3IPXA 1NZDA 3BD6A 3SX0A 5BMVF 3I42A 2WABA 3R20A 5I5EA 2ZBGA 2IIVA 1MO4A 1QO0A 1DC8A 3LPNA 2KW5A 2SCUA 3PVZA 1D04A 2R8RA 1DARA 4BTLA 3O2JA 1B6GA 3QBVA 2G83A 1JG6A 1JHMA 3BYZA 5I7AA 1FCJA 2Q4DA 2ZJ8A 4ZHQB 4CIAA 1B14A 4RM3A 2B36A 4DVJA 4OJQA 5FJIA 5FX2A 3C7KA 2SBTA 3MLEA 4PVDA 3KU4A 3RYCB 2ZAGA 5DOZA 4C5AA 4K8RB 1XTKA 2P9BA 2HWWA 4YBRA 1KJZA 2XUFA 4ZOEA 4C30A 2AJDA 3NWEA 4DCMA 1ZH0A 2W4MA 3UJCA 1QVVA 4XIGS 1RAIA 5A4IS 2BFAA 2H2AA 4MRNA 4E13A 1OA1A 3OLQA 2P5UA 2HA5A 4UHEA 1DRVA 2PGIA 1JDUA 1ML3A 4QLAA 5D3QA 2VWQA 4JBXA 2HM7A 3L18A 4HF7A 1Y48E 3CY6A 3IQZA 2IOFA 3BK2A 4Q4DA 2A58A 2BCJQ 4X60A 4DBZA 2BM0A 5EKSA 4RF3A 4DAEA 5IHPA 1YBMA 5EJ9A 2OVFA 4YAOA 1PEKE 4UNSA 1ZIOA 1KC1A 4X24A 3PFFA 3VX3A 3UUGA 2BV3A 2GS9A 1DWUA 1NUHA 1QGUB 3A4TA 1QUEA 3MS7A 3LOQA 1OH5A 1KE2A 4ETMA 2JG3A 1BX0A 2UXDB 1JFSA 2W4IA 3GUCA 3PHIA 1KJ8A 3KLBA 1JQKA 3PEVA 5IU6A 5JFOA 4G5SA 3QSGA 3W6ZA 4V1CI 1B76A 4EEZA 3Q5EA 2R85A 2DR2A 4U2KA 1H3NA 1OYWA 1Q0QA 1SBTA 4FYKA 4HMPA 2JA2A 4L0CA 1SB9A 1GRRA 1TQHA 1F8GA 4M55A 1I5RA 1MB4A 1QDEA 1KOLA 2W6ID 2FHPA 3WX0A 4BNYA 1CCWA 3W04A 4D9GA 3ZH9B 4G0OA 4MCAA 1DJPA 3IALA 2IZ6A 3PHLA 2JIMA 2AH5A 2L18A 1GZUA 4HVCA 4GZMA 1ESDA 1TO1E 2G1AA 1YRQA 1E3WB 3I6ZA 4YUWA 4C5CA 4MYRA 1YMUA 5DTIA 3CLKA 1VKZA 4C0SA 5FWXB 1PNQA 2HHJA 4Q9LA 3H8VA 5GGYA 3R7LA 4YUZA 3PUXA 1PX0A 2J3IA 1RYNA 1QTIA 1WULS 1XCMA 1ISIA 3AHIA 1XCBA 1BQ4A 1Q11A 1R0SA 2FPSA 3NXKA 4KXNA 1UF9A 3LMKA 5DNCA 1E5VA 2VDWA 5CAEB 1OXXK 3P96A 2NLOA 2JHFA 1F1JA 2HRRA 4FPXA 2Z2XA 4I36A 1TUBB 4ZT3A 1LH0A 5J3JA 3MUFA 2XQJA 2O0HA 1XBTA 3LCCA 2B7CA 2Q9UA 5DEOA 1QHYA 3UAGA 2CXTA 1K92A 1J25A 4BMPB 3AM3A 2VPTA 3EXFB 3G0HA 4WW0A 5FORA 4AJKA 2BI7A 1U0TA 2JVIA 5HJ5A 4LWOA 3N6RA 2JFYA 3VQTA 1HLDA 4MUYA 3OF5A 1WMAA 1ZRSA 2BI4A 5J5VA 3PJGA 4AJLA 4ARSA 4M38A 2NP6A 4C0BA 3UAYA 3BXXA 1X7GA 1TYEB 3DKVA 2DHDA 5KYWB 2C7RA 4PRKA 1EFCA 2ZYHA 3AF0A 3DFKA 3W79A 1WMEA 5FR1A 1XD9A 3G5LA 1J2YA 3QNMA 4MS4B 4R2JA 1ZY2A 1DMRA 3LC0A 3OFJA 3AHHA 1JVBA 5JUWA 1OA0A 1TA4A 4JZKA 5KWIA 4MWDA 1JQLB 4JX9A 4R98A 4ZPXA 4QJ3A 3CNEA 1A8UA 2R6JA 1A9XB 3IEKA 5J40A 2ODPA 4XJVA 3T5CA 3B51X 4KPUB 2P69A 4GVXA 1VB3A 2O06A 2YIVX 3JATA 4TYMA 1NUSA 5AIAA 4C0JA 4MLDA 1MO5A 3H5IA 5L3SB 1T91A 2VDLB 4K6CA 4BZXA 4MJLA 3AM1A 1KS2A 1HUQA 3L8GA 1KR5A 3NHZA 4NBRA 4Y2TA 6LDHA 2RHOA 1A5SB 1XRLA 1FJHA 4N0EA 1VIYA 4DMGA 4D4JA 5F9MA 5LP6B 2YQZA 1U63A 2Q5FA 1QMGA 3M33A 1ELOA 4FB4A 1HE5A 4N47A 1BH6A 3Q40A 2H11A 5F3RA 2G1UA 1C9JA 2H2HA 1MOSA 1UWKA 5I8PA 3W5SA 1RI3A 4UD2A 2VVTA 4JLWA 5K8UA 2EG9A 4D9FA 4FYHA 2Y1LA 3GMIA 4J4HA 1HNWB 4RYLA 2YOGA 2DR0A 3H2IA 3IDAA 3LF2A 4X7BA 1SXJA 5DRYA 4EYGA 4PBSA 2WKRA 1ODFA 2DUWA 4YMLA 2FQQA 4M6WA 5E2BA 4HG2A 4PC3A 4TV9A 2ZP1A 3TLBA 4ZODA 4B3JA 3G5UA 1XNRB 1DKUA 4HQNA 4JBLA 4EF4A 1ZR2A 4FOTA 3HDQA 1SEVA 3AVWA 3RLFA 3R9IA 3NWOA 3FPEA 4I1SA 4DIOA 5A3JA 2IYVA 4G2NA 1G5IA 2YVUA 1HF3A 2ZCVA 4UHKA 5IDYA 4OQQA 1MVLA 3H17A 3IKVA 4EMSA 2WWFA 1YU6A 3KR2A 1ZM9A 4IOMA 1TCBA 5HKKD 1JP7A 4PO1A 1NXPA 1H2HA 4R1QA 5JMTA 5KSZA 1E0KA 5HMLA 2CVZA 3WMXA 1KJQA 1X13A 3BTUA 3Q9LA 5AUQA 2HQOA 3KHUA 4FDAA 3INGA 2M9MA 1AU9A 2VWPA 4QOFA 3G7UA 4B85A 4QM6A 1EK0A 4WN3A 2CE7A 1BKDR 1ZCFA 2CE2X 2GEBA 1I6MA 3B8HA 4EH1A 4EPVA 3K6SA 4F4JA 4JQSA 3N87A 1BEZA 1ULBA 3JQ7B 3I6IA 4CHTA 1Y42X 1WP9A 1YBAA 2NV2B 3FPLA 4OVKA 5CU7A 3S1AB 9ABPA 1IULA 2DBQA 3IOEA 4CLHA 4BVHA 4B2PA 3CNBA 4WOBA 2UVDA 2LUOA 4X44A 4BATA 4LZWA 3OQJA 1QMPA 2GJ8A 5EZ5A 2Z8ZA 3E9YA 1GV0A 1W0JD 3KYDA 4JXZA 2Y76A 4MI1A 3WKAA 5B58C 2QAGC 3AUFA 5DT9A 5H9WA 1I2AA 2FB9A 4PICA 4DSOA 4C4SA 1UBNA 3WRVA 1DBVO 3K1YA 3WHPA 1D6MA 1CRQA 1G21B 1RQLA 4IDEA 2WTUA 3HI6A 2HU2A 1V9LA 3JTEA 2ROQA 2JIBA 2VF2A 1BFUA 3NOXA 1XAIA 4EUHA 3JQBA 1I14A 2JDID 3R3HA 4IX1A 3V8PA 2BFEB 2OZLA 1OXMA 1ZITA 2OBYA 3T7JA 3HKCB 2G8NA 2A2ZA 3MBKA 5ICSA 4Q66C 3SLRA 1P81A 2X15A 3GPCA 2P1DA 3K0CA 3WMEA 4B0PA 2PMWB 1H2FA 1SOUA 1UJ2A 2X3FA 1AMNA 3GMSA 1AKQA 2O8DB 2J3KA 2V54A 1SURA 2V7GA 2Y3IA 3CNHA 3PC8C 4CKCB 3LBAA 1MPTA 5ITZB 2IYXA 2CVQA 3DAOA 3E2IA 3KFLA 1LDEA 3D7SA 3IAHA 1C0IA 1XMVA 1CK4A 1HOXA 1K6IA 2XOXA 3B9PA 3P20A 2BKEA 3V1KA 3F8SA 3FROA 2YICA 1NI4B 3RRYA 2O3TA 4HJXA 4MRAA 4I9FA 1PFGA 3CEPB 4WKOA 3UJ7A 2DMRA 3N70A 1N6PA 4GL2A 5BYJA 2CXNA 2QMYA 2X7XA 1IFXA 3E53A 3F5QA 4HTAA 2WFMA 1WD5A 2EFDB 2E6UX 3LYAA 5FB3A 2Q2NA 4CG1A 1HR0B 1JI3A 1R8SA 3DH0A 4B8WA 4PYQA 4GOLD 5IYZB 3FPSA 1BX1A 4LNAA 2IE8A 2A9FA 3LIIA 1QP4A 1IB0A 5LL6P 4DG8A 5ELLA 5KBYA 1QQ6A 1V5GA 3GLHE 2P3OA 2J3LA 3WTCA 4B6EA 1I3KA 1Q50A 4HK4A 2PKQO 1JHPA 3PFGA 4QNNA 4U1RA 4EW6A 2HK8A 1B73A 2MINA 3PDHA 3PI7A 1ENYA 4KSBA 4OGKA 5E4TA 4Q48A 4TLEA 4X8LA 4ZVTA 3WYBA 3VR4H 5H8WA 3E03A 1CDDA 3LBIA 1NN1A 3SN6A 4FDMA 5C37A 1TZCA 5IJZA 3T3PB 3L06A 1W2HA 1OLSA 2ARKA 4LRSB 4LRWA 1RQGA 2GSWA 2IF2A 2E55A 1U98A 121PA 1T10A 2PMKA 3LY5A 3PDJA 3AR3A 1JG7A 3NM5A 4JCOA 1HQCA 4GICA 2IZ7A 3OX1A 3KAJA 1FMCA 3KQSA 2UYQA 1Q2UA 2GXSA 4G0VA 1ONSA 2PJRA 2J6BA 5HIKA 2O59A 4RA9A 5JSUA 1KFCB 2N3ZA 1IL0A 1O5TA 1RQNA 3H83A 4RL4A 3F9IA 3LLMA 4EI9A 1U0RA 1YVRA 1PL6A 4AU1A 5DGIA 1CZRA 3WDKA 3D3EA 4FFLA 2X8WA 4A3SA 2H5IA 3PUKA 4ZO8A 5ETJA 4IJVA 3U9LA 4LGMA 2MMCA 1B2LA 3D0QA 3FDZA 4DPKA 1KRXA 4M0MA 2R4QA 2ASEA 3HBMA 5A1TA 4YWJA 4N0MA 2CUKA 2DE0X 5KI6A 1VRVA 1JEAA 1TJ4A 4ODIA 4TM8A 5G4KA 3ZWOA 1K7SN 1MDBA 3KZ1E 1G291 5EPUA 3H2BA 1FSPA 5JCZA 1N5LA 4JU8A 1JBKA 4GC9A 5IXSA 3RH0A 1A7KA 1P2GA 1GCGA 3GIDA 3R44A 1QAOA 3DCNA 2YV1A 3ND9A 4UPEA 1D6NA 1O1YA 4S05A 2Q8PA 4HOYA 2PUEA 4TYPA 4J2TA 4DV2B 2CVPA 2BMFA 2GJKA 2JHPA 4KBYA 3CJQA 3ONNA 1MX1A 5ICCA 2G77B 2C61A 2C9MA 1NVTA 2YY5A 3ZW7A 3ZU5A 3ZXXA 1JV2B 2DQ4A 2UKDA 3GPIA 4KWHA 8MHTA 3G2OA 1JUDA 3A6KA 2WFLA 3GCGA 1MCZA 1L4GA 1P7YA 2E7ZA 2WKWA 3QVSA 3ZGNA 3RFVA 2VJOA 1BXKA 4WINA 1CY2A 1B8NA 5B7QA 2L2QA 3B3JA 3GO4A 1MD9A 5EHNA 4LJ6A 3WWCA 4AULA 4MRPA 1ISRA 1M2OB 2YVAA 4WCFA 5LYJF 1H65A 2XA9A 5MHTA 1USGA 3HFRA 4LV6A 1S96A 4CW7A 2B61A 1M5RA 3BL6A 1R6XA 2GCIA 2QLNA 5B57C 1IXKA 2HOQA 2P2NA 1RPNA 1GGJA 1ACMA 1AKRA 1N7HA 1PNOA 1SOAA 2XE8A 3SFVA 1FMTA 3ILHA 2XITA 3EWIA 4CIXA 2FMTA 4F85A 1Q95A 3EIQA 5IAKA 2P62A 3WLMA 1N7JA 4AP6A 1SQ5A 5H1YA 3UT0A 1YE3A 1QQAA 4EHHA 4ZAXA 4PBRA 5CPBA 2ZJ5A 4QBIA 3MF4A 1IK6A 4EHDA 5BPHA 2VP4A 2X40A 1P91A 3FCOA 1N4AA 3VNUA 4MVJG 1Y4AE 1RHRA 4B6FA 1L4MA 1X1AA 3HSKA 4KNVA 1JTEA 1B0UA 4QBGB 1HK7A 3OCYA 5FFMA 4O2AA 4ZA2A 4XGKA 3TRJA 3ZWYA 3SQWA 1RXEA 1G6HA 2KM1A 2I7DA 2O3QA 1RAGA 2WTAA 4KO1S 4S35A 5K0GA 1IONA 4V0LA 5C53B 2O8FA 3IMCA 4H3HB 3NDRA 4JP1A 3THYB 4JBHA 3H2SA 4H6XA 2X5JO 1PGJA 1VL2A 4ZEMA 3L1UA 2QYOA 3FAZA 5G02A 4C06A 1KGDA 1HMYA 1QORA 1QB7A 1FE8A 1ISPA 2CWDA 1II8A 5JNTA 1ATZA 2NACA 3UK2A 2BWJA 4Q0MA 1E79A 3LGAA 2HA3A 2R9VA 1OYOA 3H2HA 5A05A 1C9KA 2V5UA 1L1FA 2PMEA 1YONA 4HUJA 1NPTO 5EXXA 1ZA1A 4CQLB 3HKBB 2EZ8A 3DFZA 2I1LA 5HXAA 3WGHA 4DLTA 1RXWA 1H2ZA 2WLSA 2NSDA 2QLLA 2GK4A 4UATA 2B4RO 2PX3A 4MVXA 1VFPA 5SYAA 1XZMA 1YCFA 3EGCA 5TGZA 1U31A 5DLYA 1OAOA 2FOXA 1ZUD1 1N8SA 4GM0A 3U7QB 2X0IA 2QT1A 3W8EA 1EA5A 1Z6QA 4R1PA 4IS2A 3F74A 2ID8A 2IHNA 4JELA 3QI7A 5I47A 3BRQA 4JI5B 3EPLA 1UDRA 1IMJA 1J21A 3I3SR 4XUDA 3T4UA 3R6DA 1QHHB 5CBKA 3R0IA 1LLFA 4NJEB 4ZJPA 4L75A 4QPCA 2QU7A 4OKSA 5FOVA 3CZ5A 4LY9A 3BTVA 5TPZD 1W5FA 3RKSA 5K4HA 1I4DD 1N3IA 5HF8A 5F7XA 2UVPB 4M46A 3MHPA 4RNCA 1CUZA 1CR2A 5BSUA 3H5OA 3ZWVA 1NR7A 4B3HA 4EJ0A 5JD5A 4RM2A 1A76A 1QRRA 5TLSA 4QL3A 1X2BA 2Y1DA 4OP2A 4UBOA 4XVQA 4YRKA 1EFHA 2DY1A 1YE8A 3BJMA 4OHXA 3RFXA 4RY0A 2EOAA 3AEZA 4ABTA 4TMKA 3WDLA 5DDIP 3KOYA 3VKHA 4YGYA 3K9GA 3TKYA 2Y1EA 2PLWA 2FSHA 1Z2EA 4B6QA 4X65B 1TKRA 1ZAYA 1Q57A 4L9AA 2QTAA 5LQNA 4MQ6A 1IN1A 4Q7JB 1ZEMA 1G2QA 2Z6AA 1GSHA 2FW7A 3NYIA 4R51A 4XH9B 1AKYA 4ZCPA 1XRNA 3IBGA 5M29A 1T6ZA 1MG0A 1FXUA 1WHTB 1T2EA 1IUPA 3EOAI 3DULA 3MCAA 3MOSA 1NFQA 4A16A 4X66B 4O4IB 3I28A 1Y5IA 4EG6A 2FSVA 2XYHA 3G0OA 4Z51A 4EARA 2Z4RA 1O57A 3T5BA 1NVDA 3P0JA 4N49A 1ZZEA 3B3AA 5AICA 3ZGVA 2X7JA 3DT6A 3NWJA 2YYYA 3KAKA 5E8JA 3UJ3X 5LQMA 5A7GA 1EGQA 4L5YA 4DF3A 5JRDS 1DQYA 3W8DA 3QPAA 3BMNA 3ETJA 4YP7A 1R66A 2YXPX 2NSYA 1UIRA 3ILSA 1GNPA 4BNKA 1SZPA 2X3YA 3RS9A 4EZIA 2ORWA 5A0VA 3OEWA 3OZTA 3CCFA 2PX4A 4EABA 3TLGB 1S8FA 4AROA 3TW4A 3TX2A 5IAEA 3DZBA 3G2LA 4FB5A 2QJTA 1N2HA 2IBTA 2Y4OA 5JQGF 1XLUA 2OBFA 2VR1A 4CCSA 2VUTA 2BFDB 1BD4A 2WEKA 1SZDA 1Y5MA 2PQ0A 2LPMA 4KQKA 1A8SA 1OYVA 2VJQA 5EYPB 5TMPA 2VNIA 3RTBA 1AZSC 2WM3A 3FTPA 3G2HA 3U9TA 4V03A 3IJRA 1FYXA 1M34B 2EATA 3VYTB 1G6OA 2OV6A 3E9EA 3ND6A 3PTZA 2QX8A 4X62B 1BGVA 1KOGA 4HLDA 3FYTA 4EF5A 4Q3EA 4I3GA 5EP1A 4AAYA 3TZQA 2JIZA 5TJHA 1JJIA 1JBEA 3TZBA 2XLCA 1NUPA 1T1RA 1NMXA 4GEKA 1X1EA 2GQ0A 2HTEA 3DE0X 5IEBA 3BH7A 1RPJA 3WHIA 2VHCA 3GLKA 1JIIA 1I0LA 4S1VA 5EE3A 1YTUA 4DNOA 2QROA 3AC0A 1QFJA 3Q0EA 3G9QA 4LJ8A 2XGJA 4NOKA 2GXAA 3LT2A 3B1JA 4BBAA 5KVVA 1NVFA 1NQAO 3V1YA 1OXUA 3H1EA 3GU3A 3MOIA 4Y2GA 5ER9A 4UOQA 2XDQA 3LLSA 1VSBA 1PFKA 1E94E 1ZW1A 4HDRB 4IZIA 4RCVA 5E4JA 4ZV4A 1SR8A 3GIWA 4A15A 3NTRA 4F1JA 3GFRA 3KLNA 3QVGA 1XDGA 1RWMA 1O94A 3C0KA 1VBFA 3NR2A 2QRMA 3PQ2A 4MR9B 4OYLA 4ALNA 1G18A 3FNHA 1UK9A 3H7AA 4BV8A 4E2YA 4FQ5A 1PR2A 1HKUA 4EGQA 1Q0PA 4C4OA 3NYRA 2PSSA 3KJFA 2VJYA 4QOIA 2G1PA 1PJSA 4QQFA 3K9FC 1QZZA 2D3WA 2FF7A 2V65A 1UBMS 1Z2OX 3BL5A 3F90A 4XZ3A 1AVTA 1ZNWA 1YNOA 3G8CA 1I6WA 1YV9A 2QMUA 1M1ZA 3MJDA 1D2NA 2OV1A 4GX1A 4N3GA 1F5NA 3FPJA 3IDZA 4HWGA 4RF5A 4QGSA 3M3PA 3OG9A 1NXQA 2ODTX 1AQIA 3QWAA 3BCUA 3NHFA 3BXGA 4RQAA 3MMXA 3K9CA 1OVGA 4Z4GA 4HBGA 3R6GA 2HMAA 4BFYA 2D7CA 1S2MA 1FFAA 4U2GA 4YDQA 3LX4A 4IVNA 2Z56A 2P1RA 5E0OA 4GUDA 3M2PA 3HUTA 3IKMB 1V41E 4JJEA 5KU1A 1RACA 5F9FA 1H1LA 4L6CA 3U61B 4BLQA 4HNVA 2QLMA 3KOMA 3SF8B 3LX6A 4MUKA 2P27A 4IHQA 1C4KA 5LU9A 1IBSA 1BMFA 1AQLA 5GMOA 1Y5RA 2EQBA 1KEKA 5IULC 2ZS9A 2EBHX 5I7OA 1JH9A 1L6IA 3AKZA 3WV5A 4KRFA 2V0GA 4FK8A 5HS4A 1HX7A 3THSA 1LRJA 2XZOA 2N47A 3HZHA 4D26A 4CKWB 4U5XA 1MAUA 5JY6A 3PF8A 2BBOA 4CGYA 3OCCA 4YXWD 3OQMA 3WWYA 4JNKA 4YONB 4CM3A 4ZKEA 2XQKA 4I2NA 5IVKA 1V9SA 4ZPJA 2QTWB 5LZ9A 1A7JA 3S81A 2J46A 3I72A