1QRGA

A closer look and the active site of gamma-carbonic anhydrases: high resolution crystallographic studies of the carbonic anhydrase from methanosarcina thermophila
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
FSNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONIC ANHYDRASE
publication title A closer look at the active site of gamma-class carbonic anhydrases: high-resolution crystallographic studies of the carbonic anhydrase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Lyase
total genus 75
structure length 206
sequence length 206
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1999-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1qrgA00
3SPTA 1S80A 3ECTA 2W0WA 4KPXA 4EA9A 2OI5A 3R5CA 3TWDA 1KHRA 2WLCA 3P47A 4J09A 4R37A 1G97A 3D98A 3PMOA 2VHEA 4G3PA 2JF2A 5L6SA 2IC7A 4J18A 5E3RA 4K6RA 1HM0A 3VBPA 3EH0A 3VBKA 2P2OA 1J2ZA 3R0SA 4G3SA 4HZCA 1QRMA 2OI6A 4EQYA 3VBNA 4M98A 4N27A 3IXCA 4KQLA 1T3DA 4G87A 1HM9A 4IHFA 3D8VA 2IU8A 5AFUU 3DHOA 2V0IA 2AQ9A 3R3IA 3BFPA 2WLDA 4HCQA 1QRLA 3R3RA 3VBJA 3CJ8A 3KWEA 1KRUA 2V0KA 3HSQA 3BSWA 3NZ2A 4E1KA 3BSSA 4N6BA 3TIOA 1G95A 2XATA 3HJJA 3C8VA 3VBMA 1QRGA 2I5KA 2V0LA 4FCEA 1YP3A 1QQ0A 3OTMA 3KWDA 5L6VA 1MR7A 1SSQA 3FS8A 1XHDA 4EAAA 4N69A 2V0JA 2QIVX 1SSTA 2FKOA 1KK6A 2JF3A 5DG3A 3OU9A 3BSYA 5U2KA 2WLGA 3OTZA 2V0HA 3F1XA 4MYOA 4KNRA 2QIAA 2W0VA 3OW5A 1SSMA 2OI7A 2IUAA 2ICYA 5ADXU 3DK5A 3SRTA 4M2AA 3FOQA 3FSYA 3GUEA 4H7OA 4HUSA 5E3PA 2QKXA 2NPOA 4R7PA 3I3AA 5F42A 3I3XA 2WLEA 3R1WA 3R2WA 3FSCA 1HM8A 1THJA 1Z90A 3R8YA 4R36A 5DEPA 4MFGA 1KK5A 4M99A 1MRLA 4HZDA 1KGQA 1FWYA 5E3QA 1OCXA 3BRKX 4IHGA 1V3WA 3FSXA 3EG4A 1KK4A 4MZUA 5DEMA 2OEFA 4HURA 4E75A 2VD4A 2ICXA 5AFUV 3ST8A 1QRFA 3IGJA 4M28A 4E6TA 5ADXV 1YP4A 3FTTA 3FWWA 3P1BA 1HV9A 3R5AA 3R5BA 1XATA 2GGOA 3MQGA 3FSBA 3R5DA 4AC3A 1KRRA 4EABA 4G3QA 4KPZA 1LXAA 3VBIA 4EA8A 3TISA 3MC4A 3VBLA 4DCLA 4E79A 3VNPA 1V67A 1KQAA 4EGGA 1TDTA 3GOSA 3OUPA 4AA7A 3TK8A 3V4EA 4AAWA 3JQYA 2GGQA 1QREA 2TDTA 4M2BA 4E6UA 1YP2A 1FXJA 1KGTA 2WLFA 3BXYA 3EEVA 4KNXA 1MR9A 3GVDA 2RIJA 3Q1XA 4ISXA 4M9CA 4N6AA 4EA7A 1KRVA 2IU9A 2Q4JA 4IHHA 3TDTA 3MQHA 3DJ4A 3TV0A 3T57A 2OEGA 3KWCA
chains in the Genus database with same CATH superfamily
3SPTA 1S80A 3ECTA 2W0WA 4KPXA 4EA9A 2OI5A 3R5CA 3TWDA 1KHRA 2WLCA 3P47A 4J09A 4R37A 1G97A 3D98A 3PMOA 2VHEA 4G3PA 2JF2A 5L6SA 2IC7A 4J18A 5E3RA 4K6RA 1HM0A 3VBPA 1M8NA 3GQ8A 1Z2FA 3EH0A 3VBKA 1N4IA 2P2OA 1J2ZA 3R0SA 4G3SA 4HZCA 1QRMA 2OI6A 4EQYA 3VBNA 4M98A 4N27A 3IXCA 4KQLA 1T3DA 4G87A 1HM9A 4IHFA 3D8VA 2IU8A 5AFUU 3DHOA 2AQ9A 2V0IA 3R3IA 3BFPA 2WLDA 4HCQA 1QRLA 3R3RA 3OH1A 3VBJA 1L0SA 3CJ8A 3KWEA 1KRUA 2V0KA 3HSQA 3BSWA 3NZ2A 4E1KA 3BSSA 4N6BA 3TIOA 1G95A 2XATA 3HJJA 3C8VA 3VBMA 1QRGA 2I5KA 2V0LA 4FCEA 1YP3A 1QQ0A 3OTMA 3KWDA 5L6VA 1MR7A 1SSQA 3FS8A 1XHDA 4EAAA 4N69A 2QIVX 2V0JA 1SSTA 2FKOA 1KK6A 2JF3A 5DG3A 3OU9A 3OH4A 3BSYA 5U2KA 2WLGA 3OTZA 2V0HA 3F1XA 4MYOA 4KNRA 2QIAA 2W0VA 3OW5A 1SSMA 2OI7A 2IUAA 2ICYA 5ADXU 3DK5A 3SRTA 4M2AA 3FOQA 3FSYA 3GUEA 4H7OA 4HUSA 5E3PA 2QKXA 2NPOA 4R7PA 3I3AA 5F42A 3I3XA 2WLEA 3R1WA 3R2WA 3FSCA 1HM8A 3OH3A 1THJA 1Z90A 3R8YA 4R36A 5DEPA 4MFGA 1KK5A 4M99A 1MRLA 4HZDA 1KGQA 1FWYA 5E3QA 1OCXA 3BRKX 4IHGA 3GQ7A 1V3WA 3FSXA 3EG4A 1KK4A 4MZUA 5DEMA 2OEFA 4HURA 4E75A 2VD4A 2ICXA 5AFUV 3ST8A 1QRFA 3IGJA 4M28A 4E6TA 5ADXV 1YP4A 3FTTA 3FWWA 3P1BA 1HV9A 3R5AA 3R5BA 1XATA 2GGOA 3GQAA 3MQGA 3SUCA 3FSBA 3R5DA 4AC3A 1KRRA 4EABA 4G3QA 4KPZA 1LXAA 3OH2A 3VBIA 4EA8A 3TISA 3MC4A 3VBLA 4DCLA 4E79A 3VNPA 1V67A 1KQAA 4EGGA 1TDTA 3GOSA 3OUPA 4AA7A 3TK8A 3V4EA 4AAWA 3JQYA 2GGQA 1QREA 2TDTA 3GQ9A 3OGZA 1EWWA 4M2BA 4E6UA 1YP2A 1FXJA 1KGTA 2WLFA 3BXYA 3EEVA 4KNXA 1MR9A 3GVDA 2RIJA 3Q1XA 4ISXA 3OH0A 4M9CA 4N6AA 4EA7A 1KRVA 2IU9A 2Q4JA 4IHHA 3TDTA 3MQHA 3DJ4A 3TV0A 3T57A 2OEGA 3KWCA
chains in the Genus database with same CATH topology
3SPTA 1S80A 3ECTA 2W0WA 4KPXA 4EA9A 2OI5A 3R5CA 3TWDA 1KHRA 2WLCA 3P47A 4J09A 4R37A 1G97A 3D98A 3PMOA 2VHEA 4G3PA 2JF2A 5L6SA 2IC7A 4J18A 5E3RA 4K6RA 1HM0A 3VBPA 3EH0A 3VBKA 2P2OA 1J2ZA 3R0SA 4G3SA 4HZCA 1QRMA 2OI6A 4EQYA 3VBNA 4M98A 4N27A 3IXCA 4KQLA 1T3DA 4G87A 1HM9A 4IHFA 3D8VA 2IU8A 5AFUU 3DHOA 2V0IA 2AQ9A 3R3IA 3BFPA 2WLDA 4HCQA 1QRLA 3R3RA 3VBJA 3CJ8A 3KWEA 1KRUA 2V0KA 3HSQA 3BSWA 3NZ2A 4E1KA 3BSSA 4N6BA 3TIOA 1G95A 2XATA 3HJJA 3C8VA 3VBMA 1QRGA 2I5KA 2V0LA 4FCEA 1YP3A 1QQ0A 3OTMA 3KWDA 5L6VA 1MR7A 1SSQA 3FS8A 1XHDA 4EAAA 4N69A 2V0JA 2QIVX 1SSTA 2FKOA 1KK6A 2JF3A 5DG3A 3OU9A 3BSYA 5U2KA 2WLGA 3OTZA 2V0HA 3F1XA 4MYOA 4KNRA 2QIAA 2W0VA 3OW5A 1SSMA 2OI7A 2IUAA 2ICYA 5ADXU 3DK5A 3SRTA 4M2AA 3FOQA 3FSYA 3GUEA 4H7OA 4HUSA 5E3PA 2QKXA 2NPOA 4R7PA 3I3AA 5F42A 3I3XA 2WLEA 3R1WA 3R2WA 3FSCA 1HM8A 1THJA 1Z90A 3R8YA 4R36A 5DEPA 4MFGA 1KK5A 4M99A 1MRLA 4HZDA 1KGQA 1FWYA 5E3QA 1OCXA 3BRKX 4IHGA 1V3WA 3FSXA 3EG4A 1KK4A 4MZUA 5DEMA 2OEFA 4HURA 4E75A 2VD4A 2ICXA 5AFUV 3ST8A 1QRFA 3IGJA 4M28A 4E6TA 5ADXV 1YP4A 3FTTA 3FWWA 3P1BA 1HV9A 3R5AA 3R5BA 1XATA 2GGOA 3MQGA 3FSBA 3R5DA 4AC3A 1KRRA 4EABA 4G3QA 4KPZA 1LXAA 3VBIA 4EA8A 3TISA 3MC4A 3VBLA 4DCLA 4E79A 3VNPA 1V67A 1KQAA 4EGGA 1TDTA 3GOSA 3OUPA 4AA7A 3TK8A 3V4EA 4AAWA 3JQYA 2GGQA 1QREA 2TDTA 4M2BA 4E6UA 1YP2A 1FXJA 1KGTA 2WLFA 3BXYA 3EEVA 4KNXA 1MR9A 3GVDA 2RIJA 3Q1XA 4ISXA 4M9CA 4N6AA 4EA7A 1KRVA 2IU9A 2Q4JA 4IHHA 3TDTA 3MQHA 3DJ4A 3TV0A 3T57A 2OEGA 3KWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SPT A;  1S80 A;  3ECT A;  2W0W A;  4KPX A;  4EA9 A;  2OI5 A;  3R5C A;  3TWD A;  1KHR A;  2WLC A;  3P47 A;  4J09 A;  4R37 A;  1G97 A;  3D98 A;  3PMO A;  2VHE A;  4G3P A;  2JF2 A;  5L6S A;  2IC7 A;  4J18 A;  5E3R A;  4K6R A;  1HM0 A;  3VBP A;  3EH0 A;  3VBK A;  2P2O A;  1J2Z A;  3R0S A;  4G3S A;  4HZC A;  1QRM A;  2OI6 A;  4EQY A;  3VBN A;  4M98 A;  4N27 A;  3IXC A;  4KQL A;  1T3D A;  4G87 A;  1HM9 A;  4IHF A;  3D8V A;  2IU8 A;  5AFU U;  3DHO A;  2V0I A;  2AQ9 A;  3R3I A;  3BFP A;  2WLD A;  4HCQ A;  1QRL A;  3R3R A;  3VBJ A;  3CJ8 A;  3KWE A;  1KRU A;  2V0K A;  3HSQ A;  3BSW A;  3NZ2 A;  4E1K A;  3BSS A;  4N6B A;  3TIO A;  1G95 A;  2XAT A;  3HJJ A;  3C8V A;  3VBM A;  1QRG A;  2I5K A;  2V0L A;  4FCE A;  1YP3 A;  1QQ0 A;  3OTM A;  3KWD A;  5L6V A;  1MR7 A;  1SSQ A;  3FS8 A;  1XHD A;  4EAA A;  4N69 A;  2V0J A;  2QIV X;  1SST A;  2FKO A;  1KK6 A;  2JF3 A;  5DG3 A;  3OU9 A;  3BSY A;  5U2K A;  2WLG A;  3OTZ A;  2V0H A;  3F1X A;  4MYO A;  4KNR A;  2QIA A;  2W0V A;  3OW5 A;  1SSM A;  2OI7 A;  2IUA A;  2ICY A;  5ADX U;  3DK5 A;  3SRT A;  4M2A A;  3FOQ A;  3FSY A;  3GUE A;  4H7O A;  4HUS A;  5E3P A;  2QKX A;  2NPO A;  4R7P A;  3I3A A;  5F42 A;  3I3X A;  2WLE A;  3R1W A;  3R2W A;  3FSC A;  1HM8 A;  1THJ A;  1Z90 A;  3R8Y A;  4R36 A;  5DEP A;  4MFG A;  1KK5 A;  4M99 A;  1MRL A;  4HZD A;  1KGQ A;  1FWY A;  5E3Q A;  1OCX A;  3BRK X;  4IHG A;  1V3W A;  3FSX A;  3EG4 A;  1KK4 A;  4MZU A;  5DEM A;  2OEF A;  4HUR A;  4E75 A;  2VD4 A;  2ICX A;  5AFU V;  3ST8 A;  1QRF A;  3IGJ A;  4M28 A;  4E6T A;  5ADX V;  1YP4 A;  3FTT A;  3FWW A;  3P1B A;  1HV9 A;  3R5A A;  3R5B A;  1XAT A;  2GGO A;  3MQG A;  3FSB A;  3R5D A;  4AC3 A;  1KRR A;  4EAB A;  4G3Q A;  4KPZ A;  1LXA A;  3VBI A;  4EA8 A;  3TIS A;  3MC4 A;  3VBL A;  4DCL A;  4E79 A;  3VNP A;  1V67 A;  1KQA A;  4EGG A;  1TDT A;  3GOS A;  3OUP A;  4AA7 A;  3TK8 A;  3V4E A;  4AAW A;  3JQY A;  2GGQ A;  1QRE A;  2TDT A;  4M2B A;  4E6U A;  1YP2 A;  1FXJ A;  1KGT A;  2WLF A;  3BXY A;  3EEV A;  4KNX A;  1MR9 A;  3GVD A;  2RIJ A;  3Q1X A;  4ISX A;  4M9C A;  4N6A A;  4EA7 A;  1KRV A;  2IU9 A;  2Q4J A;  4IHH A;  3TDT A;  3MQH A;  3DJ4 A;  3TV0 A;  3T57 A;  2OEG A;  3KWC A; 
#chains in the Genus database with same CATH topology
 3SPT A;  1S80 A;  3ECT A;  2W0W A;  4KPX A;  4EA9 A;  2OI5 A;  3R5C A;  3TWD A;  1KHR A;  2WLC A;  3P47 A;  4J09 A;  4R37 A;  1G97 A;  3D98 A;  3PMO A;  2VHE A;  4G3P A;  2JF2 A;  5L6S A;  2IC7 A;  4J18 A;  5E3R A;  4K6R A;  1HM0 A;  3VBP A;  1M8N A;  3GQ8 A;  1Z2F A;  3EH0 A;  3VBK A;  1N4I A;  2P2O A;  1J2Z A;  3R0S A;  4G3S A;  4HZC A;  1QRM A;  2OI6 A;  4EQY A;  3VBN A;  4M98 A;  4N27 A;  3IXC A;  4KQL A;  1T3D A;  4G87 A;  1HM9 A;  4IHF A;  3D8V A;  2IU8 A;  5AFU U;  3DHO A;  2AQ9 A;  2V0I A;  3R3I A;  3BFP A;  2WLD A;  4HCQ A;  1QRL A;  3R3R A;  3OH1 A;  3VBJ A;  1L0S A;  3CJ8 A;  3KWE A;  1KRU A;  2V0K A;  3HSQ A;  3BSW A;  3NZ2 A;  4E1K A;  3BSS A;  4N6B A;  3TIO A;  1G95 A;  2XAT A;  3HJJ A;  3C8V A;  3VBM A;  1QRG A;  2I5K A;  2V0L A;  4FCE A;  1YP3 A;  1QQ0 A;  3OTM A;  3KWD A;  5L6V A;  1MR7 A;  1SSQ A;  3FS8 A;  1XHD A;  4EAA A;  4N69 A;  2QIV X;  2V0J A;  1SST A;  2FKO A;  1KK6 A;  2JF3 A;  5DG3 A;  3OU9 A;  3OH4 A;  3BSY A;  5U2K A;  2WLG A;  3OTZ A;  2V0H A;  3F1X A;  4MYO A;  4KNR A;  2QIA A;  2W0V A;  3OW5 A;  1SSM A;  2OI7 A;  2IUA A;  2ICY A;  5ADX U;  3DK5 A;  3SRT A;  4M2A A;  3FOQ A;  3FSY A;  3GUE A;  4H7O A;  4HUS A;  5E3P A;  2QKX A;  2NPO A;  4R7P A;  3I3A A;  5F42 A;  3I3X A;  2WLE A;  3R1W A;  3R2W A;  3FSC A;  1HM8 A;  3OH3 A;  1THJ A;  1Z90 A;  3R8Y A;  4R36 A;  5DEP A;  4MFG A;  1KK5 A;  4M99 A;  1MRL A;  4HZD A;  1KGQ A;  1FWY A;  5E3Q A;  1OCX A;  3BRK X;  4IHG A;  3GQ7 A;  1V3W A;  3FSX A;  3EG4 A;  1KK4 A;  4MZU A;  5DEM A;  2OEF A;  4HUR A;  4E75 A;  2VD4 A;  2ICX A;  5AFU V;  3ST8 A;  1QRF A;  3IGJ A;  4M28 A;  4E6T A;  5ADX V;  1YP4 A;  3FTT A;  3FWW A;  3P1B A;  1HV9 A;  3R5A A;  3R5B A;  1XAT A;  2GGO A;  3GQA A;  3MQG A;  3SUC A;  3FSB A;  3R5D A;  4AC3 A;  1KRR A;  4EAB A;  4G3Q A;  4KPZ A;  1LXA A;  3OH2 A;  3VBI A;  4EA8 A;  3TIS A;  3MC4 A;  3VBL A;  4DCL A;  4E79 A;  3VNP A;  1V67 A;  1KQA A;  4EGG A;  1TDT A;  3GOS A;  3OUP A;  4AA7 A;  3TK8 A;  3V4E A;  4AAW A;  3JQY A;  2GGQ A;  1QRE A;  2TDT A;  3GQ9 A;  3OGZ A;  1EWW A;  4M2B A;  4E6U A;  1YP2 A;  1FXJ A;  1KGT A;  2WLF A;  3BXY A;  3EEV A;  4KNX A;  1MR9 A;  3GVD A;  2RIJ A;  3Q1X A;  4ISX A;  3OH0 A;  4M9C A;  4N6A A;  4EA7 A;  1KRV A;  2IU9 A;  2Q4J A;  4IHH A;  3TDT A;  3MQH A;  3DJ4 A;  3TV0 A;  3T57 A;  2OEG A;  3KWC A; 
#chains in the Genus database with same CATH homology
 3SPT A;  1S80 A;  3ECT A;  2W0W A;  4KPX A;  4EA9 A;  2OI5 A;  3R5C A;  3TWD A;  1KHR A;  2WLC A;  3P47 A;  4J09 A;  4R37 A;  1G97 A;  3D98 A;  3PMO A;  2VHE A;  4G3P A;  2JF2 A;  5L6S A;  2IC7 A;  4J18 A;  5E3R A;  4K6R A;  1HM0 A;  3VBP A;  3EH0 A;  3VBK A;  2P2O A;  1J2Z A;  3R0S A;  4G3S A;  4HZC A;  1QRM A;  2OI6 A;  4EQY A;  3VBN A;  4M98 A;  4N27 A;  3IXC A;  4KQL A;  1T3D A;  4G87 A;  1HM9 A;  4IHF A;  3D8V A;  2IU8 A;  5AFU U;  3DHO A;  2V0I A;  2AQ9 A;  3R3I A;  3BFP A;  2WLD A;  4HCQ A;  1QRL A;  3R3R A;  3VBJ A;  3CJ8 A;  3KWE A;  1KRU A;  2V0K A;  3HSQ A;  3BSW A;  3NZ2 A;  4E1K A;  3BSS A;  4N6B A;  3TIO A;  1G95 A;  2XAT A;  3HJJ A;  3C8V A;  3VBM A;  1QRG A;  2I5K A;  2V0L A;  4FCE A;  1YP3 A;  1QQ0 A;  3OTM A;  3KWD A;  5L6V A;  1MR7 A;  1SSQ A;  3FS8 A;  1XHD A;  4EAA A;  4N69 A;  2V0J A;  2QIV X;  1SST A;  2FKO A;  1KK6 A;  2JF3 A;  5DG3 A;  3OU9 A;  3BSY A;  5U2K A;  2WLG A;  3OTZ A;  2V0H A;  3F1X A;  4MYO A;  4KNR A;  2QIA A;  2W0V A;  3OW5 A;  1SSM A;  2OI7 A;  2IUA A;  2ICY A;  5ADX U;  3DK5 A;  3SRT A;  4M2A A;  3FOQ A;  3FSY A;  3GUE A;  4H7O A;  4HUS A;  5E3P A;  2QKX A;  2NPO A;  4R7P A;  3I3A A;  5F42 A;  3I3X A;  2WLE A;  3R1W A;  3R2W A;  3FSC A;  1HM8 A;  1THJ A;  1Z90 A;  3R8Y A;  4R36 A;  5DEP A;  4MFG A;  1KK5 A;  4M99 A;  1MRL A;  4HZD A;  1KGQ A;  1FWY A;  5E3Q A;  1OCX A;  3BRK X;  4IHG A;  1V3W A;  3FSX A;  3EG4 A;  1KK4 A;  4MZU A;  5DEM A;  2OEF A;  4HUR A;  4E75 A;  2VD4 A;  2ICX A;  5AFU V;  3ST8 A;  1QRF A;  3IGJ A;  4M28 A;  4E6T A;  5ADX V;  1YP4 A;  3FTT A;  3FWW A;  3P1B A;  1HV9 A;  3R5A A;  3R5B A;  1XAT A;  2GGO A;  3MQG A;  3FSB A;  3R5D A;  4AC3 A;  1KRR A;  4EAB A;  4G3Q A;  4KPZ A;  1LXA A;  3VBI A;  4EA8 A;  3TIS A;  3MC4 A;  3VBL A;  4DCL A;  4E79 A;  3VNP A;  1V67 A;  1KQA A;  4EGG A;  1TDT A;  3GOS A;  3OUP A;  4AA7 A;  3TK8 A;  3V4E A;  4AAW A;  3JQY A;  2GGQ A;  1QRE A;  2TDT A;  4M2B A;  4E6U A;  1YP2 A;  1FXJ A;  1KGT A;  2WLF A;  3BXY A;  3EEV A;  4KNX A;  1MR9 A;  3GVD A;  2RIJ A;  3Q1X A;  4ISX A;  4M9C A;  4N6A A;  4EA7 A;  1KRV A;  2IU9 A;  2Q4J A;  4IHH A;  3TDT A;  3MQH A;  3DJ4 A;  3TV0 A;  3T57 A;  2OEG A;  3KWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...