1QRWA

Crystal structure of an alpha-lytic protease mutant with accelerated folding kinetics, r102h/g134s, ph 8
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCHSGRTTGYQCGTITAKNVTANYAEGAVRGLTQSNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALHPA-LYTIC PROTEASE
publication title A Genetic Screen That Targets Specifically the Folding Transition State of Alpha-Lytic Protease
rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase
total genus 60
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1999-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrwA01
1DWCH 2XTTB 2Q6GA 3AW0A 2VIWA 1MQ6A 2GCHF 3SU3A 1SHYA 4UFDH 1W13U 3FP6E 3MH6A 2LNCA 5FX6A 2ZGXH 1L2EA 1NO9H 1Z8RA 4CH8B 1CT0E 1BMLA 3A8BA 2FXRA 2PSXA 2QAAA 4WMDA 3GCHB 3RXBA 2HVXA 4NFEA 1K1LA 4MVNA 7LPRA 1G32B 5SGAE 5ABWA 2GZ9A 1Z8GA 1OP2A 1TRYA 1GBIA 3H7OA 4GHTA 2ZF0H 2A0QB 7ESTE 4ZUHA 1LPGB 1Y3VA 2ZWLH 3F9HA 1AFQB 1TOCB 3ESTA 1LHEH 5C2ZA 1SGDE 3SORA 1AKSA 2BDCA 2HRVA 3OY6U 1GJ4H 1FUJA 2CN0H 1O5EH 4Y76A 1CVWH 3EA8A 1KY9A 4XDEA 4B2AA 5EXLA 1TALA 2O8WA 2VWLA 4LZ4B 1H9HE 2ZECA 1P9UA 3A83A 2W3KA 5E8EH 3MI4A 1QR3E 1TYNA 1GI2A 3LKWA 2GD4B 3CP7A 1C1OA 4DCDA 4FUBA 1MAXA 3PWBA 4BTIB 1KTSB 2ANWA 2BX4A 2OXSA 3QGNB 5K7RA 1H8DH 1HAVA 1PYTD 2A31A 2CF8H 2P93A 4XE4A 2ZFFH 3S9BA 3BG4B 1TGCA 2OLGA 5DP3A 1QHRB 1O3FA 2W7SA 1TA6A 1JIRA 1EAUA 3T2NA 1NFYA 1TABE 2BOKA 3AAUA 2SGAA 1K1OA 5BPEA 1C2GA 2J2UA 1GI3A 3BSQA 2FMJA 1O33A 5PTPA 1PPZA 3RM2H 1V2QT 3BTKE 4WXIA 3QX5H 1ZZZA 1V2ST 1C5ZB 1Y8TA 1ELVA 5A09A 4X6NA 2BOHB 2ZIQH 3M3SA 1ZSJA 1GBHA 4IW4E 4Y0ZE 1HDTH 2CXVA 3P8FA 1JBUH 5L2YH 1V2OT 3SNAA 1GI9B 2P8OB 2A7HA 2KAIB 3I78A 2GCTB 4SGAE 5FBEA 3NK8A 5C67A 3ATKA 2F3CE 2R3YA 4H4FA 2B0FA 3FANA 3RXLA 4MTBA 2VJ1A 1EX3A 4H6SB 1CT2E 1D3TB 2J92A 1TNHA 1WQVH 9LPRA 1ZR0A 1J14A 4CHAC 1RGQA 3W95A 3U9AH 1FY1A 3EA9A 4X6PA 3LC5A 2HNTC 2UWOA 4INLA 3RXCA 2HOBA 4XFQA 3MO9A 3BEIB 2B9LA 1ETSH 3A82A 3PV4A 4CR5A 4OS1A 1A5GH 2HNTE 2VINA 4Y11E 5EQSA 1QY6A 2FZZA 2UUJB 4FVDA 1AZZA 1BMAA 1SGTA 1O31A 1QB9A 1YPLH 1EZSC 3URDA 2BDBA 3ZVAA 1F0RA 1GI4A 3QN7A 4WF8A 2FP7B 3E8LA 4GSOA 1Z7KA 4MPVA 2ZU2A 1ELBA 3EYDA 3TITA 1DVAH 1CSOE 2A1DB 2PGBB 1MU6B 1OKXA 1EPTA 3TK6A 5C1UA 1UK2A 3BIUH 3UTUH 1MBQA 5CMXH 1ANBA 2G55A 1P2JA 1P3EA 2JH0D 2QXIA 3RDZA 3LGTA 4NZLA 2Z7FE 3AASA 4CRCA 1QB1A 4MQAA 2FI4E 1GBTA 4VGCB 1HAOH 5DP7A 5A8YA 1TMTH 5GJ4B 1C5YB 4ZROA 1P57B 2O8TA 3A84A 1H9LB 2PSYA 5E0JA 1MU8B 1AI8H 2ALVA 3LH3A 4MPXA 1G3DA 4MNXA 3MH5A 2JH6D 1MKXK 5DP4A 1FMGA 1X7AC 2BVSH 3UOPA 2H9TH 1TX7A 3AVZA 3UNRA 2O8LA 1TB6H 3I77A 3UNQA 1HRTH 1QA7A 5GWZA 1FY4A 1FY3A 6CHAB 3P70B 3TH2H 4CRBA 1D6WA 1OP0A 1Z8JB 1LHGH 2G4TA 3SU2A 5FCKA 2BQ6B 2GTBA 1RXPA 2JKHA 1V2MT 1T8LA 1DPOA 4Q7ZA 1KLIH 1G37A 1RIWC 1O2KA 4DVAU 2OQUA 3D65E 3SU6A 1NRRH 6GCHG 4CR9A 5EQQA 1GDQA 4U30A 4XBBA 1MKWH 1XXDA 1AVXA 2PW8H 3VXEH 1MCVA 1YCPH 3BG4C 5TJXA 2BVRH 2BLOA 1MD8A 1SL3A 4A92A 3MWIU 1JWTA 3HK6B 5DP9A 3LU9B 3SOSA 1AE5A 1HAIH 4JYTA 4O3TA 1EUFA 1IQGA 4GPGA 3ZZDA 1O3LA 1EZXC 2F9BH 3LOXA 3TJVA 3M61U 1Z1JA 3RM0H 1HJAB 2VH6A 3K65B 3A88A 3M36A 1QGFA 4Y71A 2FOFA 1SLUB 5A8XA 1ABIH 2OTVA 3LGYA 1CE5A 2P3UB 1ZGVA 1CGIE 2QA9E 3PMBB 2WYJA 3HKJB 3T27A 4JK6A 1C9PA 1V2LT 1W11U 2FOAA 4XBDA 3IITA 3OX7U 1GHXH 2W7UA 3OSYA 1O3JA 2FTLE 1GI0A 3RXSA 2A4RA 2Y5HA 3ODFA 4BAKB 4FVBA 1D9IA 1V3XA 3IWMA 3TH4H 1UTPA 1DWEH 1ESAA 1KXFA 2BY6X 1SGNE 4ZKSU 2OC7A 1S0RA 1KXCA 1ZPCA 3SO3A 4CBNA 1C5MD 2YNBA 1DUEA 4CBOA 5E2OA 3ZZ8A 1O3EA 3LH1A 4WH8A 3PLPA 1T4UH 2ZCKP 2WV4A 1HAVB 3NXPA 1LVMA 1HXEH 1UVTH 5JBAS 2QV1A 1CHOF 2ODQA 2P59A 1O3KA 1TLDA 4NG9H 4A5TS 1O34A 3VB4A 4ABAA 4QT8C 1SC8U 5F8XA 2B5TB 3LDXH 5GDSH 1WCZA 1N8OB 4JK5A 1GMCG 3VGCB 2ZGHA 1MD7A 1NU7B 2RG3A 1OWIA 4A7IB 3LGUA 3U8TH 2STAE 2ZHQH 2Q6FA 2O8MA 4NA9H 4OS6A 2A4QA 1GBLA 1QBOA 2BQ7B 3NKKA 3ATLA 1TGNA 2P3TB 2ZCLP 3RC5A 1SGCA 5JBTA 3RLYH 3BTDE 3Q00A 1HAYB 1SGRE 3ZYEA 1DWBH 1O2QA 1HNEE 1C5WB 3UPEA 2G51A 4GAWA 2G52A 1LMWB 1ANCA 2DE8A 4AFZA 2Q1JA 3QZQA 3RXJA 3B23B 4AYYB 3ZZ7A 1K1MA 1PPCE 1F5LA 2ANKH 3GY3A 4H42U 2QYIA 3SGAE 3T29A 2RCEA 2Z3EA 1C2DA 5IYTA 1O36A 2QF3A 4A1VA 1EB2A 1AFEH 3BTHE 1D4PB 3KQCA 2EI7A 1LQDB 3BV9B 5I25A 1MQ5A 1O3OA 4XBCA 4KTSA 3V7TA 3L3TA 3SGQE 1PQAA 3MU1A 2J34A 4UFEH 3SUFA 3QTOH 1GBDA 2H1UA 4E06H 1S83A 2BD4A 5T3HA 2AMDA 1QA0A 2ZQ2A 3Q76A 1TAWA 1CQQA 1ETRH 1A0JA 3HGNA 2PKAB 1YLCA 1J8AA 5HMAA 3E6PH 1THSH 1NFXA 3P17H 1ESBA 1ZHRA 1ELDE 2PUQH 2ZFQH 4WMFA 4R8TB 1JRTA 1C1RA 5EU8A 1ZJDA 2IJOB 1TQ7B 5E2PA 1LHCH 3GY4A 4ISOA 1BA8B 4ABDA 1C2MA 1QL7A 2ZDKA 1OWKA 4WY3A 4ABJA 2ZGJA 3FP8E 4JYUH 5DK1A 4HGCA 1YP9A 1DLEA 1K9OE 3RXOA 2VB0A 1W3CA 2ZFRH 1YPHC 3IG6B 4TPYA 4RKOB 4X1RU 3QGJA 5AFZH 2DUCA 1O2MA 1QBNA 3MH7A 4ESTE 1L1JA 1P09A 8ESTE 5C5NA 3F9GA 2SNVA 1G30B 2BY5X 2VIPA 1FIWA 2FTMA 1S84A 2AIQA 4ZXXH 1ZMNA 1BJUA 2F83A 2Y5FA 4ZHAA 1VITG 2CHAB 2PWXA 3DHKH 4GVUA 4ISLA 2UUFB 5HGGA 3SV8A 1GJAB 5GCHG 1BZXE 2HPQH 2Z6BD 1DXWA 1VR1H 1N1LA 3OYPA 1SGFG 4BXWA 4X1PU 2W3IA 3RU4E 3ITIA 4AOQA 3SNEA 1TBRH 1C5XB 2CJIA 2PV9B 4ZHLU 3GDUA 1GMHF 1Y3YA 1XUKA 1CBWC 3FZDA 1WOFA 2WPLS 2OQ5A 3UNSA 1YC0A 3RXHA 3ZZ3A 3NWUA 2ZZUH 3TGKE 3C27B 5AVDA 4X8UH 1DS2E 1GG6B 1C9TA 1LDTT 1GBAA 3V13A 2GDEH 2WPHS 5C1YA 2V3OH 4A1XA 1O5AB 2FM2A 3M35A 3EA7A 3RLWH 2ZC9H 3NPSA 1BHXF 1ELTA 2C93B 3LPRA 2RA3A 1AWHB 3S7HB 1O2NA 1OP8A 3U98H 2Z9LA 1A1RA 3FFGA 3GYMA 3ATWA 1KDQA 3O8CA 3M7QA 4AYVB 4DJZB 1M9UA 1O2GH 1QL8A 4HFPB 1SQAA 3A7TA 7GCHG 1TBZH 1F0TA 1XXFA 3RXPA 1TPSA 4H6TA 1SHHB 1GI5A 2P95A 3QO6A 1H4WA 4WVPE 3V0XA 3HATH 1C1QA 1VGCB 5J4SA 2XXLA 5DP5A 2YNAA 1A4WH 3P95A 1UHBA 2A2QH 1ELCA 3RU4T 2J95A 2QF0A 1BRCE 2UWLA 3SJ9A 2BY9X 4X1NU 5FHTA 1S6FA 2NU3E 3RC6A 1DDJA 4B2BA 4ASHA 1PQ7A 1K2I1 1SLXB 3E0NB 1SG8B 1P2NA 2GV7A 4I32A 2FX4A 4TYDA 3A7YA 4E05H 1O2JA 1S85A 4UD9H 1XX9A 1F7ZA 1XVMA 1PQ5A 3TNSA 3LJOA 3SUEA 3NCLA 2ZU1A 4NZQA 2FOGA 3SU1A 3BN9A 2Z3CA 4WWYA 1CA8B 4IN2A 1TE0A 1F0SA 5EXMA 1EB1H 1O2UA 1QRXA 4X8SH 3MNSA 3UOUA 1QL9A 2BD3A 1LVBA 1IHTH 1MCTA 2FEQH 4JMYA 2Z9JA 3SBKA 2J9NA 1WQSA 1C5VA 1HB0B 4YOJA 2XNIA 2XBWA 1DSTA 1UTMA 1GCTB 3CENA 1MZAA 2I6QA 1EJNA 3RXIA 3SI4H 4HTCH 5T6DA 1GBMA 1O5DH 1EKBB 4AG2A 1MKXH 2ZO3H 1ESTA 3UWJH 3ZV9A 1BTWA 1QRWA 2IOTA 1DE7H 1LKBA 1W0ZU 6LPRA 1O3MA 4YESB 1GI6A 3S69A 1BRUP 5HM2A 1AU8A 4K8YA 1INCA 4AG1A 3UR6A 1QCPA 2XC0A 4NGAH 2BLQA 2ZHWH 2ILNA 4DW2U 5CHAC 1AB9C 5AFYH 1A5HA 2FDAA 2WPMS 3ATIA 3UUZA 1UTQA 5EXNA 5DP6A 3E91A 1L1GA 1QJ7B 3BG8A 4WJG2 4D7FA 1C5QA 1HJ9A 1ETTH 5LPRA 1FIZA 3KQDA 1BJVA 3A87A 1L0ZA 1YKTA 1C5SA 3OY5U 1A7SA 1DANH 3SJIA 3TGJE 2A5IA 1XKBC 1XUFA 2ZU4A 3DFLA 4KTCA 3MU8A 3PO1B 4NIXA 4K69A 2FOCA 1D3DB 1TA2A 3RXGA 4ZMAH 2PLXA 5HYOA 1W7XH 4Y0YE 2H9HA 3ODDA 4K3JA 1LPZB 1C1WH 2W5EA 1V2KT 2CV3A 5B6OA 3PTNA 2HNTF 4KKDA 4Y6DA 5TCAA 2D26C 4Q80A 3PMHB 2VWNA 3D62A 2ZI2H 1K28D 1P2IA 1H9IE 1AHTH 2NU1E 3EE0B 4U01A 2TGAA 1GG6C 5FPTA 4LZ1H 1E37B 3M5LA 2BD2A 3SJOA 4FU8A 1VCPA 2V3HH 3PMJA 3ZZCA 6ESTA 3SNCA 1IQFA 3MNCA 2RA0A 2SGQE 1O2WA 4BNRA 1ARCA 1RTLA 3U69H 1NU9A 3LGVA 1WSSH 1QNJA 3T26A 1W14U 1J17T 1QQUA 2XBYA 2XCFA 1TNLA 3K2UA 4MPWA 1GJ5H 2AGGX 3RXQA 1NT1A 4K2YA 4Z6AH 1HBTH 2XBXA 1QBVH 1C2IA 1T8NA 2R3UA 4X2VA 3ZZ9A 2QCYA 1MZDA 1HCGA 4GLYA 4Y8XA 2C4FH 3URCA 5DO4H 1LVOA 1V2PT 1GCDA 1PPHE 2OP9A 5BRRE 4FUFA 1MUEB 4ISNA 5LH8A 1FN8A 3K6ZA 3V12A 4U32A 1NN6A 3QWCH 3SHCH 5FXLA 1ELEE 1P11E 1Y3WA 3SN8A 4DOQA 3UQVA 3KL6A 1EAXA 1C2EA 1O39A 2Y82A 2D2DA 1AQ7A 1P01A 2ODPA 5LPEA 5F03A 4AX9H 2Z3DA 1VCQA 4ABHA 4X1QU 2QY0B 1P03A 2C8WB 2NWNA 5DGJA 4B76A 1YM0A 1ZJKA 4JZEH 3KF2A 3GY2A 1KTTB 1GL0E 1EAIA 1P8VC 2TBSA 3GCHC 3ELAH 1C5LH 2ZFPH 1OWEA 2A2XH 1GJ9B 2BTCE 1GBKA 1LO6A 2FOEA 1O3HA 2WYGA 1KDQB 4IN1A 4NFFA 2SNWA 2R9PA 1HYLA 3GDSA 1EASA 1ZPBA 3P8NA 3TJUA 4DY7B 1P12E 4JZIA 1AFQC 4I8JA 1MTNB 2ZHFH 1P04A 5FCRA 1BQYA 4MG3A 2ZG0H 1DY9A 3VB3A 3UREA 2ZU3A 1C5NH 1AE8H 1IOEA 3VPKA 1DXPA 3A80A 3QTVH 6GCHF 2QXGA 1V2VT 2TGTA 2G8TA 3BEFB 3HK3B 5L30H 1C1TA 1CHGA 2QXJA 1QIXB 4LXBH 1SGQE 4THNH 2C8YB 3STJA 1VITH 3MH4A 1SSXA 1NFUA 1WYKA 1TNKA 2G5VA 5C20A 1AVGH 1ORFA 5I46H 2GT7A 5EOKA 4Y79A 4J1YA 4I31A 1UVOA 1O5BB 1FPCH 1ZTLA 3BTTE 1N6XA 2PKSB 3P8OA 5F8TA 1V2TT 3MTYA 3ZYDA 4A1TA 3A8AA 3O8BA 4D8NA 1UTLM 1BT7A 3MMGA 3VEQB 3R3GB 2QXHA 2BMGB 2XRCA 2F9OA 1G2LA 1DITH 2HPPH 2ZFTA 2Y5GA 1B5GH 1AKSB 7KMEH 2P3FH 3ZVGA 3HKIB 3F68H 1A0HB 2OUAA 1DLKB 1JXPA 3VB7A 4MNVA 1SBWA 1GJ8B 1UK4A 1BTUA 1JRSA 1O3GA 4DGJA 1BTHH 3QZRA 2P8OC 1GHAG 2GCTC 1UMAH 3PWCA 2OINA 3RXUA 2QC2A 2BDHA 4CRAA 4DURA 2PHBA 1IQEA 4UDWH 5JB8S 1A3BH 4Q7YA 2Z9KA 1GMCF 2ZKSA 2ASUB 4E7RG 3H7TA 1SR5C 4I33A 1BTXA 1UO6A 2A5AA 2ANMH 2NU4E 4TWWA 1OPHB 3SV6A 3S9CA 5C5OA 2VWMA 3KGPA 1NRPH 5C1XA 4RN6A 1YF4A 1OS8A 1ELFA 2PR3A 2SGDE 3FZZA 2VIVA 1SGEE 2V35A 1BITA 1J9CH 1BBRK 4XOJA 1ZSLA 3R0FA 4I8LA 4D76A 3GY8A 1FY5A 1KXEA 3ZV8A 4ZHMU 2R2WU 3SZNA 2FYQA 1MH0A 1HXFH 4OS4A 3SUDA 1O2ZA 1RS0A 3D49H 1WBGB 1C5UA 3BF6H 1GJ6A 4ZKRU 3EQ0H 1YGCH 5F6MA 1OXGA 1YPMH 4AB9A 4OGYA 1FLEE 5J4QA 3I29A 1MTSA 3TGIE 1B0EA 2ZTXA 1DFPA 4NWKA 1IQIA 3P6ZB 3RXFA 5K0HA 2JETB 4E7NA 3AW1A 4ZAEA 1O2IA 4YO9A 1BIOA 3A89A 3MOCA 5ESBA 3SGBE 3PLKA 4VGCC 1YYY1 5TCCA 2VNTA 2ZGBH 4Y10E 5EPYA 4INHA 2FS9A 4IBLH 1NM6A 3G01A 2B8OH 1Y5BT 3L6PA 4YLQH 1IQKA 1AWFH 1GI8B 1FPHH 1TRMA 3U8OH 3F9FA 1BCUH 3CS0A 1YLDA 1BB0B 4MPUA 4AFSA 2TGDA 3FVFB 4IGDA 1T4VH 6CHAC 2VGCB 3O8DA 1VJ9U 3ENSB 2D1JA 3GCOA 4FUEA 3MFJA 2FLRH 4XSKU 4B2CA 1HGTH 3ZVDA 3A85A 3RP2A 2VH0A 5FPSA 2TGPZ 2G81E 1O5GH 3KQBA 3RXRA 4X8TH 4O97A 4X0WU 1Z71A 3ATMA 4MDSA 8LPRA 1EPTB 1S81A 2A7JA 1EAWA 1BBRE 1IAUA 1ZSKA 2STBE 4WXVA 2SGEE 1FY8E 2Y80A 2EI6A 1OSSA 1TGTA 5JBCS 1J16A 3OTJE 2EA3A 1TWXB 1LHFH 1C2JA 1TMUH 5AHGH 2ZQ1A 1XUJA 1CU1A 1VITF 1HJAC 4PROA 1K1JA 2AFQB 3SW2B 2ESTE 1EOLA 1E34B 4TPIZ 3SQEE 3SU4A 5GCHF 2EEKA 2WINI 1PJPA 2ZP0H 4WMEA 5JPMH 1C1PA 8KME2 3K9XB 4X8VH 3SJKA 1TGSZ 1Y59T 1YPKH 2FI5E 1KXDA 2GX4A 2SGPE 4BTTB 5LPFA 1G3EA 4OS5A 4MNWA 2C3SA 2FOMB 1K22H 2ZPSA 2BB4A 1AVWA 4BOHA 5JBBS 5LGOA 1GBCA 2GP9B 2BDYA 4D9QA 3GCTG 2AIPA 1F2SE 5FBIA 2OD3B 1OOKB 1NPMA 2GZ8A 5A8ZA 1HFDA 1C2LA 2GT8A 2HWLB 3RMOH 3SNDA 1HPGA 1WTGH 4JZDH 1OYQA 1SGIB 4UFGH 2FWWA 3B8JA 2WV5A 1SVPA 2TPIZ 3UY9A 3PB1E 3ZZ6A 1ZLRA 2G4UA 4BAMB 3LJJA 1V2JT 1FN6A 1UTOA 4YM9A 4NIWA 1GL1A 4GCHG 3KN2A 1LHDH 2FS8A 2FI3E 1N8OC 3VGCC 3KHVA 7GCHF 4CH2B 1Y5AT 3GICB 1BDAA 2F9UA 2ZTZA 3M7UA 1GBBA 1GHZA 3BIVH 3TVJB 1D6RA 1K21H 1O3CA 1BTPA 1G9IE 4B75A 1QRZA 3PTBA 3MU0A 1HAZB 1FV9A 4WH6A 2A4GA 1BUIA 2BDIA 2EC9H 2BQWB 2ODYB 3D23A 3ZVFA 4ABGA 2R0KA 2FESH 4NWLA 1ZPZA 3A8DA 1ZOMA 4KGAA 1IQHA 3MU5A 4YZUA 1L4ZA 1KXBA 1ZYOA 1GHBG 3RXTA 2CMYA 1P06A 3A8CA 4INKA 3NZIA 2NU0E 3VB6A 4Y8ZA 5DJ7A 1NTPA 4K1SA 3SU5A 2VVVA 4HZHA 5EQRA 4Q7XA 5EG4A 1Q3XA 3M37A 2XYAA 5EGMA 2P94A 2GZ7A 2H2ZA 1O30A 2ALPA 2OBQA 4FUIA 4Z0KA 1F0UA 1C5TA 1SPJA 4CHAB 1Q31A 1TX8A 1WV7H 1PYTC 3Q3YA 3SUGA 8GCHG 1D3PB 3M7TA 3RU4D 1CA0B 3SI3H 1O37A 1W0YH 4IMQA 1O3DA 4DIHH 1ZGIA 1S5SA 4CRGA 1EATA 2GKVE 1S0QA 1EPTC 2AH4X 1QJ6B 1TONA 1W10U 2OC1A 3MNBA 1GGDB 4UFFH 1TNGA 1DSUA 1UTNA 1RTKA 1UCYK 3RMLH 4UE7H 1ACBE 1UK3A 2PFEA 1HAGE 1ZRKA 2BD8A 5H4IB 1AO5A 2GDDA 1Z8IB 1PQ8A 1U6QA 3E16B 4ABBA 1TNIA 3RXMA 1GDNA 2ANYA 2VWOA 1SQTA 2P16A 3PMAB 3TIUA 4NSYA 4ISIH 4IS5A 1QTFA 2AGEX 1GBEA 1XKAC 1A0LA 1GJ7B 1O2VA 2AYWA 3M3VA 4K1EA 4IC6A 1O5CB 3EGKH 1BRBE 4YOGA 1GBFA 2FYRA 1BMMH 2FODA 1P0SH 1DX5M 3JZ2B 4ABIA 1OWHA 1WAYB 2EI8A 4DG4A 2M5TA 4F49A 3TPIZ 2BLWA 1FDPA 1YPEH 2GCHG 5IDKA 1S82A 5JB9S 4Y7BA 1GVZA 1Z1IA 1SI5H 2CHAC 3P8GA 1XVOA 2TIOA 3BTGE 1CO7E 1AIXH 1ANEA 2V6NA 4OS7A 1QQ4A 4YTAA 3BTWE 2BYAX 3F9EA 1HAPH 1MBMA 1F92A 2J94A 2ULLA 2GMTB 2SFAA 3F1SB 2AGIX 1C2KA 4B74A 1O35A 3E1XB 3LGIA 2H9EH 1ANDA 2WPKS 1QJ1B 5E0GA 1DM4B 1BTYA 1AD8H 1QURH 1DT2A 3M3TA 1LQEA 3VXFH 1RIWB 3AAVA 3QLPH 3EAJA 5ESTE 3T28A 1OWDA 5FPYA 4BTUB 1O2XA 1TPPA 1AN1E 4IMZA 2ZTYA 3BTQE 4K8BA 1UCYE 2H6MA 1IHSH 2XWAA 1W8BH 4BXSA 1SMFE 1HIAA 4CRFA 2Z94A 1NS3A 1G3CA 3A7XA 2F9PA 1T31A 1SGFA 1SLVB 3PROA 1FQ3A 5JYIA 5DG6A 3UWIA 1HLTH 1GJCB 2XBVA 2FIRH 4NA8A 4X2YA 1AZ8A 2O9QA 2VVCA 3Q77A 2HGTH 2PTNA 4IC5A 1K1PA 1GWAA 1SOTA 1A3EH 4AGKA 3PLBA 3RXKA 2ZGCA 1LCYA 3E0PB 1K1IA 1VGCC 1O3NA 2JH5D 4NCYA 1YBWA 1CGHA 3Q3XA 4I8KA 4AB8A 2A32A 2UUKB 3KIDU 3TJNA 1GBJA 2K1QA 2C8ZB 1GJDB 1BBRH 3QK1A 2OC0A 3TK9A 1MMJN 5A0AE 1DICA 3GY6A 1IQNA 2O8UA 2UWPA 1KSNA 1A5IA 1ZTJA 3QDZB 4NIYA 1SFIA 1Q2WA 4Q2KA 2F9NA 2PTCE 2LPRA 1CA0C 4FU7A 3GOVB 3E90B 1SGYE 4KP0A 1N6YA 3RMNH 3S0NA 3GCNA 5C3NA 5E0HA 3TJOA 1P2MA 1GGDC 4FUCA 3BTFE 2BVXH 5A2MH 4SGBE 2SGFE 1NRNH 4OS2A 5EW1H 4KELA 2Y6TA 5HM9A 2ZPRA 2ZEBA 1QB6A 1HUTH 1EZQA 1TMBH 2PKAA 1CGJE 1UVSH 4K5ZA 3GDVA 2ZHEH 1ZHMA 4CRDA 1WU1A 2I6SA 4ABEA 1O2TA 1PPFE 2R2MB 4DT7B 4NIVA 1FAKH 3MYWA 3LGWA 3SJ8A 1GCTC 4YT7H 3N7OA 3DA9B 1T8MA 1P10A 2AERH 5T6GA 2Y7XA 4FUHA 4TY7A 2Z9GA 1O2PA 3MNXA 4ZXYH 3NUMA 1UHBB 4B73A 3S7KB 3U8RH 1GI7B 4AORA 2PUXB 1YCPM 3KEEA 2BDAA 1F5KU 4YLUA 2A45B 4UONA 1JOUB 2Q6DA 4GUXA 4TWYA 2F91A 3OU0A 1C1MA 1Z6EA 4X6OA 4FXGH 1B0FA 3A7VA 1AGJA 3B9FH 1L1NA 1GI1A 1O3BA 3T5FH 1JIMA 2A5KA 3LT3A 2XCNA 3ZZBA 3UFAA 1DUAA 1IQJA 2NU2E 1O5FH 3KNXA 4JZ1A 4B1TA 1GVKB 2GMTC 9ESTA 1VJAU 3S9AA 2BDGA 3PO1C 2QGRA 4BAQB 3HGPA 1C5RA 3PM3A 4O03A 4B71A 4Y8YA 2UUYA 2BLVA 3UIRA 3CS7A 4FUJA 1MTWA 1TBQH 5HXFA 2G00A 4K60A 1GHAF 1V2UT 2AMPA 3RXDA 4D7GA 1AUTC 5CE1A 4LK4A 2ZDAH 1O3AA 1L4DA 4HI3A 4FU9A 1THPB 1YPJH 2GV6A 2OC8A 3LC3A 2XC5A 4ABFA 2VU8E 1XMNB 4FUDA 3UR9A 3V3MA 1OWJA 1H1BA 2FOHA 5JDUB 4DIIH 1J15A 1O38A 4AN7A 1T32A 2ZCHP 2VIOA 2Z9IA 4RKJB 3FP7E 3ZVBA 1DWDH 4X2WA 1NFWA 1LKAA 1TNJA 1G2MA 2FOBA 4O9VA 5GPIB 3DT0H 1ZMLA 4NSVA 2FO9A 1TFXA 3RXEA 4A6LA 1K1NA 2WPJS 2DE9A 4JCNA 2GGVB 5EODA 3STIA 3U1JB 3RUOA 1GMDF 2C8XB 3U1IB 1MTUA 1NZQH 2OBOA 2WUBA 5EPNA 2BZ6H 1ABJH 2XC4A 3TH3H 4YT6H 4AFUA 4BAOB 3ZVEA 2GVFA 4O3UA 1Y5UT 2HLCA 5F8ZA 4AZ2B 3SV9A 1W2KH 3E3TA 3GY7A 2ZNKH 3SHAH 2BD7A 1BOQA 2HALA 3QUMP 1RRKA 1IQLA 3MO6A 3BTEE 1ELAA 5L6NH 1EP6A 1MAYA 5GIBA 1E35B 3W94A 1GMDG 3GISB 1OYTH 1C4U2 3A86A 1CBWB 1HIAB 1C5PA 1C1SA 1NRSH 3L33A 1A61H 2W26A 4X6MA 1E36B 1O0DH 1RJXB 1FZZA 2H5CA 1GHYH 3ZZ5A 4ISHH 1FI8A 4FUGA 1AMHA 1UVPA 3ZZ4A 1HAXB 2BY7X 2FPZA 1FONA 2BD9A 2QIQA 5A0CA 3M5OA 3HPTB 4CREA 1RD3B 1P02A 4D9RA 1C1NA 4BAHB 1RFNA 2CF9H 4ZKNU 1MTNC 1P2KA 1CHOG 1DOJA 1S6HA 1PPEE 1W12U 1BTZA 1SQOA 3SNBA 1FNIA 5DPAA 4J2YB 1OX1A 2Y7ZA 1LTOA 3GY5A 2VIDA 1LVYA 5L2ZH 1IQMA 4I8GA 1EJAA 1EXFA 5ETXA 3ZZAA 2OCVB 4I7YH 3LIWA 3BEUA 1Z6JH 1AY6H 1TRNA 3KQEA 2H5DA 1XM1A 1C4Y2 2Y81A 1P9SA 3RMMH 3GYLB 3LONA 1H8IH 2F9VA 3PYHA 1XUHA 1UCYH 2IN2A 3A81A 1VZQH 4F4OC 2B7DH 1BHXB 2BX3A 1DY8A 4U2WA 3BTME 2PKSC 1O2OA 4X1SU 1AUJA 2AEIH 1EZUC 1P3CA 3M5MA 4OGXA 1C1UH 3O8RA 1GHVH 2ZDLA 2VIQA 3GCTF 1D3QB 1A46H 1T8OA 3TK5A 1TGBA 3C1KA 1EQ9A 1UVUH 2YOLA 1NY22 1MKWK 2TRMA 2BM2A 3VFEA 1YCPK 2G5NA 3A7ZA 5GXPA 1ARBA 1P2QA 1T7CA 4R0IA 5DKMA 3TLOA 2QN5T 5DP8A 4M7GA 3MO3A 2ZHDA 1GVLA 1MTVA 1HAHH 1EJMA 2XW9A 2ZDMA 4UEHH 1C2HA 4MLFB 1THRH 4GCHF 2J38A 1TIOA 2C90B 4JZFH 1EP5A 1ZRBA 1ID5H 2AMQA 3UQOA 1YPHE 1NESE 3DFJA 5A0BA 2D8WA 1C5OH 1PPBH 1O2SA 3T25A 3H5CB 2KAIA 1XUIA 2BZAA 5CHAB 1AB9B 4RSPA 1KIGH 2V0BA 4KTUA 5FX5A 2ZPQA 3KCGH 1G36A 2ZFSA 1WTHD 1O2RA 1TOMH 1V2RT 1GJBB 1W7GH 4NA7A 2AS9A 4X2XA 1C1VH 2ZDVH 3MHWU 1PFXC 1O3IA 5FAHA 2A7CA 2CGAA 1PPGE 1TX6A 1GDUA 1KXAA 1SOZA 4GHQA 1O2YA 1YPGH 4Y7AA 3SU0A 1UJ1A 2ZDNA 1CT4E 2ZU5A 1GHBF 1O32A 1SLWB 4K1TA 3F6UH 2FX6A 1QFKH 1P05A 1E38B 3JZ1B 2BHGA 1C2FA 3ZVCA 2RDLA 1FXYA 1KLJH 4JYVH 1ZMJA 4LOYH 3RXVA 4AFQA 1HJ8A 2JETC 3T62A 1SGPE 3VB5A 3RXAA 1RTFB 1V6DA 3EDXB 1F5RA 2THFB 2PGQB 3MU4A 4MNYA 4ZKOU 1VCWA 2IPHA 2A4OA 2BXUH 5EW2H 5AF9H 1XUGA 2BD5A 1TPOA 1BMNH 1GMHG 8GCHF 1V2NT 2VVUA 3SV2H 1ELGA 1G3BA 4AGJA 3SV7A 1FAXA 3TU7H 1SFQB 1A2CH 1E0FD 1P2OA 1ZHPA 1O3PB 3Q3KA 1NRQH 1KYNA 1HV7A 3FAOA 4TY6A 5T6FA 2WUCA 1KLTA 2WPIS 2BXTH 1O2HA 2BY8X 3SQHE 2VGCC 1TPAE 4YOIA 1LPKB 2ZA5A 1UTJA 1GPZA 4I8HA 1GHWH 4ZH8A 1NC6A 1UTKA 3DUXH 2XWBI 3K6YA 1C4V2 3M5NA 5G4BA 1Y3XA 3A7WA 1B7XB 1ZTKA 3DD2H 2R0LA 3RC4A 1V2WT 1WUNH 1BRAA 4BANB 1SB1H 1Y3UA 1NROH 3WY8A 3TNTA 1EOJA 1TQ0B 2FLBH 1JMOH 1FJSA 1O2LA 3P92A 2J4IA
chains in the Genus database with same CATH superfamily
1DWCH 2XTTB 2Q6GA 3AW0A 2VIWA 3KYGA 1MQ6A 2GCHF 3SU3A 1SHYA 4UFDH 1W13U 3FP6E 3MH6A 2LNCA 5FX6A 2ZGXH 1L2EA 1NO9H 1Z8RA 4CH8B 1CT0E 1BMLA 3A8BA 2FXRA 2PSXA 2QAAA 4WMDA 3GCHB 3RXBA 2HVXA 4NFEA 1K1LA 4MVNA 7LPRA 1G32B 5SGAE 5ABWA 2GZ9A 1Z8GA 1OP2A 1TRYA 1GBIA 3H7OA 4GHTA 2ZF0H 2A0QB 7ESTE 4ZUHA 1LPGB 1Y3VA 2ZWLH 3F9HA 1AFQB 1TOCB 3ESTA 1LHEH 5C2ZA 1SGDE 3SORA 1AKSA 2BDCA 2HRVA 3OY6U 1GJ4H 1FUJA 2CN0H 1O5EH 4Y76A 1CVWH 2K8IA 3EA8A 1KY9A 4XDEA 4B2AA 5EXLA 1TALA 2O8WA 2VWLA 4LZ4B 1H9HE 2RDEA 2ZECA 1P9UA 3A83A 2W3KA 5E8EH 3MI4A 1QR3E 1TYNA 1GI2A 3LKWA 2GD4B 3CP7A 1C1OA 2J98A 4DCDA 4FUBA 1MAXA 3PWBA 4BTIB 1KTSB 2ANWA 5KGOA 2BX4A 2OXSA 3QGNB 5K7RA 2JDID 1H8DH 1HAVA 1PYTD 2A31A 2CF8H 2P93A 4XE4A 2ZFFH 3S9BA 3BG4B 1TGCA 2OLGA 5DP3A 1QHRB 2XNDD 1O3FA 2W7SA 1TA6A 1JIRA 3NRLA 1EAUA 3PV2A 3T2NA 1NFYA 1TABE 2BOKA 3AAUA 2SGAA 1K1OA 5BPEA 1C2GA 2J2UA 1GI3A 3BSQA 2FMJA 1O33A 5PTPA 1PPZA 3RM2H 1V2QT 3BTKE 4WXIA 3QX5H 1ZZZA 4XD7D 1V2ST 1C5ZB 1Y8TA 1ELVA 5A09A 4X6NA 2BOHB 2ZIQH 3M3SA 1ZSJA 1GBHA 4IW4E 4Y0ZE 1HDTH 2CXVA 3P8FA 1JBUH 5L2YH 1V2OT 3SNAA 1GI9B 2F4LA 2P8OB 2A7HA 2KAIB 3I78A 2GCTB 4SGAE 5FBEA 3NK8A 2OK5A 5C67A 3ATKA 2F3CE 2R3YA 2M2AA 4H4FA 2B0FA 3FANA 3RXLA 4MTBA 2VJ1A 1EX3A 4H6SB 1CT2E 1D3TB 2J92A 1TNHA 1WQVH 9LPRA 1ZR0A 1J14A 4CHAC 1RGQA 3W95A 3U9AH 1FY1A 3EA9A 3FOAA 4X6PA 3LC5A 2HNTC 2UWOA 4INLA 3RXCA 2HOBA 4XFQA 3MO9A 3BEIB 2B9LA 1ETSH 3A82A 3PV4A 4CR5A 4OS1A 1A5GH 2HNTE 2VINA 4Y11E 5EQSA 1QY6A 2FZZA 2UUJB 4FVDA 1AZZA 1BMAA 1SGTA 1O31A 1QB9A 1YPLH 1EZSC 5C94A 3URDA 2BDBA 3ZVAA 1F0RA 1GI4A 3QN7A 4WF8A 2FP7B 3E8LA 4GSOA 5EJ1A 1Z7KA 4MPVA 2ZU2A 1ELBA 3EYDA 3TITA 1DVAH 1CSOE 2A1DB 2PGBB 1MU6B 1OKXA 1EPTA 3TK6A 3UAIC 5C1UA 1UK2A 3BIUH 3UTUH 1MBQA 5CMXH 1ANBA 2G55A 1P2JA 1P3EA 2JH0D 2QXIA 2WZQA 3F0PA 3RDZA 3LGTA 4NZLA 2Z7FE 3AASA 3SYJA 4CRCA 1QB1A 4MQAA 2FI4E 1GBTA 4VGCB 1HAOH 5DP7A 5A8YA 1TMTH 5GJ4B 1C5YB 4ZROA 1P57B 3AK5A 2O8TA 3A84A 1H9LB 2PSYA 5E0JA 1MU8B 1AI8H 2ALVA 3LH3A 4MPXA 1G3DA 4MNXA 3MH5A 2JH6D 1MKXK 5DP4A 1FMGA 1X7AC 2BVSH 3UOPA 2H9TH 1TX7A 3AVZA 5DN6D 3UNRA 2O8LA 1TB6H 3I77A 3UNQA 1HRTH 1QA7A 5GWZA 1FY4A 1FY3A 6CHAB 3P70B 3TH2H 4CRBA 1D6WA 1OP0A 1Z8JB 1LHGH 2G4TA 3SU2A 5FCKA 2BQ6B 2GTBA 1RXPA 2JKHA 1V2MT 1T8LA 1DPOA 4Q7ZA 1KLIH 1G37A 1RIWC 1O2KA 4DVAU 2OQUA 3D65E 3SU6A 1NRRH 6GCHG 4CR9A 5EQQA 1GDQA 4U30A 4XBBA 1MKWH 1XXDA 1AVXA 2PW8H 3VXEH 1MCVA 1YCPH 3BG4C 5TJXA 2BVRH 2BLOA 1MD8A 1SL3A 4A92A 3MWIU 1JWTA 3HK6B 5DP9A 3LU9B 3SOSA 1AE5A 1HAIH 4JYTA 4O3TA 1EUFA 1IQGA 4GPGA 3ZZDA 1O3LA 1EZXC 2F9BH 3LOXA 3TJVA 3M61U 5CHBA 1Z1JA 3RM0H 1HJAB 2VH6A 3K65B 3A88A 3M36A 1QGFA 4Y71A 2FOFA 1SLUB 5A8XA 1ABIH 2OTVA 3LGYA 1CE5A 2P3UB 1ZGVA 1CGIE 2QA9E 3PMBB 2WYJA 3HKJB 3T27A 4JK6A 1C9PA 1V2LT 1W11U 2FOAA 4XBDA 3IITA 3OX7U 1GHXH 2W7UA 3OSYA 4DJZB 1O3JA 2FTLE 1GI0A 3RXSA 3FKSD 2A4RA 2Y5HA 3ODFA 4BAKB 4FVBA 1D9IA 1V3XA 3IWMA 3TH4H 1UTPA 1DWEH 1ESAA 1KXFA 2BY6X 1SGNE 4ZKSU 2OC7A 1S0RA 1KXCA 1ZPCA 3SO3A 4CBNA 1C5MD 2YNBA 1DUEA 4CBOA 2QF5A 5E2OA 3ZZ8A 1O3EA 3LH1A 4WH8A 3PLPA 1T4UH 2ZCKP 2WV4A 2L74A 1HAVB 3NXPA 1LVMA 1HXEH 1UVTH 2CK3D 5JBAS 2QV1A 1CHOF 2ODQA 2P59A 1O3KA 1TLDA 4NG9H 4A5TS 1O34A 3VB4A 4ABAA 4QT8C 1SC8U 5F8XA 2B5TB 3LDXH 5GDSH 1WCZA 1N8OB 4JK5A 1GMCG 3VGCB 2ZGHA 1MD7A 1NU7B 2RG3A 1OWIA 4A7IB 3LGUA 3U8TH 2STAE 2ZHQH 2Q6FA 2O8MA 4NA9H 4OS6A 2J5UA 2A4QA 1GBLA 1QBOA 2BQ7B 3NKKA 3ATLA 1TGNA 2P3TB 2ZCLP 3RC5A 1SGCA 5JBTA 3RLYH 3BTDE 3Q00A 1WXRA 3N99A 1HAYB 1SGRE 3ZYEA 1DWBH 1O2QA 1HNEE 1C5WB 5DSFA 3UPEA 2G51A 4GAWA 2G52A 1LMWB 1ANCA 2DE8A 4AFZA 2Q1JA 3QZQA 3RXJA 5HKKD 3B23B 2J97A 4AYYB 3ZZ7A 1K1MA 1PPCE 1F5LA 2ANKH 3GY3A 4H42U 2QYIA 3SGAE 3T29A 2RCEA 2Z3EA 1C2DA 5IYTA 1O36A 2QF3A 4A1VA 1EB2A 1AFEH 3BTHE 1D4PB 3KQCA 2EI7A 1LQDB 3BV9B 5I25A 1MQ5A 1O3OA 4XBCA 4KTSA 3V7TA 3L3TA 3SGQE 1PQAA 3MU1A 2J34A 4UFEH 3SUFA 3QTOH 1GBDA 2H1UA 4E06H 1S83A 2BD4A 2KCPA 5T3HA 2GJGA 2AMDA 1QA0A 2ZQ2A 3Q76A 1TAWA 1CQQA 1ETRH 1A0JA 2JJ2D 3HGNA 2PKAB 1YLCA 1J8AA 5HMAA 3E6PH 1SKYE 1THSH 1NFXA 3P17H 1ESBA 1ZHRA 1ELDE 4B6EA 2PUQH 2ZFQH 4WMFA 4R8TB 1JRTA 1C1RA 5EU8A 1ZJDA 2IJOB 1TQ7B 5E2PA 1LHCH 3GY4A 4ISOA 1BA8B 4ABDA 1C2MA 1QL7A 2ZDKA 4ASUD 1OWKA 4WY3A 4ABJA 2ZGJA 3FP8E 4JYUH 5DK1A 4HGCA 1YP9A 1DLEA 1K9OE 3RXOA 2VB0A 1W3CA 2ZFRH 3GS9A 1YPHC 3IG6B 2KM0A 4TPYA 4RKOB 4X1RU 3QGJA 5AFZH 2DUCA 1O2MA 3U28C 1QBNA 3MH7A 4ESTE 1L1JA 1P09A 8ESTE 5HIZA 5C5NA 3F9GA 2SNVA 1G30B 2BY5X 2VIPA 1FIWA 2FTMA 1S84A 2AIQA 4ZXXH 1ZMNA 1BJUA 2F83A 2Y5FA 4ZHAA 1VITG 2CHAB 2PWXA 3DHKH 4GVUA 4ISLA 2UUFB 5HGGA 3SV8A 1GJAB 5GCHG 1BZXE 2HPQH 2Z6BD 1DXWA 1VR1H 1N1LA 3OYPA 1SGFG 4BXWA 4X1PU 2W3IA 3RU4E 2YMSC 3ITIA 4AOQA 3SNEA 1TBRH 1C5XB 2CJIA 2PV9B 4ZHLU 3GDUA 1GMHF 1Y3YA 1XUKA 1CBWC 3FZDA 1WOFA 2WPLS 2OQ5A 3UNSA 1YC0A 3RXHA 3ZZ3A 3NWUA 2ZZUH 3TGKE 4M9FA 3C27B 5AVDA 4X8UH 1DS2E 1GG6B 1C9TA 1LDTT 1GBAA 3V13A 2GDEH 2WPHS 5C1YA 2V3OH 4A1XA 1O5AB 2FM2A 3M35A 3EA7A 3RLWH 2ZC9H 3NPSA 1BHXF 1ELTA 2C93B 3LPRA 2RA3A 1AWHB 3S7HB 1O2NA 1OP8A 3U98H 2Z9LA 1A1RA 1YWUA 3FFGA 2V3MA 3GYMA 3ATWA 1KDQA 3O8CA 3M7QA 3OAAD 4AYVB 1M9UA 1O2GH 1QL8A 4HFPB 1SQAA 3A7TA 5HIYA 7GCHG 1TBZH 1F0TA 1XXFA 3RXPA 1TPSA 4H6TA 4AC9A 1SHHB 1GI5A 2P95A 3QO6A 1H4WA 4WVPE 3V0XA 3HATH 1C1QA 1VGCB 5J4SA 2XXLA 5DP5A 5KECA 2YNAA 1A4WH 3P95A 1UHBA 2A2QH 1COWD 1ELCA 3RU4T 2J95A 1YLNA 2QF0A 1BRCE 2UWLA 4DT4A 3SJ9A 2BY9X 4X1NU 5FHTA 1S6FA 2NU3E 3RC6A 1DDJA 4B2BA 4ASHA 1PQ7A 1K2I1 1SLXB 3E0NB 1SG8B 1P2NA 2GV7A 4I32A 2FX4A 4TYDA 3A7YA 4E05H 1O2JA 1S85A 4UD9H 1XX9A 1F7ZA 1XVMA 1PQ5A 3TNSA 3LJOA 3SUEA 3NCLA 2ZU1A 4NZQA 2FOGA 3SU1A 3BN9A 2Z3CA 4WWYA 2KZ4A 1CA8B 4IN2A 1TE0A 1F0SA 5EXMA 1EB1H 1O2UA 1QRXA 4X8SH 3MNSA 3UOUA 1QL9A 2BD3A 1LVBA 1W0JD 3PRDA 1IHTH 1MCTA 2FEQH 4JMYA 2Z9JA 3SBKA 4OM9A 2J9NA 1WQSA 1C5VA 1HB0B 4YOJA 2XNIA 2XBWA 1DSTA 1UTMA 1GCTB 3CENA 1MZAA 2I6QA 1EJNA 3RXIA 3SI4H 4HTCH 5T6DA 1GBMA 1O5DH 1EKBB 4AG2A 1MKXH 2ZO3H 1ESTA 3UWJH 3ZV9A 1BTWA 1QRWA 2IOTA 1DE7H 1LKBA 1W0ZU 6LPRA 1O3MA 4YESB 1GI6A 3S69A 1BRUP 5HM2A 1AU8A 4K8YA 1INCA 4AG1A 3UR6A 1QCPA 2XC0A 4NGAH 2BLQA 2ZHWH 1W0KD 2ILNA 4DW2U 5CHAC 1AB9C 5AFYH 1A5HA 2FDAA 2WPMS 3ATIA 3UUZA 1UTQA 5EXNA 5DP6A 3E91A 1L1GA 1QJ7B 3BG8A 4WJG2 4D7FA 1C5QA 1HJ9A 1ETTH 2IPQX 5LPRA 1FIZA 3KQDA 1BJVA 1EFRD 3A87A 1L0ZA 1YKTA 1C5SA 3OY5U 1A7SA 1DANH 3SJIA 3TGJE 4TT3D 1BMFD 2A5IA 1XKBC 1XUFA 2ZU4A 3DFLA 4KTCA 3MU8A 3PO1B 5KEDA 4NIXA 4K69A 2FOCA 1D3DB 1TA2A 3RXGA 4ZMAH 1E79D 2PLXA 5HYOA 1W7XH 4Y0YE 2H9HA 3ODDA 4K3JA 1LPZB 1C1WH 2W5EA 1V2KT 2CV3A 5B6OA 3PTNA 2HNTF 4KKDA 4Y6DA 5TCAA 2D26C 4Q80A 3PMHB 2VWNA 3D62A 2ZI2H 1K28D 1P2IA 1H9IE 1AHTH 2NU1E 3EE0B 4U01A 2TGAA 1GG6C 5FPTA 4LZ1H 2WV9A 1E37B 3M5LA 2BD2A 3SJOA 2WPDD 4FU8A 1VCPA 2V3HH 3PMJA 3ZZCA 6ESTA 3SNCA 1IQFA 3MNCA 2RA0A 2SGQE 1O2WA 4BNRA 1ARCA 1RTLA 3U69H 1NU9A 3LGVA 1WSSH 1QNJA 3T26A 1W14U 1J17T 1QQUA 2XBYA 2XCFA 3VG8A 1TNLA 3K2UA 4MPWA 1GJ5H 2AGGX 3RXQA 1NT1A 4K2YA 4Z6AH 1HBTH 2LP6A 2XBXA 1QBVH 4HG6A 1C2IA 1T8NA 2R3UA 4X2VA 3FO8D 3ZZ9A 2QCYA 1MZDA 1HCGA 4GLYA 4Y8XA 2C4FH 3URCA 5DO4H 1LVOA 1V2PT 3OTPA 1GCDA 1PPHE 2OP9A 5BRRE 4FUFA 1MUEB 4ISNA 5LH8A 1FN8A 3K6ZA 3V12A 5IK2D 1WDIA 4U32A 1NN6A 3QWCH 3SHCH 5FXLA 1ELEE 1P11E 1Y3WA 3SN8A 4DOQA 3UQVA 4F48B 3KL6A 1EAXA 1C2EA 1O39A 2Y82A 2D2DA 1AQ7A 1P01A 2ODPA 5LPEA 5F03A 4AX9H 2Z3DA 1VCQA 4ABHA 4X1QU 2QY0B 1P03A 2C8WB 2NWNA 5DGJA 4B76A 1YM0A 1ZJKA 3CNRA 4JZEH 3KF2A 3GY2A 1KTTB 1GL0E 1EAIA 1P8VC 2TBSA 3GCHC 3ELAH 1C5LH 2ZFPH 1OWEA 2A2XH 1GJ9B 2BTCE 1GBKA 1LO6A 2FOEA 1O3HA 2WYGA 1KDQB 4IN1A 4NFFA 2SNWA 2R9PA 1HYLA 3GDSA 1EASA 1ZPBA 3P8NA 3TJUA 4DY7B 4YXWD 1P12E 4JZIA 1AFQC 4I8JA 1MTNB 2ZHFH 1P04A 5FCRA 1VKYA 1BQYA 4MG3A 2ZG0H 1DY9A 3VB3A 3UREA 2ZU3A 1C5NH 1AE8H 1IOEA 3VPKA 1DXPA 3A80A 3QTVH 6GCHF 2QXGA 1V2VT 2TGTA 4ACBA 2G8TA 3BEFB 3HK3B 5L30H 1C1TA 1CHGA 2QXJA 3F2FA 1QIXB 4LXBH 1SGQE 4THNH 2C8YB 3STJA 1VITH 3MH4A 1SSXA 1NFUA 1WYKA 1TNKA 2G5VA 5C20A 1AVGH 1ORFA 5I46H 2GT7A 5EOKA 4Y79A 4J1YA 4I31A 1UVOA 1O5BB 3F0OA 1FPCH 1ZTLA 3BTTE 1N6XA 4I86A 2PKSB 3P8OA 5F8TA 1V2TT 3WW7A 3MTYA 3ZYDA 4A1TA 4FETA 3A8AA 3O8BA 4D8NA 1UTLM 1BT7A 3MMGA 3VEQB 3R3GB 2QXHA 2BMGB 2XRCA 2F9OA 1G2LA 1DITH 2HPPH 2ZFTA 2JIZD 2Y5GA 1B5GH 1AKSB 7KMEH 2P3FH 3ZVGA 3HKIB 3F68H 1A0HB 2OUAA 1DLKB 1JXPA 3VB7A 4MNVA 1SBWA 1GJ8B 4Z1MD 1UK4A 1BTUA 1JRSA 3PV5A 1O3GA 4DGJA 1BTHH 3QZRA 2P8OC 1GHAG 2GCTC 1UMAH 3PWCA 2OINA 3RXUA 2QE7D 2J98B 2QC2A 2BDHA 2EY4C 4CRAA 4DURA 2PHBA 1IQEA 4UDWH 5JB8S 1A3BH 4Q7YA 2Z9KA 1GMCF 2ZKSA 2ASUB 4E7RG 5F53A 3H7TA 1SR5C 4I33A 1BTXA 1UO6A 2A5AA 2ANMH 2NU4E 4TWWA 1OPHB 3SV6A 3S9CA 5C5OA 2VWMA 3KGPA 4FOUC 1NRPH 5C1XA 4RN6A 1YF4A 1OS8A 1ELFA 2PR3A 2SGDE 3FZZA 2VIVA 1SGEE 3WWFA 2V35A 1BITA 1J9CH 1FX0B 1BBRK 4XOJA 5EIYA 1ZSLA 3R0FA 4I8LA 3KQ5A 4D76A 3GY8A 1FY5A 1KXEA 3ZV8A 4ZHMU 2R2WU 3SZNA 2FYQA 1MH0A 1OHHD 1HXFH 4OS4A 3SUDA 1O2ZA 1RS0A 3D49H 1WBGB 1C5UA 3BF6H 1GJ6A 4ZKRU 3EQ0H 1YGCH 2HLDD 5F6MA 1OXGA 1YPMH 4AB9A 4OGYA 1FLEE 5J4QA 3I29A 1MTSA 3TGIE 1B0EA 2ZTXA 1DFPA 4NWKA 1IQIA 3P6ZB 3RXFA 5K0HA 2JETB 5C0UA 4E7NA 3AW1A 4ZAEA 1O2IA 4YO9A 1BIOA 3A89A 3MOCA 5ESBA 3SGBE 3PLKA 2IJD1 4VGCC 1YYY1 5TCCA 2VNTA 2ZGBH 4Y10E 5EPYA 4INHA 2FS9A 4IBLH 1NM6A 3G01A 2B8OH 1Y5BT 4ZCNA 3L6PA 4YLQH 2LELA 2AHME 1IQKA 1AWFH 1GI8B 1FPHH 1TRMA 3U8OH 3F9FA 1BCUH 3CS0A 3OEHD 1YLDA 1BB0B 4MPUA 4XRNA 4AFSA 1KMHB 2TGDA 3FVFB 4IGDA 1T4VH 6CHAC 2VGCB 3F2HA 3O8DA 1VJ9U 3ENSB 2D1JA 3GCOA 2KFWA 4FUEA 3MFJA 2FLRH 4XSKU 4B2CA 1HGTH 3ZVDA 3A85A 3RP2A 2VH0A 5FPSA 2TGPZ 2G81E 1O5GH 3KQBA 3RXRA 4X8TH 4O97A 4X0WU 1Z71A 3ATMA 4MDSA 8LPRA 1EPTB 1S81A 2A7JA 1EAWA 1BBRE 1IAUA 1ZSKA 2STBE 3DSOA 4WXVA 2SGEE 1FY8E 2Y80A 2EI6A 1OSSA 1TGTA 5JBCS 1J16A 3OTJE 2EA3A 1TWXB 1LHFH 1C2JA 1TMUH 5AHGH 2ZQ1A 1XUJA 1CU1A 1VITF 1HJAC 4PROA 1K1JA 2AFQB 3SW2B 2ESTE 1EOLA 1E34B 4TPIZ 3SQEE 3SU4A 5GCHF 2EEKA 2WINI 1PJPA 2ZP0H 4WMEA 5JPMH 1C1PA 8KME2 3K9XB 4X8VH 3SJKA 1TGSZ 1Y59T 1YPKH 2FI5E 1KXDA 2GX4A 2SGPE 4BTTB 5LPFA 1G3EA 4OS5A 3MQKC 4MNWA 2C3SA 2FOMB 1K22H 2ZPSA 2BB4A 1AVWA 4BOHA 5JBBS 5LGOA 1GBCA 2GP9B 2BDYA 4D9QA 3GCTG 2AIPA 1F2SE 5FBIA 2OD3B 1OOKB 1NPMA 2GZ8A 5A8ZA 1HFDA 5C17A 1C2LA 2GT8A 2HWLB 3RMOH 3SNDA 1HPGA 1WTGH 4JZDH 1OYQA 1SGIB 4UFGH 2FWWA 3B8JA 2WV5A 1SVPA 2TPIZ 3UY9A 3PB1E 3ZZ6A 1ZLRA 2G4UA 4BAMB 3LJJA 1V2JT 4P00A 1FN6A 1NBME 1UTOA 4YM9A 4NIWA 1GL1A 4GCHG 3KN2A 1LHDH 2FS8A 2FI3E 1N8OC 3VGCC 3KHVA 7GCHF 4CH2B 1Y5AT 3GICB 1BDAA 2F9UA 2ZTZA 3M7UA 1GBBA 3OEED 3F2GA 3DSGA 1H8HD 1GHZA 3BIVH 3TVJB 1D6RA 1K21H 1O3CA 1BTPA 1G9IE 4B75A 1QRZA 3PTBA 3MU0A 1HAZB 1FV9A 4WH6A 2A4GA 1BUIA 2BDIA 2EC9H 2BQWB 2ODYB 3D23A 3ZVFA 4ABGA 2R0KA 2FESH 4NWLA 1ZPZA 3A8DA 1ZOMA 4KGAA 1IQHA 3MU5A 4YZUA 1L4ZA 1KXBA 1ZYOA 1GHBG 3RXTA 2CMYA 1P06A 3A8CA 2VBCA 4INKA 3NZIA 2NU0E 2XOKD 3VB6A 4Y8ZA 5DJ7A 1NTPA 4K1SA 3SU5A 2VVVA 4HZHA 5EQRA 4Q7XA 5EG4A 1Q3XA 3M37A 2XYAA 5EGMA 2P94A 2GZ7A 2H2ZA 1O30A 2ALPA 2OBQA 4FUIA 4Z0KA 1F0UA 1C5TA 1SPJA 4CHAB 1Q31A 1TX8A 1WV7H 1PYTC 3Q3YA 2HVYB 3SUGA 8GCHG 1D3PB 3M7TA 3RU4D 1CA0B 3SI3H 1O37A 1W0YH 3N7DA 1O3DA 4IMQA 4DIHH 1ZGIA 1S5SA 4CRGA 1EATA 2QF4A 2GKVE 1S0QA 1EPTC 2AH4X 1QJ6B 1TONA 1W10U 2OC1A 3MNBA 1GGDB 2YMSD 4UFFH 1TNGA 1DSUA 1UTNA 1RTKA 1UCYK 3RMLH 4UE7H 1ACBE 1UK3A 2PFEA 1HAGE 1ZRKA 2BD8A 5H4IB 1AO5A 2W6JD 2GDDA 1Z8IB 1PQ8A 1U6QA 3E16B 4ABBA 1TNIA 3RXMA 1GDNA 2ANYA 2VWOA 1SQTA 2P16A 3PMAB 3TIUA 4NSYA 4ISIH 4IS5A 1QTFA 2AGEX 1GBEA 1YY3A 1XKAC 1A0LA 1GJ7B 1O2VA 2AYWA 3M3VA 4K1EA 4IC6A 1O5CB 3EGKH 1BRBE 4YOGA 1GBFA 2FYRA 1BMMH 2FODA 1P0SH 1DX5M 3JZ2B 4ABIA 1OWHA 1WAYB 2EI8A 4DG4A 2M5TA 4F49A 3TPIZ 2PP6A 2BLWA 1FDPA 1YPEH 2GCHG 5IDKA 1S82A 5JB9S 4Y7BA 1GVZA 5EJLA 1Z1IA 1SI5H 2CHAC 3DSPA 3P8GA 2L6OA 1XVOA 2TIOA 3BTGE 1CO7E 1AIXH 1ANEA 2V6NA 4OS7A 1QQ4A 4YTAA 3BTWE 2BYAX 3F9EA 1HAPH 1MBMA 1F92A 2J94A 2ULLA 2GMTB 4Q4LA 2SFAA 3F1SB 2AGIX 1C2KA 4B74A 1O35A 3E1XB 3LGIA 2H9EH 1ANDA 2WPKS 1QJ1B 5E0GA 1DM4B 1BTYA 1AD8H 1QURH 1DT2A 3KYFA 3M3TA 1LQEA 3VXFH 1RIWB 3AAVA 3QLPH 3EAJA 5ESTE 3T28A 1OWDA 5FPYA 4BTUB 1O2XA 1TPPA 1AN1E 4IMZA 2ZTYA 3BTQE 4K8BA 1UCYE 2H6MA 1IHSH 2XWAA 2KCAA 1W8BH 4BXSA 1SMFE 1HIAA 4CRFA 2KCOA 2Z94A 1NS3A 1G3CA 3A7XA 2F9PA 1T31A 3PRBA 1SGFA 1SLVB 3PROA 1FQ3A 5JYIA 5DG6A 3UWIA 1HLTH 1GJCB 2XBVA 2FIRH 4NA8A 4X2YA 1AZ8A 2O9QA 2VVCA 3Q77A 2HGTH 2PTNA 4IC5A 1K1PA 1GWAA 1SOTA 3H09A 1A3EH 4AGKA 3PLBA 3RXKA 2ZGCA 1LCYA 3E0PB 1K1IA 1VGCC 1O3NA 2JH5D 1MABB 4NCYA 1YBWA 1CGHA 5C0TA 3Q3XA 4I8KA 4AB8A 2A32A 2UUKB 3KIDU 3TJNA 1GBJA 2K1QA 2C8ZB 1GJDB 1BBRH 3QK1A 2OC0A 4RT0A 3TK9A 1MMJN 5A0AE 1DICA 3GY6A 3F3BA 1IQNA 2O8UA 2UWPA 1KSNA 1A5IA 1ZTJA 3QDZB 4NIYA 1SFIA 1Q2WA 4Q2KA 2F9NA 2WSSD 2PTCE 2LPRA 1CA0C 4FU7A 3GOVB 3E90B 1SGYE 4KP0A 1N6YA 3OE7D 3RMNH 3S0NA 3GCNA 5C3NA 5E0HA 3TJOA 1H8ED 1P2MA 1GGDC 4FUCA 3BTFE 2BVXH 5A2MH 4SGBE 2SGFE 1NRNH 4OS2A 5EW1H 4KELA 2Y6TA 5HM9A 2ZPRA 2ZEBA 1QB6A 1HUTH 1EZQA 1TMBH 2PKAA 1CGJE 1UVSH 3UB0A 4K5ZA 3GDVA 2ZHEH 1ZHMA 4CRDA 1WU1A 2I6SA 4ABEA 1O2TA 1PPFE 2R2MB 4DT7B 4NIVA 1FAKH 3MYWA 3LGWA 3SJ8A 1GCTC 4YT7H 3N7OA 3DA9B 1T8MA 1P10A 2AERH 5T6GA 2Y7XA 1K0HA 4FUHA 4TY7A 2Z9GA 1O2PA 3MNXA 4ZXYH 3NUMA 1UHBB 4B73A 3S7KB 3U8RH 1GI7B 4AORA 2PUXB 1YCPM 3KEEA 2BDAA 1F5KU 4YLUA 2A45B 4UONA 1JOUB 2Q6DA 4GUXA 4TWYA 5T1VA 2F91A 3OU0A 2KX4A 1C1MA 1Z6EA 4X6OA 4FXGH 1B0FA 3A7VA 1AGJA 3B9FH 1L1NA 1GI1A 1O3BA 3T5FH 1E1QD 1JIMA 2A5KA 3LT3A 2XCNA 3DCLA 1UW7A 3UFAA 1DUAA 1IQJA 2NU2E 3ZZBA 1O5FH 3KNXA 4JZ1A 4B1TA 1GVKB 2GMTC 2KR7A 9ESTA 1VJAU 3S9AA 2BDGA 3FN8A 2QGRA 3PO1C 4BAQB 3HGPA 1C5RA 3PM3A 4O03A 4B71A 4Y8YA 2UUYA 2BLVA 3UIRA 3CS7A 4FUJA 1MTWA 1TBQH 5HXFA 2G00A 4K60A 1GHAF 1V2UT 2AMPA 3RXDA 4D7GA 1AUTC 5CE1A 1SQRA 4LK4A 2ZDAH 1O3AA 1L4DA 4HI3A 4FU9A 1THPB 1YPJH 2GV6A 2OC8A 3LC3A 2XC5A 4ABFA 2VU8E 1XMNB 4FUDA 3UR9A 3V3MA 3W1EA 1OWJA 1H1BA 2FOHA 5JDUB 4DIIH 1J15A 2W6ID 1O38A 4AN7A 1T32A 2ZCHP 2VIOA 2Z9IA 4RKJB 3FP7E 3ZVBA 1DWDH 4X2WA 1NFWA 1LKAA 1TNJA 1G2MA 3N7EA 2FOBA 2EQNA 4O9VA 5GPIB 3DT0H 1ZMLA 4NSVA 2FO9A 1TFXA 3RXEA 4A6LA 1K1NA 2WPJS 2DE9A 4JCNA 4F55A 2GGVB 5EODA 3STIA 3U1JB 3RUOA 1GMDF 2C8XB 3U1IB 1MTUA 1NZQH 2OBOA 2WUBA 5EPNA 2BZ6H 1ABJH 2XC4A 3TH3H 4YT6H 4AFUA 5B6LA 4BAOB 3ZVEA 2GVFA 4O3UA 1Y5UT 2HLCA 5F8ZA 4AZ2B 3SV9A 1W2KH 3E3TA 3GY7A 2ZNKH 3SHAH 4P02A 2BD7A 1BOQA 4Q63A 2HALA 3ZIAD 2JJ1D 1RRKA 1IQLA 3QUMP 3MO6A 3BTEE 1ELAA 2YMSB 5L6NH 1EP6A 1MAYA 5GIBA 1E35B 3W94A 1GMDG 3GISB 1OYTH 1C4U2 3A86A 1CBWB 1HIAB 1C5PA 1C1SA 1NRSH 3L33A 1A61H 2W26A 4X6MA 1E36B 1O0DH 1S6LA 1RJXB 1FZZA 2H5CA 1GHYH 3ZZ5A 4ISHH 2F43B 1FI8A 4FUGA 1AMHA 1UVPA 3ZZ4A 1HAXB 4TSFD 2BY7X 2FPZA 1FONA 2BD9A 2QIQA 5A0CA 3M5OA 3HPTB 4CREA 1RD3B 1P02A 4D9RA 1C1NA 4BAHB 1RFNA 2CF9H 4ZKNU 1MTNC 1P2KA 5FL7D 1CHOG 1DOJA 1S6HA 1PPEE 1W12U 1BTZA 1SQOA 2RFKC 3SNBA 1FNIA 5DPAA 4J2YB 1OX1A 2Y7ZA 1LTOA 3GY5A 2VIDA 1LVYA 5L2ZH 1IQMA 4I8GA 1EJAA 1EXFA 5ETXA 3ZZAA 2OCVB 4I7YH 3LIWA 3BEUA 1Z6JH 1AY6H 1TRNA 3KQEA 2H5DA 1XM1A 1C4Y2 3WWBA 2Y81A 1P9SA 3RMMH 3GYLB 3LONA 1H8IH 2F9VA 3EE7A 3PYHA 1XUHA 1UCYH 2IN2A 3A81A 1VZQH 4F4OC 2B7DH 1BHXB 2BX3A 1DY8A 4U2WA 3BTME 2PKSC 1O2OA 4X1SU 1AUJA 2AEIH 1EZUC 1P3CA 3M5MA 4OGXA 1C1UH 3O8RA 1GHVH 2ZDLA 2VIQA 3GCTF 1D3QB 1A46H 1T8OA 3TK5A 1TGBA 3C1KA 5EJZA 1EQ9A 1UVUH 2YOLA 1NY22 1MKWK 2TRMA 2BM2A 3VFEA 1YCPK 2G5NA 3A7ZA 5GXPA 1ARBA 1P2QA 1T7CA 4R0IA 5DKMA 3TLOA 4ACAA 2QN5T 5DP8A 4M7GA 3MO3A 2ZHDA 1GVLA 1MTVA 1HAHH 1EJMA 2XW9A 2ZDMA 4RI0A 4UEHH 1C2HA 4MLFB 1THRH 4GCHF 2V7QD 2J38A 1TIOA 2C90B 4JZFH 1EP5A 1ZRBA 1ID5H 2AMQA 3UQOA 1YPHE 4B6FA 1NESE 3DFJA 5A0BA 2D8WA 1C5OH 1PPBH 1O2SA 3T25A 3H5CB 2KAIA 2K0QA 1XUIA 2BZAA 5CHAB 1AB9B 4RSPA 1KIGH 1QZ8A 2V0BA 4KTUA 5FX5A 2ZPQA 3KCGH 1G36A 2ZFSA 1WTHD 1O2RA 1TOMH 1V2RT 1GJBB 1W7GH 4NA7A 2AS9A 4X2XA 1C1VH 2ZDVH 3MHWU 1PFXC 2WHXA 1O3IA 5FAHA 2A7CA 2CGAA 1PPGE 1TX6A 1GDUA 1KXAA 1SOZA 4GHQA 1O2YA 1YPGH 4Y7AA 3SU0A 1UJ1A 2ZDNA 1CT4E 2ZU5A 1GHBF 1O32A 1SLWB 4K1TA 3F6UH 2FX6A 1QFKH 1P05A 1E38B 3JZ1B 2BHGA 5GNDA 1C2FA 3ZVCA 2RDLA 1FXYA 1KLJH 4JYVH 1ZMJA 4LOYH 3RXVA 4AFQA 1HJ8A 2JETC 3T62A 1SGPE 3VB5A 3RXAA 1RTFB 1V6DA 4RT1A 3EDXB 1F5RA 2THFB 2PGQB 3MU4A 4MNYA 4ZKOU 5CDFE 1VCWA 2IPHA 2A4OA 2BXUH 3OFND 5EW2H 5AF9H 1XUGA 2BD5A 1TPOA 1BMNH 1GMHG 8GCHF 1V2NT 2VVUA 2KCYA 3SV2H 1ELGA 1G3BA 4AGJA 3SV7A 1FAXA 3TU7H 1SFQB 1A2CH 1E0FD 1P2OA 1ZHPA 1O3PB 3Q3KA 1NRQH 1KYNA 1HV7A 3FAOA 4TY6A 5T6FA 2WUCA 1KLTA 2WPIS 2BXTH 1O2HA 2BY8X 3SQHE 3SZEA 2VGCC 1TPAE 4YOIA 1LPKB 2ZA5A 1UTJA 1GPZA 4I8HA 1GHWH 4ZH8A 1NC6A 1UTKA 3DUXH 2XWBI 3K6YA 1C4V2 3M5NA 5G4BA 1Y3XA 3A7WA 1B7XB 1ZTKA 3DD2H 2R0LA 3RC4A 1E1RD 1V2WT 1WUNH 1BRAA 4BANB 1SB1H 1Y3UA 1NROH 1NBMD 3WY8A 3TNTA 1EOJA 1TQ0B 2FLBH 1JMOH 1FJSA 1O2LA 3P92A 2J4IA
chains in the Genus database with same CATH topology
1DWCH 2XTTB 2Q6GA 3AW0A 2VIWA 1MQ6A 2GCHF 3SU3A 1SHYA 4UFDH 1W13U 3FP6E 3MH6A 2LNCA 5FX6A 2ZGXH 1L2EA 1NO9H 1Z8RA 4CH8B 1CT0E 1BMLA 3A8BA 2FXRA 2PSXA 2QAAA 4WMDA 3GCHB 3RXBA 2HVXA 4NFEA 1K1LA 4MVNA 7LPRA 1G32B 5SGAE 5ABWA 2GZ9A 1Z8GA 1OP2A 1TRYA 1GBIA 3H7OA 4GHTA 2ZF0H 2A0QB 7ESTE 4ZUHA 1LPGB 1Y3VA 2ZWLH 3F9HA 1AFQB 1TOCB 3ESTA 1LHEH 5C2ZA 1SGDE 3SORA 1AKSA 2BDCA 2HRVA 3OY6U 1GJ4H 1FUJA 2CN0H 1O5EH 4Y76A 1CVWH 3EA8A 1KY9A 4XDEA 4B2AA 5EXLA 1TALA 2O8WA 2VWLA 4LZ4B 1H9HE 2ZECA 1P9UA 3A83A 2W3KA 5E8EH 3MI4A 1QR3E 1TYNA 1GI2A 3LKWA 2GD4B 3CP7A 1C1OA 4DCDA 4FUBA 1MAXA 3PWBA 4BTIB 1KTSB 2ANWA 2BX4A 2OXSA 3QGNB 5K7RA 1H8DH 1HAVA 1PYTD 2A31A 2CF8H 2P93A 4XE4A 2ZFFH 3S9BA 3BG4B 1TGCA 2OLGA 5DP3A 1QHRB 1O3FA 2W7SA 1TA6A 1JIRA 1EAUA 3T2NA 1NFYA 1TABE 2BOKA 3AAUA 2SGAA 1K1OA 5BPEA 1C2GA 2J2UA 1GI3A 3BSQA 2FMJA 1O33A 5PTPA 1PPZA 3RM2H 1V2QT 3BTKE 4WXIA 3QX5H 1ZZZA 1V2ST 1C5ZB 1Y8TA 1ELVA 5A09A 4X6NA 2BOHB 2ZIQH 3M3SA 1ZSJA 1GBHA 4IW4E 4Y0ZE 1HDTH 2CXVA 3P8FA 1JBUH 5L2YH 1V2OT 3SNAA 1GI9B 2P8OB 2A7HA 2KAIB 3I78A 2GCTB 4SGAE 5FBEA 3NK8A 5C67A 3ATKA 2F3CE 2R3YA 4H4FA 2B0FA 3FANA 3RXLA 4MTBA 2VJ1A 1EX3A 4H6SB 1CT2E 1D3TB 2J92A 1TNHA 1WQVH 9LPRA 1ZR0A 1J14A 4CHAC 1RGQA 3W95A 3U9AH 1FY1A 3EA9A 4X6PA 3LC5A 2HNTC 2UWOA 4INLA 3RXCA 2HOBA 4XFQA 3MO9A 3BEIB 2B9LA 1ETSH 3A82A 3PV4A 4CR5A 4OS1A 1A5GH 2HNTE 2VINA 4Y11E 5EQSA 1QY6A 2FZZA 2UUJB 4FVDA 1AZZA 1BMAA 1SGTA 1O31A 1QB9A 1YPLH 1EZSC 3URDA 2BDBA 3ZVAA 1F0RA 1GI4A 3QN7A 4WF8A 2FP7B 3E8LA 4GSOA 1Z7KA 4MPVA 2ZU2A 1ELBA 3EYDA 3TITA 1DVAH 1CSOE 2A1DB 2PGBB 1MU6B 1OKXA 1EPTA 3TK6A 5C1UA 1UK2A 3BIUH 3UTUH 1MBQA 5CMXH 1ANBA 2G55A 1P2JA 1P3EA 2JH0D 2QXIA 3RDZA 3LGTA 4NZLA 2Z7FE 3AASA 4CRCA 1QB1A 4MQAA 2FI4E 1GBTA 4VGCB 1HAOH 5DP7A 5A8YA 1TMTH 5GJ4B 1C5YB 4ZROA 1P57B 2O8TA 3A84A 1H9LB 2PSYA 5E0JA 1MU8B 1AI8H 2ALVA 3LH3A 4MPXA 1G3DA 4MNXA 3MH5A 2JH6D 1MKXK 5DP4A 1FMGA 1X7AC 2BVSH 3UOPA 2H9TH 1TX7A 3AVZA 3UNRA 2O8LA 1TB6H 3I77A 3UNQA 1HRTH 1QA7A 5GWZA 1FY4A 1FY3A 6CHAB 3P70B 3TH2H 4CRBA 1D6WA 1OP0A 1Z8JB 1LHGH 2G4TA 3SU2A 5FCKA 2BQ6B 2GTBA 1RXPA 2JKHA 1V2MT 1T8LA 1DPOA 4Q7ZA 1KLIH 1G37A 1RIWC 1O2KA 4DVAU 2OQUA 3D65E 3SU6A 1NRRH 6GCHG 4CR9A 5EQQA 1GDQA 4U30A 4XBBA 1MKWH 1XXDA 1AVXA 2PW8H 3VXEH 1MCVA 1YCPH 3BG4C 5TJXA 2BVRH 2BLOA 1MD8A 1SL3A 4A92A 3MWIU 1JWTA 3HK6B 5DP9A 3LU9B 3SOSA 1AE5A 1HAIH 4JYTA 4O3TA 1EUFA 1IQGA 4GPGA 3ZZDA 1O3LA 1EZXC 2F9BH 3LOXA 3TJVA 3M61U 1Z1JA 3RM0H 1HJAB 2VH6A 3K65B 3A88A 3M36A 1QGFA 4Y71A 2FOFA 1SLUB 5A8XA 1ABIH 2OTVA 3LGYA 1CE5A 2P3UB 1ZGVA 1CGIE 2QA9E 3PMBB 2WYJA 3HKJB 3T27A 4JK6A 1C9PA 1V2LT 1W11U 2FOAA 4XBDA 3IITA 3OX7U 1GHXH 2W7UA 3OSYA 1O3JA 2FTLE 1GI0A 3RXSA 2A4RA 2Y5HA 3ODFA 4BAKB 4FVBA 1D9IA 1V3XA 3IWMA 3TH4H 1UTPA 1DWEH 1ESAA 1KXFA 2BY6X 1SGNE 4ZKSU 2OC7A 1S0RA 1KXCA 1ZPCA 3SO3A 4CBNA 1C5MD 2YNBA 1DUEA 4CBOA 5E2OA 3ZZ8A 1O3EA 3LH1A 4WH8A 3PLPA 1T4UH 2ZCKP 2WV4A 1HAVB 3NXPA 1LVMA 1HXEH 1UVTH 5JBAS 2QV1A 1CHOF 2ODQA 2P59A 1O3KA 1TLDA 4NG9H 4A5TS 1O34A 3VB4A 4ABAA 4QT8C 1SC8U 5F8XA 2B5TB 3LDXH 5GDSH 1WCZA 1N8OB 4JK5A 1GMCG 3VGCB 2ZGHA 1MD7A 1NU7B 2RG3A 1OWIA 4A7IB 3LGUA 3U8TH 2STAE 2ZHQH 2Q6FA 2O8MA 4NA9H 4OS6A 2A4QA 1GBLA 1QBOA 2BQ7B 3NKKA 3ATLA 1TGNA 2P3TB 2ZCLP 3RC5A 1SGCA 5JBTA 3RLYH 3BTDE 3Q00A 1HAYB 1SGRE 3ZYEA 1DWBH 1O2QA 1HNEE 1C5WB 3UPEA 2G51A 4GAWA 2G52A 1LMWB 1ANCA 2DE8A 4AFZA 2Q1JA 3QZQA 3RXJA 3B23B 4AYYB 3ZZ7A 1K1MA 1PPCE 1F5LA 2ANKH 3GY3A 4H42U 2QYIA 3SGAE 3T29A 2RCEA 2Z3EA 1C2DA 5IYTA 1O36A 2QF3A 4A1VA 1EB2A 1AFEH 3BTHE 1D4PB 3KQCA 2EI7A 1LQDB 3BV9B 5I25A 1MQ5A 1O3OA 4XBCA 4KTSA 3V7TA 3L3TA 3SGQE 1PQAA 3MU1A 2J34A 4UFEH 3SUFA 3QTOH 1GBDA 2H1UA 4E06H 1S83A 2BD4A 5T3HA 2AMDA 1QA0A 2ZQ2A 3Q76A 1TAWA 1CQQA 1ETRH 1A0JA 3HGNA 2PKAB 1YLCA 1J8AA 5HMAA 3E6PH 1THSH 1NFXA 3P17H 1ESBA 1ZHRA 1ELDE 2PUQH 2ZFQH 4WMFA 4R8TB 1JRTA 1C1RA 5EU8A 1ZJDA 2IJOB 1TQ7B 5E2PA 1LHCH 3GY4A 4ISOA 1BA8B 4ABDA 1C2MA 1QL7A 2ZDKA 1OWKA 4WY3A 4ABJA 2ZGJA 3FP8E 4JYUH 5DK1A 4HGCA 1YP9A 1DLEA 1K9OE 3RXOA 2VB0A 1W3CA 2ZFRH 1YPHC 3IG6B 4TPYA 4RKOB 4X1RU 3QGJA 5AFZH 2DUCA 1O2MA 1QBNA 3MH7A 4ESTE 1L1JA 1P09A 8ESTE 5C5NA 3F9GA 2SNVA 1G30B 2BY5X 2VIPA 1FIWA 2FTMA 1S84A 2AIQA 4ZXXH 1ZMNA 1BJUA 2F83A 2Y5FA 4ZHAA 1VITG 2CHAB 2PWXA 3DHKH 4GVUA 4ISLA 2UUFB 5HGGA 3SV8A 1GJAB 5GCHG 1BZXE 2HPQH 2Z6BD 1DXWA 1VR1H 1N1LA 3OYPA 1SGFG 4BXWA 4X1PU 2W3IA 3RU4E 3ITIA 4AOQA 3SNEA 1TBRH 1C5XB 2CJIA 2PV9B 4ZHLU 3GDUA 1GMHF 1Y3YA 1XUKA 1CBWC 3FZDA 1WOFA 2WPLS 2OQ5A 3UNSA 1YC0A 3RXHA 3ZZ3A 3NWUA 2ZZUH 3TGKE 3C27B 5AVDA 4X8UH 1DS2E 1GG6B 1C9TA 1LDTT 1GBAA 3V13A 2GDEH 2WPHS 5C1YA 2V3OH 4A1XA 1O5AB 2FM2A 3M35A 3EA7A 3RLWH 2ZC9H 3NPSA 1BHXF 1ELTA 2C93B 3LPRA 2RA3A 1AWHB 3S7HB 1O2NA 1OP8A 3U98H 2Z9LA 1A1RA 3FFGA 3GYMA 3ATWA 1KDQA 3O8CA 3M7QA 4AYVB 4DJZB 1M9UA 1O2GH 1QL8A 4HFPB 1SQAA 3A7TA 7GCHG 1TBZH 1F0TA 1XXFA 3RXPA 1TPSA 4H6TA 1SHHB 1GI5A 2P95A 3QO6A 1H4WA 4WVPE 3V0XA 3HATH 1C1QA 1VGCB 5J4SA 2XXLA 5DP5A 2YNAA 1A4WH 3P95A 1UHBA 2A2QH 1ELCA 3RU4T 2J95A 2QF0A 1BRCE 2UWLA 3SJ9A 2BY9X 4X1NU 5FHTA 1S6FA 2NU3E 3RC6A 1DDJA 4B2BA 4ASHA 1PQ7A 1K2I1 1SLXB 3E0NB 1SG8B 1P2NA 2GV7A 4I32A 2FX4A 4TYDA 3A7YA 4E05H 1O2JA 1S85A 4UD9H 1XX9A 1F7ZA 1XVMA 1PQ5A 3TNSA 3LJOA 3SUEA 3NCLA 2ZU1A 4NZQA 2FOGA 3SU1A 3BN9A 2Z3CA 4WWYA 1CA8B 4IN2A 1TE0A 1F0SA 5EXMA 1EB1H 1O2UA 1QRXA 4X8SH 3MNSA 3UOUA 1QL9A 2BD3A 1LVBA 1IHTH 1MCTA 2FEQH 4JMYA 2Z9JA 3SBKA 2J9NA 1WQSA 1C5VA 1HB0B 4YOJA 2XNIA 2XBWA 1DSTA 1UTMA 1GCTB 3CENA 1MZAA 2I6QA 1EJNA 3RXIA 3SI4H 4HTCH 5T6DA 1GBMA 1O5DH 1EKBB 4AG2A 1MKXH 2ZO3H 1ESTA 3UWJH 3ZV9A 1BTWA 1QRWA 2IOTA 1DE7H 1LKBA 1W0ZU 6LPRA 1O3MA 4YESB 1GI6A 3S69A 1BRUP 5HM2A 1AU8A 4K8YA 1INCA 4AG1A 3UR6A 1QCPA 2XC0A 4NGAH 2BLQA 2ZHWH 2ILNA 4DW2U 5CHAC 1AB9C 5AFYH 1A5HA 2FDAA 2WPMS 3ATIA 3UUZA 1UTQA 5EXNA 5DP6A 3E91A 1L1GA 1QJ7B 3BG8A 4WJG2 4D7FA 1C5QA 1HJ9A 1ETTH 5LPRA 1FIZA 3KQDA 1BJVA 3A87A 1L0ZA 1YKTA 1C5SA 3OY5U 1A7SA 1DANH 3SJIA 3TGJE 2A5IA 1XKBC 1XUFA 2ZU4A 3DFLA 4KTCA 3MU8A 3PO1B 4NIXA 4K69A 2FOCA 1D3DB 1TA2A 3RXGA 4ZMAH 2PLXA 5HYOA 1W7XH 4Y0YE 2H9HA 3ODDA 4K3JA 1LPZB 1C1WH 2W5EA 1V2KT 2CV3A 5B6OA 3PTNA 2HNTF 4KKDA 4Y6DA 5TCAA 2D26C 4Q80A 3PMHB 2VWNA 3D62A 2ZI2H 1K28D 1P2IA 1H9IE 1AHTH 2NU1E 3EE0B 4U01A 2TGAA 1GG6C 5FPTA 4LZ1H 1E37B 3M5LA 2BD2A 3SJOA 4FU8A 1VCPA 2V3HH 3PMJA 3ZZCA 6ESTA 3SNCA 1IQFA 3MNCA 2RA0A 2SGQE 1O2WA 4BNRA 1ARCA 1RTLA 3U69H 1NU9A 3LGVA 1WSSH 1QNJA 3T26A 1W14U 1J17T 1QQUA 2XBYA 2XCFA 1TNLA 3K2UA 4MPWA 1GJ5H 2AGGX 3RXQA 1NT1A 4K2YA 4Z6AH 1HBTH 2XBXA 1QBVH 1C2IA 1T8NA 2R3UA 4X2VA 3ZZ9A 2QCYA 1MZDA 1HCGA 4GLYA 4Y8XA 2C4FH 3URCA 5DO4H 1LVOA 1V2PT 1GCDA 1PPHE 2OP9A 5BRRE 4FUFA 1MUEB 4ISNA 5LH8A 1FN8A 3K6ZA 3V12A 4U32A 1NN6A 3QWCH 3SHCH 5FXLA 1ELEE 1P11E 1Y3WA 3SN8A 4DOQA 3UQVA 3KL6A 1EAXA 1C2EA 1O39A 2Y82A 2D2DA 1AQ7A 1P01A 2ODPA 5LPEA 5F03A 4AX9H 2Z3DA 1VCQA 4ABHA 4X1QU 2QY0B 1P03A 2C8WB 2NWNA 5DGJA 4B76A 1YM0A 1ZJKA 4JZEH 3KF2A 3GY2A 1KTTB 1GL0E 1EAIA 1P8VC 2TBSA 3GCHC 3ELAH 1C5LH 2ZFPH 1OWEA 2A2XH 1GJ9B 2BTCE 1GBKA 1LO6A 2FOEA 1O3HA 2WYGA 1KDQB 4IN1A 4NFFA 2SNWA 2R9PA 1HYLA 3GDSA 1EASA 1ZPBA 3P8NA 3TJUA 4DY7B 1P12E 4JZIA 1AFQC 4I8JA 1MTNB 2ZHFH 1P04A 5FCRA 1BQYA 4MG3A 2ZG0H 1DY9A 3VB3A 3UREA 2ZU3A 1C5NH 1AE8H 1IOEA 3VPKA 1DXPA 3A80A 3QTVH 6GCHF 2QXGA 1V2VT 2TGTA 2G8TA 3BEFB 3HK3B 5L30H 1C1TA 1CHGA 2QXJA 1QIXB 4LXBH 1SGQE 4THNH 2C8YB 3STJA 1VITH 3MH4A 1SSXA 1NFUA 1WYKA 1TNKA 2G5VA 5C20A 1AVGH 1ORFA 5I46H 2GT7A 5EOKA 4Y79A 4J1YA 4I31A 1UVOA 1O5BB 1FPCH 1ZTLA 3BTTE 1N6XA 2PKSB 3P8OA 5F8TA 1V2TT 3MTYA 3ZYDA 4A1TA 3A8AA 3O8BA 4D8NA 1UTLM 1BT7A 3MMGA 3VEQB 3R3GB 2QXHA 2BMGB 2XRCA 2F9OA 1G2LA 1DITH 2HPPH 2ZFTA 2Y5GA 1B5GH 1AKSB 7KMEH 2P3FH 3ZVGA 3HKIB 3F68H 1A0HB 2OUAA 1DLKB 1JXPA 3VB7A 4MNVA 1SBWA 1GJ8B 1UK4A 1BTUA 1JRSA 1O3GA 4DGJA 1BTHH 3QZRA 2P8OC 1GHAG 2GCTC 1UMAH 3PWCA 2OINA 3RXUA 2QC2A 2BDHA 4CRAA 4DURA 2PHBA 1IQEA 4UDWH 5JB8S 1A3BH 4Q7YA 2Z9KA 1GMCF 2ZKSA