1QRGA

A closer look and the active site of gamma-carbonic anhydrases: high resolution crystallographic studies of the carbonic anhydrase from methanosarcina thermophila
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
b'FSNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONIC ANHYDRASE
publication title A closer look at the active site of gamma-class carbonic anhydrases: high-resolution crystallographic studies of the carbonic anhydrase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Lyase
total genus 75
structure length 206
sequence length 206
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1999-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1qrgA00
2Q4JA 3R5AA 3P1BA 2ICYA 2V0LA 4G3PA 1QRGA 4J09A 4K6RA 4KPZA 3FSBA 3MQGA 3DK5A 4H7OA 3JQYA 1KQAA 3TWDA 3VBPA 5L6SA 1KRRA 3F1XA 3EEVA 2OI7A 2V0IA 3FWWA 4HUSA 5E3QA 4M2BA 5DEPA 1MR7A 1HM0A 3FSCA 3HJJA 3FOQA 4MYOA 4G87A 3TISA 1HM9A 2AQ9A 5ADXU 2I5KA 4EAAA 3VNPA 3D8VA 1QREA 5AFUV 5L6VA 1SSTA 1HM8A 3I3XA 3R2WA 4G3SA 4N6AA 3VBJA 1KGQA 3GUEA 4KQLA 2GGOA 4G3QA 3IXCA 1KK6A 5DEMA 3VBLA 2IU9A 3FSYA 3DHOA 1Z90A 3R5DA 3DJ4A 3OTMA 2OEFA 2W0VA 4AAWA 3VBNA 1KRVA 1MRLA 4IHGA 1QRLA 2NPOA 3EG4A 4AA7A 1S80A 4J18A 2QKXA 4KNRA 3BSSA 4IHFA 1YP3A 4MZUA 1V3WA 2OEGA 2WLGA 2IU8A 3SPTA 5U2KA 1FWYA 1TDTA 2QIVX 1MR9A 3FSXA 1OCXA 4KPXA 4N69A 5E3PA 3GVDA 3BRKX 3OUPA 3OW5A 3TIOA 4M28A 1J2ZA 1THJA 4N27A 4AC3A 3R3IA 1SSMA 3GOSA 3IGJA 3KWDA 3PMOA 3VBMA 1SSQA 3Q1XA 4HURA 2WLEA 3C8VA 3SRTA 3VBKA 1XHDA 2JF2A 4R36A 4EA9A 3R8YA 2WLCA 3BXYA 3MQHA 5F42A 2OI6A 2XATA 2GGQA 4E6UA 3KWCA 4HZDA 3P47A 3R1WA 3ST8A 3FTTA 4E79A 2RIJA 3KWEA 4IHHA 3D98A 1QRFA 3TK8A 3CJ8A 3EH0A 3OTZA 1XATA 2V0HA 5AFUU 1V67A 4FCEA 4ISXA 2QIAA 4DCLA 4HZCA 5ADXV 1G97A 2OI5A 3FS8A 4R7PA 1YP4A 2V0KA 2VHEA 3BFPA 3OU9A 3R3RA 3TDTA 4EABA 4EQYA 4E75A 1G95A 2IC7A 1KHRA 3V4EA 3ECTA 3I3AA 2VD4A 2P2OA 2WLDA 4M98A 3NZ2A 4M99A 4EA7A 1KGTA 3BSYA 4MFGA 3R5BA 1KRUA 1FXJA 2W0WA 2FKOA 4KNXA 4E1KA 4EA8A 2IUAA 3HSQA 4M2AA 3MC4A 1KK4A 3TV0A 1QRMA 2V0JA 2TDTA 3BSWA 4EGGA 1KK5A 4R37A 4N6BA 2JF3A 5E3RA 2WLFA 3T57A 4HCQA 1YP2A 1T3DA 2ICXA 3VBIA 4E6TA 3R0SA 3R5CA 1LXAA 1HV9A 4M9CA 1QQ0A 5DG3A
chains in the Genus database with same CATH superfamily
2Q4JA 3R5AA 3P1BA 2ICYA 3OH1A 2V0LA 4G3PA 1QRGA 4J09A 4K6RA 4KPZA 3FSBA 3MQGA 3DK5A 4H7OA 3JQYA 1KQAA 3TWDA 3VBPA 5L6SA 1KRRA 3F1XA 3EEVA 2OI7A 2V0IA 3FWWA 4HUSA 5E3QA 4M2BA 3SUCA 5DEPA 1MR7A 1HM0A 3FSCA 3HJJA 3FOQA 4MYOA 4G87A 3TISA 1HM9A 2AQ9A 5ADXU 2I5KA 4EAAA 3VNPA 3D8VA 1QREA 5AFUV 5L6VA 1SSTA 1HM8A 3I3XA 3R2WA 4G3SA 4N6AA 3VBJA 1KGQA 3GUEA 4KQLA 2GGOA 4G3QA 3IXCA 1KK6A 5DEMA 3VBLA 2IU9A 3FSYA 3DHOA 1Z90A 3R5DA 3DJ4A 3OTMA 2OEFA 2W0VA 4AAWA 3VBNA 1KRVA 1MRLA 4IHGA 1QRLA 2NPOA 3EG4A 4AA7A 1S80A 4J18A 1Z2FA 2QKXA 3BSSA 4KNRA 4IHFA 1YP3A 4MZUA 1V3WA 2OEGA 2WLGA 2IU8A 3SPTA 5U2KA 1N4IA 1FWYA 1TDTA 2QIVX 1MR9A 3FSXA 1OCXA 4KPXA 3GQAA 4N69A 5E3PA 3GVDA 1M8NA 3BRKX 3OUPA 3OW5A 3TIOA 4M28A 1J2ZA 1THJA 4N27A 4AC3A 3R3IA 1SSMA 3GOSA 3IGJA 3KWDA 3PMOA 3OH3A 3VBMA 1SSQA 3Q1XA 4HURA 2WLEA 3C8VA 3SRTA 3VBKA 1XHDA 2JF2A 4R36A 4EA9A 1L0SA 3R8YA 2WLCA 3BXYA 3MQHA 5F42A 2OI6A 3GQ9A 2XATA 2GGQA 4E6UA 3KWCA 4HZDA 3P47A 3R1WA 3ST8A 3FTTA 4E79A 2RIJA 3KWEA 4IHHA 3D98A 1QRFA 3OH2A 3TK8A 3CJ8A 3EH0A 3GQ7A 1XATA 3OTZA 2V0HA 5AFUU 1V67A 4FCEA 4ISXA 2QIAA 4DCLA 4HZCA 3OH0A 1G97A 5ADXV 1EWWA 2OI5A 3FS8A 4R7PA 1YP4A 2V0KA 2VHEA 3BFPA 3OU9A 3R3RA 3TDTA 4EABA 4EQYA 4E75A 1G95A 2IC7A 1KHRA 3V4EA 3ECTA 3I3AA 2P2OA 2VD4A 2WLDA 4M98A 3NZ2A 4M99A 4EA7A 1KGTA 3BSYA 4MFGA 3R5BA 1KRUA 1FXJA 2W0WA 2FKOA 3OH4A 4KNXA 4E1KA 4EA8A 2IUAA 3HSQA 4M2AA 3MC4A 1KK4A 3GQ8A 3TV0A 1QRMA 2V0JA 2TDTA 3BSWA 4EGGA 1KK5A 4R37A 4N6BA 2JF3A 5E3RA 2WLFA 3T57A 4HCQA 1YP2A 3OGZA 1T3DA 2ICXA 3VBIA 4E6TA 3R0SA 3R5CA 1LXAA 1HV9A 4M9CA 1QQ0A 5DG3A
chains in the Genus database with same CATH topology
2Q4JA 3R5AA 3P1BA 2ICYA 2V0LA 4G3PA 1QRGA 4J09A 4K6RA 4KPZA 3FSBA 3MQGA 3DK5A 4H7OA 3JQYA 1KQAA 3TWDA 3VBPA 5L6SA 1KRRA 3F1XA 3EEVA 2OI7A 2V0IA 3FWWA 4HUSA 5E3QA 4M2BA 5DEPA 1MR7A 1HM0A 3FSCA 3HJJA 3FOQA 4MYOA 4G87A 3TISA 1HM9A 2AQ9A 5ADXU 2I5KA 4EAAA 3VNPA 3D8VA 1QREA 5AFUV 5L6VA 1SSTA 1HM8A 3I3XA 3R2WA 4G3SA 4N6AA 3VBJA 1KGQA 3GUEA 4KQLA 2GGOA 4G3QA 3IXCA 1KK6A 5DEMA 3VBLA 2IU9A 3FSYA 3DHOA 1Z90A 3R5DA 3DJ4A 3OTMA 2OEFA 2W0VA 4AAWA 3VBNA 1KRVA 1MRLA 4IHGA 1QRLA 2NPOA 3EG4A 4AA7A 1S80A 4J18A 2QKXA 4KNRA 3BSSA 4IHFA 1YP3A 4MZUA 1V3WA 2OEGA 2WLGA 2IU8A 3SPTA 5U2KA 1FWYA 1TDTA 2QIVX 1MR9A 3FSXA 1OCXA 4KPXA 4N69A 5E3PA 3GVDA 3BRKX 3OUPA 3OW5A 3TIOA 4M28A 1J2ZA 1THJA 4N27A 4AC3A 3R3IA 1SSMA 3GOSA 3IGJA 3KWDA 3PMOA 3VBMA 1SSQA 3Q1XA 4HURA 2WLEA 3C8VA 3SRTA 3VBKA 1XHDA 2JF2A 4R36A 4EA9A 3R8YA 2WLCA 3BXYA 3MQHA 5F42A 2OI6A 2XATA 2GGQA 4E6UA 3KWCA 4HZDA 3P47A 3R1WA 3ST8A 3FTTA 4E79A 2RIJA 3KWEA 4IHHA 3D98A 1QRFA 3TK8A 3CJ8A 3EH0A 3OTZA 1XATA 2V0HA 5AFUU 1V67A 4FCEA 4ISXA 2QIAA 4DCLA 4HZCA 5ADXV 1G97A 2OI5A 3FS8A 4R7PA 1YP4A 2V0KA 2VHEA 3BFPA 3OU9A 3R3RA 3TDTA 4EABA 4EQYA 4E75A 1G95A 2IC7A 1KHRA 3V4EA 3ECTA 3I3AA 2VD4A 2P2OA 2WLDA 4M98A 3NZ2A 4M99A 4EA7A 1KGTA 3BSYA 4MFGA 3R5BA 1KRUA 1FXJA 2W0WA 2FKOA 4KNXA 4E1KA 4EA8A 2IUAA 3HSQA 4M2AA 3MC4A 1KK4A 3TV0A 1QRMA 2V0JA 2TDTA 3BSWA 4EGGA 1KK5A 4R37A 4N6BA 2JF3A 5E3RA 2WLFA 3T57A 4HCQA 1YP2A 1T3DA 2ICXA 3VBIA 4E6TA 3R0SA 3R5CA 1LXAA 1HV9A 4M9CA 1QQ0A 5DG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q4J A;  3R5A A;  3P1B A;  2ICY A;  2V0L A;  4G3P A;  1QRG A;  4J09 A;  4K6R A;  4KPZ A;  3FSB A;  3MQG A;  3DK5 A;  4H7O A;  3JQY A;  1KQA A;  3TWD A;  3VBP A;  5L6S A;  1KRR A;  3F1X A;  3EEV A;  2OI7 A;  2V0I A;  3FWW A;  4HUS A;  5E3Q A;  4M2B A;  5DEP A;  1MR7 A;  1HM0 A;  3FSC A;  3HJJ A;  3FOQ A;  4MYO A;  4G87 A;  3TIS A;  1HM9 A;  2AQ9 A;  5ADX U;  2I5K A;  4EAA A;  3VNP A;  3D8V A;  1QRE A;  5AFU V;  5L6V A;  1SST A;  1HM8 A;  3I3X A;  3R2W A;  4G3S A;  4N6A A;  3VBJ A;  1KGQ A;  3GUE A;  4KQL A;  2GGO A;  4G3Q A;  3IXC A;  1KK6 A;  5DEM A;  3VBL A;  2IU9 A;  3FSY A;  3DHO A;  1Z90 A;  3R5D A;  3DJ4 A;  3OTM A;  2OEF A;  2W0V A;  4AAW A;  3VBN A;  1KRV A;  1MRL A;  4IHG A;  1QRL A;  2NPO A;  3EG4 A;  4AA7 A;  1S80 A;  4J18 A;  2QKX A;  4KNR A;  3BSS A;  4IHF A;  1YP3 A;  4MZU A;  1V3W A;  2OEG A;  2WLG A;  2IU8 A;  3SPT A;  5U2K A;  1FWY A;  1TDT A;  2QIV X;  1MR9 A;  3FSX A;  1OCX A;  4KPX A;  4N69 A;  5E3P A;  3GVD A;  3BRK X;  3OUP A;  3OW5 A;  3TIO A;  4M28 A;  1J2Z A;  1THJ A;  4N27 A;  4AC3 A;  3R3I A;  1SSM A;  3GOS A;  3IGJ A;  3KWD A;  3PMO A;  3VBM A;  1SSQ A;  3Q1X A;  4HUR A;  2WLE A;  3C8V A;  3SRT A;  3VBK A;  1XHD A;  2JF2 A;  4R36 A;  4EA9 A;  3R8Y A;  2WLC A;  3BXY A;  3MQH A;  5F42 A;  2OI6 A;  2XAT A;  2GGQ A;  4E6U A;  3KWC A;  4HZD A;  3P47 A;  3R1W A;  3ST8 A;  3FTT A;  4E79 A;  2RIJ A;  3KWE A;  4IHH A;  3D98 A;  1QRF A;  3TK8 A;  3CJ8 A;  3EH0 A;  3OTZ A;  1XAT A;  2V0H A;  5AFU U;  1V67 A;  4FCE A;  4ISX A;  2QIA A;  4DCL A;  4HZC A;  5ADX V;  1G97 A;  2OI5 A;  3FS8 A;  4R7P A;  1YP4 A;  2V0K A;  2VHE A;  3BFP A;  3OU9 A;  3R3R A;  3TDT A;  4EAB A;  4EQY A;  4E75 A;  1G95 A;  2IC7 A;  1KHR A;  3V4E A;  3ECT A;  3I3A A;  2VD4 A;  2P2O A;  2WLD A;  4M98 A;  3NZ2 A;  4M99 A;  4EA7 A;  1KGT A;  3BSY A;  4MFG A;  3R5B A;  1KRU A;  1FXJ A;  2W0W A;  2FKO A;  4KNX A;  4E1K A;  4EA8 A;  2IUA A;  3HSQ A;  4M2A A;  3MC4 A;  1KK4 A;  3TV0 A;  1QRM A;  2V0J A;  2TDT A;  3BSW A;  4EGG A;  1KK5 A;  4R37 A;  4N6B A;  2JF3 A;  5E3R A;  2WLF A;  3T57 A;  4HCQ A;  1YP2 A;  1T3D A;  2ICX A;  3VBI A;  4E6T A;  3R0S A;  3R5C A;  1LXA A;  1HV9 A;  4M9C A;  1QQ0 A;  5DG3 A; 
#chains in the Genus database with same CATH topology
 2Q4J A;  3R5A A;  3P1B A;  2ICY A;  3OH1 A;  2V0L A;  4G3P A;  1QRG A;  4J09 A;  4K6R A;  4KPZ A;  3FSB A;  3MQG A;  3DK5 A;  4H7O A;  3JQY A;  1KQA A;  3TWD A;  3VBP A;  5L6S A;  1KRR A;  3F1X A;  3EEV A;  2OI7 A;  2V0I A;  3FWW A;  4HUS A;  5E3Q A;  4M2B A;  3SUC A;  5DEP A;  1MR7 A;  1HM0 A;  3FSC A;  3HJJ A;  3FOQ A;  4MYO A;  4G87 A;  3TIS A;  1HM9 A;  2AQ9 A;  5ADX U;  2I5K A;  4EAA A;  3VNP A;  3D8V A;  1QRE A;  5AFU V;  5L6V A;  1SST A;  1HM8 A;  3I3X A;  3R2W A;  4G3S A;  4N6A A;  3VBJ A;  1KGQ A;  3GUE A;  4KQL A;  2GGO A;  4G3Q A;  3IXC A;  1KK6 A;  5DEM A;  3VBL A;  2IU9 A;  3FSY A;  3DHO A;  1Z90 A;  3R5D A;  3DJ4 A;  3OTM A;  2OEF A;  2W0V A;  4AAW A;  3VBN A;  1KRV A;  1MRL A;  4IHG A;  1QRL A;  2NPO A;  3EG4 A;  4AA7 A;  1S80 A;  4J18 A;  1Z2F A;  2QKX A;  3BSS A;  4KNR A;  4IHF A;  1YP3 A;  4MZU A;  1V3W A;  2OEG A;  2WLG A;  2IU8 A;  3SPT A;  5U2K A;  1N4I A;  1FWY A;  1TDT A;  2QIV X;  1MR9 A;  3FSX A;  1OCX A;  4KPX A;  3GQA A;  4N69 A;  5E3P A;  3GVD A;  1M8N A;  3BRK X;  3OUP A;  3OW5 A;  3TIO A;  4M28 A;  1J2Z A;  1THJ A;  4N27 A;  4AC3 A;  3R3I A;  1SSM A;  3GOS A;  3IGJ A;  3KWD A;  3PMO A;  3OH3 A;  3VBM A;  1SSQ A;  3Q1X A;  4HUR A;  2WLE A;  3C8V A;  3SRT A;  3VBK A;  1XHD A;  2JF2 A;  4R36 A;  4EA9 A;  1L0S A;  3R8Y A;  2WLC A;  3BXY A;  3MQH A;  5F42 A;  2OI6 A;  3GQ9 A;  2XAT A;  2GGQ A;  4E6U A;  3KWC A;  4HZD A;  3P47 A;  3R1W A;  3ST8 A;  3FTT A;  4E79 A;  2RIJ A;  3KWE A;  4IHH A;  3D98 A;  1QRF A;  3OH2 A;  3TK8 A;  3CJ8 A;  3EH0 A;  3GQ7 A;  1XAT A;  3OTZ A;  2V0H A;  5AFU U;  1V67 A;  4FCE A;  4ISX A;  2QIA A;  4DCL A;  4HZC A;  3OH0 A;  1G97 A;  5ADX V;  1EWW A;  2OI5 A;  3FS8 A;  4R7P A;  1YP4 A;  2V0K A;  2VHE A;  3BFP A;  3OU9 A;  3R3R A;  3TDT A;  4EAB A;  4EQY A;  4E75 A;  1G95 A;  2IC7 A;  1KHR A;  3V4E A;  3ECT A;  3I3A A;  2P2O A;  2VD4 A;  2WLD A;  4M98 A;  3NZ2 A;  4M99 A;  4EA7 A;  1KGT A;  3BSY A;  4MFG A;  3R5B A;  1KRU A;  1FXJ A;  2W0W A;  2FKO A;  3OH4 A;  4KNX A;  4E1K A;  4EA8 A;  2IUA A;  3HSQ A;  4M2A A;  3MC4 A;  1KK4 A;  3GQ8 A;  3TV0 A;  1QRM A;  2V0J A;  2TDT A;  3BSW A;  4EGG A;  1KK5 A;  4R37 A;  4N6B A;  2JF3 A;  5E3R A;  2WLF A;  3T57 A;  4HCQ A;  1YP2 A;  3OGZ A;  1T3D A;  2ICX A;  3VBI A;  4E6T A;  3R0S A;  3R5C A;  1LXA A;  1HV9 A;  4M9C A;  1QQ0 A;  5DG3 A; 
#chains in the Genus database with same CATH homology
 2Q4J A;  3R5A A;  3P1B A;  2ICY A;  2V0L A;  4G3P A;  1QRG A;  4J09 A;  4K6R A;  4KPZ A;  3FSB A;  3MQG A;  3DK5 A;  4H7O A;  3JQY A;  1KQA A;  3TWD A;  3VBP A;  5L6S A;  1KRR A;  3F1X A;  3EEV A;  2OI7 A;  2V0I A;  3FWW A;  4HUS A;  5E3Q A;  4M2B A;  5DEP A;  1MR7 A;  1HM0 A;  3FSC A;  3HJJ A;  3FOQ A;  4MYO A;  4G87 A;  3TIS A;  1HM9 A;  2AQ9 A;  5ADX U;  2I5K A;  4EAA A;  3VNP A;  3D8V A;  1QRE A;  5AFU V;  5L6V A;  1SST A;  1HM8 A;  3I3X A;  3R2W A;  4G3S A;  4N6A A;  3VBJ A;  1KGQ A;  3GUE A;  4KQL A;  2GGO A;  4G3Q A;  3IXC A;  1KK6 A;  5DEM A;  3VBL A;  2IU9 A;  3FSY A;  3DHO A;  1Z90 A;  3R5D A;  3DJ4 A;  3OTM A;  2OEF A;  2W0V A;  4AAW A;  3VBN A;  1KRV A;  1MRL A;  4IHG A;  1QRL A;  2NPO A;  3EG4 A;  4AA7 A;  1S80 A;  4J18 A;  2QKX A;  4KNR A;  3BSS A;  4IHF A;  1YP3 A;  4MZU A;  1V3W A;  2OEG A;  2WLG A;  2IU8 A;  3SPT A;  5U2K A;  1FWY A;  1TDT A;  2QIV X;  1MR9 A;  3FSX A;  1OCX A;  4KPX A;  4N69 A;  5E3P A;  3GVD A;  3BRK X;  3OUP A;  3OW5 A;  3TIO A;  4M28 A;  1J2Z A;  1THJ A;  4N27 A;  4AC3 A;  3R3I A;  1SSM A;  3GOS A;  3IGJ A;  3KWD A;  3PMO A;  3VBM A;  1SSQ A;  3Q1X A;  4HUR A;  2WLE A;  3C8V A;  3SRT A;  3VBK A;  1XHD A;  2JF2 A;  4R36 A;  4EA9 A;  3R8Y A;  2WLC A;  3BXY A;  3MQH A;  5F42 A;  2OI6 A;  2XAT A;  2GGQ A;  4E6U A;  3KWC A;  4HZD A;  3P47 A;  3R1W A;  3ST8 A;  3FTT A;  4E79 A;  2RIJ A;  3KWE A;  4IHH A;  3D98 A;  1QRF A;  3TK8 A;  3CJ8 A;  3EH0 A;  3OTZ A;  1XAT A;  2V0H A;  5AFU U;  1V67 A;  4FCE A;  4ISX A;  2QIA A;  4DCL A;  4HZC A;  5ADX V;  1G97 A;  2OI5 A;  3FS8 A;  4R7P A;  1YP4 A;  2V0K A;  2VHE A;  3BFP A;  3OU9 A;  3R3R A;  3TDT A;  4EAB A;  4EQY A;  4E75 A;  1G95 A;  2IC7 A;  1KHR A;  3V4E A;  3ECT A;  3I3A A;  2VD4 A;  2P2O A;  2WLD A;  4M98 A;  3NZ2 A;  4M99 A;  4EA7 A;  1KGT A;  3BSY A;  4MFG A;  3R5B A;  1KRU A;  1FXJ A;  2W0W A;  2FKO A;  4KNX A;  4E1K A;  4EA8 A;  2IUA A;  3HSQ A;  4M2A A;  3MC4 A;  1KK4 A;  3TV0 A;  1QRM A;  2V0J A;  2TDT A;  3BSW A;  4EGG A;  1KK5 A;  4R37 A;  4N6B A;  2JF3 A;  5E3R A;  2WLF A;  3T57 A;  4HCQ A;  1YP2 A;  1T3D A;  2ICX A;  3VBI A;  4E6T A;  3R0S A;  3R5C A;  1LXA A;  1HV9 A;  4M9C A;  1QQ0 A;  5DG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...