1QRFA

A closer look at the active site of gamma-carbonic anhydrases: high resolution crystallographic studies of the carbonic anhydrase from methanosarcina thermophila
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
206
structure length
206
Chain Sequence
FSNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A closer look at the active site of gamma-class carbonic anhydrases: high-resolution crystallographic studies of the carbonic anhydrase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Lyase
molecule keywords CARBONIC ANHYDRASE
total genus 76
structure length 206
sequence length 206
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1999-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1qrfA00
1V67A 1XHDA 3NZ2A 2IU9A 2VHEA 4R7PA 3TWDA 3MQGA 3R8YA 4K6RA 3TIOA 5DEPA 3MQHA 4DCLA 4H7OA 4G3QA 1YP4A 5L6VA 2W0WA 2WLFA 4M2BA 3R0SA 3TDTA 1KHRA 3BSWA 3IGJA 3VBMA 4M28A 2V0KA 1TDTA 3SPTA 3T57A 4ISXA 3VBIA 2TDTA 3GUEA 5L6SA 2RIJA 3F1XA 2IUAA 4HZCA 2GGQA 3R5DA 2JF2A 4EABA 1G97A 3D8VA 2V0LA 3SRTA 1S80A 2GGOA 2JF3A 3OUPA 3DHOA 5AFUV 4M98A 3KWCA 3KWDA 4KNXA 3VBJA 3TV0A 4KNRA 3OU9A 4IHHA 1KK6A 1LXAA 2IU8A 1MRLA 5AFUU 4E1KA 1SSTA 2IC7A 3MC4A 5DG3A 2ICXA 4N27A 4M2AA 3P47A 3FSYA 2V0HA 3VBKA 1KGQA 1MR7A 4AC3A 2WLGA 4J09A 5E3RA 4MZUA 3VNPA 1KRVA 2WLEA 4R36A 2QKXA 3R5AA 3VBLA 2XATA 4HCQA 3FWWA 4M99A 1J2ZA 3FTTA 3ST8A 3R5CA 4EA8A 4MFGA 5U2KA 2W0VA 1FWYA 1HV9A 1OCXA 3VBPA 2VD4A 2OI6A 1THJA 1QRGA 4EQYA 1XATA 3I3XA 3R3IA 3FSXA 5DEMA 1Z90A 3ECTA 3IXCA 3PMOA 1SSQA 3BSSA 4G3PA 3OW5A 1V3WA 2QIAA 2NPOA 4E6TA 4EAAA 1QREA 3CJ8A 1QRLA 4N6AA 2AQ9A 3TISA 1G95A 2P2OA 3FS8A 3GVDA 1HM8A 4N69A 2WLCA 5ADXU 4E6UA 3C8VA 4M9CA 4IHFA 5E3QA 3V4EA 3BSYA 1KRUA 1QRMA 2OI7A 3EH0A 1HM9A 4AAWA 1YP2A 3BXYA 1YP3A 3JQYA 3FSCA 3OTZA 4MYOA 4EA9A 4E79A 5ADXV 4E75A 2QIVX 1KGTA 2I5KA 2WLDA 3EG4A 1HM0A 3DJ4A 4HUSA 1KRRA 5E3PA 4HURA 3Q1XA 2Q4JA 1QRFA 3OTMA 5F42A 3KWEA 2OEFA 2V0IA 3BRKX 3D98A 3BFPA 2FKOA 4KPXA 4FCEA 1KK5A 3EEVA 1SSMA 3R1WA 3VBNA 3FOQA 4HZDA 4G3SA 3TK8A 1MR9A 1T3DA 4G87A 3FSBA 4IHGA 4EA7A 3R2WA 3R3RA 3HJJA 4KQLA 3HSQA 4AA7A 3DK5A 3I3AA 4N6BA 2ICYA 3GOSA 4EGGA 1KQAA 1FXJA 2V0JA 1QQ0A 3R5BA 2OI5A 4KPZA 4R37A 3P1BA 4J18A 2OEGA 1KK4A
chains in the Genus database with same CATH superfamily
1V67A 1XHDA 3NZ2A 2IU9A 2VHEA 4R7PA 3TWDA 3MQGA 3R8YA 4K6RA 3TIOA 5DEPA 3MQHA 4DCLA 4H7OA 4G3QA 1L0SA 1YP4A 5L6VA 2W0WA 2WLFA 4M2BA 3R0SA 3TDTA 1KHRA 3BSWA 3IGJA 3VBMA 4M28A 2V0KA 1TDTA 3SPTA 3T57A 4ISXA 3VBIA 2TDTA 3GUEA 5L6SA 2RIJA 3F1XA 2IUAA 4HZCA 2GGQA 3R5DA 2JF2A 4EABA 1G97A 3D8VA 2V0LA 3GQ9A 3SRTA 1S80A 2GGOA 2JF3A 3OUPA 3DHOA 5AFUV 4M98A 3KWCA 3KWDA 3OH1A 4KNXA 3VBJA 3TV0A 4KNRA 3OU9A 4IHHA 3OH0A 1KK6A 1LXAA 2IU8A 1MRLA 5AFUU 4E1KA 1SSTA 2IC7A 3MC4A 5DG3A 2ICXA 4N27A 4M2AA 3P47A 3FSYA 2V0HA 3VBKA 1KGQA 1MR7A 4AC3A 2WLGA 4J09A 5E3RA 4MZUA 3VNPA 1KRVA 2WLEA 3OH2A 4R36A 2QKXA 3R5AA 3VBLA 2XATA 4HCQA 3FWWA 4M99A 1J2ZA 1M8NA 3FTTA 3ST8A 3R5CA 3GQ7A 4EA8A 4MFGA 5U2KA 2W0VA 3OH4A 1FWYA 1HV9A 1OCXA 3VBPA 2VD4A 2OI6A 1THJA 1QRGA 4EQYA 1XATA 3I3XA 3R3IA 3FSXA 5DEMA 1Z90A 3ECTA 3IXCA 3PMOA 1SSQA 3BSSA 4G3PA 3OW5A 1V3WA 2QIAA 2NPOA 4E6TA 4EAAA 1QREA 3CJ8A 1EWWA 1QRLA 4N6AA 2AQ9A 3TISA 1G95A 2P2OA 3OH3A 3FS8A 3GVDA 1HM8A 4N69A 2WLCA 5ADXU 4E6UA 3C8VA 3GQ8A 4M9CA 4IHFA 5E3QA 3V4EA 3BSYA 1KRUA 3OGZA 1QRMA 2OI7A 3EH0A 1HM9A 4AAWA 1YP2A 3BXYA 1YP3A 1Z2FA 3JQYA 3FSCA 3OTZA 4MYOA 4EA9A 4E79A 5ADXV 4E75A 2QIVX 1KGTA 2I5KA 2WLDA 3EG4A 1HM0A 3DJ4A 4HUSA 1KRRA 5E3PA 4HURA 3Q1XA 2Q4JA 3SUCA 1QRFA 3OTMA 5F42A 3KWEA 2OEFA 2V0IA 3BRKX 3D98A 3BFPA 2FKOA 4KPXA 4FCEA 1KK5A 3EEVA 1SSMA 3R1WA 3VBNA 3FOQA 4HZDA 4G3SA 3TK8A 1MR9A 1T3DA 4G87A 3FSBA 4IHGA 4EA7A 3R2WA 3R3RA 3GQAA 3HJJA 4KQLA 3HSQA 4AA7A 3DK5A 3I3AA 4N6BA 2ICYA 3GOSA 4EGGA 1KQAA 1FXJA 2V0JA 1QQ0A 3R5BA 2OI5A 4KPZA 4R37A 3P1BA 1N4IA 4J18A 2OEGA 1KK4A
chains in the Genus database with same CATH topology
1V67A 1XHDA 3NZ2A 2IU9A 2VHEA 4R7PA 3TWDA 3MQGA 3R8YA 4K6RA 3TIOA 5DEPA 3MQHA 4DCLA 4H7OA 4G3QA 1YP4A 5L6VA 2W0WA 2WLFA 4M2BA 3R0SA 3TDTA 1KHRA 3BSWA 3IGJA 3VBMA 4M28A 2V0KA 1TDTA 3SPTA 3T57A 4ISXA 3VBIA 2TDTA 3GUEA 5L6SA 2RIJA 3F1XA 2IUAA 4HZCA 2GGQA 3R5DA 2JF2A 4EABA 1G97A 3D8VA 2V0LA 3SRTA 1S80A 2GGOA 2JF3A 3OUPA 3DHOA 5AFUV 4M98A 3KWCA 3KWDA 4KNXA 3VBJA 3TV0A 4KNRA 3OU9A 4IHHA 1KK6A 1LXAA 2IU8A 1MRLA 5AFUU 4E1KA 1SSTA 2IC7A 3MC4A 5DG3A 2ICXA 4N27A 4M2AA 3P47A 3FSYA 2V0HA 3VBKA 1KGQA 1MR7A 4AC3A 2WLGA 4J09A 5E3RA 4MZUA 3VNPA 1KRVA 2WLEA 4R36A 2QKXA 3R5AA 3VBLA 2XATA 4HCQA 3FWWA 4M99A 1J2ZA 3FTTA 3ST8A 3R5CA 4EA8A 4MFGA 5U2KA 2W0VA 1FWYA 1HV9A 1OCXA 3VBPA 2VD4A 2OI6A 1THJA 1QRGA 4EQYA 1XATA 3I3XA 3R3IA 3FSXA 5DEMA 1Z90A 3ECTA 3IXCA 3PMOA 1SSQA 3BSSA 4G3PA 3OW5A 1V3WA 2QIAA 2NPOA 4E6TA 4EAAA 1QREA 3CJ8A 1QRLA 4N6AA 2AQ9A 3TISA 1G95A 2P2OA 3FS8A 3GVDA 1HM8A 4N69A 2WLCA 5ADXU 4E6UA 3C8VA 4M9CA 4IHFA 5E3QA 3V4EA 3BSYA 1KRUA 1QRMA 2OI7A 3EH0A 1HM9A 4AAWA 1YP2A 3BXYA 1YP3A 3JQYA 3FSCA 3OTZA 4MYOA 4EA9A 4E79A 5ADXV 4E75A 2QIVX 1KGTA 2I5KA 2WLDA 3EG4A 1HM0A 3DJ4A 4HUSA 1KRRA 5E3PA 4HURA 3Q1XA 2Q4JA 1QRFA 3OTMA 5F42A 3KWEA 2OEFA 2V0IA 3BRKX 3D98A 3BFPA 2FKOA 4KPXA 4FCEA 1KK5A 3EEVA 1SSMA 3R1WA 3VBNA 3FOQA 4HZDA 4G3SA 3TK8A 1MR9A 1T3DA 4G87A 3FSBA 4IHGA 4EA7A 3R2WA 3R3RA 3HJJA 4KQLA 3HSQA 4AA7A 3DK5A 3I3AA 4N6BA 2ICYA 3GOSA 4EGGA 1KQAA 1FXJA 2V0JA 1QQ0A 3R5BA 2OI5A 4KPZA 4R37A 3P1BA 4J18A 2OEGA 1KK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V67 A;  1XHD A;  3NZ2 A;  2IU9 A;  2VHE A;  4R7P A;  3TWD A;  3MQG A;  3R8Y A;  4K6R A;  3TIO A;  5DEP A;  3MQH A;  4DCL A;  4H7O A;  4G3Q A;  1YP4 A;  5L6V A;  2W0W A;  2WLF A;  4M2B A;  3R0S A;  3TDT A;  1KHR A;  3BSW A;  3IGJ A;  3VBM A;  4M28 A;  2V0K A;  1TDT A;  3SPT A;  3T57 A;  4ISX A;  3VBI A;  2TDT A;  3GUE A;  5L6S A;  2RIJ A;  3F1X A;  2IUA A;  4HZC A;  2GGQ A;  3R5D A;  2JF2 A;  4EAB A;  1G97 A;  3D8V A;  2V0L A;  3SRT A;  1S80 A;  2GGO A;  2JF3 A;  3OUP A;  3DHO A;  5AFU V;  4M98 A;  3KWC A;  3KWD A;  4KNX A;  3VBJ A;  3TV0 A;  4KNR A;  3OU9 A;  4IHH A;  1KK6 A;  1LXA A;  2IU8 A;  1MRL A;  5AFU U;  4E1K A;  1SST A;  2IC7 A;  3MC4 A;  5DG3 A;  2ICX A;  4N27 A;  4M2A A;  3P47 A;  3FSY A;  2V0H A;  3VBK A;  1KGQ A;  1MR7 A;  4AC3 A;  2WLG A;  4J09 A;  5E3R A;  4MZU A;  3VNP A;  1KRV A;  2WLE A;  4R36 A;  2QKX A;  3R5A A;  3VBL A;  2XAT A;  4HCQ A;  3FWW A;  4M99 A;  1J2Z A;  3FTT A;  3ST8 A;  3R5C A;  4EA8 A;  4MFG A;  5U2K A;  2W0V A;  1FWY A;  1HV9 A;  1OCX A;  3VBP A;  2VD4 A;  2OI6 A;  1THJ A;  1QRG A;  4EQY A;  1XAT A;  3I3X A;  3R3I A;  3FSX A;  5DEM A;  1Z90 A;  3ECT A;  3IXC A;  3PMO A;  1SSQ A;  3BSS A;  4G3P A;  3OW5 A;  1V3W A;  2QIA A;  2NPO A;  4E6T A;  4EAA A;  1QRE A;  3CJ8 A;  1QRL A;  4N6A A;  2AQ9 A;  3TIS A;  1G95 A;  2P2O A;  3FS8 A;  3GVD A;  1HM8 A;  4N69 A;  2WLC A;  5ADX U;  4E6U A;  3C8V A;  4M9C A;  4IHF A;  5E3Q A;  3V4E A;  3BSY A;  1KRU A;  1QRM A;  2OI7 A;  3EH0 A;  1HM9 A;  4AAW A;  1YP2 A;  3BXY A;  1YP3 A;  3JQY A;  3FSC A;  3OTZ A;  4MYO A;  4EA9 A;  4E79 A;  5ADX V;  4E75 A;  2QIV X;  1KGT A;  2I5K A;  2WLD A;  3EG4 A;  1HM0 A;  3DJ4 A;  4HUS A;  1KRR A;  5E3P A;  4HUR A;  3Q1X A;  2Q4J A;  1QRF A;  3OTM A;  5F42 A;  3KWE A;  2OEF A;  2V0I A;  3BRK X;  3D98 A;  3BFP A;  2FKO A;  4KPX A;  4FCE A;  1KK5 A;  3EEV A;  1SSM A;  3R1W A;  3VBN A;  3FOQ A;  4HZD A;  4G3S A;  3TK8 A;  1MR9 A;  1T3D A;  4G87 A;  3FSB A;  4IHG A;  4EA7 A;  3R2W A;  3R3R A;  3HJJ A;  4KQL A;  3HSQ A;  4AA7 A;  3DK5 A;  3I3A A;  4N6B A;  2ICY A;  3GOS A;  4EGG A;  1KQA A;  1FXJ A;  2V0J A;  1QQ0 A;  3R5B A;  2OI5 A;  4KPZ A;  4R37 A;  3P1B A;  4J18 A;  2OEG A;  1KK4 A; 
#chains in the Genus database with same CATH topology
 1V67 A;  1XHD A;  3NZ2 A;  2IU9 A;  2VHE A;  4R7P A;  3TWD A;  3MQG A;  3R8Y A;  4K6R A;  3TIO A;  5DEP A;  3MQH A;  4DCL A;  4H7O A;  4G3Q A;  1L0S A;  1YP4 A;  5L6V A;  2W0W A;  2WLF A;  4M2B A;  3R0S A;  3TDT A;  1KHR A;  3BSW A;  3IGJ A;  3VBM A;  4M28 A;  2V0K A;  1TDT A;  3SPT A;  3T57 A;  4ISX A;  3VBI A;  2TDT A;  3GUE A;  5L6S A;  2RIJ A;  3F1X A;  2IUA A;  4HZC A;  2GGQ A;  3R5D A;  2JF2 A;  4EAB A;  1G97 A;  3D8V A;  2V0L A;  3GQ9 A;  3SRT A;  1S80 A;  2GGO A;  2JF3 A;  3OUP A;  3DHO A;  5AFU V;  4M98 A;  3KWC A;  3KWD A;  3OH1 A;  4KNX A;  3VBJ A;  3TV0 A;  4KNR A;  3OU9 A;  4IHH A;  3OH0 A;  1KK6 A;  1LXA A;  2IU8 A;  1MRL A;  5AFU U;  4E1K A;  1SST A;  2IC7 A;  3MC4 A;  5DG3 A;  2ICX A;  4N27 A;  4M2A A;  3P47 A;  3FSY A;  2V0H A;  3VBK A;  1KGQ A;  1MR7 A;  4AC3 A;  2WLG A;  4J09 A;  5E3R A;  4MZU A;  3VNP A;  1KRV A;  2WLE A;  3OH2 A;  4R36 A;  2QKX A;  3R5A A;  3VBL A;  2XAT A;  4HCQ A;  3FWW A;  4M99 A;  1J2Z A;  1M8N A;  3FTT A;  3ST8 A;  3R5C A;  3GQ7 A;  4EA8 A;  4MFG A;  5U2K A;  2W0V A;  3OH4 A;  1FWY A;  1HV9 A;  1OCX A;  3VBP A;  2VD4 A;  2OI6 A;  1THJ A;  1QRG A;  4EQY A;  1XAT A;  3I3X A;  3R3I A;  3FSX A;  5DEM A;  1Z90 A;  3ECT A;  3IXC A;  3PMO A;  1SSQ A;  3BSS A;  4G3P A;  3OW5 A;  1V3W A;  2QIA A;  2NPO A;  4E6T A;  4EAA A;  1QRE A;  3CJ8 A;  1EWW A;  1QRL A;  4N6A A;  2AQ9 A;  3TIS A;  1G95 A;  2P2O A;  3OH3 A;  3FS8 A;  3GVD A;  1HM8 A;  4N69 A;  2WLC A;  5ADX U;  4E6U A;  3C8V A;  3GQ8 A;  4M9C A;  4IHF A;  5E3Q A;  3V4E A;  3BSY A;  1KRU A;  3OGZ A;  1QRM A;  2OI7 A;  3EH0 A;  1HM9 A;  4AAW A;  1YP2 A;  3BXY A;  1YP3 A;  1Z2F A;  3JQY A;  3FSC A;  3OTZ A;  4MYO A;  4EA9 A;  4E79 A;  5ADX V;  4E75 A;  2QIV X;  1KGT A;  2I5K A;  2WLD A;  3EG4 A;  1HM0 A;  3DJ4 A;  4HUS A;  1KRR A;  5E3P A;  4HUR A;  3Q1X A;  2Q4J A;  3SUC A;  1QRF A;  3OTM A;  5F42 A;  3KWE A;  2OEF A;  2V0I A;  3BRK X;  3D98 A;  3BFP A;  2FKO A;  4KPX A;  4FCE A;  1KK5 A;  3EEV A;  1SSM A;  3R1W A;  3VBN A;  3FOQ A;  4HZD A;  4G3S A;  3TK8 A;  1MR9 A;  1T3D A;  4G87 A;  3FSB A;  4IHG A;  4EA7 A;  3R2W A;  3R3R A;  3GQA A;  3HJJ A;  4KQL A;  3HSQ A;  4AA7 A;  3DK5 A;  3I3A A;  4N6B A;  2ICY A;  3GOS A;  4EGG A;  1KQA A;  1FXJ A;  2V0J A;  1QQ0 A;  3R5B A;  2OI5 A;  4KPZ A;  4R37 A;  3P1B A;  1N4I A;  4J18 A;  2OEG A;  1KK4 A; 
#chains in the Genus database with same CATH homology
 1V67 A;  1XHD A;  3NZ2 A;  2IU9 A;  2VHE A;  4R7P A;  3TWD A;  3MQG A;  3R8Y A;  4K6R A;  3TIO A;  5DEP A;  3MQH A;  4DCL A;  4H7O A;  4G3Q A;  1YP4 A;  5L6V A;  2W0W A;  2WLF A;  4M2B A;  3R0S A;  3TDT A;  1KHR A;  3BSW A;  3IGJ A;  3VBM A;  4M28 A;  2V0K A;  1TDT A;  3SPT A;  3T57 A;  4ISX A;  3VBI A;  2TDT A;  3GUE A;  5L6S A;  2RIJ A;  3F1X A;  2IUA A;  4HZC A;  2GGQ A;  3R5D A;  2JF2 A;  4EAB A;  1G97 A;  3D8V A;  2V0L A;  3SRT A;  1S80 A;  2GGO A;  2JF3 A;  3OUP A;  3DHO A;  5AFU V;  4M98 A;  3KWC A;  3KWD A;  4KNX A;  3VBJ A;  3TV0 A;  4KNR A;  3OU9 A;  4IHH A;  1KK6 A;  1LXA A;  2IU8 A;  1MRL A;  5AFU U;  4E1K A;  1SST A;  2IC7 A;  3MC4 A;  5DG3 A;  2ICX A;  4N27 A;  4M2A A;  3P47 A;  3FSY A;  2V0H A;  3VBK A;  1KGQ A;  1MR7 A;  4AC3 A;  2WLG A;  4J09 A;  5E3R A;  4MZU A;  3VNP A;  1KRV A;  2WLE A;  4R36 A;  2QKX A;  3R5A A;  3VBL A;  2XAT A;  4HCQ A;  3FWW A;  4M99 A;  1J2Z A;  3FTT A;  3ST8 A;  3R5C A;  4EA8 A;  4MFG A;  5U2K A;  2W0V A;  1FWY A;  1HV9 A;  1OCX A;  3VBP A;  2VD4 A;  2OI6 A;  1THJ A;  1QRG A;  4EQY A;  1XAT A;  3I3X A;  3R3I A;  3FSX A;  5DEM A;  1Z90 A;  3ECT A;  3IXC A;  3PMO A;  1SSQ A;  3BSS A;  4G3P A;  3OW5 A;  1V3W A;  2QIA A;  2NPO A;  4E6T A;  4EAA A;  1QRE A;  3CJ8 A;  1QRL A;  4N6A A;  2AQ9 A;  3TIS A;  1G95 A;  2P2O A;  3FS8 A;  3GVD A;  1HM8 A;  4N69 A;  2WLC A;  5ADX U;  4E6U A;  3C8V A;  4M9C A;  4IHF A;  5E3Q A;  3V4E A;  3BSY A;  1KRU A;  1QRM A;  2OI7 A;  3EH0 A;  1HM9 A;  4AAW A;  1YP2 A;  3BXY A;  1YP3 A;  3JQY A;  3FSC A;  3OTZ A;  4MYO A;  4EA9 A;  4E79 A;  5ADX V;  4E75 A;  2QIV X;  1KGT A;  2I5K A;  2WLD A;  3EG4 A;  1HM0 A;  3DJ4 A;  4HUS A;  1KRR A;  5E3P A;  4HUR A;  3Q1X A;  2Q4J A;  1QRF A;  3OTM A;  5F42 A;  3KWE A;  2OEF A;  2V0I A;  3BRK X;  3D98 A;  3BFP A;  2FKO A;  4KPX A;  4FCE A;  1KK5 A;  3EEV A;  1SSM A;  3R1W A;  3VBN A;  3FOQ A;  4HZD A;  4G3S A;  3TK8 A;  1MR9 A;  1T3D A;  4G87 A;  3FSB A;  4IHG A;  4EA7 A;  3R2W A;  3R3R A;  3HJJ A;  4KQL A;  3HSQ A;  4AA7 A;  3DK5 A;  3I3A A;  4N6B A;  2ICY A;  3GOS A;  4EGG A;  1KQA A;  1FXJ A;  2V0J A;  1QQ0 A;  3R5B A;  2OI5 A;  4KPZ A;  4R37 A;  3P1B A;  4J18 A;  2OEG A;  1KK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...