1QRJA

Solution structure of htlv-i capsid protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
HHHHHSSGHIEGRHMQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASLHHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALPGSAKDPSWASILQGLEEPYHAFVERLNIALDNGLPEGTPKDPILRSLAYSNANKECQKLLQARGHTNSPLGDMLRACQTWTPKDKTKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence-specific 1H, 13C and 15N chemical shift assignment and secondary structure of the HTLV-I capsid protein.
pubmed doi rcsb
source organism Human t-cell lymphotrophic virus type 1
molecule tags Viral protein
molecule keywords HTLV-I CAPSID PROTEIN
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1qrjA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1qrjA02
4M0IA 4PH0A 3MGEA 2ONTA 4HTWA 4B4NA 2GOLB 3DS0A 5I4TG 4E91A 5HGMA 1G03A 1M9FC 3G1GA 4PH3A 4U0BA 3VRLC 4INBA 4QNBA 2V4XA 3G29A 2XV6A 3G21A 4U0CA 1M9DC 1M9EC 4XFXA 3G0VA 3DS5A 5DCKA 3H4EA 1AUMA 3DS1A 3G1IA 4XFYA 2JPRA 2WLVA 3P05A 2PXRC 4WYMA 4COCA 2LF4A 2JYLA 1M9XC 3BP9A 4E92A 3LRYA 5HGLA 4XRQA 1U7KA 2M8PA 4U0AA 1P7NA 2XDEA 1M9YC 5JPAA 4PH2A 2XGVA 2XGYA 1AFVA 4XFZA 2GONA 3DPHA 3DS2A 5HGNA 2X82A 3G26A 2M8LA 1A8OA 2Y4ZA 4NX4C 2KGFA 4IPYA 1EOQA 4DGEC 3H47A 4U0DA 2M8NA 4COPA 2XT1A 2WLVB 3DTJA 2EIAA 3G28A 2X83A 1M9CC 2PWMA 4XROA 1GWPA 1QRJA 3NTEA 4U0EA 5HGKA 1BAJA 5HGOA 1L6NA 1A43A 1D1DA 1EIAA 1E6JP 2KODA 2JYGA 2BUOA 2XGUA 4PH1A 2PWOA 3DS4A 1EM9A 2L6EA 4LQWC 4J93A 2JO0A 4DGAC 4U0FA 2X2DD 3DS3A 1AK4C 2XXMA
chains in the Genus database with same CATH superfamily
1YJNP 2ONTA 2AF8A 2K92A 2LIWA 1CEIA 5KP6B 3G1GA 4PH3A 4QNBA 1KC8Q 2GDYA 2EG5A 2V4XA 2XV6A 2PEMA 2OARA 2N50A 2P9XA 2EHSA 3CPWO 1YHQP 5DCKA 1RO0A 2L9FA 1Z6MA 2JPRA 1L0IA 3I56P 3WBHA 3CMAP 2JYLA 3CCVP 1GXHA 2E1MA 4U0AA 1VQKP 2XGYA 1AFVA 4UHPB 1Q86Q 2KGEA 2K2QA 3DPHA 1VQLP 3G26A 2XZ1C 1MZ8A 2GZGA 4IPYA 5F2OA 2PEOA 2QNWA 3B4QA 1BXIA 3H47A 4U0DA 3CCJP 4COPA 2MR7A 3G28A 3GJNA 5HGKA 1VQ4P 1VQ5P 2OTJP 2MR8A 1L6NA 4GR2A 2M5RA 1DNYA 1EIAA 2L22A 2N98A 2KODA 2Z45A 2BUOA 1Q7YQ 3Q20A 2L6EA 3LMOA 1YJWP 2QA4P 2XXMA 1M6EX 4PH0A 5EJDA 3U43A 4F37A 1VQ6P 2L4BA 4HTWA 2LPKA 1VQ9P 2N5IA 2FADA 3G71P 1G03A 5BS2A 1M9FC 1M74A 2MD9A 2AVAA 2FVAA 2FQ0A 4INBA 5HVCA 3G29A 1YITP 3G21A 2FVFA 2VLPA 2FQ2A 4U0CA 1E0HA 4PXHB 1UNKA 4BPHA 4XFXA 3DS5A 3G1IA 1RNIA 2JU1A 2Z46A 4WYMA 4COCA 2LF4A 1L0HA 1M9XC 4E92A 4DG9A 3LRYA 3GZMA 2LOLA 2N6ZA 1QVFO 1YIJP 2ERHA 2M8PA 5EW5E 1P7NA 3OW2O 1Q81Q 1IMQA 1M9YC 1VQOP 4PH2A 2VLOA 1JJ2O 1Q82Q 2LL8A 5F2NA 1S72P 3EJDA 3DS2A 2M8LA 1A8OA 2Y4ZA 4NX4C 4GR6A 1ACPA 3RG2A 1RO2A 2K0YA 3HYBA 4BPGA 2M8NA 1QVGO 2WLVB 3DTJA 1KQSO 2GZJA 1M9CC 2PWMA 1AF8A 1K73Q 3GKLC 1QRJA 2EHTA 2GYKA 3I55P 4H2YC 3DS4A 1K8AQ 4LQWC 2MF4A 4DGAC 2PY8A 2JQ4A 3DS3A 4M0IA 2KOQA 3GZLA 3CCLP 2CGQA 2GZEA 2GOLB 3DS0A 1K30A 3CCMP 4E91A 5HGMA 2BHVA 1UJZA 2EFJA 2KR5A 2KG8A 3E2DA 4U0BA 3VRLC 3RG6C 2KOPA 2WPTA 1VKUA 4H2XC 3H0DA 2KGDA 2KWLA 5BS1A 2DGYA 2N5HA 2K0XA 3DS1A 4XFYA 2WLVA 3P05A 2CWOA 1VHNA 2PEJA 2X2BA 3BP9A 3CC2P 5CZDB 3CC4P 4XRQA 2VSQA 2JAZA 1KD1Q 2VLNA 5JPAA 3CCEP 2XGVA 2K0DX 2FHSC 5HV8A 1T8KA 3NY7B 3EJEA 2FVEA 1EOQA 3CC7P 2QEXP 2XT1A 3CCQP 2KG6A 2ROQA 1GXGA 4CA3A 2X83A 1M90Q 1GWPA 3NTEA 1X3OA 5KP8B 5F2KA 1HQBA 1A43A 2GZFA 2K94A 1D1DA 2KGAA 1E6JP 2JYGA 1EMVA 2XGUA 4PH1A 1AYIA 1EM9A 4J93A 2AFDA 1N8RQ 3CD6P 4U0FA 2X2DD 1AK4C 1YJ9P 4NEOA 2DNWA 4HKGA 3MGEA 3CCRP 2K5XA 3CCUP 4B4NA 1KLPA 5I4TG 1VQ8P 1OR5A 2MVVA 1M1KQ 2KW2A 2PEQA 2XZ0D 2LMLA 4H2WC 2AFEA 2JU2A 2CNRA 3EJBA 2FQ1A 1M9DC 3B5IA 1VQNP 1M9EC 1NQ4A 3G0VA 4IZ6A 3H4EA 1AUMA 1VQMP 1YI2P 1HY8A 2PXRC 2LTEA 2GDWA 1IMPA 5HGLA 7CEIA 2MY5A 4BPFA 3CXCO 3CCSP 1U7KA 3G6EP 2OTLP 2L0QA 4PWVB 2XDEA 2K93A 1F80D 1M6NA 2GZIA 4XFZA 2JGPA 2GONA 5HGNA 2X82A 1K9MQ 2KGFA 2KGCA 4MRTC 4DGEC 2KORA 3HZQA 2JB0A 2KOSA 1W2BO 4QKOA 3CMEP 2EIAA 2NO8A 2VLQA 1ZNVA 1IUQA 4XROA 2LKIA 1DV5A 1FR2A 1VQ7P 4U0EA 1BAJA 5HGOA 2JBGA 1GPJA 2GDXA 3G4SP 5KP7B 1NJIQ 3M1MA 2CG5B 4R0MA 2Z44A 2KOOA 1VQPP 2PWOA 3CE7A 2PENA 1ZMBA 2PNGA 2KG9A 2CQ8A 2JO0A 2FAEA 2N6YA 2PEKA 2FACA 2LIUA 2PEIA 2MVUA
chains in the Genus database with same CATH topology
1YJNP 4M0IA 4PH0A 3MGEA 2ONTA 3CCRP 3CCLP 1VQ6P 4HTWA 3CCUP 1VQ9P 4B4NA 2GOLB 3DS0A 1K30A 5I4TG 3G71P 4E91A 3CCMP 5HGMA 1G03A 1VQ8P 5BS2A 2BHVA 1M9FC 1M74A 1M1KQ 2EFJA 2PEQA 3G1GA 4PH3A 3E2DA 4U0BA 3VRLC 4INBA 4QNBA 3RG6C 1KC8Q 2EG5A 2V4XA 3G29A 2XV6A 1YITP 3G21A 3H0DA 2PEMA 2OARA 4U0CA 2P9XA 1M9DC 3B5IA 1VQNP 1M9EC 3CPWO 5BS1A 2DGYA 4XFXA 1YHQP 3G0VA 3DS5A 5DCKA 1RO0A 3H4EA 1AUMA 1VQMP 3DS1A 3G1IA 4XFYA 2JPRA 1YI2P 3I56P 2WLVA 3P05A 1RNIA 2CWOA 3WBHA 2PXRC 2Z46A 3CMAP 2PEJA 4WYMA 4COCA 2LF4A 2JYLA 1M9XC 3CCVP 3BP9A 4E92A 3LRYA 3CC2P 5HGLA 3CC4P 3CXCO 3CCSP 2E1MA 4XRQA 1QVFO 1YIJP 1U7KA 2M8PA 4U0AA 1P7NA 3G6EP 2OTLP 3OW2O 1Q81Q 2XDEA 1VQKP 1M9YC 1VQOP 1KD1Q 5JPAA 4PH2A 3CCEP 2XGVA 1JJ2O 1Q82Q 1M6NA 2XGYA 1AFVA 5F2NA 4XFZA 1Q86Q 1S72P 2GONA 3DPHA 1VQLP 3DS2A 5HGNA 2X82A 3G26A 2M8LA 1A8OA 2Y4ZA 4NX4C 1K9MQ 2KGFA 4IPYA 4GR6A 5F2OA 1RO2A 2PEOA 1EOQA 4DGEC 3H47A 3HZQA 4U0DA 3HYBA 3CCJP 2M8NA 3CC7P 2QEXP 4COPA 2XT1A 2WLVB 3DTJA 1QVGO 1W2BO 3CCQP 1KQSO 3CMEP 2EIAA 3G28A 1IUQA 2X83A 1M9CC 2PWMA 4XROA 1M90Q 1K73Q 1GWPA 1VQ7P 1QRJA 3NTEA 4U0EA 5HGKA 1VQ5P 1VQ4P 2OTJP 1BAJA 5HGOA 5F2KA 4GR2A 1L6NA 1A43A 1D1DA 1EIAA 3I55P 3G4SP 1NJIQ 1E6JP 2KODA 2JYGA 3M1MA 2Z45A 2BUOA 2XGUA 2Z44A 4PH1A 1Q7YQ 1VQPP 2PWOA 3DS4A 1K8AQ 3Q20A 2PENA 1EM9A 1ZMBA 2L6EA 1YJWP 4LQWC 4J93A 2JO0A 2PEKA 1N8RQ 4DGAC 2PEIA 2PY8A 2QA4P 3CD6P 4U0FA 2X2DD 3DS3A 1AK4C 2XXMA 1YJ9P 1M6EX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M0I A;  4PH0 A;  3MGE A;  2ONT A;  4HTW A;  4B4N A;  2GOL B;  3DS0 A;  5I4T G;  4E91 A;  5HGM A;  1G03 A;  1M9F C;  3G1G A;  4PH3 A;  4U0B A;  3VRL C;  4INB A;  4QNB A;  2V4X A;  3G29 A;  2XV6 A;  3G21 A;  4U0C A;  1M9D C;  1M9E C;  4XFX A;  3G0V A;  3DS5 A;  5DCK A;  3H4E A;  1AUM A;  3DS1 A;  3G1I A;  4XFY A;  2JPR A;  2WLV A;  3P05 A;  2PXR C;  4WYM A;  4COC A;  2LF4 A;  2JYL A;  1M9X C;  3BP9 A;  4E92 A;  3LRY A;  5HGL A;  4XRQ A;  1U7K A;  2M8P A;  4U0A A;  1P7N A;  2XDE A;  1M9Y C;  5JPA A;  4PH2 A;  2XGV A;  2XGY A;  1AFV A;  4XFZ A;  2GON A;  3DPH A;  3DS2 A;  5HGN A;  2X82 A;  3G26 A;  2M8L A;  1A8O A;  2Y4Z A;  4NX4 C;  2KGF A;  4IPY A;  1EOQ A;  4DGE C;  3H47 A;  4U0D A;  2M8N A;  4COP A;  2XT1 A;  2WLV B;  3DTJ A;  2EIA A;  3G28 A;  2X83 A;  1M9C C;  2PWM A;  4XRO A;  1GWP A;  1QRJ A;  3NTE A;  4U0E A;  5HGK A;  1BAJ A;  5HGO A;  1L6N A;  1A43 A;  1D1D A;  1EIA A;  1E6J P;  2KOD A;  2JYG A;  2BUO A;  2XGU A;  4PH1 A;  2PWO A;  3DS4 A;  1EM9 A;  2L6E A;  4LQW C;  4J93 A;  2JO0 A;  4DGA C;  4U0F A;  2X2D D;  3DS3 A;  1AK4 C;  2XXM A; 
#chains in the Genus database with same CATH topology
 1YJN P;  2ONT A;  2AF8 A;  2K92 A;  2LIW A;  1CEI A;  5KP6 B;  3G1G A;  4PH3 A;  4QNB A;  1KC8 Q;  2GDY A;  2EG5 A;  2V4X A;  2XV6 A;  2PEM A;  2OAR A;  2N50 A;  2P9X A;  2EHS A;  3CPW O;  1YHQ P;  5DCK A;  1RO0 A;  2L9F A;  1Z6M A;  2JPR A;  1L0I A;  3I56 P;  3WBH A;  3CMA P;  2JYL A;  3CCV P;  1GXH A;  2E1M A;  4U0A A;  1VQK P;  2XGY A;  1AFV A;  4UHP B;  1Q86 Q;  2KGE A;  2K2Q A;  3DPH A;  1VQL P;  3G26 A;  2XZ1 C;  1MZ8 A;  2GZG A;  4IPY A;  5F2O A;  2PEO A;  2QNW A;  3B4Q A;  1BXI A;  3H47 A;  4U0D A;  3CCJ P;  4COP A;  2MR7 A;  3G28 A;  3GJN A;  5HGK A;  1VQ4 P;  1VQ5 P;  2OTJ P;  2MR8 A;  1L6N A;  4GR2 A;  2M5R A;  1DNY A;  1EIA A;  2L22 A;  2N98 A;  2KOD A;  2Z45 A;  2BUO A;  1Q7Y Q;  3Q20 A;  2L6E A;  3LMO A;  1YJW P;  2QA4 P;  2XXM A;  1M6E X;  4PH0 A;  5EJD A;  3U43 A;  4F37 A;  1VQ6 P;  2L4B A;  4HTW A;  2LPK A;  1VQ9 P;  2N5I A;  2FAD A;  3G71 P;  1G03 A;  5BS2 A;  1M9F C;  1M74 A;  2MD9 A;  2AVA A;  2FVA A;  2FQ0 A;  4INB A;  5HVC A;  3G29 A;  1YIT P;  3G21 A;  2FVF A;  2VLP A;  2FQ2 A;  4U0C A;  1E0H A;  4PXH B;  1UNK A;  4BPH A;  4XFX A;  3DS5 A;  3G1I A;  1RNI A;  2JU1 A;  2Z46 A;  4WYM A;  4COC A;  2LF4 A;  1L0H A;  1M9X C;  4E92 A;  4DG9 A;  3LRY A;  3GZM A;  2LOL A;  2N6Z A;  1QVF O;  1YIJ P;  2ERH A;  2M8P A;  5EW5 E;  1P7N A;  3OW2 O;  1Q81 Q;  1IMQ A;  1M9Y C;  1VQO P;  4PH2 A;  2VLO A;  1JJ2 O;  1Q82 Q;  2LL8 A;  5F2N A;  1S72 P;  3EJD A;  3DS2 A;  2M8L A;  1A8O A;  2Y4Z A;  4NX4 C;  4GR6 A;  1ACP A;  3RG2 A;  1RO2 A;  2K0Y A;  3HYB A;  4BPG A;  2M8N A;  1QVG O;  2WLV B;  3DTJ A;  1KQS O;  2GZJ A;  1M9C C;  2PWM A;  1AF8 A;  1K73 Q;  3GKL C;  1QRJ A;  2EHT A;  2GYK A;  3I55 P;  4H2Y C;  3DS4 A;  1K8A Q;  4LQW C;  2MF4 A;  4DGA C;  2PY8 A;  2JQ4 A;  3DS3 A;  4M0I A;  2KOQ A;  3GZL A;  3CCL P;  2CGQ A;  2GZE A;  2GOL B;  3DS0 A;  1K30 A;  3CCM P;  4E91 A;  5HGM A;  2BHV A;  1UJZ A;  2EFJ A;  2KR5 A;  2KG8 A;  3E2D A;  4U0B A;  3VRL C;  3RG6 C;  2KOP A;  2WPT A;  1VKU A;  4H2X C;  3H0D A;  2KGD A;  2KWL A;  5BS1 A;  2DGY A;  2N5H A;  2K0X A;  3DS1 A;  4XFY A;  2WLV A;  3P05 A;  2CWO A;  1VHN A;  2PEJ A;  2X2B A;  3BP9 A;  3CC2 P;  5CZD B;  3CC4 P;  4XRQ A;  2VSQ A;  2JAZ A;  1KD1 Q;  2VLN A;  5JPA A;  3CCE P;  2XGV A;  2K0D X;  2FHS C;  5HV8 A;  1T8K A;  3NY7 B;  3EJE A;  2FVE A;  1EOQ A;  3CC7 P;  2QEX P;  2XT1 A;  3CCQ P;  2KG6 A;  2ROQ A;  1GXG A;  4CA3 A;  2X83 A;  1M90 Q;  1GWP A;  3NTE A;  1X3O A;  5KP8 B;  5F2K A;  1HQB A;  1A43 A;  2GZF A;  2K94 A;  1D1D A;  2KGA A;  1E6J P;  2JYG A;  1EMV A;  2XGU A;  4PH1 A;  1AYI A;  1EM9 A;  4J93 A;  2AFD A;  1N8R Q;  3CD6 P;  4U0F A;  2X2D D;  1AK4 C;  1YJ9 P;  4NEO A;  2DNW A;  4HKG A;  3MGE A;  3CCR P;  2K5X A;  3CCU P;  4B4N A;  1KLP A;  5I4T G;  1VQ8 P;  1OR5 A;  2MVV A;  1M1K Q;  2KW2 A;  2PEQ A;  2XZ0 D;  2LML A;  4H2W C;  2AFE A;  2JU2 A;  2CNR A;  3EJB A;  2FQ1 A;  1M9D C;  3B5I A;  1VQN P;  1M9E C;  1NQ4 A;  3G0V A;  4IZ6 A;  3H4E A;  1AUM A;  1VQM P;  1YI2 P;  1HY8 A;  2PXR C;  2LTE A;  2GDW A;  1IMP A;  5HGL A;  7CEI A;  2MY5 A;  4BPF A;  3CXC O;  3CCS P;  1U7K A;  3G6E P;  2OTL P;  2L0Q A;  4PWV B;  2XDE A;  2K93 A;  1F80 D;  1M6N A;  2GZI A;  4XFZ A;  2JGP A;  2GON A;  5HGN A;  2X82 A;  1K9M Q;  2KGF A;  2KGC A;  4MRT C;  4DGE C;  2KOR A;  3HZQ A;  2JB0 A;  2KOS A;  1W2B O;  4QKO A;  3CME P;  2EIA A;  2NO8 A;  2VLQ A;  1ZNV A;  1IUQ A;  4XRO A;  2LKI A;  1DV5 A;  1FR2 A;  1VQ7 P;  4U0E A;  1BAJ A;  5HGO A;  2JBG A;  1GPJ A;  2GDX A;  3G4S P;  5KP7 B;  1NJI Q;  3M1M A;  2CG5 B;  4R0M A;  2Z44 A;  2KOO A;  1VQP P;  2PWO A;  3CE7 A;  2PEN A;  1ZMB A;  2PNG A;  2KG9 A;  2CQ8 A;  2JO0 A;  2FAE A;  2N6Y A;  2PEK A;  2FAC A;  2LIU A;  2PEI A;  2MVU A; 
#chains in the Genus database with same CATH homology
 1YJN P;  4M0I A;  4PH0 A;  3MGE A;  2ONT A;  3CCR P;  3CCL P;  1VQ6 P;  4HTW A;  3CCU P;  1VQ9 P;  4B4N A;  2GOL B;  3DS0 A;  1K30 A;  5I4T G;  3G71 P;  4E91 A;  3CCM P;  5HGM A;  1G03 A;  1VQ8 P;  5BS2 A;  2BHV A;  1M9F C;  1M74 A;  1M1K Q;  2EFJ A;  2PEQ A;  3G1G A;  4PH3 A;  3E2D A;  4U0B A;  3VRL C;  4INB A;  4QNB A;  3RG6 C;  1KC8 Q;  2EG5 A;  2V4X A;  3G29 A;  2XV6 A;  1YIT P;  3G21 A;  3H0D A;  2PEM A;  2OAR A;  4U0C A;  2P9X A;  1M9D C;  3B5I A;  1VQN P;  1M9E C;  3CPW O;  5BS1 A;  2DGY A;  4XFX A;  1YHQ P;  3G0V A;  3DS5 A;  5DCK A;  1RO0 A;  3H4E A;  1AUM A;  1VQM P;  3DS1 A;  3G1I A;  4XFY A;  2JPR A;  1YI2 P;  3I56 P;  2WLV A;  3P05 A;  1RNI A;  2CWO A;  3WBH A;  2PXR C;  2Z46 A;  3CMA P;  2PEJ A;  4WYM A;  4COC A;  2LF4 A;  2JYL A;  1M9X C;  3CCV P;  3BP9 A;  4E92 A;  3LRY A;  3CC2 P;  5HGL A;  3CC4 P;  3CXC O;  3CCS P;  2E1M A;  4XRQ A;  1QVF O;  1YIJ P;  1U7K A;  2M8P A;  4U0A A;  1P7N A;  3G6E P;  2OTL P;  3OW2 O;  1Q81 Q;  2XDE A;  1VQK P;  1M9Y C;  1VQO P;  1KD1 Q;  5JPA A;  4PH2 A;  3CCE P;  2XGV A;  1JJ2 O;  1Q82 Q;  1M6N A;  2XGY A;  1AFV A;  5F2N A;  4XFZ A;  1Q86 Q;  1S72 P;  2GON A;  3DPH A;  1VQL P;  3DS2 A;  5HGN A;  2X82 A;  3G26 A;  2M8L A;  1A8O A;  2Y4Z A;  4NX4 C;  1K9M Q;  2KGF A;  4IPY A;  4GR6 A;  5F2O A;  1RO2 A;  2PEO A;  1EOQ A;  4DGE C;  3H47 A;  3HZQ A;  4U0D A;  3HYB A;  3CCJ P;  2M8N A;  3CC7 P;  2QEX P;  4COP A;  2XT1 A;  2WLV B;  3DTJ A;  1QVG O;  1W2B O;  3CCQ P;  1KQS O;  3CME P;  2EIA A;  3G28 A;  1IUQ A;  2X83 A;  1M9C C;  2PWM A;  4XRO A;  1M90 Q;  1K73 Q;  1GWP A;  1VQ7 P;  1QRJ A;  3NTE A;  4U0E A;  5HGK A;  1VQ5 P;  1VQ4 P;  2OTJ P;  1BAJ A;  5HGO A;  5F2K A;  4GR2 A;  1L6N A;  1A43 A;  1D1D A;  1EIA A;  3I55 P;  3G4S P;  1NJI Q;  1E6J P;  2KOD A;  2JYG A;  3M1M A;  2Z45 A;  2BUO A;  2XGU A;  2Z44 A;  4PH1 A;  1Q7Y Q;  1VQP P;  2PWO A;  3DS4 A;  1K8A Q;  3Q20 A;  2PEN A;  1EM9 A;  1ZMB A;  2L6E A;  1YJW P;  4LQW C;  4J93 A;  2JO0 A;  2PEK A;  1N8R Q;  4DGA C;  2PEI A;  2PY8 A;  2QA4 P;  3CD6 P;  4U0F A;  2X2D D;  3DS3 A;  1AK4 C;  2XXM A;  1YJ9 P;  1M6E X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...