1QRJA

Solution structure of htlv-i capsid protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
HHHHHSSGHIEGRHMQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASLHHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALPGSAKDPSWASILQGLEEPYHAFVERLNIALDNGLPEGTPKDPILRSLAYSNANKECQKLLQARGHTNSPLGDMLRACQTWTPKDKTKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence-specific 1H, 13C and 15N chemical shift assignment and secondary structure of the HTLV-I capsid protein.
pubmed doi rcsb
source organism Human t-cell lymphotrophic virus type 1
molecule tags Viral protein
molecule keywords HTLV-I CAPSID PROTEIN
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1qrjA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1qrjA02
2XGUA 2LF4A 2WLVA 4XFYA 3G0VA 4XFZA 1P7NA 1G03A 1M9EC 3NTEA 1A8OA 2JO0A 5JPAA 4U0CA 2KGFA 3DS4A 3G29A 1M9CC 2PWMA 4PH0A 2JYGA 3G28A 3DPHA 1M9XC 2M8LA 5HGLA 2PXRC 4NX4C 1L6NA 1EOQA 3VRLC 3LRYA 1AK4C 2XDEA 2KODA 3DS5A 4U0BA 2EIAA 2GOLB 2WLVB 4HTWA 4B4NA 2XV6A 3G21A 3G26A 2M8PA 4WYMA 1AFVA 2X83A 3DTJA 4COCA 4DGAC 3DS2A 2M8NA 5HGNA 2BUOA 4E91A 2GONA 4XROA 2X82A 1BAJA 5I4TG 1EIAA 1U7KA 1EM9A 3H47A 4INBA 1M9DC 2XGYA 4DGEC 1GWPA 2XT1A 4PH3A 4U0DA 4XRQA 4PH1A 2JPRA 2Y4ZA 3P05A 1M9YC 4IPYA 4COPA 3DS3A 4E92A 3G1IA 4U0AA 2XXMA 4QNBA 4XFXA 3BP9A 4PH2A 5HGOA 1QRJA 4U0EA 1E6JP 1A43A 2L6EA 3DS1A 3H4EA 3DS0A 2V4XA 4LQWC 3G1GA 5HGMA 2X2DD 2PWOA 2ONTA 1M9FC 5HGKA 5DCKA 2JYLA 1D1DA 2XGVA 4M0IA 4J93A 4U0FA 1AUMA 3MGEA
chains in the Genus database with same CATH superfamily
2CQ8A 4H2XC 7CEIA 2N6YA 1P7NA 1M9EC 3Q20A 3I56P 2FVAA 2JO0A 5JPAA 4U0CA 3G29A 1M9CC 2PWMA 4PH0A 2JQ4A 2GZFA 2JYGA 3G28A 2L22A 2QEXP 1OR5A 3GZMA 3CCUP 2N6ZA 1GXHA 5F2OA 2ROQA 4NX4C 3CCJP 3VRLC 3LRYA 5F2KA 4UHPB 2L9FA 1YI2P 2FQ0A 1M90Q 2CWOA 2MR7A 2JB0A 4U0BA 3CMAP 2GOLB 2WLVB 4HTWA 2XV6A 2XZ1C 3LMOA 1QVFO 1HQBA 3G71P 1IUQA 4WYMA 2FACA 3DS2A 5BS2A 1S72P 2GZJA 2K0YA 3CCSP 2Z44A 2N5HA 4XROA 2FVEA 4CA3A 1W2BO 3CMEP 1EM9A 3H47A 1E0HA 1M9DC 2KGCA 2FADA 2GZGA 1GWPA 2XT1A 3CC2P 2PEOA 2JPRA 1AF8A 1M6NA 1BXIA 2X2BA 5HV8A 2KR5A 1VKUA 3DS1A 4BPHA 1F80D 2LMLA 3G1GA 2X2DD 2GZEA 2JGPA 3EJEA 2JU1A 1UNKA 2XGUA 2CG5B 2P9XA 1VQ9P 1KD1Q 3G0VA 2K2QA 3GKLC 4DG9A 2KGFA 1MZ8A 1K30A 1RNIA 5BS1A 4PWVB 2L0QA 2OTLP 1M9XC 1L0IA 3NY7B 1M1KQ 2MY5A 2KGDA 1EOQA 2KGEA 3M1MA 4NEOA 2FVFA 1NJIQ 2PENA 1VQ5P 3CCRP 2FQ2A 2DGYA 3CCLP 1CEIA 1HY8A 2X83A 4DGAC 5HGNA 2KW2A 4E91A 3CCMP 4QKOA 5I4TG 2AFDA 1ZMBA 1VQ7P 1Z6MA 3H0DA 2PEQA 3CCQP 4PH3A 1Q81Q 3G4SP 1QVGO 3P05A 1VQ4P 4IPYA 1L0HA 4COPA 2N98A 4BPFA 2KOQA 3G1IA 2XXMA 4XFXA 2VLQA 3BP9A 2PEIA 2KG6A 1E6JP 1GXGA 5F2NA 1NQ4A 4MRTC 2PNGA 2DNWA 1YJWP 2GYKA 1K73Q 3DS0A 3B5IA 4R0MA 2V4XA 1VQNP 5HGKA 5DCKA 2JYLA 1RO0A 1D1DA 2VLPA 3HZQA 3CXCO 4U0FA 1IMQA 1N8RQ 1JJ2O 4H2WC 1X3OA 2GDWA 1M74A 2LF4A 2LIUA 2CNRA 2GZIA 1UJZA 4XFZA 2K0DX 3NTEA 1A8OA 2M5RA 3B4QA 3G6EP 1RO2A 2Z45A 5HGLA 2E1MA 2EG5A 2L4BA 1DV5A 3CD6P 3GZLA 2MD9A 2PEMA 2MVVA 1L6NA 1VQPP 1KC8Q 1AK4C 3I55P 1VQ8P 2XDEA 1YJ9P 2K0XA 2JU2A 3G21A 5EW5E 1AFVA 3DTJA 2Z46A 4COCA 2M8NA 2BUOA 2GONA 2PEJA 3U43A 2X82A 1Q7YQ 1EIAA 3EJBA 3CC7P 2LPKA 4INBA 4GR6A 1Q82Q 1FR2A 4DGEC 3E2DA 3HYBA 4PH1A 2N5IA 2FQ1A 2KG9A 2K93A 2PEKA 5HVCA 2K5XA 4U0AA 2LTEA 2QA4P 1QRJA 4U0EA 2VLOA 2OTJP 1GPJA 2L6EA 1KLPA 3EJDA 3H4EA 5KP6B 4LQWC 2PWOA 3GJNA 1M9FC 2ERHA 2LL8A 1YHQP 4GR2A 1VQLP 1YIJP 2XGVA 1T8KA 3MGEA 3CCEP 3CC4P 2FHSC 2KORA 3RG2A 1K9MQ 2WLVA 4XFYA 3OW2O 1G03A 5KP8B 2JAZA 3DS4A 1EMVA 2EFJA 2CGQA 2KGAA 2AFEA 3RG6C 3DPHA 2VSQA 2M8LA 5EJDA 2MR8A 2PXRC 2KWLA 1ACPA 2WPTA 3CCVP 5KP7B 2N50A 2LOLA 1VHNA 3CPWO 2AVAA 2LIWA 2XZ0D 2KODA 2MVUA 1Q86Q 3DS5A 2AF8A 2EIAA 4B4NA 1ZNVA 3G26A 2M8PA 1K8AQ 4PXHB 1VQOP 2KOOA 2JBGA 1BAJA 1U7KA 2KOPA 2EHSA 1IMPA 2XGYA 5CZDB 1VQKP 2PY8A 1DNYA 4U0DA 3WBHA 2K94A 4XRQA 2K92A 2QNWA 2Y4ZA 2NO8A 3CE7A 1VQ6P 1M9YC 1KQSO 4H2YC 3DS3A 4E92A 1YITP 4QNBA 4PH2A 1AYIA 5HGOA 2VLNA 4BPGA 1A43A 4IZ6A 2KOSA 4F37A 4HKGA 2BHVA 2EHTA 2MF4A 1VQMP 2KG8A 2LKIA 5HGMA 2ONTA 2FAEA 2GDYA 2OARA 4M0IA 4J93A 1AUMA 1M6EX 2GDXA 1YJNP
chains in the Genus database with same CATH topology
2XGUA 2P9XA 1M74A 2LF4A 1VQ9P 1K9MQ 2WLVA 4XFYA 1KD1Q 3G0VA 4XFZA 3OW2O 1P7NA 1G03A 1M9EC 3Q20A 3NTEA 1A8OA 3I56P 2JO0A 5JPAA 4U0CA 2KGFA 3DS4A 1K30A 1RNIA 3G29A 1M9CC 2PWMA 1RO2A 2EFJA 2Z45A 5BS1A 4PH0A 3G6EP 3RG6C 2JYGA 3G28A 3DPHA 2QEXP 2OTLP 1M9XC 2M8LA 5HGLA 2E1MA 2EG5A 3CCUP 1M1KQ 2PXRC 5F2OA 3CD6P 4NX4C 2PEMA 1L6NA 1EOQA 3CCJP 1VQPP 3CCVP 1KC8Q 3VRLC 3LRYA 1AK4C 3M1MA 5F2KA 3CPWO 3I55P 1NJIQ 1YI2P 1VQ8P 2XDEA 1M90Q 2KODA 2CWOA 2PENA 1VQ5P 1YJ9P 1Q86Q 3DS5A 3CCRP 2DGYA 4U0BA 3CMAP 2EIAA 3CCLP 2GOLB 2WLVB 4HTWA 4B4NA 2XV6A 3G21A 3G26A 1QVFO 3G71P 2M8PA 1IUQA 4WYMA 1AFVA 2X83A 2Z46A 3DTJA 4DGAC 3DS2A 4COCA 2M8NA 5HGNA 1K8AQ 5BS2A 2BUOA 1VQOP 1S72P 4E91A 2GONA 2PEJA 3CCMP 2Z44A 3CCSP 4XROA 2X82A 1BAJA 5I4TG 1EIAA 1U7KA 1W2BO 1Q7YQ 3CMEP 3CC7P 1ZMBA 1EM9A 1VQ7P 3H47A 4INBA 4GR6A 1Q82Q 1M9DC 3CCEP 2XGYA 3H0DA 4DGEC 2PEQA 1GWPA 2XT1A 1VQKP 3CCQP 3E2DA 4PH3A 2PY8A 3HYBA 1Q81Q 3CC2P 4U0DA 3WBHA 3G4SP 4XRQA 2PEOA 4PH1A 2JPRA 2Y4ZA 1QVGO 3P05A 1M6NA 2PEKA 1VQ4P 1VQ6P 1M9YC 1KQSO 4IPYA 4COPA 3DS3A 4E92A 3G1IA 4U0AA 2XXMA 1YITP 4QNBA 4XFXA 3BP9A 2PEIA 2QA4P 1JJ2O 4PH2A 5HGOA 1QRJA 4U0EA 1E6JP 5F2NA 2OTJP 1A43A 2L6EA 1YJWP 1K73Q 2BHVA 3DS1A 3H4EA 3DS0A 1VQMP 2V4XA 4LQWC 3B5IA 3G1GA 1VQNP 5HGMA 2X2DD 2PWOA 2ONTA 1M9FC 5HGKA 5DCKA 2JYLA 1RO0A 1YHQP 1D1DA 4GR2A 1VQLP 2OARA 3HZQA 1YIJP 2XGVA 3CXCO 4M0IA 4J93A 4U0FA 1AUMA 1M6EX 3MGEA 1YJNP 1N8RQ 3CC4P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGU A;  2LF4 A;  2WLV A;  4XFY A;  3G0V A;  4XFZ A;  1P7N A;  1G03 A;  1M9E C;  3NTE A;  1A8O A;  2JO0 A;  5JPA A;  4U0C A;  2KGF A;  3DS4 A;  3G29 A;  1M9C C;  2PWM A;  4PH0 A;  2JYG A;  3G28 A;  3DPH A;  1M9X C;  2M8L A;  5HGL A;  2PXR C;  4NX4 C;  1L6N A;  1EOQ A;  3VRL C;  3LRY A;  1AK4 C;  2XDE A;  2KOD A;  3DS5 A;  4U0B A;  2EIA A;  2GOL B;  2WLV B;  4HTW A;  4B4N A;  2XV6 A;  3G21 A;  3G26 A;  2M8P A;  4WYM A;  1AFV A;  2X83 A;  3DTJ A;  4COC A;  4DGA C;  3DS2 A;  2M8N A;  5HGN A;  2BUO A;  4E91 A;  2GON A;  4XRO A;  2X82 A;  1BAJ A;  5I4T G;  1EIA A;  1U7K A;  1EM9 A;  3H47 A;  4INB A;  1M9D C;  2XGY A;  4DGE C;  1GWP A;  2XT1 A;  4PH3 A;  4U0D A;  4XRQ A;  4PH1 A;  2JPR A;  2Y4Z A;  3P05 A;  1M9Y C;  4IPY A;  4COP A;  3DS3 A;  4E92 A;  3G1I A;  4U0A A;  2XXM A;  4QNB A;  4XFX A;  3BP9 A;  4PH2 A;  5HGO A;  1QRJ A;  4U0E A;  1E6J P;  1A43 A;  2L6E A;  3DS1 A;  3H4E A;  3DS0 A;  2V4X A;  4LQW C;  3G1G A;  5HGM A;  2X2D D;  2PWO A;  2ONT A;  1M9F C;  5HGK A;  5DCK A;  2JYL A;  1D1D A;  2XGV A;  4M0I A;  4J93 A;  4U0F A;  1AUM A;  3MGE A; 
#chains in the Genus database with same CATH topology
 2CQ8 A;  4H2X C;  7CEI A;  2N6Y A;  1P7N A;  1M9E C;  3Q20 A;  3I56 P;  2FVA A;  2JO0 A;  5JPA A;  4U0C A;  3G29 A;  1M9C C;  2PWM A;  4PH0 A;  2JQ4 A;  2GZF A;  2JYG A;  3G28 A;  2L22 A;  2QEX P;  1OR5 A;  3GZM A;  3CCU P;  2N6Z A;  1GXH A;  5F2O A;  2ROQ A;  4NX4 C;  3CCJ P;  3VRL C;  3LRY A;  5F2K A;  4UHP B;  2L9F A;  1YI2 P;  2FQ0 A;  1M90 Q;  2CWO A;  2MR7 A;  2JB0 A;  4U0B A;  3CMA P;  2GOL B;  2WLV B;  4HTW A;  2XV6 A;  2XZ1 C;  3LMO A;  1QVF O;  1HQB A;  3G71 P;  1IUQ A;  4WYM A;  2FAC A;  3DS2 A;  5BS2 A;  1S72 P;  2GZJ A;  2K0Y A;  3CCS P;  2Z44 A;  2N5H A;  4XRO A;  2FVE A;  4CA3 A;  1W2B O;  3CME P;  1EM9 A;  3H47 A;  1E0H A;  1M9D C;  2KGC A;  2FAD A;  2GZG A;  1GWP A;  2XT1 A;  3CC2 P;  2PEO A;  2JPR A;  1AF8 A;  1M6N A;  1BXI A;  2X2B A;  5HV8 A;  2KR5 A;  1VKU A;  3DS1 A;  4BPH A;  1F80 D;  2LML A;  3G1G A;  2X2D D;  2GZE A;  2JGP A;  3EJE A;  2JU1 A;  1UNK A;  2XGU A;  2CG5 B;  2P9X A;  1VQ9 P;  1KD1 Q;  3G0V A;  2K2Q A;  3GKL C;  4DG9 A;  2KGF A;  1MZ8 A;  1K30 A;  1RNI A;  5BS1 A;  4PWV B;  2L0Q A;  2OTL P;  1M9X C;  1L0I A;  3NY7 B;  1M1K Q;  2MY5 A;  2KGD A;  1EOQ A;  2KGE A;  3M1M A;  4NEO A;  2FVF A;  1NJI Q;  2PEN A;  1VQ5 P;  3CCR P;  2FQ2 A;  2DGY A;  3CCL P;  1CEI A;  1HY8 A;  2X83 A;  4DGA C;  5HGN A;  2KW2 A;  4E91 A;  3CCM P;  4QKO A;  5I4T G;  2AFD A;  1ZMB A;  1VQ7 P;  1Z6M A;  3H0D A;  2PEQ A;  3CCQ P;  4PH3 A;  1Q81 Q;  3G4S P;  1QVG O;  3P05 A;  1VQ4 P;  4IPY A;  1L0H A;  4COP A;  2N98 A;  4BPF A;  2KOQ A;  3G1I A;  2XXM A;  4XFX A;  2VLQ A;  3BP9 A;  2PEI A;  2KG6 A;  1E6J P;  1GXG A;  5F2N A;  1NQ4 A;  4MRT C;  2PNG A;  2DNW A;  1YJW P;  2GYK A;  1K73 Q;  3DS0 A;  3B5I A;  4R0M A;  2V4X A;  1VQN P;  5HGK A;  5DCK A;  2JYL A;  1RO0 A;  1D1D A;  2VLP A;  3HZQ A;  3CXC O;  4U0F A;  1IMQ A;  1N8R Q;  1JJ2 O;  4H2W C;  1X3O A;  2GDW A;  1M74 A;  2LF4 A;  2LIU A;  2CNR A;  2GZI A;  1UJZ A;  4XFZ A;  2K0D X;  3NTE A;  1A8O A;  2M5R A;  3B4Q A;  3G6E P;  1RO2 A;  2Z45 A;  5HGL A;  2E1M A;  2EG5 A;  2L4B A;  1DV5 A;  3CD6 P;  3GZL A;  2MD9 A;  2PEM A;  2MVV A;  1L6N A;  1VQP P;  1KC8 Q;  1AK4 C;  3I55 P;  1VQ8 P;  2XDE A;  1YJ9 P;  2K0X A;  2JU2 A;  3G21 A;  5EW5 E;  1AFV A;  3DTJ A;  2Z46 A;  4COC A;  2M8N A;  2BUO A;  2GON A;  2PEJ A;  3U43 A;  2X82 A;  1Q7Y Q;  1EIA A;  3EJB A;  3CC7 P;  2LPK A;  4INB A;  4GR6 A;  1Q82 Q;  1FR2 A;  4DGE C;  3E2D A;  3HYB A;  4PH1 A;  2N5I A;  2FQ1 A;  2KG9 A;  2K93 A;  2PEK A;  5HVC A;  2K5X A;  4U0A A;  2LTE A;  2QA4 P;  1QRJ A;  4U0E A;  2VLO A;  2OTJ P;  1GPJ A;  2L6E A;  1KLP A;  3EJD A;  3H4E A;  5KP6 B;  4LQW C;  2PWO A;  3GJN A;  1M9F C;  2ERH A;  2LL8 A;  1YHQ P;  4GR2 A;  1VQL P;  1YIJ P;  2XGV A;  1T8K A;  3MGE A;  3CCE P;  3CC4 P;  2FHS C;  2KOR A;  3RG2 A;  1K9M Q;  2WLV A;  4XFY A;  3OW2 O;  1G03 A;  5KP8 B;  2JAZ A;  3DS4 A;  1EMV A;  2EFJ A;  2CGQ A;  2KGA A;  2AFE A;  3RG6 C;  3DPH A;  2VSQ A;  2M8L A;  5EJD A;  2MR8 A;  2PXR C;  2KWL A;  1ACP A;  2WPT A;  3CCV P;  5KP7 B;  2N50 A;  2LOL A;  1VHN A;  3CPW O;  2AVA A;  2LIW A;  2XZ0 D;  2KOD A;  2MVU A;  1Q86 Q;  3DS5 A;  2AF8 A;  2EIA A;  4B4N A;  1ZNV A;  3G26 A;  2M8P A;  1K8A Q;  4PXH B;  1VQO P;  2KOO A;  2JBG A;  1BAJ A;  1U7K A;  2KOP A;  2EHS A;  1IMP A;  2XGY A;  5CZD B;  1VQK P;  2PY8 A;  1DNY A;  4U0D A;  3WBH A;  2K94 A;  4XRQ A;  2K92 A;  2QNW A;  2Y4Z A;  2NO8 A;  3CE7 A;  1VQ6 P;  1M9Y C;  1KQS O;  4H2Y C;  3DS3 A;  4E92 A;  1YIT P;  4QNB A;  4PH2 A;  1AYI A;  5HGO A;  2VLN A;  4BPG A;  1A43 A;  4IZ6 A;  2KOS A;  4F37 A;  4HKG A;  2BHV A;  2EHT A;  2MF4 A;  1VQM P;  2KG8 A;  2LKI A;  5HGM A;  2ONT A;  2FAE A;  2GDY A;  2OAR A;  4M0I A;  4J93 A;  1AUM A;  1M6E X;  2GDX A;  1YJN P; 
#chains in the Genus database with same CATH homology
 2XGU A;  2P9X A;  1M74 A;  2LF4 A;  1VQ9 P;  1K9M Q;  2WLV A;  4XFY A;  1KD1 Q;  3G0V A;  4XFZ A;  3OW2 O;  1P7N A;  1G03 A;  1M9E C;  3Q20 A;  3NTE A;  1A8O A;  3I56 P;  2JO0 A;  5JPA A;  4U0C A;  2KGF A;  3DS4 A;  1K30 A;  1RNI A;  3G29 A;  1M9C C;  2PWM A;  1RO2 A;  2EFJ A;  2Z45 A;  5BS1 A;  4PH0 A;  3G6E P;  3RG6 C;  2JYG A;  3G28 A;  3DPH A;  2QEX P;  2OTL P;  1M9X C;  2M8L A;  5HGL A;  2E1M A;  2EG5 A;  3CCU P;  1M1K Q;  2PXR C;  5F2O A;  3CD6 P;  4NX4 C;  2PEM A;  1L6N A;  1EOQ A;  3CCJ P;  1VQP P;  3CCV P;  1KC8 Q;  3VRL C;  3LRY A;  1AK4 C;  3M1M A;  5F2K A;  3CPW O;  3I55 P;  1NJI Q;  1YI2 P;  1VQ8 P;  2XDE A;  1M90 Q;  2KOD A;  2CWO A;  2PEN A;  1VQ5 P;  1YJ9 P;  1Q86 Q;  3DS5 A;  3CCR P;  2DGY A;  4U0B A;  3CMA P;  2EIA A;  3CCL P;  2GOL B;  2WLV B;  4HTW A;  4B4N A;  2XV6 A;  3G21 A;  3G26 A;  1QVF O;  3G71 P;  2M8P A;  1IUQ A;  4WYM A;  1AFV A;  2X83 A;  2Z46 A;  3DTJ A;  4DGA C;  3DS2 A;  4COC A;  2M8N A;  5HGN A;  1K8A Q;  5BS2 A;  2BUO A;  1VQO P;  1S72 P;  4E91 A;  2GON A;  2PEJ A;  3CCM P;  2Z44 A;  3CCS P;  4XRO A;  2X82 A;  1BAJ A;  5I4T G;  1EIA A;  1U7K A;  1W2B O;  1Q7Y Q;  3CME P;  3CC7 P;  1ZMB A;  1EM9 A;  1VQ7 P;  3H47 A;  4INB A;  4GR6 A;  1Q82 Q;  1M9D C;  3CCE P;  2XGY A;  3H0D A;  4DGE C;  2PEQ A;  1GWP A;  2XT1 A;  1VQK P;  3CCQ P;  3E2D A;  4PH3 A;  2PY8 A;  3HYB A;  1Q81 Q;  3CC2 P;  4U0D A;  3WBH A;  3G4S P;  4XRQ A;  2PEO A;  4PH1 A;  2JPR A;  2Y4Z A;  1QVG O;  3P05 A;  1M6N A;  2PEK A;  1VQ4 P;  1VQ6 P;  1M9Y C;  1KQS O;  4IPY A;  4COP A;  3DS3 A;  4E92 A;  3G1I A;  4U0A A;  2XXM A;  1YIT P;  4QNB A;  4XFX A;  3BP9 A;  2PEI A;  2QA4 P;  1JJ2 O;  4PH2 A;  5HGO A;  1QRJ A;  4U0E A;  1E6J P;  5F2N A;  2OTJ P;  1A43 A;  2L6E A;  1YJW P;  1K73 Q;  2BHV A;  3DS1 A;  3H4E A;  3DS0 A;  1VQM P;  2V4X A;  4LQW C;  3B5I A;  3G1G A;  1VQN P;  5HGM A;  2X2D D;  2PWO A;  2ONT A;  1M9F C;  5HGK A;  5DCK A;  2JYL A;  1RO0 A;  1YHQ P;  1D1D A;  4GR2 A;  1VQL P;  2OAR A;  3HZQ A;  1YIJ P;  2XGV A;  3CXC O;  4M0I A;  4J93 A;  4U0F A;  1AUM A;  1M6E X;  3MGE A;  1YJN P;  1N8R Q;  3CC4 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...