1QRJA

Solution structure of htlv-i capsid protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
b'HHHHHSSGHIEGRHMQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASLHHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALPGSAKDPSWASILQGLEEPYHAFVERLNIALDNGLPEGTPKDPILRSLAYSNANKECQKLLQARGHTNSPLGDMLRACQTWTPKDKTKVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTLV-I CAPSID PROTEIN
publication title Sequence-specific 1H, 13C and 15N chemical shift assignment and secondary structure of the HTLV-I capsid protein.
pubmed doi rcsb
source organism Human t-cell lymphotrophic virus type 1
molecule tags Viral protein
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1qrjA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1qrjA02
1G03A 2JYGA 1AK4C 3DS4A 2X2DD 2JPRA 3MGEA 2JO0A 3NTEA 2L6EA 2XXMA 3VRLC 1EIAA 2PXRC 1QRJA 2WLVB 4U0DA 3G29A 2BUOA 4XRQA 2X83A 4HTWA 4INBA 4XROA 3DS5A 3P05A 4E91A 2XGYA 4XFZA 2XT1A 2M8PA 4U0AA 2GOLB 1U7KA 2XGUA 3DTJA 2M8LA 4M0IA 3G1GA 4DGAC 3DS1A 1D1DA 3H4EA 5HGMA 1P7NA 4QNBA 3G28A 4E92A 2ONTA 4PH3A 5DCKA 3DS0A 3H47A 4U0CA 3G1IA 1EM9A 3LRYA 1M9EC 2X82A 4U0BA 2KGFA 1AFVA 2XV6A 1L6NA 2WLVA 4COPA 4XFXA 5JPAA 5I4TG 2Y4ZA 2PWOA 5HGKA 4NX4C 2V4XA 1EOQA 2KODA 4J93A 4PH2A 1M9FC 2M8NA 5HGLA 1AUMA 2LF4A 3DS2A 4PH1A 5HGNA 2XDEA 3G26A 1M9DC 2GONA 1M9CC 4IPYA 1A43A 1M9YC 3DS3A 4U0EA 5HGOA 1GWPA 4WYMA 4DGEC 1M9XC 4COCA 2EIAA 1A8OA 1BAJA 3G0VA 3BP9A 4XFYA 1E6JP 4PH0A 4B4NA 2XGVA 4LQWC 4U0FA 2JYLA 3DPHA 2PWMA 3G21A
chains in the Genus database with same CATH superfamily
2QNWA 7CEIA 1G03A 1YJ9P 1GXGA 2GZFA 3DS4A 2ROQA 5EJDA 1W2BO 3GZMA 3U43A 2JPRA 5KP6B 4PWVB 4MRTC 2L6EA 2XXMA 3CPWO 1VQNP 1YI2P 1QRJA 3CMEP 4XRQA 2LOLA 2KW2A 2Z46A 2FADA 2MF4A 2KR5A 3DS5A 2KORA 2OTJP 4E91A 1KD1Q 1S72P 2KGEA 3DTJA 3GKLC 2PEJA 1D1DA 3G28A 1X3OA 4PH3A 2ONTA 3CC4P 1KC8Q 3CCSP 2L0QA 2MR7A 4GR2A 2FVEA 2X82A 3RG6C 2KOPA 2KGFA 1VQLP 2N5HA 1ACPA 2XV6A 4COPA 2Y4ZA 2PWOA 2KODA 5HV8A 4J93A 1M1KQ 3HZQA 2LF4A 3DS2A 3CCVP 2FQ1A 2K92A 5CZDB 4IPYA 2KG6A 3DS3A 2AFEA 4U0EA 1MZ8A 2OARA 2EIAA 2N6YA 3BP9A 3CC7P 2VLQA 2FAEA 4GR6A 3HYBA 4LQWC 2BHVA 2N50A 4U0FA 5KP8B 1NQ4A 2QA4P 3G4SP 4F37A 2K0XA 1RO2A 2GZIA 1M6EX 1AK4C 1T8KA 2KOSA 2LIUA 2KGCA 2EHTA 2KG9A 1Q82Q 3G71P 2VLOA 2GYKA 3G29A 5BS1A 3I55P 2X83A 4BPGA 1GXHA 2FVAA 2K0YA 2CNRA 2CGQA 5HVCA 3EJDA 2XGYA 3CCRP 4XFZA 2KOOA 2KGDA 1U7KA 1Z6MA 2XGUA 4M0IA 1YJNP 3G1GA 3DS1A 2FHSC 2CWOA 4QNBA 2MY5A 3GZLA 2MVVA 2Z44A 5DCKA 1QVGO 1YITP 1VQOP 1L0IA 1KLPA 1EM9A 3LRYA 2KWLA 2KG8A 1L6NA 2WLVA 3G6EP 3CC2P 5JPAA 2LIWA 2K5XA 3OW2O 2AF8A 2V4XA 1EOQA 1N8RQ 2L4BA 3WBHA 2M8NA 1AUMA 3H0DA 5HGNA 2GZGA 2MR8A 1GWPA 2CQ8A 1BAJA 2JU2A 2PY8A 1GPJA 4XFYA 1VQKP 1K9MQ 2JGPA 2LPKA 1KQSO 2ERHA 4UHPB 1E6JP 1VQ4P 1OR5A 2VSQA 2JYLA 1VQPP 3G21A 1RO0A 2N6ZA 2JYGA 4PXHB 1IUQA 2MVUA 2NO8A 3MGEA 2CG5B 2FACA 3NTEA 3CCQP 2LKIA 3E2DA 2KOQA 3VRLC 2EFJA 4QKOA 2PXRC 1UNKA 2WLVB 2JAZA 4HKGA 1IMPA 3GJNA 4INBA 4HTWA 4XROA 2GDXA 1M6NA 1HQBA 2M8PA 4U0AA 1FR2A 2VLNA 3CCEP 1ZMBA 4NEOA 2FQ2A 2LTEA 2LL8A 2Z45A 4IZ6A 5HGMA 1K30A 1K73Q 2GZJA 1AYIA 3H47A 1ZNVA 4U0CA 1YJWP 1RNIA 2PEIA 5F2KA 4U0BA 3CCUP 1VQ6P 3CCMP 1L0HA 3Q20A 2PEMA 4XFXA 2XZ0D 5I4TG 2L9FA 2PNGA 3RG2A 1VQMP 4PH2A 3CE7A 1M9FC 5HGLA 3I56P 2GZEA 2X2BA 4BPFA 4H2WC 4PH1A 2FVFA 1VHNA 3G26A 1M9DC 2GONA 2PEKA 3CD6P 1CEIA 2GDYA 4H2YC 3M1MA 2PEOA 4PH0A 2QEXP 1JJ2O 2LMLA 2FQ0A 3DPHA 2PWMA 2K94A 2PENA 4DG9A 2PEQA 3NY7B 3EJBA 1VQ8P 2GDWA 2K93A 2X2DD 1VKUA 5EW5E 4BPHA 2JB0A 3CCJP 2K2QA 1QVFO 2JO0A 2N5IA 1IMQA 2WPTA 1Q86Q 1EIAA 3LMOA 2M5RA 4U0DA 2P9XA 2BUOA 1K8AQ 2JBGA 2AVAA 2KGAA 4H2XC 3P05A 2XT1A 1DV5A 1UJZA 1EMVA 2GOLB 2L22A 1NJIQ 2M8LA 5F2OA 4DGAC 1YHQP 3H4EA 2DGYA 1P7NA 2DNWA 2JQ4A 4E92A 3CCLP 1VQ7P 1HY8A 3DS0A 5F2NA 2EHSA 3B4QA 3G1IA 1M9EC 1M90Q 1E0HA 1AFVA 2VLPA 2XZ1C 5HGKA 3EJEA 4NX4C 1BXIA 4CA3A 2MD9A 2OTLP 2K0DX 1YIJP 1Q81Q 2XDEA 1AF8A 1Q7YQ 1M9CC 1A43A 1M9YC 2JU1A 5HGOA 4WYMA 1F80D 1VQ9P 4DGEC 1VQ5P 1M9XC 4COCA 1A8OA 3G0VA 1DNYA 4B4NA 2AFDA 2N98A 4R0MA 2XGVA 3CXCO 1M74A 2EG5A 3B5IA 3CMAP 5BS2A 2E1MA 5KP7B
chains in the Genus database with same CATH topology
2PEQA 1G03A 1YJ9P 1RO0A 2JYGA 1VQ8P 1M6EX 1AK4C 3DS4A 1IUQA 2X2DD 1W2BO 2JPRA 3CCJP 3MGEA 1QVFO 2JO0A 3NTEA 2L6EA 3CCQP 2XXMA 3E2DA 3CPWO 1VQNP 3VRLC 2EFJA 1Q86Q 1YI2P 1Q82Q 3G71P 1EIAA 2PXRC 1QRJA 2WLVB 4U0DA 3G29A 5BS1A 2P9XA 3CMEP 2BUOA 4XRQA 1K8AQ 2Z46A 3I55P 2X83A 4HTWA 4INBA 4XROA 3DS5A 1M6NA 2OTJP 3P05A 4E91A 2XGYA 3CCRP 1KD1Q 4XFZA 2XT1A 1S72P 2M8PA 4U0AA 2GOLB 1U7KA 3CCEP 1ZMBA 2XGUA 3DTJA 1NJIQ 2M8LA 5F2OA 4M0IA 1YJNP 2PEJA 2Z45A 4DGAC 3DS1A 3G1GA 1YHQP 1D1DA 3H4EA 5HGMA 2CWOA 1K30A 1P7NA 2DGYA 4QNBA 3G28A 4E92A 3CCLP 2ONTA 4PH3A 1VQ7P 3CC4P 2Z44A 1K73Q 1KC8Q 5DCKA 3DS0A 1QVGO 3CCSP 5F2NA 3H47A 4U0CA 1YITP 1YJWP 3G1IA 4GR2A 1RNIA 2PEIA 1VQOP 1EM9A 5F2KA 3LRYA 1M9EC 2X82A 4U0BA 3RG6C 2KGFA 3CCUP 1M90Q 1VQ6P 1VQLP 3CCMP 1AFVA 2XV6A 1L6NA 2WLVA 3Q20A 3G6EP 2PEMA 4XFXA 4COPA 3CC2P 5JPAA 5I4TG 2Y4ZA 2PWOA 5HGKA 1VQMP 3OW2O 4NX4C 2V4XA 1EOQA 2KODA 4J93A 1M1KQ 4PH2A 1N8RQ 2OTLP 1M9FC 3WBHA 3HZQA 2M8NA 5HGLA 3I56P 1AUMA 1YIJP 2LF4A 3DS2A 4PH1A 3H0DA 3CCVP 5HGNA 1Q81Q 2XDEA 3G26A 1M9DC 2GONA 2PEKA 1Q7YQ 1M9CC 4IPYA 3CD6P 1A43A 1M9YC 3DS3A 4U0EA 5HGOA 1GWPA 4WYMA 2OARA 1VQ9P 4DGEC 1VQ5P 1M9XC 4COCA 2EIAA 1A8OA 1BAJA 2PY8A 3G0VA 3BP9A 3CC7P 1VQKP 4XFYA 3M1MA 1K9MQ 1KQSO 1E6JP 2PEOA 4PH0A 4B4NA 2QEXP 1VQ4P 4GR6A 2XGVA 3HYBA 3CXCO 4LQWC 1M74A 2BHVA 4U0FA 2EG5A 3B5IA 1JJ2O 2QA4P 3CMAP 3G4SP 5BS2A 2E1MA 2JYLA 3DPHA 1VQPP 2PWMA 3G21A 2PENA 1RO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G03 A;  2JYG A;  1AK4 C;  3DS4 A;  2X2D D;  2JPR A;  3MGE A;  2JO0 A;  3NTE A;  2L6E A;  2XXM A;  3VRL C;  1EIA A;  2PXR C;  1QRJ A;  2WLV B;  4U0D A;  3G29 A;  2BUO A;  4XRQ A;  2X83 A;  4HTW A;  4INB A;  4XRO A;  3DS5 A;  3P05 A;  4E91 A;  2XGY A;  4XFZ A;  2XT1 A;  2M8P A;  4U0A A;  2GOL B;  1U7K A;  2XGU A;  3DTJ A;  2M8L A;  4M0I A;  3G1G A;  4DGA C;  3DS1 A;  1D1D A;  3H4E A;  5HGM A;  1P7N A;  4QNB A;  3G28 A;  4E92 A;  2ONT A;  4PH3 A;  5DCK A;  3DS0 A;  3H47 A;  4U0C A;  3G1I A;  1EM9 A;  3LRY A;  1M9E C;  2X82 A;  4U0B A;  2KGF A;  1AFV A;  2XV6 A;  1L6N A;  2WLV A;  4COP A;  4XFX A;  5JPA A;  5I4T G;  2Y4Z A;  2PWO A;  5HGK A;  4NX4 C;  2V4X A;  1EOQ A;  2KOD A;  4J93 A;  4PH2 A;  1M9F C;  2M8N A;  5HGL A;  1AUM A;  2LF4 A;  3DS2 A;  4PH1 A;  5HGN A;  2XDE A;  3G26 A;  1M9D C;  2GON A;  1M9C C;  4IPY A;  1A43 A;  1M9Y C;  3DS3 A;  4U0E A;  5HGO A;  1GWP A;  4WYM A;  4DGE C;  1M9X C;  4COC A;  2EIA A;  1A8O A;  1BAJ A;  3G0V A;  3BP9 A;  4XFY A;  1E6J P;  4PH0 A;  4B4N A;  2XGV A;  4LQW C;  4U0F A;  2JYL A;  3DPH A;  2PWM A;  3G21 A; 
#chains in the Genus database with same CATH topology
 2QNW A;  7CEI A;  1G03 A;  1YJ9 P;  1GXG A;  2GZF A;  3DS4 A;  2ROQ A;  5EJD A;  1W2B O;  3GZM A;  3U43 A;  2JPR A;  5KP6 B;  4PWV B;  4MRT C;  2L6E A;  2XXM A;  3CPW O;  1VQN P;  1YI2 P;  1QRJ A;  3CME P;  4XRQ A;  2LOL A;  2KW2 A;  2Z46 A;  2FAD A;  2MF4 A;  2KR5 A;  3DS5 A;  2KOR A;  2OTJ P;  4E91 A;  1KD1 Q;  1S72 P;  2KGE A;  3DTJ A;  3GKL C;  2PEJ A;  1D1D A;  3G28 A;  1X3O A;  4PH3 A;  2ONT A;  3CC4 P;  1KC8 Q;  3CCS P;  2L0Q A;  2MR7 A;  4GR2 A;  2FVE A;  2X82 A;  3RG6 C;  2KOP A;  2KGF A;  1VQL P;  2N5H A;  1ACP A;  2XV6 A;  4COP A;  2Y4Z A;  2PWO A;  2KOD A;  5HV8 A;  4J93 A;  1M1K Q;  3HZQ A;  2LF4 A;  3DS2 A;  3CCV P;  2FQ1 A;  2K92 A;  5CZD B;  4IPY A;  2KG6 A;  3DS3 A;  2AFE A;  4U0E A;  1MZ8 A;  2OAR A;  2EIA A;  2N6Y A;  3BP9 A;  3CC7 P;  2VLQ A;  2FAE A;  4GR6 A;  3HYB A;  4LQW C;  2BHV A;  2N50 A;  4U0F A;  5KP8 B;  1NQ4 A;  2QA4 P;  3G4S P;  4F37 A;  2K0X A;  1RO2 A;  2GZI A;  1M6E X;  1AK4 C;  1T8K A;  2KOS A;  2LIU A;  2KGC A;  2EHT A;  2KG9 A;  1Q82 Q;  3G71 P;  2VLO A;  2GYK A;  3G29 A;  5BS1 A;  3I55 P;  2X83 A;  4BPG A;  1GXH A;  2FVA A;  2K0Y A;  2CNR A;  2CGQ A;  5HVC A;  3EJD A;  2XGY A;  3CCR P;  4XFZ A;  2KOO A;  2KGD A;  1U7K A;  1Z6M A;  2XGU A;  4M0I A;  1YJN P;  3G1G A;  3DS1 A;  2FHS C;  2CWO A;  4QNB A;  2MY5 A;  3GZL A;  2MVV A;  2Z44 A;  5DCK A;  1QVG O;  1YIT P;  1VQO P;  1L0I A;  1KLP A;  1EM9 A;  3LRY A;  2KWL A;  2KG8 A;  1L6N A;  2WLV A;  3G6E P;  3CC2 P;  5JPA A;  2LIW A;  2K5X A;  3OW2 O;  2AF8 A;  2V4X A;  1EOQ A;  1N8R Q;  2L4B A;  3WBH A;  2M8N A;  1AUM A;  3H0D A;  5HGN A;  2GZG A;  2MR8 A;  1GWP A;  2CQ8 A;  1BAJ A;  2JU2 A;  2PY8 A;  1GPJ A;  4XFY A;  1VQK P;  1K9M Q;  2JGP A;  2LPK A;  1KQS O;  2ERH A;  4UHP B;  1E6J P;  1VQ4 P;  1OR5 A;  2VSQ A;  2JYL A;  1VQP P;  3G21 A;  1RO0 A;  2N6Z A;  2JYG A;  4PXH B;  1IUQ A;  2MVU A;  2NO8 A;  3MGE A;  2CG5 B;  2FAC A;  3NTE A;  3CCQ P;  2LKI A;  3E2D A;  2KOQ A;  3VRL C;  2EFJ A;  4QKO A;  2PXR C;  1UNK A;  2WLV B;  2JAZ A;  4HKG A;  1IMP A;  3GJN A;  4INB A;  4HTW A;  4XRO A;  2GDX A;  1M6N A;  1HQB A;  2M8P A;  4U0A A;  1FR2 A;  2VLN A;  3CCE P;  1ZMB A;  4NEO A;  2FQ2 A;  2LTE A;  2LL8 A;  2Z45 A;  4IZ6 A;  5HGM A;  1K30 A;  1K73 Q;  2GZJ A;  1AYI A;  3H47 A;  1ZNV A;  4U0C A;  1YJW P;  1RNI A;  2PEI A;  5F2K A;  4U0B A;  3CCU P;  1VQ6 P;  3CCM P;  1L0H A;  3Q20 A;  2PEM A;  4XFX A;  2XZ0 D;  5I4T G;  2L9F A;  2PNG A;  3RG2 A;  1VQM P;  4PH2 A;  3CE7 A;  1M9F C;  5HGL A;  3I56 P;  2GZE A;  2X2B A;  4BPF A;  4H2W C;  4PH1 A;  2FVF A;  1VHN A;  3G26 A;  1M9D C;  2GON A;  2PEK A;  3CD6 P;  1CEI A;  2GDY A;  4H2Y C;  3M1M A;  2PEO A;  4PH0 A;  2QEX P;  1JJ2 O;  2LML A;  2FQ0 A;  3DPH A;  2PWM A;  2K94 A;  2PEN A;  4DG9 A;  2PEQ A;  3NY7 B;  3EJB A;  1VQ8 P;  2GDW A;  2K93 A;  2X2D D;  1VKU A;  5EW5 E;  4BPH A;  2JB0 A;  3CCJ P;  2K2Q A;  1QVF O;  2JO0 A;  2N5I A;  1IMQ A;  2WPT A;  1Q86 Q;  1EIA A;  3LMO A;  2M5R A;  4U0D A;  2P9X A;  2BUO A;  1K8A Q;  2JBG A;  2AVA A;  2KGA A;  4H2X C;  3P05 A;  2XT1 A;  1DV5 A;  1UJZ A;  1EMV A;  2GOL B;  2L22 A;  1NJI Q;  2M8L A;  5F2O A;  4DGA C;  1YHQ P;  3H4E A;  2DGY A;  1P7N A;  2DNW A;  2JQ4 A;  4E92 A;  3CCL P;  1VQ7 P;  1HY8 A;  3DS0 A;  5F2N A;  2EHS A;  3B4Q A;  3G1I A;  1M9E C;  1M90 Q;  1E0H A;  1AFV A;  2VLP A;  2XZ1 C;  5HGK A;  3EJE A;  4NX4 C;  1BXI A;  4CA3 A;  2MD9 A;  2OTL P;  2K0D X;  1YIJ P;  1Q81 Q;  2XDE A;  1AF8 A;  1Q7Y Q;  1M9C C;  1A43 A;  1M9Y C;  2JU1 A;  5HGO A;  4WYM A;  1F80 D;  1VQ9 P;  4DGE C;  1VQ5 P;  1M9X C;  4COC A;  1A8O A;  3G0V A;  1DNY A;  4B4N A;  2AFD A;  2N98 A;  4R0M A;  2XGV A;  3CXC O;  1M74 A;  2EG5 A;  3B5I A;  3CMA P;  5BS2 A;  2E1M A;  5KP7 B; 
#chains in the Genus database with same CATH homology
 2PEQ A;  1G03 A;  1YJ9 P;  1RO0 A;  2JYG A;  1VQ8 P;  1M6E X;  1AK4 C;  3DS4 A;  1IUQ A;  2X2D D;  1W2B O;  2JPR A;  3CCJ P;  3MGE A;  1QVF O;  2JO0 A;  3NTE A;  2L6E A;  3CCQ P;  2XXM A;  3E2D A;  3CPW O;  1VQN P;  3VRL C;  2EFJ A;  1Q86 Q;  1YI2 P;  1Q82 Q;  3G71 P;  1EIA A;  2PXR C;  1QRJ A;  2WLV B;  4U0D A;  3G29 A;  5BS1 A;  2P9X A;  3CME P;  2BUO A;  4XRQ A;  1K8A Q;  2Z46 A;  3I55 P;  2X83 A;  4HTW A;  4INB A;  4XRO A;  3DS5 A;  1M6N A;  2OTJ P;  3P05 A;  4E91 A;  2XGY A;  3CCR P;  1KD1 Q;  4XFZ A;  2XT1 A;  1S72 P;  2M8P A;  4U0A A;  2GOL B;  1U7K A;  3CCE P;  1ZMB A;  2XGU A;  3DTJ A;  1NJI Q;  2M8L A;  5F2O A;  4M0I A;  1YJN P;  2PEJ A;  2Z45 A;  4DGA C;  3DS1 A;  3G1G A;  1YHQ P;  1D1D A;  3H4E A;  5HGM A;  2CWO A;  1K30 A;  1P7N A;  2DGY A;  4QNB A;  3G28 A;  4E92 A;  3CCL P;  2ONT A;  4PH3 A;  1VQ7 P;  3CC4 P;  2Z44 A;  1K73 Q;  1KC8 Q;  5DCK A;  3DS0 A;  1QVG O;  3CCS P;  5F2N A;  3H47 A;  4U0C A;  1YIT P;  1YJW P;  3G1I A;  4GR2 A;  1RNI A;  2PEI A;  1VQO P;  1EM9 A;  5F2K A;  3LRY A;  1M9E C;  2X82 A;  4U0B A;  3RG6 C;  2KGF A;  3CCU P;  1M90 Q;  1VQ6 P;  1VQL P;  3CCM P;  1AFV A;  2XV6 A;  1L6N A;  2WLV A;  3Q20 A;  3G6E P;  2PEM A;  4XFX A;  4COP A;  3CC2 P;  5JPA A;  5I4T G;  2Y4Z A;  2PWO A;  5HGK A;  1VQM P;  3OW2 O;  4NX4 C;  2V4X A;  1EOQ A;  2KOD A;  4J93 A;  1M1K Q;  4PH2 A;  1N8R Q;  2OTL P;  1M9F C;  3WBH A;  3HZQ A;  2M8N A;  5HGL A;  3I56 P;  1AUM A;  1YIJ P;  2LF4 A;  3DS2 A;  4PH1 A;  3H0D A;  3CCV P;  5HGN A;  1Q81 Q;  2XDE A;  3G26 A;  1M9D C;  2GON A;  2PEK A;  1Q7Y Q;  1M9C C;  4IPY A;  3CD6 P;  1A43 A;  1M9Y C;  3DS3 A;  4U0E A;  5HGO A;  1GWP A;  4WYM A;  2OAR A;  1VQ9 P;  4DGE C;  1VQ5 P;  1M9X C;  4COC A;  2EIA A;  1A8O A;  1BAJ A;  2PY8 A;  3G0V A;  3BP9 A;  3CC7 P;  1VQK P;  4XFY A;  3M1M A;  1K9M Q;  1KQS O;  1E6J P;  2PEO A;  4PH0 A;  4B4N A;  2QEX P;  1VQ4 P;  4GR6 A;  2XGV A;  3HYB A;  3CXC O;  4LQW C;  1M74 A;  2BHV A;  4U0F A;  2EG5 A;  3B5I A;  1JJ2 O;  2QA4 P;  3CMA P;  3G4S P;  5BS2 A;  2E1M A;  2JYL A;  3DPH A;  1VQP P;  2PWM A;  3G21 A;  2PEN A;  1RO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...