1QRJA

Solution structure of htlv-i capsid protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
HHHHHSSGHIEGRHMQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASLHHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALPGSAKDPSWASILQGLEEPYHAFVERLNIALDNGLPEGTPKDPILRSLAYSNANKECQKLLQARGHTNSPLGDMLRACQTWTPKDKTKVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTLV-I CAPSID PROTEIN
publication title Sequence-specific 1H, 13C and 15N chemical shift assignment and secondary structure of the HTLV-I capsid protein.
pubmed doi rcsb
source organism Human t-cell lymphotrophic virus type 1
molecule tags Viral protein
total genus 47
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1999-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1qrjA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1qrjA02
4HTWA 1L6NA 2L6EA 4WYMA 3DS4A 4E91A 3VRLC 1M9XC 1GWPA 4PH0A 1EIAA 2XGYA 3DS0A 3LRYA 1M9FC 2JO0A 4M0IA 3H47A 1D1DA 2JYGA 5HGLA 4INBA 1EM9A 2WLVB 2BUOA 4U0AA 1QRJA 2JYLA 4XROA 2GOLB 4DGEC 3DTJA 4XFYA 3BP9A 4QNBA 3DS1A 2JPRA 1P7NA 3G21A 3DS3A 4COCA 4PH1A 3MGEA 3G0VA 2V4XA 4LQWC 1A43A 1M9EC 2XDEA 2XT1A 1EOQA 5HGNA 4XFXA 5HGKA 2LF4A 1E6JP 4J93A 1M9DC 1AUMA 1A8OA 2PWOA 2PWMA 2X82A 2GONA 3NTEA 2M8NA 3DS5A 4XRQA 2XXMA 1U7KA 4U0DA 4U0CA 2Y4ZA 4COPA 1M9YC 4IPYA 3G28A 4U0FA 4U0EA 2PXRC 1M9CC 4E92A 2WLVA 1AFVA 2X2DD 3G29A 2EIAA 2M8LA 3DS2A 4U0BA 3G26A 5JPAA 5DCKA 3G1GA 3DPHA 3H4EA 4DGAC 2X83A 4B4NA 2XV6A 4PH2A 5HGOA 2M8PA 1BAJA 3G1IA 4XFZA 1G03A 3P05A 2XGUA 2KODA 5I4TG 2KGFA 5HGMA 4NX4C 2XGVA 1AK4C 2ONTA 4PH3A
chains in the Genus database with same CATH superfamily
1RNIA 1NQ4A 5EJDA 3DS4A 2QEXP 2N6YA 2K93A 1M9XC 1GXHA 1EIAA 2XGYA 2Z45A 3DS0A 1RO2A 2VLPA 2JO0A 1D1DA 2OTJP 3G71P 1YHQP 1F80D 4INBA 2EG5A 2PY8A 1EMVA 2FVAA 2KGDA 2BUOA 2KR5A 5F2OA 2QA4P 2LIWA 2CG5B 3CCJP 2PEJA 3DS1A 7CEIA 1MZ8A 3G0VA 1IMQA 2JU1A 1QVGO 4LQWC 1AF8A 1VQLP 2XT1A 5KP6B 2CWOA 3GJNA 5HGNA 2OARA 2FACA 5KP7B 2NO8A 4H2WC 4J93A 1AUMA 2EHSA 2FHSC 2GZEA 2MR8A 1L0IA 1DNYA 2M5RA 2KOPA 1U7KA 4U0CA 2Y4ZA 3CCEP 4U0FA 2DGYA 4IZ6A 1X3OA 1AFVA 1VQ4P 1QVFO 4UHPB 2EIAA 2VSQA 4DG9A 3CCSP 4U0BA 2JAZA 3CC7P 5JPAA 3G1GA 4H2YC 3CMAP 2GZIA 1VQPP 2KG8A 3G6EP 4XFZA 1K30A 2PEQA 2XGVA 2K2QA 2CNRA 1KC8Q 4HTWA 4WYMA 3RG6C 2KW2A 2EFJA 5F2NA 2PNGA 4GR6A 2K0XA 1VQ7P 2PEKA 1T8KA 4M0IA 1M9FC 1S72P 3LMOA 3H47A 2QNWA 3B4QA 2MD9A 1K8AQ 1VQ5P 2WLVB 2LTEA 2N5IA 4DGEC 3CC2P 4XFYA 2MVVA 4GR2A 4QNBA 2KG9A 3MGEA 1GXGA 2FVEA 1GPJA 2V4XA 2XDEA 1VKUA 2LIUA 1W2BO 2AF8A 3RG2A 2AVAA 4CA3A 1E6JP 1M6EX 3CC4P 2X82A 1YIJP 2GONA 2M8NA 3DS5A 2L22A 4U0DA 1M9YC 4IPYA 2KGAA 2MY5A 4U0EA 2K0YA 2FAEA 2WLVA 2X2DD 5HVCA 2KOQA 3G4SP 3G26A 2GZFA 1VQ8P 3CCRP 2XV6A 5HGOA 2M8PA 1BAJA 3G1IA 3M1MA 5BS2A 1NJIQ 5EW5E 2MVUA 1KQSO 5HGMA 2FQ0A 1VQKP 1VQMP 2JGPA 4QKOA 2N50A 3U43A 2MR7A 3VRLC 2PEMA 1ACPA 2KGEA 1GWPA 2FADA 3HYBA 2PENA 2KORA 2OTLP 1Z6MA 2X2BA 3LRYA 2JQ4A 2ROQA 4PWVB 1OR5A 5HGLA 3CCMP 1K9MQ 2Z44A 4H2XC 1VQNP 1VQOP 2VLOA 1M6NA 3DTJA 3BP9A 2K92A 2L4BA 1YJWP 1P7NA 3DS3A 1HY8A 4COCA 4PH1A 4R0MA 3WBHA 1YJ9P 2FQ1A 1M9EC 3CCVP 2L0QA 3EJBA 1EOQA 2VLNA 1Q82Q 3CCLP 4XFXA 1CEIA 1K73Q 2MF4A 1FR2A 1A8OA 1YJNP 4BPGA 4F37A 3NTEA 3GZMA 3CMEP 4XRQA 2CQ8A 2K94A 3G28A 3I56P 2PXRC 1M90Q 3NY7B 1JJ2O 2GZJA 2N6ZA 4PXHB 5DCKA 3EJEA 1RO0A 2JB0A 1M1KQ 3EJDA 1Q81Q 1G03A 1M74A 1UJZA 2XGUA 2KOOA 2XZ0D 4NX4C 2DNWA 2XZ1C 2LL8A 5BS1A 2ONTA 3B5IA 4PH3A 5KP8B 2N5HA 1DV5A 1L6NA 2L6EA 3HZQA 1AYIA 4E91A 2ERHA 4BPHA 2GDXA 4PH0A 1KD1Q 2LMLA 2LOLA 2GZGA 2BHVA 4BPFA 2FQ2A 1ZNVA 2FVFA 2JYGA 2K5XA 3CXCO 2N98A 1EM9A 4MRTC 4U0AA 2KGCA 1QRJA 2JYLA 4XROA 2GOLB 5CZDB 4HKGA 2JPRA 3Q20A 3CCQP 3G21A 2EHTA 1E0HA 1A43A 1UNKA 2LKIA 1Q86Q 1VQ9P 2AFEA 2JBGA 5HGKA 3CD6P 2LF4A 3I55P 1M9DC 2PWOA 2PWMA 1YITP 1KLPA 5F2KA 3H0DA 1HQBA 2XXMA 3E2DA 1BXIA 2E1MA 4COPA 2GDYA 1IUQA 2KOSA 1N8RQ 3GKLC 1M9CC 4E92A 2JU2A 2P9XA 3G29A 2GDWA 2M8LA 2LPKA 2PEOA 2KG6A 2CGQA 3DS2A 4NEOA 2GYKA 2KWLA 3DPHA 3H4EA 2VLQA 2K0DX 4DGAC 5HV8A 1ZMBA 2X83A 4B4NA 4PH2A 3GZLA 2L9FA 1VQ6P 3OW2O 3CE7A 2PEIA 2Z46A 3P05A 1IMPA 1L0HA 2KODA 1Q7YQ 5I4TG 2AFDA 2WPTA 2KGFA 1VHNA 3CPWO 1AK4C 3CCUP 1YI2P
chains in the Genus database with same CATH topology
1RNIA 4HTWA 1L6NA 2L6EA 3HZQA 4WYMA 3RG6C 3DS4A 4E91A 2QEXP 2EFJA 5F2NA 3VRLC 4GR6A 2PEMA 1M9XC 1GWPA 1VQ7P 2PEKA 3HYBA 2PENA 4PH0A 1KD1Q 1EIAA 2OTLP 2XGYA 2Z45A 3DS0A 1RO2A 2BHVA 3LRYA 1M9FC 2JO0A 4M0IA 1S72P 3H47A 1D1DA 2OTJP 3G71P 2JYGA 1YHQP 3CXCO 5HGLA 3CCMP 1K9MQ 4INBA 2EG5A 1EM9A 2Z44A 1K8AQ 2PY8A 1VQ5P 2WLVB 2BUOA 4U0AA 1VQNP 1QRJA 2JYLA 5F2OA 2QA4P 4XROA 1VQOP 2GOLB 4DGEC 1M6NA 3DTJA 3CC2P 4XFYA 3BP9A 2PEJA 4GR2A 3CCJP 4QNBA 3DS1A 2JPRA 3Q20A 3CCQP 1P7NA 1YJWP 3G21A 3DS3A 4COCA 4PH1A 3MGEA 3WBHA 1YJ9P 3G0VA 2V4XA 1QVGO 4LQWC 1A43A 1M9EC 2XDEA 1VQLP 3CCVP 2XT1A 1EOQA 1Q86Q 2CWOA 1Q82Q 1VQ9P 5HGNA 3CCLP 4XFXA 1W2BO 5HGKA 3CD6P 2OARA 1K73Q 2LF4A 1E6JP 1M6EX 3I55P 4J93A 1M9DC 1AUMA 1A8OA 3CC4P 2PWOA 2PWMA 2X82A 1YIJP 1YJNP 1YITP 5F2KA 2GONA 3NTEA 3H0DA 2M8NA 3DS5A 3CMEP 4XRQA 2XXMA 3E2DA 1U7KA 4U0DA 4U0CA 2E1MA 2Y4ZA 4COPA 1M9YC 4IPYA 3G28A 1IUQA 3CCEP 4U0FA 4U0EA 2PXRC 3I56P 1M9CC 2DGYA 1N8RQ 4E92A 1M90Q 2WLVA 1AFVA 2P9XA 1VQ4P 2X2DD 3G29A 1QVFO 2EIAA 3G4SP 2M8LA 2PEOA 1JJ2O 3CCSP 3DS2A 4U0BA 3CC7P 3G26A 5JPAA 5DCKA 3G1GA 3DPHA 3H4EA 3CMAP 1VQ8P 4DGAC 1RO0A 3CCRP 1ZMBA 1VQPP 2X83A 4B4NA 2XV6A 4PH2A 3G6EP 5HGOA 1M1KQ 2M8PA 1BAJA 3G1IA 3M1MA 5BS2A 1VQ6P 3OW2O 1Q81Q 1NJIQ 4XFZA 1G03A 2PEIA 1M74A 1K30A 3P05A 2XGUA 2Z46A 2KODA 1Q7YQ 5I4TG 2PEQA 1KQSO 2KGFA 5HGMA 4NX4C 2XGVA 3CPWO 5BS1A 1AK4C 1VQKP 2ONTA 3B5IA 4PH3A 1KC8Q 1VQMP 3CCUP 1YI2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HTW A;  1L6N A;  2L6E A;  4WYM A;  3DS4 A;  4E91 A;  3VRL C;  1M9X C;  1GWP A;  4PH0 A;  1EIA A;  2XGY A;  3DS0 A;  3LRY A;  1M9F C;  2JO0 A;  4M0I A;  3H47 A;  1D1D A;  2JYG A;  5HGL A;  4INB A;  1EM9 A;  2WLV B;  2BUO A;  4U0A A;  1QRJ A;  2JYL A;  4XRO A;  2GOL B;  4DGE C;  3DTJ A;  4XFY A;  3BP9 A;  4QNB A;  3DS1 A;  2JPR A;  1P7N A;  3G21 A;  3DS3 A;  4COC A;  4PH1 A;  3MGE A;  3G0V A;  2V4X A;  4LQW C;  1A43 A;  1M9E C;  2XDE A;  2XT1 A;  1EOQ A;  5HGN A;  4XFX A;  5HGK A;  2LF4 A;  1E6J P;  4J93 A;  1M9D C;  1AUM A;  1A8O A;  2PWO A;  2PWM A;  2X82 A;  2GON A;  3NTE A;  2M8N A;  3DS5 A;  4XRQ A;  2XXM A;  1U7K A;  4U0D A;  4U0C A;  2Y4Z A;  4COP A;  1M9Y C;  4IPY A;  3G28 A;  4U0F A;  4U0E A;  2PXR C;  1M9C C;  4E92 A;  2WLV A;  1AFV A;  2X2D D;  3G29 A;  2EIA A;  2M8L A;  3DS2 A;  4U0B A;  3G26 A;  5JPA A;  5DCK A;  3G1G A;  3DPH A;  3H4E A;  4DGA C;  2X83 A;  4B4N A;  2XV6 A;  4PH2 A;  5HGO A;  2M8P A;  1BAJ A;  3G1I A;  4XFZ A;  1G03 A;  3P05 A;  2XGU A;  2KOD A;  5I4T G;  2KGF A;  5HGM A;  4NX4 C;  2XGV A;  1AK4 C;  2ONT A;  4PH3 A; 
#chains in the Genus database with same CATH topology
 1RNI A;  1NQ4 A;  5EJD A;  3DS4 A;  2QEX P;  2N6Y A;  2K93 A;  1M9X C;  1GXH A;  1EIA A;  2XGY A;  2Z45 A;  3DS0 A;  1RO2 A;  2VLP A;  2JO0 A;  1D1D A;  2OTJ P;  3G71 P;  1YHQ P;  1F80 D;  4INB A;  2EG5 A;  2PY8 A;  1EMV A;  2FVA A;  2KGD A;  2BUO A;  2KR5 A;  5F2O A;  2QA4 P;  2LIW A;  2CG5 B;  3CCJ P;  2PEJ A;  3DS1 A;  7CEI A;  1MZ8 A;  3G0V A;  1IMQ A;  2JU1 A;  1QVG O;  4LQW C;  1AF8 A;  1VQL P;  2XT1 A;  5KP6 B;  2CWO A;  3GJN A;  5HGN A;  2OAR A;  2FAC A;  5KP7 B;  2NO8 A;  4H2W C;  4J93 A;  1AUM A;  2EHS A;  2FHS C;  2GZE A;  2MR8 A;  1L0I A;  1DNY A;  2M5R A;  2KOP A;  1U7K A;  4U0C A;  2Y4Z A;  3CCE P;  4U0F A;  2DGY A;  4IZ6 A;  1X3O A;  1AFV A;  1VQ4 P;  1QVF O;  4UHP B;  2EIA A;  2VSQ A;  4DG9 A;  3CCS P;  4U0B A;  2JAZ A;  3CC7 P;  5JPA A;  3G1G A;  4H2Y C;  3CMA P;  2GZI A;  1VQP P;  2KG8 A;  3G6E P;  4XFZ A;  1K30 A;  2PEQ A;  2XGV A;  2K2Q A;  2CNR A;  1KC8 Q;  4HTW A;  4WYM A;  3RG6 C;  2KW2 A;  2EFJ A;  5F2N A;  2PNG A;  4GR6 A;  2K0X A;  1VQ7 P;  2PEK A;  1T8K A;  4M0I A;  1M9F C;  1S72 P;  3LMO A;  3H47 A;  2QNW A;  3B4Q A;  2MD9 A;  1K8A Q;  1VQ5 P;  2WLV B;  2LTE A;  2N5I A;  4DGE C;  3CC2 P;  4XFY A;  2MVV A;  4GR2 A;  4QNB A;  2KG9 A;  3MGE A;  1GXG A;  2FVE A;  1GPJ A;  2V4X A;  2XDE A;  1VKU A;  2LIU A;  1W2B O;  2AF8 A;  3RG2 A;  2AVA A;  4CA3 A;  1E6J P;  1M6E X;  3CC4 P;  2X82 A;  1YIJ P;  2GON A;  2M8N A;  3DS5 A;  2L22 A;  4U0D A;  1M9Y C;  4IPY A;  2KGA A;  2MY5 A;  4U0E A;  2K0Y A;  2FAE A;  2WLV A;  2X2D D;  5HVC A;  2KOQ A;  3G4S P;  3G26 A;  2GZF A;  1VQ8 P;  3CCR P;  2XV6 A;  5HGO A;  2M8P A;  1BAJ A;  3G1I A;  3M1M A;  5BS2 A;  1NJI Q;  5EW5 E;  2MVU A;  1KQS O;  5HGM A;  2FQ0 A;  1VQK P;  1VQM P;  2JGP A;  4QKO A;  2N50 A;  3U43 A;  2MR7 A;  3VRL C;  2PEM A;  1ACP A;  2KGE A;  1GWP A;  2FAD A;  3HYB A;  2PEN A;  2KOR A;  2OTL P;  1Z6M A;  2X2B A;  3LRY A;  2JQ4 A;  2ROQ A;  4PWV B;  1OR5 A;  5HGL A;  3CCM P;  1K9M Q;  2Z44 A;  4H2X C;  1VQN P;  1VQO P;  2VLO A;  1M6N A;  3DTJ A;  3BP9 A;  2K92 A;  2L4B A;  1YJW P;  1P7N A;  3DS3 A;  1HY8 A;  4COC A;  4PH1 A;  4R0M A;  3WBH A;  1YJ9 P;  2FQ1 A;  1M9E C;  3CCV P;  2L0Q A;  3EJB A;  1EOQ A;  2VLN A;  1Q82 Q;  3CCL P;  4XFX A;  1CEI A;  1K73 Q;  2MF4 A;  1FR2 A;  1A8O A;  1YJN P;  4BPG A;  4F37 A;  3NTE A;  3GZM A;  3CME P;  4XRQ A;  2CQ8 A;  2K94 A;  3G28 A;  3I56 P;  2PXR C;  1M90 Q;  3NY7 B;  1JJ2 O;  2GZJ A;  2N6Z A;  4PXH B;  5DCK A;  3EJE A;  1RO0 A;  2JB0 A;  1M1K Q;  3EJD A;  1Q81 Q;  1G03 A;  1M74 A;  1UJZ A;  2XGU A;  2KOO A;  2XZ0 D;  4NX4 C;  2DNW A;  2XZ1 C;  2LL8 A;  5BS1 A;  2ONT A;  3B5I A;  4PH3 A;  5KP8 B;  2N5H A;  1DV5 A;  1L6N A;  2L6E A;  3HZQ A;  1AYI A;  4E91 A;  2ERH A;  4BPH A;  2GDX A;  4PH0 A;  1KD1 Q;  2LML A;  2LOL A;  2GZG A;  2BHV A;  4BPF A;  2FQ2 A;  1ZNV A;  2FVF A;  2JYG A;  2K5X A;  3CXC O;  2N98 A;  1EM9 A;  4MRT C;  4U0A A;  2KGC A;  1QRJ A;  2JYL A;  4XRO A;  2GOL B;  5CZD B;  4HKG A;  2JPR A;  3Q20 A;  3CCQ P;  3G21 A;  2EHT A;  1E0H A;  1A43 A;  1UNK A;  2LKI A;  1Q86 Q;  1VQ9 P;  2AFE A;  2JBG A;  5HGK A;  3CD6 P;  2LF4 A;  3I55 P;  1M9D C;  2PWO A;  2PWM A;  1YIT P;  1KLP A;  5F2K A;  3H0D A;  1HQB A;  2XXM A;  3E2D A;  1BXI A;  2E1M A;  4COP A;  2GDY A;  1IUQ A;  2KOS A;  1N8R Q;  3GKL C;  1M9C C;  4E92 A;  2JU2 A;  2P9X A;  3G29 A;  2GDW A;  2M8L A;  2LPK A;  2PEO A;  2KG6 A;  2CGQ A;  3DS2 A;  4NEO A;  2GYK A;  2KWL A;  3DPH A;  3H4E A;  2VLQ A;  2K0D X;  4DGA C;  5HV8 A;  1ZMB A;  2X83 A;  4B4N A;  4PH2 A;  3GZL A;  2L9F A;  1VQ6 P;  3OW2 O;  3CE7 A;  2PEI A;  2Z46 A;  3P05 A;  1IMP A;  1L0H A;  2KOD A;  1Q7Y Q;  5I4T G;  2AFD A;  2WPT A;  2KGF A;  1VHN A;  3CPW O;  1AK4 C;  3CCU P;  1YI2 P; 
#chains in the Genus database with same CATH homology
 1RNI A;  4HTW A;  1L6N A;  2L6E A;  3HZQ A;  4WYM A;  3RG6 C;  3DS4 A;  4E91 A;  2QEX P;  2EFJ A;  5F2N A;  3VRL C;  4GR6 A;  2PEM A;  1M9X C;  1GWP A;  1VQ7 P;  2PEK A;  3HYB A;  2PEN A;  4PH0 A;  1KD1 Q;  1EIA A;  2OTL P;  2XGY A;  2Z45 A;  3DS0 A;  1RO2 A;  2BHV A;  3LRY A;  1M9F C;  2JO0 A;  4M0I A;  1S72 P;  3H47 A;  1D1D A;  2OTJ P;  3G71 P;  2JYG A;  1YHQ P;  3CXC O;  5HGL A;  3CCM P;  1K9M Q;  4INB A;  2EG5 A;  1EM9 A;  2Z44 A;  1K8A Q;  2PY8 A;  1VQ5 P;  2WLV B;  2BUO A;  4U0A A;  1VQN P;  1QRJ A;  2JYL A;  5F2O A;  2QA4 P;  4XRO A;  1VQO P;  2GOL B;  4DGE C;  1M6N A;  3DTJ A;  3CC2 P;  4XFY A;  3BP9 A;  2PEJ A;  4GR2 A;  3CCJ P;  4QNB A;  3DS1 A;  2JPR A;  3Q20 A;  3CCQ P;  1P7N A;  1YJW P;  3G21 A;  3DS3 A;  4COC A;  4PH1 A;  3MGE A;  3WBH A;  1YJ9 P;  3G0V A;  2V4X A;  1QVG O;  4LQW C;  1A43 A;  1M9E C;  2XDE A;  1VQL P;  3CCV P;  2XT1 A;  1EOQ A;  1Q86 Q;  2CWO A;  1Q82 Q;  1VQ9 P;  5HGN A;  3CCL P;  4XFX A;  1W2B O;  5HGK A;  3CD6 P;  2OAR A;  1K73 Q;  2LF4 A;  1E6J P;  1M6E X;  3I55 P;  4J93 A;  1M9D C;  1AUM A;  1A8O A;  3CC4 P;  2PWO A;  2PWM A;  2X82 A;  1YIJ P;  1YJN P;  1YIT P;  5F2K A;  2GON A;  3NTE A;  3H0D A;  2M8N A;  3DS5 A;  3CME P;  4XRQ A;  2XXM A;  3E2D A;  1U7K A;  4U0D A;  4U0C A;  2E1M A;  2Y4Z A;  4COP A;  1M9Y C;  4IPY A;  3G28 A;  1IUQ A;  3CCE P;  4U0F A;  4U0E A;  2PXR C;  3I56 P;  1M9C C;  2DGY A;  1N8R Q;  4E92 A;  1M90 Q;  2WLV A;  1AFV A;  2P9X A;  1VQ4 P;  2X2D D;  3G29 A;  1QVF O;  2EIA A;  3G4S P;  2M8L A;  2PEO A;  1JJ2 O;  3CCS P;  3DS2 A;  4U0B A;  3CC7 P;  3G26 A;  5JPA A;  5DCK A;  3G1G A;  3DPH A;  3H4E A;  3CMA P;  1VQ8 P;  4DGA C;  1RO0 A;  3CCR P;  1ZMB A;  1VQP P;  2X83 A;  4B4N A;  2XV6 A;  4PH2 A;  3G6E P;  5HGO A;  1M1K Q;  2M8P A;  1BAJ A;  3G1I A;  3M1M A;  5BS2 A;  1VQ6 P;  3OW2 O;  1Q81 Q;  1NJI Q;  4XFZ A;  1G03 A;  2PEI A;  1M74 A;  1K30 A;  3P05 A;  2XGU A;  2Z46 A;  2KOD A;  1Q7Y Q;  5I4T G;  2PEQ A;  1KQS O;  2KGF A;  5HGM A;  4NX4 C;  2XGV A;  3CPW O;  5BS1 A;  1AK4 C;  1VQK P;  2ONT A;  3B5I A;  4PH3 A;  1KC8 Q;  1VQM P;  3CCU P;  1YI2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...