1QREA

A closer look at the active site of gamma-carbonic anhydrases: high resolution crystallographic studies of the carbonic anhydrase from methanosarcina thermophila
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
210
structure length
210
Chain Sequence
TVDEFSNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A closer look at the active site of gamma-class carbonic anhydrases: high-resolution crystallographic studies of the carbonic anhydrase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Lyase
molecule keywords CARBONIC ANHYDRASE
total genus 76
structure length 210
sequence length 210
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1999-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1qreA00
2RIJA 3R2WA 4G3QA 3VBIA 2OI5A 1KK4A 4M28A 2V0KA 1KGQA 1Z90A 2V0HA 4J09A 2OEFA 4KNRA 3IXCA 3MQHA 3KWEA 3R3RA 3R5DA 3KWCA 5E3RA 4R37A 2WLFA 3R5BA 1KK5A 3MC4A 2FKOA 2WLCA 2OI7A 1SSMA 1QRFA 3OUPA 4K6RA 2AQ9A 2JF2A 3MQGA 4KPZA 4N27A 5L6SA 1KHRA 2GGQA 4M99A 1KRRA 4HZDA 4E75A 2OEGA 1QREA 1LXAA 1HM0A 4J18A 1HV9A 1S80A 3TV0A 2IU9A 1THJA 3T57A 4N6AA 5AFUV 4E79A 4KNXA 3DK5A 2VD4A 1XHDA 2V0JA 1T3DA 3FTTA 4DCLA 1YP3A 4IHGA 3OTZA 3R1WA 3R8YA 1MR9A 2VHEA 3HSQA 2QIAA 4N69A 2V0LA 3VBNA 2TDTA 3FSCA 3JQYA 4FCEA 4E6TA 1V67A 3OU9A 3V4EA 4N6BA 1G95A 1OCXA 1SSTA 4EABA 3GUEA 4R36A 3OW5A 3TISA 1FXJA 2W0VA 4M9CA 4AAWA 3R3IA 5DEPA 3EH0A 1MR7A 3TK8A 1KRVA 3FSBA 5E3QA 2WLGA 4EAAA 1MRLA 3P1BA 4HUSA 5ADXV 3P47A 1QRLA 3Q1XA 3I3XA 3CJ8A 3TWDA 3VBJA 3EEVA 2IUAA 2ICXA 5F42A 3FSXA 4G3SA 1V3WA 4G87A 3I3AA 3VBLA 1KK6A 3IGJA 3FS8A 4E6UA 4M98A 1HM8A 1G97A 3D98A 1YP2A 2P2OA 3TIOA 3NZ2A 3VBKA 4EQYA 3ECTA 1J2ZA 2GGOA 5ADXU 2QIVX 5DEMA 5L6VA 5DG3A 3R0SA 3BSYA 3VNPA 4AA7A 3SPTA 3ST8A 3BSWA 4M2AA 1XATA 4HURA 2I5KA 1YP4A 3GOSA 3EG4A 3BXYA 3TDTA 2V0IA 4G3PA 5AFUU 4HCQA 4HZCA 1KRUA 3KWDA 3BFPA 3DHOA 3BRKX 4KQLA 5E3PA 3FOQA 4EGGA 2JF3A 3F1XA 2XATA 3DJ4A 4IHHA 2IC7A 4MZUA 2ICYA 3D8VA 1KQAA 4MFGA 1FWYA 3BSSA 1QQ0A 3SRTA 3R5CA 2OI6A 3VBMA 2Q4JA 2QKXA 4MYOA 4H7OA 2WLEA 4KPXA 5U2KA 2W0WA 4ISXA 1SSQA 1KGTA 3PMOA 3FWWA 4M2BA 2WLDA 3FSYA 1QRGA 2NPOA 4EA9A 1HM9A 3HJJA 3C8VA 2IU8A 3R5AA 4AC3A 3OTMA 4E1KA 1QRMA 3GVDA 4R7PA 4EA8A 1TDTA 4IHFA 4EA7A 3VBPA
chains in the Genus database with same CATH superfamily
2RIJA 3R2WA 4G3QA 3VBIA 2OI5A 1KK4A 4M28A 2V0KA 1KGQA 1Z90A 2V0HA 4J09A 2OEFA 4KNRA 3IXCA 3MQHA 3KWEA 3R3RA 3R5DA 3KWCA 5E3RA 4R37A 2WLFA 3R5BA 1KK5A 3MC4A 2FKOA 2WLCA 2OI7A 1SSMA 1QRFA 3OUPA 4K6RA 2AQ9A 2JF2A 3MQGA 4KPZA 4N27A 5L6SA 1KHRA 2GGQA 1EWWA 4M99A 1KRRA 4HZDA 4E75A 2OEGA 1QREA 1LXAA 1HM0A 4J18A 1HV9A 1S80A 3TV0A 2IU9A 1THJA 3T57A 4N6AA 5AFUV 4E79A 4KNXA 3DK5A 3OH4A 2VD4A 1XHDA 2V0JA 1T3DA 3FTTA 4DCLA 1YP3A 4IHGA 3OTZA 3R1WA 3R8YA 1MR9A 2VHEA 3HSQA 3GQ7A 2QIAA 4N69A 2V0LA 3VBNA 2TDTA 3FSCA 1M8NA 3JQYA 4FCEA 4E6TA 1V67A 3OU9A 3OGZA 3V4EA 4N6BA 1G95A 1OCXA 1SSTA 4EABA 3GUEA 4R36A 3GQAA 3OW5A 3TISA 1FXJA 2W0VA 3OH1A 4M9CA 4AAWA 1L0SA 3R3IA 5DEPA 3EH0A 1MR7A 3TK8A 1KRVA 3FSBA 5E3QA 2WLGA 4EAAA 1Z2FA 1MRLA 3P1BA 4HUSA 5ADXV 3P47A 1QRLA 3Q1XA 3I3XA 3CJ8A 3SUCA 3TWDA 3VBJA 3EEVA 2IUAA 2ICXA 5F42A 3FSXA 4G3SA 1V3WA 3GQ9A 4G87A 3I3AA 3VBLA 1KK6A 3IGJA 3FS8A 3OH3A 4E6UA 4M98A 1HM8A 1G97A 3D98A 1YP2A 2P2OA 3TIOA 3NZ2A 3VBKA 4EQYA 3ECTA 1J2ZA 2GGOA 5ADXU 2QIVX 5DEMA 5L6VA 5DG3A 3R0SA 3BSYA 3VNPA 4AA7A 3SPTA 3ST8A 3BSWA 4M2AA 3OH0A 1XATA 4HURA 2I5KA 1YP4A 3GOSA 3EG4A 3BXYA 3TDTA 2V0IA 4G3PA 5AFUU 4HCQA 4HZCA 1KRUA 3KWDA 3BFPA 3DHOA 3BRKX 4KQLA 5E3PA 3FOQA 4EGGA 2JF3A 3F1XA 2XATA 3DJ4A 4IHHA 2IC7A 4MZUA 2ICYA 3D8VA 1KQAA 4MFGA 1FWYA 3BSSA 1QQ0A 3SRTA 3R5CA 2OI6A 3OH2A 2Q4JA 2QKXA 4MYOA 3VBMA 4H7OA 2WLEA 4KPXA 5U2KA 2W0WA 4ISXA 1SSQA 1KGTA 3PMOA 1N4IA 3FWWA 4M2BA 2WLDA 3FSYA 1QRGA 2NPOA 4EA9A 1HM9A 3HJJA 3C8VA 2IU8A 3GQ8A 3R5AA 3OTMA 4AC3A 1QRMA 3GVDA 4R7PA 4E1KA 1TDTA 4IHFA 4EA8A 4EA7A 3VBPA
chains in the Genus database with same CATH topology
2RIJA 3R2WA 4G3QA 3VBIA 2OI5A 1KK4A 4M28A 2V0KA 1KGQA 1Z90A 2V0HA 4J09A 2OEFA 4KNRA 3IXCA 3MQHA 3KWEA 3R3RA 3R5DA 3KWCA 5E3RA 4R37A 2WLFA 3R5BA 1KK5A 3MC4A 2FKOA 2WLCA 2OI7A 1SSMA 1QRFA 3OUPA 4K6RA 2AQ9A 2JF2A 3MQGA 4KPZA 4N27A 5L6SA 1KHRA 2GGQA 4M99A 1KRRA 4HZDA 4E75A 2OEGA 1QREA 1LXAA 1HM0A 4J18A 1HV9A 1S80A 3TV0A 2IU9A 1THJA 3T57A 4N6AA 5AFUV 4E79A 4KNXA 3DK5A 2VD4A 1XHDA 2V0JA 1T3DA 3FTTA 4DCLA 1YP3A 4IHGA 3OTZA 3R1WA 3R8YA 1MR9A 2VHEA 3HSQA 2QIAA 4N69A 2V0LA 3VBNA 2TDTA 3FSCA 3JQYA 4FCEA 4E6TA 1V67A 3OU9A 3V4EA 4N6BA 1G95A 1OCXA 1SSTA 4EABA 3GUEA 4R36A 3OW5A 3TISA 1FXJA 2W0VA 4M9CA 4AAWA 3R3IA 5DEPA 3EH0A 1MR7A 3TK8A 1KRVA 3FSBA 5E3QA 2WLGA 4EAAA 1MRLA 3P1BA 4HUSA 5ADXV 3P47A 1QRLA 3Q1XA 3I3XA 3CJ8A 3TWDA 3VBJA 3EEVA 2IUAA 2ICXA 5F42A 3FSXA 4G3SA 1V3WA 4G87A 3I3AA 3VBLA 1KK6A 3IGJA 3FS8A 4E6UA 4M98A 1HM8A 1G97A 3D98A 1YP2A 2P2OA 3TIOA 3NZ2A 3VBKA 4EQYA 3ECTA 1J2ZA 2GGOA 5ADXU 2QIVX 5DEMA 5L6VA 5DG3A 3R0SA 3BSYA 3VNPA 4AA7A 3SPTA 3ST8A 3BSWA 4M2AA 1XATA 4HURA 2I5KA 1YP4A 3GOSA 3EG4A 3BXYA 3TDTA 2V0IA 4G3PA 5AFUU 4HCQA 4HZCA 1KRUA 3KWDA 3BFPA 3DHOA 3BRKX 4KQLA 5E3PA 3FOQA 4EGGA 2JF3A 3F1XA 2XATA 3DJ4A 4IHHA 2IC7A 4MZUA 2ICYA 3D8VA 1KQAA 4MFGA 1FWYA 3BSSA 1QQ0A 3SRTA 3R5CA 2OI6A 3VBMA 2Q4JA 2QKXA 4MYOA 4H7OA 2WLEA 4KPXA 5U2KA 2W0WA 4ISXA 1SSQA 1KGTA 3PMOA 3FWWA 4M2BA 2WLDA 3FSYA 1QRGA 2NPOA 4EA9A 1HM9A 3HJJA 3C8VA 2IU8A 3R5AA 4AC3A 3OTMA 4E1KA 1QRMA 3GVDA 4R7PA 4EA8A 1TDTA 4IHFA 4EA7A 3VBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIJ A;  3R2W A;  4G3Q A;  3VBI A;  2OI5 A;  1KK4 A;  4M28 A;  2V0K A;  1KGQ A;  1Z90 A;  2V0H A;  4J09 A;  2OEF A;  4KNR A;  3IXC A;  3MQH A;  3KWE A;  3R3R A;  3R5D A;  3KWC A;  5E3R A;  4R37 A;  2WLF A;  3R5B A;  1KK5 A;  3MC4 A;  2FKO A;  2WLC A;  2OI7 A;  1SSM A;  1QRF A;  3OUP A;  4K6R A;  2AQ9 A;  2JF2 A;  3MQG A;  4KPZ A;  4N27 A;  5L6S A;  1KHR A;  2GGQ A;  4M99 A;  1KRR A;  4HZD A;  4E75 A;  2OEG A;  1QRE A;  1LXA A;  1HM0 A;  4J18 A;  1HV9 A;  1S80 A;  3TV0 A;  2IU9 A;  1THJ A;  3T57 A;  4N6A A;  5AFU V;  4E79 A;  4KNX A;  3DK5 A;  2VD4 A;  1XHD A;  2V0J A;  1T3D A;  3FTT A;  4DCL A;  1YP3 A;  4IHG A;  3OTZ A;  3R1W A;  3R8Y A;  1MR9 A;  2VHE A;  3HSQ A;  2QIA A;  4N69 A;  2V0L A;  3VBN A;  2TDT A;  3FSC A;  3JQY A;  4FCE A;  4E6T A;  1V67 A;  3OU9 A;  3V4E A;  4N6B A;  1G95 A;  1OCX A;  1SST A;  4EAB A;  3GUE A;  4R36 A;  3OW5 A;  3TIS A;  1FXJ A;  2W0V A;  4M9C A;  4AAW A;  3R3I A;  5DEP A;  3EH0 A;  1MR7 A;  3TK8 A;  1KRV A;  3FSB A;  5E3Q A;  2WLG A;  4EAA A;  1MRL A;  3P1B A;  4HUS A;  5ADX V;  3P47 A;  1QRL A;  3Q1X A;  3I3X A;  3CJ8 A;  3TWD A;  3VBJ A;  3EEV A;  2IUA A;  2ICX A;  5F42 A;  3FSX A;  4G3S A;  1V3W A;  4G87 A;  3I3A A;  3VBL A;  1KK6 A;  3IGJ A;  3FS8 A;  4E6U A;  4M98 A;  1HM8 A;  1G97 A;  3D98 A;  1YP2 A;  2P2O A;  3TIO A;  3NZ2 A;  3VBK A;  4EQY A;  3ECT A;  1J2Z A;  2GGO A;  5ADX U;  2QIV X;  5DEM A;  5L6V A;  5DG3 A;  3R0S A;  3BSY A;  3VNP A;  4AA7 A;  3SPT A;  3ST8 A;  3BSW A;  4M2A A;  1XAT A;  4HUR A;  2I5K A;  1YP4 A;  3GOS A;  3EG4 A;  3BXY A;  3TDT A;  2V0I A;  4G3P A;  5AFU U;  4HCQ A;  4HZC A;  1KRU A;  3KWD A;  3BFP A;  3DHO A;  3BRK X;  4KQL A;  5E3P A;  3FOQ A;  4EGG A;  2JF3 A;  3F1X A;  2XAT A;  3DJ4 A;  4IHH A;  2IC7 A;  4MZU A;  2ICY A;  3D8V A;  1KQA A;  4MFG A;  1FWY A;  3BSS A;  1QQ0 A;  3SRT A;  3R5C A;  2OI6 A;  3VBM A;  2Q4J A;  2QKX A;  4MYO A;  4H7O A;  2WLE A;  4KPX A;  5U2K A;  2W0W A;  4ISX A;  1SSQ A;  1KGT A;  3PMO A;  3FWW A;  4M2B A;  2WLD A;  3FSY A;  1QRG A;  2NPO A;  4EA9 A;  1HM9 A;  3HJJ A;  3C8V A;  2IU8 A;  3R5A A;  4AC3 A;  3OTM A;  4E1K A;  1QRM A;  3GVD A;  4R7P A;  4EA8 A;  1TDT A;  4IHF A;  4EA7 A;  3VBP A; 
#chains in the Genus database with same CATH topology
 2RIJ A;  3R2W A;  4G3Q A;  3VBI A;  2OI5 A;  1KK4 A;  4M28 A;  2V0K A;  1KGQ A;  1Z90 A;  2V0H A;  4J09 A;  2OEF A;  4KNR A;  3IXC A;  3MQH A;  3KWE A;  3R3R A;  3R5D A;  3KWC A;  5E3R A;  4R37 A;  2WLF A;  3R5B A;  1KK5 A;  3MC4 A;  2FKO A;  2WLC A;  2OI7 A;  1SSM A;  1QRF A;  3OUP A;  4K6R A;  2AQ9 A;  2JF2 A;  3MQG A;  4KPZ A;  4N27 A;  5L6S A;  1KHR A;  2GGQ A;  1EWW A;  4M99 A;  1KRR A;  4HZD A;  4E75 A;  2OEG A;  1QRE A;  1LXA A;  1HM0 A;  4J18 A;  1HV9 A;  1S80 A;  3TV0 A;  2IU9 A;  1THJ A;  3T57 A;  4N6A A;  5AFU V;  4E79 A;  4KNX A;  3DK5 A;  3OH4 A;  2VD4 A;  1XHD A;  2V0J A;  1T3D A;  3FTT A;  4DCL A;  1YP3 A;  4IHG A;  3OTZ A;  3R1W A;  3R8Y A;  1MR9 A;  2VHE A;  3HSQ A;  3GQ7 A;  2QIA A;  4N69 A;  2V0L A;  3VBN A;  2TDT A;  3FSC A;  1M8N A;  3JQY A;  4FCE A;  4E6T A;  1V67 A;  3OU9 A;  3OGZ A;  3V4E A;  4N6B A;  1G95 A;  1OCX A;  1SST A;  4EAB A;  3GUE A;  4R36 A;  3GQA A;  3OW5 A;  3TIS A;  1FXJ A;  2W0V A;  3OH1 A;  4M9C A;  4AAW A;  1L0S A;  3R3I A;  5DEP A;  3EH0 A;  1MR7 A;  3TK8 A;  1KRV A;  3FSB A;  5E3Q A;  2WLG A;  4EAA A;  1Z2F A;  1MRL A;  3P1B A;  4HUS A;  5ADX V;  3P47 A;  1QRL A;  3Q1X A;  3I3X A;  3CJ8 A;  3SUC A;  3TWD A;  3VBJ A;  3EEV A;  2IUA A;  2ICX A;  5F42 A;  3FSX A;  4G3S A;  1V3W A;  3GQ9 A;  4G87 A;  3I3A A;  3VBL A;  1KK6 A;  3IGJ A;  3FS8 A;  3OH3 A;  4E6U A;  4M98 A;  1HM8 A;  1G97 A;  3D98 A;  1YP2 A;  2P2O A;  3TIO A;  3NZ2 A;  3VBK A;  4EQY A;  3ECT A;  1J2Z A;  2GGO A;  5ADX U;  2QIV X;  5DEM A;  5L6V A;  5DG3 A;  3R0S A;  3BSY A;  3VNP A;  4AA7 A;  3SPT A;  3ST8 A;  3BSW A;  4M2A A;  3OH0 A;  1XAT A;  4HUR A;  2I5K A;  1YP4 A;  3GOS A;  3EG4 A;  3BXY A;  3TDT A;  2V0I A;  4G3P A;  5AFU U;  4HCQ A;  4HZC A;  1KRU A;  3KWD A;  3BFP A;  3DHO A;  3BRK X;  4KQL A;  5E3P A;  3FOQ A;  4EGG A;  2JF3 A;  3F1X A;  2XAT A;  3DJ4 A;  4IHH A;  2IC7 A;  4MZU A;  2ICY A;  3D8V A;  1KQA A;  4MFG A;  1FWY A;  3BSS A;  1QQ0 A;  3SRT A;  3R5C A;  2OI6 A;  3OH2 A;  2Q4J A;  2QKX A;  4MYO A;  3VBM A;  4H7O A;  2WLE A;  4KPX A;  5U2K A;  2W0W A;  4ISX A;  1SSQ A;  1KGT A;  3PMO A;  1N4I A;  3FWW A;  4M2B A;  2WLD A;  3FSY A;  1QRG A;  2NPO A;  4EA9 A;  1HM9 A;  3HJJ A;  3C8V A;  2IU8 A;  3GQ8 A;  3R5A A;  3OTM A;  4AC3 A;  1QRM A;  3GVD A;  4R7P A;  4E1K A;  1TDT A;  4IHF A;  4EA8 A;  4EA7 A;  3VBP A; 
#chains in the Genus database with same CATH homology
 2RIJ A;  3R2W A;  4G3Q A;  3VBI A;  2OI5 A;  1KK4 A;  4M28 A;  2V0K A;  1KGQ A;  1Z90 A;  2V0H A;  4J09 A;  2OEF A;  4KNR A;  3IXC A;  3MQH A;  3KWE A;  3R3R A;  3R5D A;  3KWC A;  5E3R A;  4R37 A;  2WLF A;  3R5B A;  1KK5 A;  3MC4 A;  2FKO A;  2WLC A;  2OI7 A;  1SSM A;  1QRF A;  3OUP A;  4K6R A;  2AQ9 A;  2JF2 A;  3MQG A;  4KPZ A;  4N27 A;  5L6S A;  1KHR A;  2GGQ A;  4M99 A;  1KRR A;  4HZD A;  4E75 A;  2OEG A;  1QRE A;  1LXA A;  1HM0 A;  4J18 A;  1HV9 A;  1S80 A;  3TV0 A;  2IU9 A;  1THJ A;  3T57 A;  4N6A A;  5AFU V;  4E79 A;  4KNX A;  3DK5 A;  2VD4 A;  1XHD A;  2V0J A;  1T3D A;  3FTT A;  4DCL A;  1YP3 A;  4IHG A;  3OTZ A;  3R1W A;  3R8Y A;  1MR9 A;  2VHE A;  3HSQ A;  2QIA A;  4N69 A;  2V0L A;  3VBN A;  2TDT A;  3FSC A;  3JQY A;  4FCE A;  4E6T A;  1V67 A;  3OU9 A;  3V4E A;  4N6B A;  1G95 A;  1OCX A;  1SST A;  4EAB A;  3GUE A;  4R36 A;  3OW5 A;  3TIS A;  1FXJ A;  2W0V A;  4M9C A;  4AAW A;  3R3I A;  5DEP A;  3EH0 A;  1MR7 A;  3TK8 A;  1KRV A;  3FSB A;  5E3Q A;  2WLG A;  4EAA A;  1MRL A;  3P1B A;  4HUS A;  5ADX V;  3P47 A;  1QRL A;  3Q1X A;  3I3X A;  3CJ8 A;  3TWD A;  3VBJ A;  3EEV A;  2IUA A;  2ICX A;  5F42 A;  3FSX A;  4G3S A;  1V3W A;  4G87 A;  3I3A A;  3VBL A;  1KK6 A;  3IGJ A;  3FS8 A;  4E6U A;  4M98 A;  1HM8 A;  1G97 A;  3D98 A;  1YP2 A;  2P2O A;  3TIO A;  3NZ2 A;  3VBK A;  4EQY A;  3ECT A;  1J2Z A;  2GGO A;  5ADX U;  2QIV X;  5DEM A;  5L6V A;  5DG3 A;  3R0S A;  3BSY A;  3VNP A;  4AA7 A;  3SPT A;  3ST8 A;  3BSW A;  4M2A A;  1XAT A;  4HUR A;  2I5K A;  1YP4 A;  3GOS A;  3EG4 A;  3BXY A;  3TDT A;  2V0I A;  4G3P A;  5AFU U;  4HCQ A;  4HZC A;  1KRU A;  3KWD A;  3BFP A;  3DHO A;  3BRK X;  4KQL A;  5E3P A;  3FOQ A;  4EGG A;  2JF3 A;  3F1X A;  2XAT A;  3DJ4 A;  4IHH A;  2IC7 A;  4MZU A;  2ICY A;  3D8V A;  1KQA A;  4MFG A;  1FWY A;  3BSS A;  1QQ0 A;  3SRT A;  3R5C A;  2OI6 A;  3VBM A;  2Q4J A;  2QKX A;  4MYO A;  4H7O A;  2WLE A;  4KPX A;  5U2K A;  2W0W A;  4ISX A;  1SSQ A;  1KGT A;  3PMO A;  3FWW A;  4M2B A;  2WLD A;  3FSY A;  1QRG A;  2NPO A;  4EA9 A;  1HM9 A;  3HJJ A;  3C8V A;  2IU8 A;  3R5A A;  4AC3 A;  3OTM A;  4E1K A;  1QRM A;  3GVD A;  4R7P A;  4EA8 A;  1TDT A;  4IHF A;  4EA7 A;  3VBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...