1QRGA

A closer look and the active site of gamma-carbonic anhydrases: high resolution crystallographic studies of the carbonic anhydrase from methanosarcina thermophila
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
FSNIRENPVTPWNPEPSAPVIDPTAYIDPQASVIGEVTIGANVMVSPMASIRSDEGMPIFVGDRSNVQDGVVLHALETINEEGEPIEDNIVEVDGKEYAVYIGNNVSLAHQSQVHGPAAVGDDTFIGMQAFVFKSKVGNNCVLEPRSAAIGVTIPDGRYIPAGMVVTSQAEADKLPEVTDDYAYSHTNEAVVYVNVHLAEGYKETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A closer look at the active site of gamma-class carbonic anhydrases: high-resolution crystallographic studies of the carbonic anhydrase from Methanosarcina thermophila.
pubmed doi rcsb
source organism Methanosarcina thermophila
molecule tags Lyase
molecule keywords CARBONIC ANHYDRASE
total genus 75
structure length 206
sequence length 206
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 1999-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1qrgA00
3ECTA 2V0HA 3R2WA 2OI7A 1KGQA 1LXAA 3R1WA 1KGTA 1KRRA 4EGGA 2OEFA 3R0SA 3I3AA 2XATA 1KRVA 3Q1XA 2I5KA 3GVDA 3ST8A 1V3WA 3TK8A 1KRUA 3HJJA 1TDTA 3TV0A 2VHEA 3VBIA 1Z90A 2Q4JA 1J2ZA 4N27A 3GOSA 3OW5A 1S80A 2V0JA 1FWYA 4J09A 1G97A 4EA8A 1MR9A 4EQYA 2IU9A 1YP3A 2WLEA 4R37A 3BXYA 1QRMA 2OEGA 1KK4A 3R3RA 2GGOA 3F1XA 3FSBA 2WLFA 3OTMA 3EH0A 3VNPA 4KPXA 1QRFA 4HUSA 4MYOA 2NPOA 5L6VA 5DEMA 2VD4A 1MRLA 1HM8A 2V0IA 4G3PA 2IU8A 4G3SA 4G3QA 5E3QA 4KPZA 3BSSA 2IUAA 3VBPA 3IGJA 3VBLA 3KWCA 2OI5A 1QRLA 3FSCA 4IHFA 1KHRA 1T3DA 1HM9A 3FSYA 3I3XA 3MQHA 3EG4A 3BRKX 5U2KA 3TWDA 1QQ0A 1QREA 1FXJA 3FOQA 3VBNA 3IXCA 4MZUA 3SRTA 4KNRA 1YP2A 4N69A 3BSWA 4R36A 1THJA 3FSXA 2WLCA 1SSMA 5L6SA 2JF3A 2QIAA 4FCEA 3VBJA 3C8VA 4M2BA 4DCLA 3OUPA 3TIOA 4E1KA 1V67A 3FTTA 4E79A 4EABA 2GGQA 3KWDA 4EAAA 4KNXA 2FKOA 4M98A 4G87A 4N6BA 3R5DA 4MFGA 2OI6A 2V0KA 4N6AA 3R8YA 3SPTA 5DEPA 3MQGA 4AA7A 4M99A 5F42A 1HV9A 3DK5A 4AC3A 3BFPA 3NZ2A 3DJ4A 3D98A 1MR7A 1OCXA 1KQAA 3FS8A 4M9CA 1HM0A 2IC7A 3DHOA 3P1BA 4ISXA 3JQYA 3HSQA 4K6RA 1G95A 4R7PA 3R3IA 4J18A 5AFUV 4EA9A 1KK5A 3TDTA 4H7OA 1YP4A 4KQLA 2QIVX 4EA7A 3BSYA 4HZDA 1XHDA 1KK6A 3R5BA 3KWEA 2ICYA 4AAWA 3VBKA 4M2AA 3MC4A 3FWWA 2QKXA 3R5AA 1SSQA 2W0VA 5ADXV 5ADXU 4E6UA 2V0LA 3OTZA 3D8VA 3VBMA 2ICXA 3GUEA 1XATA 3R5CA 4HZCA 3CJ8A 2WLDA 3OU9A 1SSTA 3TISA 4HURA 2W0WA 5AFUU 4E6TA 3T57A 3PMOA 2TDTA 2WLGA 3EEVA 4E75A 3P47A 4IHGA 5E3PA 4HCQA 2JF2A 4M28A 2AQ9A 5E3RA 2P2OA 4IHHA 2RIJA 3V4EA 1QRGA 5DG3A
chains in the Genus database with same CATH superfamily
3ECTA 2V0HA 3R2WA 2OI7A 1KGQA 1LXAA 3R1WA 1KGTA 1KRRA 4EGGA 2OEFA 3R0SA 3OH3A 3I3AA 1Z2FA 2XATA 1KRVA 3Q1XA 2I5KA 3GVDA 3ST8A 1V3WA 3TK8A 1KRUA 3HJJA 1TDTA 3TV0A 2VHEA 3VBIA 1Z90A 2Q4JA 3GQ7A 1J2ZA 4N27A 3GOSA 3OW5A 1S80A 2V0JA 1FWYA 4J09A 1G97A 4EA8A 1EWWA 1MR9A 4EQYA 2IU9A 1YP3A 2WLEA 4R37A 3BXYA 1QRMA 2OEGA 3GQ9A 1KK4A 3R3RA 2GGOA 3F1XA 3FSBA 2WLFA 3OTMA 3EH0A 3VNPA 4KPXA 1QRFA 4HUSA 4MYOA 2NPOA 5L6VA 5DEMA 2VD4A 1M8NA 1MRLA 1HM8A 1N4IA 2V0IA 2IU8A 4G3PA 4G3SA 4G3QA 5E3QA 4KPZA 3BSSA 2IUAA 3VBPA 3IGJA 3VBLA 3KWCA 2OI5A 1QRLA 3FSCA 4IHFA 1KHRA 3OGZA 1T3DA 1HM9A 3FSYA 3I3XA 3MQHA 3EG4A 3BRKX 3GQ8A 5U2KA 1QQ0A 3TWDA 1QREA 1FXJA 3FOQA 3VBNA 3IXCA 4MZUA 3GQAA 4KNRA 1YP2A 4N69A 3SRTA 1L0SA 3BSWA 4R36A 1THJA 3FSXA 2WLCA 3OH4A 1SSMA 3OH1A 5L6SA 2JF3A 2QIAA 4FCEA 3VBJA 3C8VA 4M2BA 4DCLA 3OUPA 3TIOA 4E1KA 1V67A 3FTTA 4E79A 4EABA 2GGQA 3KWDA 3OH2A 4EAAA 4KNXA 2FKOA 3OH0A 4G87A 4M98A 3R5DA 4N6BA 4MFGA 2OI6A 2V0KA 4N6AA 3R8YA 3SPTA 5DEPA 3MQGA 4AA7A 4M99A 5F42A 1HV9A 3DK5A 3SUCA 4AC3A 3BFPA 3NZ2A 3DJ4A 3D98A 1MR7A 1OCXA 1KQAA 3FS8A 4M9CA 1HM0A 2IC7A 3DHOA 3P1BA 4ISXA 3JQYA 3HSQA 4K6RA 1G95A 4R7PA 3R3IA 4J18A 5AFUV 4EA9A 1KK5A 3TDTA 4H7OA 1YP4A 4KQLA 2QIVX 4EA7A 3BSYA 4HZDA 1KK6A 1XHDA 3R5BA 3KWEA 2ICYA 4AAWA 3VBKA 4M2AA 3MC4A 3FWWA 2QKXA 3R5AA 1SSQA 2W0VA 5ADXV 5ADXU 4E6UA 2V0LA 3OTZA 3D8VA 3VBMA 2ICXA 3GUEA 1XATA 3R5CA 4HZCA 3CJ8A 2WLDA 3OU9A 1SSTA 3TISA 4HURA 2W0WA 5AFUU 4E6TA 3T57A 3PMOA 2TDTA 2WLGA 3EEVA 4E75A 3P47A 4IHGA 5E3PA 4HCQA 2JF2A 4M28A 2AQ9A 5E3RA 2P2OA 4IHHA 2RIJA 3V4EA 1QRGA 5DG3A
chains in the Genus database with same CATH topology
3ECTA 2V0HA 3R2WA 2OI7A 1KGQA 1LXAA 3R1WA 1KGTA 1KRRA 4EGGA 2OEFA 3R0SA 3I3AA 2XATA 1KRVA 3Q1XA 2I5KA 3GVDA 3ST8A 1V3WA 3TK8A 1KRUA 3HJJA 1TDTA 3TV0A 2VHEA 3VBIA 1Z90A 2Q4JA 1J2ZA 4N27A 3GOSA 3OW5A 1S80A 2V0JA 1FWYA 4J09A 1G97A 4EA8A 1MR9A 4EQYA 2IU9A 1YP3A 2WLEA 4R37A 3BXYA 1QRMA 2OEGA 1KK4A 3R3RA 2GGOA 3F1XA 3FSBA 2WLFA 3OTMA 3EH0A 3VNPA 4KPXA 1QRFA 4HUSA 4MYOA 2NPOA 5L6VA 5DEMA 2VD4A 1MRLA 1HM8A 2V0IA 4G3PA 2IU8A 4G3SA 4G3QA 5E3QA 4KPZA 3BSSA 2IUAA 3VBPA 3IGJA 3VBLA 3KWCA 2OI5A 1QRLA 3FSCA 4IHFA 1KHRA 1T3DA 1HM9A 3FSYA 3I3XA 3MQHA 3EG4A 3BRKX 5U2KA 3TWDA 1QQ0A 1QREA 1FXJA 3FOQA 3VBNA 3IXCA 4MZUA 3SRTA 4KNRA 1YP2A 4N69A 3BSWA 4R36A 1THJA 3FSXA 2WLCA 1SSMA 5L6SA 2JF3A 2QIAA 4FCEA 3VBJA 3C8VA 4M2BA 4DCLA 3OUPA 3TIOA 4E1KA 1V67A 3FTTA 4E79A 4EABA 2GGQA 3KWDA 4EAAA 4KNXA 2FKOA 4M98A 4G87A 4N6BA 3R5DA 4MFGA 2OI6A 2V0KA 4N6AA 3R8YA 3SPTA 5DEPA 3MQGA 4AA7A 4M99A 5F42A 1HV9A 3DK5A 4AC3A 3BFPA 3NZ2A 3DJ4A 3D98A 1MR7A 1OCXA 1KQAA 3FS8A 4M9CA 1HM0A 2IC7A 3DHOA 3P1BA 4ISXA 3JQYA 3HSQA 4K6RA 1G95A 4R7PA 3R3IA 4J18A 5AFUV 4EA9A 1KK5A 3TDTA 4H7OA 1YP4A 4KQLA 2QIVX 4EA7A 3BSYA 4HZDA 1XHDA 1KK6A 3R5BA 3KWEA 2ICYA 4AAWA 3VBKA 4M2AA 3MC4A 3FWWA 2QKXA 3R5AA 1SSQA 2W0VA 5ADXV 5ADXU 4E6UA 2V0LA 3OTZA 3D8VA 3VBMA 2ICXA 3GUEA 1XATA 3R5CA 4HZCA 3CJ8A 2WLDA 3OU9A 1SSTA 3TISA 4HURA 2W0WA 5AFUU 4E6TA 3T57A 3PMOA 2TDTA 2WLGA 3EEVA 4E75A 3P47A 4IHGA 5E3PA 4HCQA 2JF2A 4M28A 2AQ9A 5E3RA 2P2OA 4IHHA 2RIJA 3V4EA 1QRGA 5DG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ECT A;  2V0H A;  3R2W A;  2OI7 A;  1KGQ A;  1LXA A;  3R1W A;  1KGT A;  1KRR A;  4EGG A;  2OEF A;  3R0S A;  3I3A A;  2XAT A;  1KRV A;  3Q1X A;  2I5K A;  3GVD A;  3ST8 A;  1V3W A;  3TK8 A;  1KRU A;  3HJJ A;  1TDT A;  3TV0 A;  2VHE A;  3VBI A;  1Z90 A;  2Q4J A;  1J2Z A;  4N27 A;  3GOS A;  3OW5 A;  1S80 A;  2V0J A;  1FWY A;  4J09 A;  1G97 A;  4EA8 A;  1MR9 A;  4EQY A;  2IU9 A;  1YP3 A;  2WLE A;  4R37 A;  3BXY A;  1QRM A;  2OEG A;  1KK4 A;  3R3R A;  2GGO A;  3F1X A;  3FSB A;  2WLF A;  3OTM A;  3EH0 A;  3VNP A;  4KPX A;  1QRF A;  4HUS A;  4MYO A;  2NPO A;  5L6V A;  5DEM A;  2VD4 A;  1MRL A;  1HM8 A;  2V0I A;  4G3P A;  2IU8 A;  4G3S A;  4G3Q A;  5E3Q A;  4KPZ A;  3BSS A;  2IUA A;  3VBP A;  3IGJ A;  3VBL A;  3KWC A;  2OI5 A;  1QRL A;  3FSC A;  4IHF A;  1KHR A;  1T3D A;  1HM9 A;  3FSY A;  3I3X A;  3MQH A;  3EG4 A;  3BRK X;  5U2K A;  3TWD A;  1QQ0 A;  1QRE A;  1FXJ A;  3FOQ A;  3VBN A;  3IXC A;  4MZU A;  3SRT A;  4KNR A;  1YP2 A;  4N69 A;  3BSW A;  4R36 A;  1THJ A;  3FSX A;  2WLC A;  1SSM A;  5L6S A;  2JF3 A;  2QIA A;  4FCE A;  3VBJ A;  3C8V A;  4M2B A;  4DCL A;  3OUP A;  3TIO A;  4E1K A;  1V67 A;  3FTT A;  4E79 A;  4EAB A;  2GGQ A;  3KWD A;  4EAA A;  4KNX A;  2FKO A;  4M98 A;  4G87 A;  4N6B A;  3R5D A;  4MFG A;  2OI6 A;  2V0K A;  4N6A A;  3R8Y A;  3SPT A;  5DEP A;  3MQG A;  4AA7 A;  4M99 A;  5F42 A;  1HV9 A;  3DK5 A;  4AC3 A;  3BFP A;  3NZ2 A;  3DJ4 A;  3D98 A;  1MR7 A;  1OCX A;  1KQA A;  3FS8 A;  4M9C A;  1HM0 A;  2IC7 A;  3DHO A;  3P1B A;  4ISX A;  3JQY A;  3HSQ A;  4K6R A;  1G95 A;  4R7P A;  3R3I A;  4J18 A;  5AFU V;  4EA9 A;  1KK5 A;  3TDT A;  4H7O A;  1YP4 A;  4KQL A;  2QIV X;  4EA7 A;  3BSY A;  4HZD A;  1XHD A;  1KK6 A;  3R5B A;  3KWE A;  2ICY A;  4AAW A;  3VBK A;  4M2A A;  3MC4 A;  3FWW A;  2QKX A;  3R5A A;  1SSQ A;  2W0V A;  5ADX V;  5ADX U;  4E6U A;  2V0L A;  3OTZ A;  3D8V A;  3VBM A;  2ICX A;  3GUE A;  1XAT A;  3R5C A;  4HZC A;  3CJ8 A;  2WLD A;  3OU9 A;  1SST A;  3TIS A;  4HUR A;  2W0W A;  5AFU U;  4E6T A;  3T57 A;  3PMO A;  2TDT A;  2WLG A;  3EEV A;  4E75 A;  3P47 A;  4IHG A;  5E3P A;  4HCQ A;  2JF2 A;  4M28 A;  2AQ9 A;  5E3R A;  2P2O A;  4IHH A;  2RIJ A;  3V4E A;  1QRG A;  5DG3 A; 
#chains in the Genus database with same CATH topology
 3ECT A;  2V0H A;  3R2W A;  2OI7 A;  1KGQ A;  1LXA A;  3R1W A;  1KGT A;  1KRR A;  4EGG A;  2OEF A;  3R0S A;  3OH3 A;  3I3A A;  1Z2F A;  2XAT A;  1KRV A;  3Q1X A;  2I5K A;  3GVD A;  3ST8 A;  1V3W A;  3TK8 A;  1KRU A;  3HJJ A;  1TDT A;  3TV0 A;  2VHE A;  3VBI A;  1Z90 A;  2Q4J A;  3GQ7 A;  1J2Z A;  4N27 A;  3GOS A;  3OW5 A;  1S80 A;  2V0J A;  1FWY A;  4J09 A;  1G97 A;  4EA8 A;  1EWW A;  1MR9 A;  4EQY A;  2IU9 A;  1YP3 A;  2WLE A;  4R37 A;  3BXY A;  1QRM A;  2OEG A;  3GQ9 A;  1KK4 A;  3R3R A;  2GGO A;  3F1X A;  3FSB A;  2WLF A;  3OTM A;  3EH0 A;  3VNP A;  4KPX A;  1QRF A;  4HUS A;  4MYO A;  2NPO A;  5L6V A;  5DEM A;  2VD4 A;  1M8N A;  1MRL A;  1HM8 A;  1N4I A;  2V0I A;  2IU8 A;  4G3P A;  4G3S A;  4G3Q A;  5E3Q A;  4KPZ A;  3BSS A;  2IUA A;  3VBP A;  3IGJ A;  3VBL A;  3KWC A;  2OI5 A;  1QRL A;  3FSC A;  4IHF A;  1KHR A;  3OGZ A;  1T3D A;  1HM9 A;  3FSY A;  3I3X A;  3MQH A;  3EG4 A;  3BRK X;  3GQ8 A;  5U2K A;  1QQ0 A;  3TWD A;  1QRE A;  1FXJ A;  3FOQ A;  3VBN A;  3IXC A;  4MZU A;  3GQA A;  4KNR A;  1YP2 A;  4N69 A;  3SRT A;  1L0S A;  3BSW A;  4R36 A;  1THJ A;  3FSX A;  2WLC A;  3OH4 A;  1SSM A;  3OH1 A;  5L6S A;  2JF3 A;  2QIA A;  4FCE A;  3VBJ A;  3C8V A;  4M2B A;  4DCL A;  3OUP A;  3TIO A;  4E1K A;  1V67 A;  3FTT A;  4E79 A;  4EAB A;  2GGQ A;  3KWD A;  3OH2 A;  4EAA A;  4KNX A;  2FKO A;  3OH0 A;  4G87 A;  4M98 A;  3R5D A;  4N6B A;  4MFG A;  2OI6 A;  2V0K A;  4N6A A;  3R8Y A;  3SPT A;  5DEP A;  3MQG A;  4AA7 A;  4M99 A;  5F42 A;  1HV9 A;  3DK5 A;  3SUC A;  4AC3 A;  3BFP A;  3NZ2 A;  3DJ4 A;  3D98 A;  1MR7 A;  1OCX A;  1KQA A;  3FS8 A;  4M9C A;  1HM0 A;  2IC7 A;  3DHO A;  3P1B A;  4ISX A;  3JQY A;  3HSQ A;  4K6R A;  1G95 A;  4R7P A;  3R3I A;  4J18 A;  5AFU V;  4EA9 A;  1KK5 A;  3TDT A;  4H7O A;  1YP4 A;  4KQL A;  2QIV X;  4EA7 A;  3BSY A;  4HZD A;  1KK6 A;  1XHD A;  3R5B A;  3KWE A;  2ICY A;  4AAW A;  3VBK A;  4M2A A;  3MC4 A;  3FWW A;  2QKX A;  3R5A A;  1SSQ A;  2W0V A;  5ADX V;  5ADX U;  4E6U A;  2V0L A;  3OTZ A;  3D8V A;  3VBM A;  2ICX A;  3GUE A;  1XAT A;  3R5C A;  4HZC A;  3CJ8 A;  2WLD A;  3OU9 A;  1SST A;  3TIS A;  4HUR A;  2W0W A;  5AFU U;  4E6T A;  3T57 A;  3PMO A;  2TDT A;  2WLG A;  3EEV A;  4E75 A;  3P47 A;  4IHG A;  5E3P A;  4HCQ A;  2JF2 A;  4M28 A;  2AQ9 A;  5E3R A;  2P2O A;  4IHH A;  2RIJ A;  3V4E A;  1QRG A;  5DG3 A; 
#chains in the Genus database with same CATH homology
 3ECT A;  2V0H A;  3R2W A;  2OI7 A;  1KGQ A;  1LXA A;  3R1W A;  1KGT A;  1KRR A;  4EGG A;  2OEF A;  3R0S A;  3I3A A;  2XAT A;  1KRV A;  3Q1X A;  2I5K A;  3GVD A;  3ST8 A;  1V3W A;  3TK8 A;  1KRU A;  3HJJ A;  1TDT A;  3TV0 A;  2VHE A;  3VBI A;  1Z90 A;  2Q4J A;  1J2Z A;  4N27 A;  3GOS A;  3OW5 A;  1S80 A;  2V0J A;  1FWY A;  4J09 A;  1G97 A;  4EA8 A;  1MR9 A;  4EQY A;  2IU9 A;  1YP3 A;  2WLE A;  4R37 A;  3BXY A;  1QRM A;  2OEG A;  1KK4 A;  3R3R A;  2GGO A;  3F1X A;  3FSB A;  2WLF A;  3OTM A;  3EH0 A;  3VNP A;  4KPX A;  1QRF A;  4HUS A;  4MYO A;  2NPO A;  5L6V A;  5DEM A;  2VD4 A;  1MRL A;  1HM8 A;  2V0I A;  4G3P A;  2IU8 A;  4G3S A;  4G3Q A;  5E3Q A;  4KPZ A;  3BSS A;  2IUA A;  3VBP A;  3IGJ A;  3VBL A;  3KWC A;  2OI5 A;  1QRL A;  3FSC A;  4IHF A;  1KHR A;  1T3D A;  1HM9 A;  3FSY A;  3I3X A;  3MQH A;  3EG4 A;  3BRK X;  5U2K A;  3TWD A;  1QQ0 A;  1QRE A;  1FXJ A;  3FOQ A;  3VBN A;  3IXC A;  4MZU A;  3SRT A;  4KNR A;  1YP2 A;  4N69 A;  3BSW A;  4R36 A;  1THJ A;  3FSX A;  2WLC A;  1SSM A;  5L6S A;  2JF3 A;  2QIA A;  4FCE A;  3VBJ A;  3C8V A;  4M2B A;  4DCL A;  3OUP A;  3TIO A;  4E1K A;  1V67 A;  3FTT A;  4E79 A;  4EAB A;  2GGQ A;  3KWD A;  4EAA A;  4KNX A;  2FKO A;  4M98 A;  4G87 A;  4N6B A;  3R5D A;  4MFG A;  2OI6 A;  2V0K A;  4N6A A;  3R8Y A;  3SPT A;  5DEP A;  3MQG A;  4AA7 A;  4M99 A;  5F42 A;  1HV9 A;  3DK5 A;  4AC3 A;  3BFP A;  3NZ2 A;  3DJ4 A;  3D98 A;  1MR7 A;  1OCX A;  1KQA A;  3FS8 A;  4M9C A;  1HM0 A;  2IC7 A;  3DHO A;  3P1B A;  4ISX A;  3JQY A;  3HSQ A;  4K6R A;  1G95 A;  4R7P A;  3R3I A;  4J18 A;  5AFU V;  4EA9 A;  1KK5 A;  3TDT A;  4H7O A;  1YP4 A;  4KQL A;  2QIV X;  4EA7 A;  3BSY A;  4HZD A;  1XHD A;  1KK6 A;  3R5B A;  3KWE A;  2ICY A;  4AAW A;  3VBK A;  4M2A A;  3MC4 A;  3FWW A;  2QKX A;  3R5A A;  1SSQ A;  2W0V A;  5ADX V;  5ADX U;  4E6U A;  2V0L A;  3OTZ A;  3D8V A;  3VBM A;  2ICX A;  3GUE A;  1XAT A;  3R5C A;  4HZC A;  3CJ8 A;  2WLD A;  3OU9 A;  1SST A;  3TIS A;  4HUR A;  2W0W A;  5AFU U;  4E6T A;  3T57 A;  3PMO A;  2TDT A;  2WLG A;  3EEV A;  4E75 A;  3P47 A;  4IHG A;  5E3P A;  4HCQ A;  2JF2 A;  4M28 A;  2AQ9 A;  5E3R A;  2P2O A;  4IHH A;  2RIJ A;  3V4E A;  1QRG A;  5DG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...