1QRWA

Crystal structure of an alpha-lytic protease mutant with accelerated folding kinetics, r102h/g134s, ph 8
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCHSGRTTGYQCGTITAKNVTANYAEGAVRGLTQSNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Genetic Screen That Targets Specifically the Folding Transition State of Alpha-Lytic Protease
rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase
molecule keywords ALHPA-LYTIC PROTEASE
total genus 60
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1999-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrwA01
3GY4A 3VB3A 5GJ4B 1SMFE 4Y0ZE 2C93B 4MNYA 1GJDB 2VJ1A 5FAHA 2F83A 4QT8C 1XX9A 1ACBE 1QIXB 4VGCC 2WUBA 3TJUA 1AVGH 3P8NA 3A7TA 1ZRBA 2HNTE 1Z1JA 4BAKB 4WMEA 4ZMAH 1CA0B 1CA0C 1P04A 4CRDA 4GCHG 1QQUA 4B2AA 3SNDA 3UTUH 1P8VC 2BHGA 3OSYA 3MI4A 2VGCC 4LZ4B 4K3JA 1O34A 1SSXA 4JZEH 1H9LB 1TRMA 1Y5AT 1FPHH 4NA8A 3TK5A 4DW2U 1G37A 1MUEB 2CGAA 2Y5FA 3B8JA 1GBCA 2B0FA 2R3YA 1AB9C 3BF6H 3SUGA 2ZU2A 1GI1A 4YZUA 1UTLM 2FPZA 4I31A 2FS8A 1O2JA 1TA6A 4UDWH 4YESB 1O2IA 3S9AA 2P16A 3U69H 1AUJA 3K2UA 1ZGVA 1QR3E 1MKXK 1S82A 2VB0A 1LHDH 1OWDA 1TX7A 4B76A 1UVPA 2FESH 4I8GA 1OWEA 2VWNA 1NS3A 4X2YA 2TGAA 1W14U 2ZF0H 1JRSA 1O3PB 1IQGA 3H7TA 1SQAA 1OKXA 2HWLB 1BTHH 3SI3H 3UIRA 1HAVB 1EASA 1GI5A 1TNIA 1EJMA 1U6QA 4E05H 4YOIA 4X8SH 4NZLA 1FI8A 1C5PA 1CE5A 1DWEH 1CGIE 2Z3EA 1BRBE 4AG2A 5DP9A 1ZJDA 1EKBB 1FAKH 4Q7YA 1AUTC 1A3BH 3BEFB 3NPSA 4R8TB 2BX4A 1DICA 4JZ1A 1P9SA 5L30H 3TK9A 1KTSB 1TGNA 2P59A 3LGVA 4XFQA 1O39A 1SLVB 2XCFA 2RA0A 1TRNA 1HIAA 1MTVA 1G3CA 3M3TA 4MPWA 3ZZAA 5GDSH 2OXSA 5DK1A 3C27B 1GI8B 4BXWA 4UE7H 1GMDG 1SGEE 4OGYA 1BUIA 3FFGA 3Q3XA 1A3EH 2P93A 3NWUA 1L2EA 4FXGH 4GPGA 4WMDA 1O3MA 5EGMA 3SN8A 4K1TA 4YOGA 1DVAH 2W3IA 5I46H 4AN7A 3BTFE 1EAWA 3ELAH 1EATA 2F9BH 3BV9B 1K1OA 3Q3YA 4AFZA 1VGCB 1ABJH 1O5CB 1NU9A 1ETSH 1IQLA 3T2NA 3PO1B 1KY9A 4X8VH 3MU4A 3SHAH 5A0CA 2ZP0H 2OBOA 3RM0H 4CHAC 3TH4H 1TX8A 2BLOA 4X1PU 2GDDA 2ZQ2A 1VR1H 5EOKA 1MH0A 1IQFA 4DIHH 4K5ZA 2HNTC 4ZAEA 5A0AE 1DLKB 3E90B 1KXCA 4NIVA 1RFNA 4ZXYH 3OU0A 1AN1E 2ZFSA 1SG8B 3BTEE 1XXFA 2ALVA 1F0UA 3S0NA 4FU7A 2HPPH 4GLYA 1C1NA 1C5LH 5A09A 4IN1A 4FUCA 1YYY1 4ZHMU 2H2ZA 3MFJA 1VCWA 2G4UA 2ESTE 1L4DA 2PTCE 4BTTB 2OBQA 1UTNA 1CBWC 2VWLA 2F3CE 2FODA 1MQ6A 2FI4E 5GIBA 3HKJB 2ZECA 2VIOA 2GZ8A 3ODFA 2GZ9A 1IHSH 2GCTC 3HK6B 2PUXB 3OY6U 4O03A 3A81A 3SJKA 1XUIA 2IOTA 3FP6E 4ABHA 4Y8YA 1J16A 1V2OT 1ZHMA 2WV5A 2Y7XA 1SOTA 2BXTH 4E7NA 1O3LA 2G81E 3RXBA 1KXAA 1MAYA 1RRKA 1KXEA 1SC8U 2ZA5A 1LDTT 1UO6A 1NZQH 3UOUA 1GMHG 3V13A 3EAJA 5EXLA 2FI3E 3PB1E 5F8XA 3VEQB 4J1YA 1SHHB 1EAIA 1GL0E 1HJAB 2A32A 3PM3A 3ZVBA 1W3CA 3RXEA 3UWIA 3BTME 1N1LA 1PPGE 1WV7H 2F9OA 4NWKA 3E1XB 1F5RA 1QRXA 3UNSA 4ZKRU 5FCRA 3MO9A 3UWJH 2BD9A 2CN0H 5EG4A 1UK2A 1N8OB 4GCHF 2UWLA 4H6TA 2XCNA 1KLTA 2Z9GA 2XYAA 1Z6JH 4WY3A 1QB1A 2BD5A 2BDIA 2F9NA 5HXFA 2QAAA 3SUFA 3GY8A 2ZCLP 1SGPE 1GMDF 2P94A 1GMHF 1DY9A 1A46H 3P8FA 4ABJA 2ZC9H 2BY9X 1TNKA 1W0YH 2ZU4A 3PMBB 2AMDA 4CBNA 2BDGA 4CR9A 2ZCHP 3PTBA 1LVMA 4ABIA 3QK1A 1FQ3A 3BG8A 1Z8IB 2FOCA 1Z7KA 3LGIA 3LT3A 1VZQH 2WPLS 1TRYA 4AFQA 2V0BA 3LC5A 2QN5T 2ZDNA 1WBGB 2BQ6B 4IMZA 5T3HA 2ZDLA 2V35A 4NFEA 1KXFA 2BZAA 1O2ZA 4FVDA 2W7UA 1G32B 4ZHAA 3NUMA 4OS6A 3RC4A 3DD2H 1MTNC 4Y0YE 1ZMLA 4D9QA 1UJ1A 5EU8A 3M7UA 1C1MA 5TCCA 9LPRA 5GXPA 1XVOA 1V2NT 1AY6H 1F0SA 4MDSA 1GBIA 2GT7A 2R2MB 2HOBA 1D3PB 3ODDA 4LK4A 2BDYA 1DOJA 1OYQA 1HJ8A 2GZ7A 2GCHF 3MH4A 3QUMP 3MU1A 4FUDA 4D76A 2ZFRH 1TA2A 5JB9S 2ULLA 5A0BA 1O3DA 2FYRA 1CHGA 2XBWA 3URCA 1TOMH 2R0LA 2BY8X 5FPYA 1C1OA 5K0HA 3GCOA 1ELCA 1IOEA 4I8HA 4YOJA 1MZAA 3C1KA 5AHGH 3TNSA 1O2SA 4X6NA 1K1NA 1XM1A 3EQ0H 2ZDAH 1QJ1B 1PQ8A 1QL9A 2FOMB 5C5OA 4BANB 2Y81A 1P2OA 1HBTH 2EEKA 3ITIA 1LHGH 1P09A 1O3FA 1OP0A 3MWIU 1E36B 1HLTH 4ZHLU 3B23B 1P3EA 3KCGH 1P2QA 1O2RA 1VITG 2VIQA 2FOEA 2ZU3A 4FU9A 3H7OA 5TCAA 2P8OB 4TY7A 2QCYA 4MPUA 1XUHA 1W11U 1KDQB 3V7TA 1O3OA 2FWWA 1G3DA 1QL7A 3V3MA 5AFYH 4Y8XA 3BIVH 4NGAH 1O5EH 1TE0A 1NESE 5SGAE 2SGPE 3RLYH 1O2OA 4UFDH 4HTCH 4WXIA 1V2ST 1BMAA 1SLWB 5PTPA 2ZWLH 3P8GA 5DP6A 3RXDA 2C8XB 3PMJA 2F9VA 4NIYA 1PPZA 3ZYDA 1SGIB 1K1PA 7KMEH 5HMAA 3RC6A 1TQ0B 1O2WA 3M37A 4RSPA 4AZ2B 1ZMJA 2PKSB 1GJCB 1F0TA 3K9XB 4KGAA 4AOQA 5A8ZA 1AGJA 4FU8A 5DP4A 3LONA 3RMLH 2AIPA 2FOFA 4NWLA 3NKKA 3OTJE 1FJSA 1QBNA 4INHA 1EB1H 2ZTXA 3BTKE 3DHKH 1TLDA 3TVJB 1RTLA 1IQEA 2ZDMA 3FANA 2AIQA 1HJAC 3TPIZ 2OD3B 2M5TA 4X1RU 4A1XA 1AI8H 3S9CA 3LKWA 4BTIB 5JB8S 4YM9A 3SO3A 4Y7AA 3A86A 1TGTA 3UREA 1P02A 1LHCH 1YCPH 4XSKU 2GVFA 4D9RA 1DWCH 2ZPRA 3SZNA 5C1XA 2QC2A 3RXOA 2V6NA 1Y3UA 2XTTB 4IBLH 4FUFA 2ZFQH 3W94A 2FOAA 4OS4A 5J4SA 1UMAH 2QF0A 3EE0B 3KEEA 3ZZ8A 3AW1A 1C5VA 3FAOA 2JETB 1BRAA 3U98H 4KELA 2GD4B 3SQHE 4U32A 2OQUA 1HRTH 5DP3A 1YM0A 2P95A 8GCHF 2V3HH 2ODQA 2BD8A 1QHRB 4UFEH 1GI3A 3T26A 1FIZA 2SFAA 2VVUA 3HGNA 1T31A 1BBRE 2ZNKH 3F9GA 2A5KA 2GX4A 1C4V2 1YPEH 1OXGA 2Q1JA 2SGDE 1K22H 3A85A 1S6FA 1SPJA 1TONA 8GCHG 1BRUP 5T6GA 1DS2E 1UCYK 4DT7B 3T62A 1BB0B 4I32A 1DXPA 4OS1A 1S83A 3GY6A 2CHAC 1GDNA 3TGIE 1FN6A 3MMGA 4MNVA 1D6RA 2AS9A 3U1IB 2UUKB 5BRRE 2O8UA 1FV9A 1A0JA 1LVYA 3KQBA 4BOHA 3E0PB 4FVBA 2AMQA 1KIGH 4Q80A 1P12E 1LVBA 1YCPM 3RXCA 4A1TA 3SU4A 3QZQA 4ZXXH 2A7CA 4X1QU 4RKJB 3RXPA 3U9AH 3KIDU 2QXGA 1FUJA 1TPSA 4ABFA 1C1RA 1C9TA 1YCPK 2O8TA 2KAIB 1EAUA 2RCEA 2ZFFH 3I29A 1AU8A 2TGTA 3QZRA 3CENA 4Q2KA 2B7DH 5J4QA 1D3TB 2FTMA 2WPHS 4DOQA 2JH0D 1GHBG 1PPFE 2P3TB 3DA9B 1XUFA 2C8YB 4RKOB 3MO6A 5ETXA 3WY8A 4K1SA 1O2UA 1IQHA 2J94A 1LCYA 1ELDE 1QRZA 1PFXC 1EXFA 4JZDH 4CR5A 1V6DA 1SR5C 1YC0A 3BTWE 1YP9A 3SBKA 3MHWU 4BAHB 4NIWA 1W7XH 1AFQC 3SHCH 1YLCA 4GHQA 1V2TT 1SGDE 1P06A 1G3EA 1ORFA 1O33A 1QBVH 3I78A 4H42U 2PR3A 3O8CA 1BCUH 2TPIZ 1SGNE 1LTOA 1F5KU 3ZZBA 3DT0H 1DT2A 1K1IA 1QBOA 4X1NU 5ESBA 1ELAA 1O3KA 1PQ7A 1SHYA 4CRAA 3A7XA 5EW1H 1JIRA 4MNXA 3LGWA 2OC1A 3ZZDA 1BRCE 1EAXA 3RXFA 2XC4A 2XBVA 1E37B 5GCHG 1V2VT 3SJOA 1NT1A 1H8DH 1K1MA 1T4UH 1LVOA 1ZHRA 2NU3E 1EPTB 2TBSA 1FPCH 1O2YA 3SNEA 1E38B 5FX6A 3EDXB 5JBBS 2VGCB 3QN7A 5DP7A 1YPHC 4I8JA 1QTFA 2WPIS 1INCA 3V0XA 3EA7A 2O9QA 4LXBH 1MTWA 1EP5A 3EA8A 1HNEE 4XOJA 1C4Y2 3UY9A 2LNCA 2FLBH 2ANKH 3RXRA 2UUJB 2BZ6H 4DURA 1HJ9A 1HGTH 4OS2A 6GCHF 1FONA 3BIUH 1GCDA 1C5TA 3TLOA 1IQIA 2WPMS 1N8OC 7GCHF 1TWXB 1GPZA 1DWBH 3LH3A 3T28A 4BAMB 2Z94A 4TY6A 4E06H 4Z0KA 1BTUA 1C1QA 3RXJA 2FZZA 1C5QA 1GG6C 4SGBE 1C5OH 2WPJS 2W7SA 1MTSA 2ZU5A 4YLQH 1GBHA 1C4U2 1C5MD 1A7SA 2R0KA 3A87A 1BDAA 4CRGA 1NRPH 1DUEA 3AAVA 2WYGA 1T32A 1EZXC 2SNVA 3E0NB 1NY22 1FY4A 3E16B 3F68H 5E0HA 1O31A 4NSVA 1DDJA 4MTBA 2A4OA 3SJ8A 3TITA 3T29A 3BTHE 4X2VA 3LPRA 1UVTH 5FCKA 1OP8A 4JZFH 3PO1C 1UCYE 1BBRH 1SVPA 3VB5A 4AYYB 1KLIH 1P0SH 1QA0A 2SGEE 2H6MA 1BBRK 2CHAB 1O2HA 3N7OA 1HAVA 5L6NH 1Y3XA 1BOQA 3AASA 1GI0A 1XMNB 1LPKB 3GCHC 1Y3YA 4XE4A 3GCTG 4HFPB 4Q7XA 3O8RA 1SGTA 2BD3A 1EPTA 1A5HA 4VGCB 2OC8A 3SJIA 2Z6BD 5EW2H 1HXEH 2STBE 3A8CA 3PTNA 1J17T 1KTTB 4WVPE 2Y5HA 1H9IE 3MTYA 1UTMA 3RDZA 1Y3WA 3S69A 4CRBA 2B9LA 4AX9H 1C5NH 1HUTH 1CA8B 1FLEE 1J15A 1B0EA 4IS5A 4DIIH 1TMBH 2SGFE 1GVKB 4AORA 4J2YB 2CV3A 1NTPA 1GJBB 3KF2A 1SGYE 4IC5A 1A1RA 1NO9H 4K2YA 3A88A 1V2PT 2B5TB 5B6OA 1O2MA 2VIDA 1UCYH 1MD7A 1K21H 1Z1IA 2A0QB 5F8TA 2ZTYA 1CGHA 4NG9H 3O8BA 1F2SE 3A8AA 1HAYB 2SNWA 4B2BA 1YPHE 3BSQA 1O2LA 1GMCF 2AGEX 4FUEA 1AVWA 3L3TA 4NSYA 3T27A 2I6QA 1ARCA 3ATKA 6GCHG 2AGGX 3KHVA 2ZGHA 3F9HA 1WTGH 3ATWA 1NFXA 1GBKA 5FPSA 4F4OC 1NFUA 4XBDA 5JPMH 2PKAA 5CHAB 3URDA 4XBBA 3SW2B 3UNRA 3PWBA 4UEHH 3F9FA 4F49A 1D9IA 1O3GA 3A8DA 4DG4A 2A45B 4B2CA 3IWMA 1IQMA 4I33A 2FS9A 5LPFA 3Q3KA 1ZTLA 2FMJA 1AKSB 3TIUA 3UQOA 1NRSH 3MNCA 2BOKA 3FZDA 2A2QH 1ZPBA 1NFYA 4X8UH 5FBEA 2BQWB 3NK8A 3Q00A 1SQOA 1CBWB 2H5DA 3ATMA 3RXKA 1T7CA 2ZTZA 2AH4X 2BXUH 1LQDB 3TH2H 1WTHD 3LDXH 4TWYA 3VPKA 3OYPA 1VCPA 3A8BA 1CHOG 1VITH 1Y5BT 2Q6DA 3A7ZA 1TGBA 1GJAB 2OQ5A 1GCTC 2Y80A 3FP7E 5FBIA 2EI7A 1YKTA 2ASUB 3PV4A 2VNTA 1O3NA 2D8WA 2AERH 4B74A 2C90B 5ESTE 1NROH 1HYLA 2ZDVH 3UFAA 1AQ7A 5EXNA 2AFQB 1O2VA 1C2KA 1O3BA 2XNIA 2O8LA 3VFEA 3SNAA 1TNLA 2GCTB 3GICB 1TYNA 2FX6A 1BMLA 1IQJA 2QV1A 1XKBC 1DX5M 3BEUA 4Y76A 4K1EA 4I8KA 2Z9JA 3PLPA 1WOFA 2J95A 3RU4D 1C9PA 5LGOA 1ZTJA 3W95A 3SGQE 1GBAA 5C2ZA 1YLDA 1V2UT 1TPAE 1LKAA 1MBMA 4B71A 2EI6A 2ZFTA 1S84A 3K6ZA 1AE8H 3VGCB 1GMCG 3MYWA 1JBUH 2BLWA 3UR6A 4FUGA 3QWCH 4JYVH 4X1SU 1W0ZU 3UUZA 1O5FH 2BDAA 2OUAA 1EOJA 2BTCE 1V2MT 1TOCB 1C5ZB 3GCHB 1LO6A 3GYMA 3RU4T 1GHAG 1L1JA 3MNSA 2FX4A 1TFXA 1GJ6A 1MU6B 1MCVA 1FY8E 3MU0A 1GI4A 3K65B 1EPTC 1J9CH 2WUCA 3VB4A 4ISHH 2VIPA 8LPRA 1K1JA 4MLFB 3A7WA 4LOYH 4WMFA 4ZKNU 1O2KA 4TWWA 1ETRH 3D65E 2H9TH 1O3JA 1L4ZA 1GWAA 1P2JA 4ZROA 1GJ9B 1KDQA 2BB4A 2ZIQH 3U8OH 5FPTA 4AG1A 2WV4A 4CRCA 3QGJA 4MVNA 1GJ7B 3T25A 3UPEA 3RXLA 4H6SB 1TQ7B 1GBMA 2FXRA 1KSNA 2CXVA 3S9BA 2FOBA 2G4TA 3RLWH 2PKAB 2W5EA 5AVDA 3D49H 3VXFH 2IN2A 1CGJE 1DY8A 1RD3B 2BVRH 3RMMH 5LPEA 4AFUA 4MG3A 4TPYA 1O2PA 1DSTA 1MKWH 1A5GH 3VB7A 3SU3A 2G52A 4X0WU 4H4FA 3DUXH 4R0IA 3AAUA 3RMNH 5DO4H 1OP2A 2XXLA 2A7HA 4CBOA 3PROA 1BTZA 3KGPA 2THFB 1HDTH 1C5SA 4X2XA 1SLXB 1BTXA 1GJ4H 1Q3XA 1G30B 1QRWA 1XUGA 1PPCE 1QGFA 3Q77A 1UVUH 1O3IA 1V2WT 3P17H 2PHBA 3E8LA 1S81A 3A82A 3NXPA 5TJXA 4INLA 1ZJKA 1AO5A 1P2KA 3G01A 1HAOH 1HCGA 4UFFH 4X8TH 2P8OC 2HRVA 2FEQH 4ISLA 1HAXB 2GGVB 4NIXA 4NA9H 3M5LA 4FUBA 2BDBA 1DE7H 4DY7B 5I25A 1K2I1 2PV9B 5CHAC 3LGYA 2VH0A 3ESTA 1A0LA 1RXPA 2AEIH 2C4FH 2FTLE 4NA7A 2TRMA 3UOPA 2XBXA 1FMGA 2J2UA 4ZKSU 1AKSA 2FI5E 3ZZ9A 1V2JT 3TJOA 4BTUB 3PLBA 2BLVA 3ZZ4A 1QURH 1P05A 1F92A 3ZVFA 1ZSJA 3MNBA 1SL3A 1SBWA 3SU1A 5EQQA 2ZI2H 1NN6A 4CH2B 2A5IA 4ZKOU 1QL8A 2ZEBA 1YBWA 3RM2H 1OWKA 1ELVA 1L0ZA 1TAWA 1DSUA 5HGGA 3SV9A 1C1SA 2XBYA 4ESTE 5EQRA 8KME2 3RXTA 4DGJA 5GPIB 1IAUA 5CE1A 2VVCA 3MH5A 1QCPA 1C5XB 3EGKH 1O38A 1VGCC 1ID5H 1ZPZA 5FX5A 1D4PB 1O2TA 3ZVDA 3TK6A 3TGKE 5C20A 5F6MA 1V3XA 1BITA 2OTVA 3SU5A 1CT2E 1NRNH 4X6OA 1EP6A 1QA7A 2ZHWH 2J34A 1MKWK 1MAXA 1EZQA 2A2XH 5A2MH 4U01A 3LJJA 2Z9KA 3M35A 1PPBH 1OYTH 2PWXA 3HGPA 3CS7A 4YO9A 2HPQH 4BAQB 2BDHA 2ANWA 4E7RG 1H4WA 1KLJH 4ISNA 2GKVE 1L1GA 1HAZB 1GI9B 2C8WB 2FLRH 2GV7A 2HNTF 2PGBB 3QGNB 1FY3A 1GBDA 3ATLA 2IJOB 3Q76A 3RMOH 3M61U 1ANBA 4DVAU 2R3UA 4JYUH 1ELFA 3LC3A 2OC0A 3M3VA 1LQEA 3RP2A 1AHTH 1GGDC 2D1JA 1NU7B 3MU8A 3SU2A 4O9VA 5ABWA 4IGDA 1UTPA 2K1QA 1ELTA 4M7GA 2DE9A 4HZHA 1ZSLA 1V2KT 3PYHA 5DG6A 4CRFA 1EOLA 1HFDA 2I6SA 1Y3VA 4Q7ZA 4KTSA 1ABIH 1ZLRA 1TNJA 3TGJE 1C2DA 3HATH 1O32A 2ALPA 1BJUA 1CU1A 1RTFB 3RU4E 4JK5A 5L2YH 1NFWA 1UTJA 1C2HA 3UNQA 2Q6FA 5HM9A 1W13U 3S7KB 1VJ9U 5E8EH 1BTWA 2J4IA 3BTGE 1YPMH 3OY5U 4XBCA 4IW4E 2BY6X 1F7ZA 2D26C 1TMTH 1TB6H 1C2JA 2KAIA 1PJPA 3E6PH 3M7TA 5DKMA 2GMTC 3D62A 1UHBA 2FDAA 1P2MA 1MD8A 3EYDA 1O5GH 3ZVEA 3JZ1B 1CT0E 1GBLA 2Y6TA 1TABE 1FNIA 4D8NA 2ZKSA 1O5BB 2BD2A 7GCHG 1DITH 1DANH 2B8OH 1HXFH 3RXAA 5DGJA 4OGXA 2QA9E 4JK6A 5A8YA 1HAGE 1ZMNA 1OPHB 3M7QA 3MH7A 1WAYB 2CF9H 1Z71A 4HGCA 2BY5X 5JBTA 1AMHA 1NPMA 1CO7E 1JXPA 4UD9H 5IDKA 4O3UA 3U8RH 3SJ9A 4KKDA 1OWHA 2YNAA 5FHTA 1OX1A 3R0FA 1FXYA 3P6ZB 1P03A 1FY5A 3CS0A 1O2XA 1P2NA 4BNRA 4K8BA 2Y5GA 1UTQA 3ZYEA 1G2LA 3M5NA 1P57B 1BA8B 2Q6GA 3ZZ3A 1OWJA 2ANMH 1HIAB 1GHWH 4B1TA 6LPRA 3H5CB 3ZVGA 1FIWA 1Y8TA 3F1SB 1UTOA 1P10A 1GDUA 1ZOMA 3P8OA 3A7VA 1PQ5A 3GY7A 1N6YA 5F03A 1LPZB 3RXMA 4Y6DA 5AFZH 1TALA 1SGFG 1SGRE 5C3NA 4YLUA 3MNXA 4CH8B 2OLGA 3MOCA 1GGDB 1O0DH 3RC5A 2Y7ZA 2CF8H 4KP0A 4X6PA 1Z8JB 2CMYA 3KQDA 1P01A 1BZXE 3RXVA 5GWZA 2FO9A 1WCZA 4OS5A 4TPIZ 1D3QB 4X2WA 2G8TA 3SGBE 1THRH 4YTAA 1W10U 2A4RA 4O3TA 1AFEH 1HV7A 3VB6A 2QXIA 3F9EA 3FP8E 2BYAX 4X6MA 1UVSH 2AGIX 4XDEA 1ANEA 2IPHA 1TNHA 3R3GB 2LPRA 2EA3A 2BM2A 1GG6B 1QNJA 4WH8A 1O35A 4AB9A 1C1TA 1OSSA 4JZIA 1RJXB 2V3OH 1AVXA 2QY0B 4WXVA 2FM2A 1S6HA 3ZZ5A 3QDZB 3FVFB 2NU2E 1GBEA 1MZDA 1BHXF 2AYWA 2H5CA 3A84A 1RGQA 1ZYOA 3ATIA 1XVMA 3PLKA 3IITA 3AW0A 7ESTE 1UK3A 2HGTH 1MTUA 1EQ9A 3M5OA 1P11E 1O2QA 1YPGH 1DM4B 1D3DB 2PUQH 2XW9A 3RXSA 2Z9IA 2QYIA 2ZCKP 2DUCA 1MU8B 5E2OA 1KXDA 1GHZA 2R2WU 3TJVA 2GDEH 2ZGCA 2GTBA 1WSSH 1NRRH 2JH6D 3KN2A 3LOXA 1UK4A 1IHTH 4IC6A 3SV7A 1NM6A 5E0JA 2QXJA 1XKAC 1TMUH 2ZO3H 1N6XA 1FAXA 9ESTA 1C2IA 5EXMA 1YF4A 3GCTF 2ZHEH 1UTKA 3SNBA 1O3HA 3ZVCA 5C1UA 1PPHE 1CVWH 2D2DA 1PYTD 2BQ7B 3P70B 1C2MA 1W12U 1TIOA 2H9EH 2A1DB 2PFEA 2ZPSA 1YGCH 4K69A 1QFKH 2A7JA 2BMGB 2BY7X 1HB0B 1P9UA 5C67A 1E34B 4ZUHA 2ZU1A 2A5AA 2A4GA 3I77A 1VCQA 1D6WA 1GI6A 1EX3A 3SI4H 2QF3A 1XUJA 3SUEA 1B0FA 1OWIA 1P2IA 1WQSA 4ASHA 2BX3A 1AFQB 3D23A 4Y8ZA 1ELGA 2CJIA 1C1WH 1HPGA 4Y7BA 1SQTA 1MKXH 2BVSH 4K60A 5LH8A 2NWNA 4YT6H 1PYTC 2C3SA 2QIQA 1MCTA 3SOSA 5EPYA 1A4WH 1GCTB 3SUDA 2ILNA 3ZVAA 1EZUC 1MQ5A 1V2LT 4LZ1H 1C5RA 4BAOB 2F91A 4AYVB 5CMXH 4CREA 2DE8A 1G2MA 1ETTH 4ABEA 3M36A 2A4QA 1DPOA 2NU1E 1BHXB 1S0RA 3MU5A 1Y59T 2XC5A 4JCNA 4THNH 3GY3A 5DP5A 2HVXA 5T6DA 1GHAF 3B9FH 3UQVA 2PW8H 1X7AC 4AGKA 3BG4C 3HK3B 1BTYA 1THSH 2PKSC 1A5IA 2WYJA 2G5NA 1OOKB 2BVXH 5HM2A 1GL1A 3E91A 3BTDE 1YPJH 3NCLA 2GCHG 2HALA 1M9UA 1AWFH 2C8ZB 2FYQA 4IMQA 3SV6A 3BG4B 3HKIB 1C1PA 3TNTA 4GVUA 5JBCS 5EODA 2PSYA 1H8IH 2QGRA 2PSXA 2QXHA 3O8DA 1AE5A 1LHFH 3IG6B 4B75A 1C2LA 1BQYA 1ANDA 1SB1H 1Z8GA 4MNWA 1CHOF 1Z8RA 2A31A 3GYLB 1TBZH 1DXWA 1O37A 3STIA 2VIWA 3JZ2B 1Y5UT 1O36A 3HPTB 3U1JB 1ESAA 3LU9B 4K8YA 1QB6A 1RS0A 4I7YH 4SGAE 1GJ5H 1GVZA 1P3CA 4INKA 1L1NA 5JDUB 3LIWA 3DFLA 1SFQB 1ZZZA 3U8TH 3VGCC 1WU1A 1JIMA 1TGCA 1V2RT 1JMOH 1NC6A 2BLQA 2ZPQA 5IYTA 3ZV9A 7LPRA 5G4BA 1SGFA 1QJ6B 3BTQE 5E2PA 3ZZCA 3KNXA 1QQ4A 1GBFA 4KTUA 2Z7FE 2GV6A 1EJAA 5DJ7A 4UONA 2EC9H 2RDLA 1E0FD 3SU0A 2WINI 2ANYA 2OINA 4U30A 1ZR0A 2BDCA 3P92A 1SGQE 1JRTA 1SI5H 3EA9A 6ESTA 3S7HB 3SQEE 2TGPZ 4B73A 2NU0E 8ESTE 3V12A 3TU7H 1CQQA 1UVOA 2PGQB 1RIWB 3SORA 3KL6A 4DCDA 1F0RA 4GUXA 2XWAA 4FUIA 4MPXA 4FUHA 3VXEH 1O3CA 1LHEH 1MTNB 1TBRH 3L33A 1QJ7B 1AZ8A 2P3UB 5EPNA 1ELEE 4ISOA 3RUOA 1Q2WA 2VU8E 1WUNH 5LPRA 1XXDA 4GAWA 4A7IB 2OCVB 1FDPA 1RTKA 1A0HB 1EZSC 1UHBB 6CHAC 2H1UA 1LKBA 3A89A 1TX6A 1GI7B 1BMMH 4ABAA 1GBTA 1ZGIA 3QO6A 2ZGXH 2WPKS 1ZTKA 2FOGA 4Y71A 3BTTE 4D7FA 1YPLH 1LPGB 2YNBA 3OX7U 1O30A 3TJNA 2NU4E 1QB9A 3NZIA 2VH6A 1YPKH 1C2GA 1O2NA 1C5UA 1O5AB 2ZZUH 2YOLA 4AFSA 1ESBA 2XWBI 3FZZA 1SOZA 4JYTA 3LH1A 1TNGA 2Z3DA 2ZHDA 1G9IE 2O8WA 2PLXA 2ZGJA 1C1UH 3E3TA 4ABDA 1VITF 1EB2A 5EQSA 5DPAA 3M3SA 1LMWB 2STAE 1GI2A 3MH6A 5JYIA 1GHBF 5A8XA 4IN2A 1HAPH 4WWYA 5AF9H 4KTCA 2OP9A 2ZDKA 3PWCA 3QTOH 1KYNA 1H1BA 1TPOA 4NCYA 1J8AA 1SLUB 2H9HA 1W7GH 2P3FH 2ZHQH 1BJVA 3SNCA 4AGJA 1TPPA 1ZHPA 1C5WB 3TH3H 1KXBA 2JKHA 4MPVA 1C1VH 1T8MA 1JOUB 1SGCA 1QY6A 1C5YB 1S85A 3CP7A 1ZSKA 2VWOA 1AD8H 4I8LA 2ODYB 2O8MA 4GSOA 1ZRKA 2FOHA 3GDVA 1S0QA 4PROA 2G00A 1DFPA 1W8BH 2OC7A 2ZGBH 3M5MA 1AIXH 2RG3A 5JBAS 2J9NA 4RN6A 1C2EA 1GHVH 3RXGA 2W3KA 4A92A 4A5TS 1F5LA 1IQKA 4Y11E 3A83A 2FIRH 3GY2A 2AMPA 1ANCA 5GCHF 2JH5D 3BN9A 1O3AA 4DJZB 1THPB 1J14A 2BOHB 1ARBA 4Z6AH 3AVZA 2TGDA 2TIOA 3GCNA 2UWPA 4WF8A 1TBQH 2ZHFH 3GDSA 1O3EA 1MBQA 5DP8A 1O5DH 4GHTA 4ZH8A 1A61H 1HAIH 2Z3CA 2FP7B 2PTNA 1IQNA 2VINA 4ABGA 5L2ZH 4U2WA 3GDUA 1ESTA 1DLEA 1CSOE 1GHYH 1SFIA 2G51A 1G36A 5K7RA 4OS7A 2F9UA 3UR9A 1AB9B 1VJAU 3SU6A 2BD7A 4NFFA 3SV8A 2SGQE 5C1YA 3LJOA 1G3BA 3RXIA 3MO3A 1AZZA 2GT8A 5F8ZA 3RXHA 3GY5A 1DWDH 1V2QT 3P95A 2ZQ1A 1PQAA 3BEIB 4MQAA 3RXUA 1GVLA 1NRQH 3ZZ6A 4FUJA 1OS8A 1DUAA 3STJA 2R9PA 1GJ8B 1W2KH 1T4VH 1H9HE 5BPEA 4BXSA 3K6YA 4ISIH 1E35B 4NZQA 1S5SA 3F6UH 4A1VA 3QLPH 3T5FH 2UWOA 1TGSZ 1PPEE 4AB8A 3A80A 2ODPA 2GP9B 1GBJA 1EJNA 1FZZA 1GBBA 3LGUA 2UUYA 2VWMA 4UFGH 1B5GH 1A2CH 2SGAA 3L6PA 2XRCA 4D7GA 5E0GA 2J38A 1BT7A 3LGTA 1HAHH 1T8OA 3SGAE 5HYOA 6CHAB 1BTPA 4YT7H 1T8NA 4HI3A 4A6LA 2UUFB 2F9PA 1T8LA 2RA3A 3ZZ7A 2VIVA 1BIOA 4Y10E 5H4IB 2ZFPH 2BD4A 3ZV8A 4CHAB 2G5VA 3DFJA 1K9OE 3ENSB 2EI8A 1AWHB 1GDQA 1FN8A 1K28D 1CT4E 2G55A 1K1LA 4TYDA 1RIWC 1EUFA 2ZG0H 1BMNH 3KQEA 2J92A 3QX5H 1JWTA 3GOVB 5FXLA 2JETC 3KQCA 4JMYA 4O97A 2XC0A 1XUKA 4Y79A 5T6FA 1WQVH 4ABBA 3GISB 2Z9LA 1ELBA 1GHXH 1WYKA 5C5NA 2W26A 3PMAB 4WH6A 1Q31A 3A7YA 3PMHB 1FY1A 1Z6EA 2GMTB 3QTVH 4WJG2 1B7XB 1O2GH 1ZPCA 2Y82A 1C2FA 3SV2H 3RXQA 2HLCA 1MMJN 2VVVA
chains in the Genus database with same CATH superfamily
3GY4A 3VB3A 5GJ4B 1SMFE 4TT3D 2C93B 4Y0ZE 4MNYA 1GJDB 2VJ1A 5FAHA 2F83A 4QT8C 1XX9A 1ACBE 1QIXB 4VGCC 2WUBA 3TJUA 1AVGH 3P8NA 3A7TA 1ZRBA 2HNTE 1Z1JA 4BAKB 4WMEA 4ZMAH 1CA0B 1CA0C 1P04A 4CRDA 4GCHG 1OHHD 1QQUA 4B2AA 3SNDA 3UTUH 1P8VC 2BHGA 3OSYA 3MI4A 3PV5A 2VGCC 4LZ4B 4K3JA 1O34A 1SSXA 4JZEH 1H9LB 1TRMA 1Y5AT 1FPHH 4NA8A 3TK5A 4DW2U 1G37A 1MUEB 2CGAA 2Y5FA 3B8JA 1GBCA 2B0FA 2R3YA 1AB9C 3BF6H 3SUGA 2ZU2A 1GI1A 4YZUA 1UTLM 2FPZA 4I31A 2FS8A 1O2JA 1TA6A 4UDWH 4YESB 1O2IA 3S9AA 2P16A 3U69H 1AUJA 3K2UA 5B6LA 1ZGVA 1QR3E 1MKXK 1S82A 2VB0A 1LHDH 1OWDA 1TX7A 4B76A 1SKYE 1UVPA 2FESH 4I8GA 1OWEA 2VWNA 1NS3A 4X2YA 2TGAA 1W14U 2ZF0H 1JRSA 1O3PB 1IQGA 3H7TA 1SQAA 1OKXA 2HWLB 1BTHH 3SI3H 3UIRA 1HAVB 1EASA 1GI5A 1TNIA 1EJMA 1U6QA 4E05H 2JJ1D 4X8SH 4YOIA 4NZLA 1FI8A 3F2GA 1C5PA 1CE5A 1DWEH 1CGIE 2Z3EA 1BRBE 4AG2A 5DP9A 1ZJDA 1EKBB 1FAKH 4Q7YA 1AUTC 1A3BH 3BEFB 3NPSA 4R8TB 2BX4A 1DICA 4JZ1A 1P9SA 5L30H 3TK9A 1KTSB 1TGNA 2P59A 3LGVA 4XFQA 1O39A 1SLVB 2XCFA 2RA0A 1TRNA 2V7QD 1HIAA 1MTVA 1G3CA 3M3TA 4MPWA 1E1RD 5GDSH 3ZZAA 2OXSA 2WZQA 5DK1A 3C27B 1GI8B 4BXWA 4UE7H 1GMDG 1SGEE 4OGYA 1BUIA 3FFGA 3Q3XA 1A3EH 3UB0A 2P93A 3NWUA 1L2EA 4FXGH 2KCYA 4GPGA 2IPQX 4WMDA 1O3MA 5EGMA 3SN8A 4K1TA 4YOGA 1DVAH 4ACAA 2W3IA 5I46H 3CNRA 3BTFE 4AN7A 1EAWA 3ELAH 1EATA 2F9BH 3BV9B 1K1OA 3Q3YA 4AFZA 1VGCB 2XNDD 1ABJH 1O5CB 1NU9A 1ETSH 1IQLA 3T2NA 3PO1B 1KY9A 4X8VH 3MU4A 3SHAH 5A0CA 2ZP0H 2OBOA 3RM0H 4CHAC 3TH4H 1TX8A 2BLOA 4X1PU 2GDDA 2ZQ2A 1VR1H 5EOKA 3OEHD 1MH0A 1IQFA 4DIHH 4K5ZA 2HNTC 4ZAEA 5A0AE 1DLKB 3E90B 1KXCA 4NIVA 1RFNA 4ZXYH 3OU0A 1AN1E 2ZFSA 1SG8B 3BTEE 1XXFA 2ALVA 5DSFA 1F0UA 3S0NA 4FU7A 2HPPH 3DCLA 4GLYA 1C1NA 1C5LH 5A09A 4IN1A 4FUCA 1YYY1 1COWD 2H2ZA 4ZHMU 3MFJA 1VCWA 2G4UA 2ESTE 1L4DA 2PTCE 4BTTB 2WV9A 2OBQA 1UTNA 1CBWC 1UW7A 2VWLA 2F3CE 2FODA 2L6OA 1MQ6A 2FI4E 5GIBA 3HKJB 2ZECA 2VIOA 2GZ8A 3ODFA 2GZ9A 1IHSH 2GCTC 3HK6B 2PUXB 4AC9A 3OY6U 4O03A 3A81A 3SJKA 1XUIA 1K0HA 2IOTA 3FP6E 4ABHA 4Y8YA 1J16A 1V2OT 1ZHMA 2WV5A 2Y7XA 1SOTA 2BXTH 4E7NA 1YWUA 1O3LA 2G81E 3RXBA 1KXAA 3OEED 1MAYA 1RRKA 1KXEA 1SC8U 2KZ4A 2ZA5A 1LDTT 1UO6A 1NZQH 3UOUA 1GMHG 3V13A 3EAJA 5EXLA 2FI3E 3PB1E 5F8XA 3VEQB 4J1YA 2WPDD 1SHHB 1EAIA 1GL0E 1HJAB 2KCOA 2A32A 3PM3A 3ZVBA 1W3CA 3RXEA 3UWIA 3BTME 1N1LA 1PPGE 1WV7H 2F9OA 4NWKA 3E1XB 1F5RA 1QRXA 3UNSA 4ZKRU 5FCRA 3MO9A 3UWJH 2BD9A 2CN0H 5EG4A 1H8ED 1N8OB 1UK2A 4GCHF 2UWLA 4H6TA 2XCNA 1KLTA 2Z9GA 2XYAA 1Z6JH 4WY3A 1QB1A 2BD5A 2BDIA 2F9NA 2W6ID 5HXFA 2QAAA 3SUFA 3GY8A 2ZCLP 1SGPE 5EJZA 1GMDF 2P94A 1GMHF 1DY9A 1A46H 2J98A 3P8FA 4ABJA 2ZC9H 2BY9X 1TNKA 1W0YH 2ZU4A 3PMBB 2AMDA 4CBNA 2BDGA 4CR9A 2ZCHP 3PTBA 1LVMA 4ABIA 3QK1A 1FQ3A 3BG8A 1Z8IB 2FOCA 1Z7KA 3LGIA 3LT3A 1VZQH 1TRYA 2WPLS 4AFQA 2V0BA 3LC5A 2QN5T 2ZDNA 1WBGB 2BQ6B 4IMZA 5T3HA 2ZDLA 2V35A 4NFEA 1KXFA 2BZAA 1O2ZA 4FVDA 2W7UA 1G32B 4ZHAA 3NUMA 4OS6A 3RC4A 3DD2H 1MTNC 4Y0YE 1ZMLA 4D9QA 1UJ1A 5EU8A 3M7UA 1C1MA 5TCCA 9LPRA 5GXPA 2IJD1 2J5UA 1XVOA 1V2NT 1AY6H 1F0SA 4MDSA 1GBIA 2GT7A 5C94A 2R2MB 2HOBA 1D3PB 3ODDA 4LK4A 1S6LA 2BDYA 1DOJA 1OYQA 1HJ8A 2GZ7A 2GCHF 3MH4A 3QUMP 3MU1A 4FUDA 4D76A 2ZFRH 1TA2A 5JB9S 3OTPA 2ULLA 5A0BA 1O3DA 2FYRA 1CHGA 2XBWA 3URCA 1TOMH 2R0LA 2BY8X 5FPYA 1C1OA 5K0HA 1QZ8A 3GCOA 1ELCA 1IOEA 4I8HA 4YOJA 1MZAA 3C1KA 5AHGH 3WWFA 3TNSA 1O2SA 4X6NA 1K1NA 1XM1A 3EQ0H 2ZDAH 1QJ1B 1PQ8A 1QL9A 2FOMB 5C5OA 4BANB 2Y81A 1P2OA 1HBTH 2EEKA 3ITIA 1LHGH 3KYFA 1P09A 1O3FA 1OP0A 3MWIU 1E36B 1HLTH 4ZHLU 3B23B 1P3EA 3KCGH 1P2QA 1O2RA 1VITG 2VIQA 2FOEA 2ZU3A 4FU9A 3H7OA 5TCAA 2P8OB 4TY7A 2QCYA 4MPUA 1XUHA 1W11U 1KDQB 3V7TA 1O3OA 2FWWA 1G3DA 1QL7A 3V3MA 5AFYH 4Y8XA 3BIVH 4NGAH 1O5EH 1TE0A 1NESE 5EJLA 5SGAE 2K0QA 2SGPE 3RLYH 1O2OA 4UFDH 4HTCH 4WXIA 1V2ST 1BMAA 1SLWB 5PTPA 2ZWLH 3P8GA 5DP6A 3ZIAD 3RXDA 2C8XB 3PMJA 2F9VA 4NIYA 1PPZA 3ZYDA 1SGIB 1K1PA 7KMEH 5HMAA 3RC6A 1TQ0B 1O2WA 3M37A 4RSPA 4AZ2B 1ZMJA 2PKSB 1GJCB 1F0TA 3K9XB 4KGAA 4AOQA 5A8ZA 1AGJA 4FU8A 5DP4A 3LONA 3RMLH 2AIPA 2FOFA 4NWLA 3NKKA 3OTJE 1FJSA 1QBNA 4INHA 1EB1H 2ZTXA 3OAAD 3BTKE 3DHKH 1TLDA 3TVJB 1RTLA 1IQEA 2ZDMA 3FANA 2AIQA 1HJAC 3TPIZ 2OD3B 3FKSD 2M5TA 4X1RU 4A1XA 1AI8H 2K8IA 3S9CA 3LKWA 4BTIB 5JB8S 1WXRA 4YM9A 3SO3A 4Y7AA 3A86A 1TGTA 3UREA 1P02A 1LHCH 1YCPH 4XSKU 2GVFA 4D9RA 1DWCH 2ZPRA 3SZNA 5C1XA 2QC2A 3RXOA 2V6NA 1Y3UA 2XTTB 4IBLH 4FUFA 2ZFQH 3W94A 2FOAA 4OS4A 5J4SA 1UMAH 2QF0A 5CHBA 3EE0B 3KEEA 3ZZ8A 3AW1A 1C5VA 3FAOA 3KYGA 2JETB 1BRAA 3U98H 4KELA 2GD4B 3SQHE 4U32A 2OQUA 1HRTH 5DP3A 1YM0A 2P95A 8GCHF 2V3HH 2ODQA 2BD8A 1QHRB 4UFEH 1GI3A 3T26A 1FIZA 2SFAA 2VVUA 5IK2D 3HGNA 1T31A 1BBRE 2ZNKH 2KR7A 3F9GA 3F2HA 2A5KA 2GX4A 2EY4C 1C4V2 1YPEH 3EE7A 1OXGA 2Q1JA 2SGDE 1K22H 3A85A 1EFRD 1S6FA 1SPJA 1TONA 8GCHG 2HVYB 1BRUP 5T6GA 1DS2E 1UCYK 4DT7B 3T62A 1BB0B 4I32A 1DXPA 4OS1A 1S83A 3GY6A 2CHAC 1GDNA 2QE7D 3TGIE 1FN6A 3MMGA 4MNVA 1D6RA 2AS9A 3U1IB 2UUKB 5BRRE 2O8UA 1FV9A 1A0JA 1LVYA 3KQBA 4BOHA 3E0PB 3DSGA 4FVBA 2AMQA 1KIGH 4Q80A 1P12E 1LVBA 1YCPM 3RXCA 4A1TA 3SU4A 3QZQA 4ZXXH 2A7CA 4X1QU 4RKJB 3RXPA 3U9AH 3KIDU 3PRDA 3DSOA 2QXGA 1FUJA 1TPSA 4ABFA 1C1RA 1C9TA 1YCPK 2O8TA 2KAIB 1EAUA 2RCEA 2ZFFH 3I29A 1AU8A 2M2AA 2TGTA 3QZRA 3CENA 4Q2KA 2B7DH 1FX0B 4ZCNA 5J4QA 1D3TB 2FTMA 2WPHS 4DOQA 2JH0D 1GHBG 1PPFE 2P3TB 3DA9B 1XUFA 2C8YB 4RKOB 3MO6A 5ETXA 3WY8A 4K1SA 1KMHB 1O2UA 1IQHA 2J94A 1LCYA 1ELDE 3U28C 1QRZA 1PFXC 1EXFA 4JZDH 4CR5A 1V6DA 1SR5C 1YC0A 3BTWE 1YP9A 3SBKA 3MHWU 4BAHB 4NIWA 1W7XH 1AFQC 3SHCH 1YLCA 4GHQA 1V2TT 1SGDE 1P06A 1G3EA 1ORFA 1O33A 1QBVH 3I78A 4H42U 2PR3A 3O8CA 1BCUH 2TPIZ 1SGNE 1LTOA 1F5KU 3ZZBA 3DT0H 1DT2A 1K1IA 4ACBA 1QBOA 4X1NU 5ESBA 1ELAA 1O3KA 1PQ7A 1SHYA 4CRAA 3FOAA 3A7XA 5EW1H 1JIRA 4MNXA 3LGWA 2OC1A 3ZZDA 1BRCE 1EAXA 3RXFA 2XC4A 2XBVA 1E37B 5GCHG 1V2VT 3SJOA 1NT1A 1H8DH 1K1MA 5HIZA 1T4UH 1LVOA 1ZHRA 2NU3E 1EPTB 2RDEA 2TBSA 1FPCH 1O2YA 3SNEA 1E38B 5FX6A 1W0KD 3EDXB 5JBBS 2J98B 2VGCB 3QN7A 5DP7A 1YPHC 4I8JA 1QTFA 2WPIS 1INCA 3H09A 3V0XA 3EA7A 2O9QA 2HLDD 4LXBH 1MTWA 1EP5A 3EA8A 3FO8D 1HNEE 4XOJA 3AK5A 1C4Y2 3UY9A 2LNCA 2FLBH 2ANKH 3RXRA 2UUJB 2BZ6H 4DURA 1HJ9A 1HGTH 4OS2A 6GCHF 1FONA 3BIUH 1GCDA 1C5TA 3TLOA 1IQIA 2WPMS 1N8OC 7GCHF 1TWXB 1GPZA 1DWBH 3LH3A 3T28A 4BAMB 2Z94A 4TY6A 4E06H 4Z0KA 1BTUA 1C1QA 3RXJA 2FZZA 1C5QA 1GG6C 4SGBE 1C5OH 2WPJS 2W7SA 5C0TA 1MTSA 2ZU5A 4YLQH 1GBHA 1C4U2 1C5MD 1A7SA 2R0KA 4F48B 3A87A 1BDAA 4CRGA 1NRPH 1DUEA 3AAVA 2WYGA 2KX4A 2SNVA 1EZXC 1T32A 3E0NB 1NY22 1FY4A 3E16B 3F68H 5E0HA 1O31A 4NSVA 1DDJA 4MTBA 2A4OA 3SJ8A 3TITA 3T29A 3BTHE 4X2VA 3LPRA 1UVTH 5FCKA 1OP8A 4JZFH 3PO1C 3PV2A 1UCYE 1BBRH 1SVPA 3VB5A 4AYYB 1KLIH 1P0SH 1QA0A 2SGEE 2H6MA 1BBRK 2CHAB 3OE7D 1O2HA 3N7OA 3WW7A 1HAVA 5L6NH 1Y3XA 1BOQA 3AASA 1GI0A 1XMNB 1LPKB 3GCHC 1Y3YA 4XE4A 3GCTG 4HFPB 4Q7XA 4XD7D 3O8RA 1SGTA 2BD3A 1EPTA 1A5HA 4VGCB 2OC8A 3SJIA 2Z6BD 5EW2H 1HXEH 2STBE 3A8CA 3PTNA 1J17T 1KTTB 4WVPE 2Y5HA 1H9IE 3MTYA 1UTMA 3RDZA 1Y3WA 3S69A 4CRBA 2B9LA 1WDIA 4AX9H 1C5NH 1HUTH 1CA8B 1FLEE 1YY3A 1J15A 3F3BA 1B0EA 4IS5A 4DIIH 1TMBH 2SGFE 1GVKB 4AORA 4J2YB 2CV3A 1NTPA 1GJBB 3KF2A 1SGYE 4IC5A 1A1RA 2YMSC 1NO9H 4K2YA 1E1QD 4RT1A 3A88A 1V2PT 2B5TB 5B6OA 1VKYA 1O2MA 2VIDA 1UCYH 1MD7A 1K21H 1Z1IA 2A0QB 5F8TA 2ZTYA 1CGHA 4NG9H 3O8BA 1F2SE 3A8AA 1HAYB 2SNWA 4B2BA 1YPHE 3BSQA 1O2LA 1GMCF 2AGEX 4FUEA 1AVWA 3L3TA 4NSYA 2QF5A 3T27A 2I6QA 1ARCA 3ATKA 4FETA 6GCHG 2AGGX 3KHVA 2ZGHA 3F9HA 1WTGH 3ATWA 4P02A 1NFXA 1GBKA 5FPSA 4F4OC 1NFUA 4XBDA 5JPMH 2PKAA 5CHAB 2KCPA 3URDA 4XBBA 3SW2B 3UNRA 2KFWA 3PWBA 4UEHH 3F9FA 4F49A 1D9IA 1O3GA 3A8DA 4DG4A 2A45B 4B2CA 3IWMA 1IQMA 4I33A 2FS9A 3F2FA 5LPFA 3Q3KA 1ZTLA 2FMJA 1AKSB 3TIUA 3UQOA 1NRSH 3MNCA 2BOKA 3FZDA 2A2QH 1ZPBA 1NFYA 3GS9A 4X8UH 3W1EA 5FBEA 2BQWB 3NK8A 3Q00A 1SQOA 3WWBA 1CBWB 2H5DA 3ATMA 3RXKA 1T7CA 2ZTZA 2AH4X 2BXUH 1LQDB 5KEDA 3TH2H 1WTHD 3LDXH 4TWYA 3VPKA 3OYPA 1VCPA 3A8BA 1CHOG 1VITH 1Y5BT 2Q6DA 3A7ZA 1TGBA 1GJAB 2OQ5A 1BMFD 1GCTC 2Y80A 3FP7E 5FBIA 2EI7A 4Z1MD 1E79D 1YKTA 2ASUB 1O3NA 2D8WA 2VNTA 2AERH 3PV4A 4B74A 2C90B 5ESTE 1NROH 1HYLA 2ZDVH 3UFAA 1AQ7A 5EXNA 2AFQB 1O2VA 1C2KA 1O3BA 2XNIA 2O8LA 3VFEA 3SNAA 2YMSD 1TNLA 2GCTB 3GICB 1TYNA 2FX6A 1BMLA 1IQJA 2QV1A 1XKBC 1MABB 1DX5M 3BEUA 4Y76A 4K1EA 4I8KA 2Z9JA 3PLPA 1WOFA 2J95A 3RU4D 1C9PA 3N99A 5LGOA 1ZTJA 3W95A 3SGQE 1GBAA 5C2ZA 1YLDA 1V2UT 1TPAE 1LKAA 1W0JD 3VG8A 1MBMA 4B71A 2EI6A 2ZFTA 1S84A 3K6ZA 1AE8H 3VGCB 1GMCG 3MYWA 1JBUH 2BLWA 2F43B 5KECA 3UR6A 4FUGA 3QWCH 4JYVH 4X1SU 1W0ZU 3UUZA 1O5FH 2BDAA 2OUAA 1EOJA 2BTCE 1V2MT 1TOCB 1C5ZB 3GCHB 1LO6A 3GYMA 3RU4T 5EJ1A 1GHAG 1L1JA 3MNSA 2FX4A 1TFXA 1GJ6A 1MU6B 1MCVA 1FY8E 3MU0A 1GI4A 3K65B 1EPTC 1J9CH 2WUCA 3VB4A 4ISHH 2VIPA 8LPRA 1K1JA 4MLFB 3A7WA 4LOYH 4WMFA 4ZKNU 1O2KA 4TWWA 1ETRH 3D65E 2H9TH 4FOUC 1O3JA 1L4ZA 1GWAA 1P2JA 4ZROA 1GJ9B 1KDQA 2BB4A 2ZIQH 3U8OH 5FPTA 4AG1A 2WV4A 4CRCA 3QGJA 4MVNA 1GJ7B 3T25A 3UPEA 3RXLA 4H6SB 1TQ7B 1GBMA 2FXRA 1KSNA 2CXVA 3S9BA 2FOBA 2G4TA 3RLWH 2PKAB 2W5EA 5AVDA 3D49H 3VXFH 2IN2A 1CGJE 1DY8A 1RD3B 2BVRH 3RMMH 5LPEA 4AFUA 4MG3A 4TPYA 1O2PA 1DSTA 1MKWH 1A5GH 3VB7A 3SU3A 2G52A 4X0WU 4H4FA 3DUXH 4R0IA 3AAUA 3RMNH 5DO4H 1OP2A 2XXLA 2A7HA 4CBOA 2JIZD 3PROA 1BTZA 3KGPA 2THFB 1HDTH 1C5SA 4X2XA 1SLXB 1BTXA 1GJ4H 1Q3XA 1G30B 1QRWA 1XUGA 4OM9A 1PPCE 1QGFA 3Q77A 1UVUH 1O3IA 1V2WT 3P17H 2PHBA 3E8LA 1S81A 3A82A 3NXPA 5TJXA 4INLA 1ZJKA 1AO5A 2OK5A 1P2KA 3G01A 1HAOH 1HCGA 4UFFH 4X8TH 2P8OC 2HRVA 2FEQH 4ISLA 1HAXB 2GGVB 4NIXA 1H8HD 4NA9H 3M5LA 4FUBA 2BDBA 1DE7H 4DY7B 5I25A 5FL7D 1K2I1 2PV9B 5CHAC 3LGYA 2VH0A 3ESTA 1A0LA 1RXPA 2AEIH 2C4FH 2LP6A 2FTLE 4NA7A 2TRMA 3UOPA 2XBXA 1FMGA 2J2UA 3NRLA 4ZKSU 1AKSA 2FI5E 3ZZ9A 1V2JT 3TJOA 4BTUB 5EIYA 3PLBA 2BLVA 3ZZ4A 1QURH 1P05A 1F92A 3ZVFA 1ZSJA 3MNBA 1SL3A 1SBWA 3SU1A 5EQQA 2ZI2H 2WSSD 1NN6A 4CH2B 2A5IA 4ZKOU 1QL8A 2ZEBA 1YBWA 3RM2H 1OWKA 1ELVA 1L0ZA 1TAWA 1DSUA 4RI0A 5HGGA 3SV9A 1C1SA 2XBYA 4ESTE 5EQRA 8KME2 3RXTA 4DGJA 5GPIB 1IAUA 5CE1A 2VVCA 3MH5A 1QCPA 1C5XB 3EGKH 1O38A 1VGCC 1ID5H 1ZPZA 5FX5A 1D4PB 1O2TA 4RT0A 3ZVDA 3TK6A 3TGKE 5C20A 5F6MA 2KCAA 1V3XA 1BITA 2OTVA 3SU5A 1CT2E 1NRNH 4X6OA 1EP6A 1QA7A 2ZHWH 2J34A 1MKWK 1MAXA 1EZQA 2A2XH 5A2MH 4U01A 3LJJA 2Z9KA 3M35A 1PPBH 4I86A 1OYTH 2PWXA 3HGPA 3MQKC 3CS7A 4YO9A 2HPQH 4BAQB 2BDHA 2ANWA 4E7RG 1H4WA 1KLJH 4ISNA 2GKVE 1L1GA 1HAZB 1GI9B 2C8WB 2FLRH 2GV7A 2HNTF 2PGBB 3QGNB 1FY3A 1GBDA 3ATLA 2IJOB 3Q76A 3RMOH 3M61U 1ANBA 4DVAU 2R3UA 4JYUH 1ELFA 3LC3A 2OC0A 3M3VA 1LQEA 3RP2A 4M9FA 1AHTH 1GGDC 2D1JA 1NU7B 3MU8A 3SU2A 4O9VA 5ABWA 4IGDA 1UTPA 2K1QA 1ELTA 4M7GA 2DE9A 4HZHA 3F0OA 1ZSLA 1V2KT 3PYHA 5DG6A 4CRFA 1EOLA 1HFDA 2I6SA 1Y3VA 4Q7ZA 4KTSA 1ABIH 1ZLRA 1TNJA 3TGJE 1C2DA 3HATH 1O32A 2ALPA 1BJUA 1CU1A 1RTFB 3RU4E 4JK5A 5L2YH 1NFWA 1UTJA 1C2HA 3UNQA 2Q6FA 5HM9A 1W13U 3S7KB 1VJ9U 5E8EH 1BTWA 2J4IA 3BTGE 1YPMH 3OY5U 4XBCA 4IW4E 2AHME 2BY6X 1F7ZA 2D26C 1TMTH 1TB6H 1C2JA 2KAIA 1PJPA 3E6PH 3M7TA 5DKMA 2GMTC 3D62A 1UHBA 2FDAA 1P2MA 1MD8A 3EYDA 1O5GH 3ZVEA 3JZ1B 1CT0E 1GBLA 2Y6TA 1TABE 1FNIA 4D8NA 2ZKSA 1O5BB 2BD2A 7GCHG 1DITH 1DANH 2B8OH 1HXFH 3RXAA 5DGJA 4OGXA 2QA9E 3KQ5A 4JK6A 5A8YA 1HAGE 1ZMNA 1OPHB 3M7QA 3MH7A 1WAYB 2CF9H 1Z71A 4HGCA 2BY5X 5JBTA 1AMHA 1NPMA 1CO7E 1JXPA 4UD9H 5IDKA 4O3UA 3U8RH 3SJ9A 4KKDA 1OWHA 2YNAA 5FHTA 1OX1A 3R0FA 1FXYA 3P6ZB 1P03A 1FY5A 3CS0A 1O2XA 1P2NA 4BNRA 4K8BA 2Y5GA 1UTQA 3ZYEA 1G2LA 2W6JD 3M5NA 1P57B 1BA8B 2Q6GA 3ZZ3A 1OWJA 2ANMH 1HIAB 1GHWH 4B1TA 6LPRA 3H5CB 3ZVGA 1FIWA 1Y8TA 3F1SB 1UTOA 1P10A 1GDUA 4Q4LA 1ZOMA 1NBME 3P8OA 3A7VA 1PQ5A 3GY7A 1N6YA 5F03A 1LPZB 3RXMA 4Y6DA 5AFZH 1TALA 1SGFG 4B6FA 1SGRE 5C3NA 4YLUA 3MNXA 4CH8B 2OLGA 2J97A 3MOCA 1GGDB 1O0DH 3RC5A 2Y7ZA 2CF8H 4KP0A 4X6PA 1Z8JB 2CMYA 3KQDA 1P01A 1BZXE 3RXVA 5GWZA 2FO9A 1WCZA 4OS5A 4TPIZ 1D3QB 4X2WA 2G8TA 3SGBE 1THRH 4YTAA 1W10U 2A4RA 4O3TA 1AFEH 1HV7A 3F0PA 3VB6A 4B6EA 2QXIA 3F9EA 3FP8E 2BYAX 4X6MA 1UVSH 2AGIX 4XDEA 1ANEA 2IPHA 1TNHA 3R3GB 2LPRA 2EA3A 2BM2A 1GG6B 1QNJA 4WH8A 1O35A 4AB9A 1C1TA 1OSSA 4JZIA 1RJXB 2V3OH 1AVXA 2QY0B 4WXVA 2FM2A 1S6HA 3ZZ5A 3QDZB 3FVFB 2NU2E 1GBEA 1MZDA 1BHXF 2JJ2D 2AYWA 2H5CA 3A84A 1RGQA 1ZYOA 3ATIA 1XVMA 3PLKA 3IITA 3AW0A 7ESTE 1UK3A 2HGTH 1MTUA 1EQ9A 3M5OA 1P11E 1O2QA 1YPGH 1DM4B 1D3DB 2PUQH 2XW9A 3RXSA 2Z9IA 2QYIA 2ZCKP 2DUCA 1MU8B 5E2OA 1KXDA 1GHZA 2R2WU 3TJVA 2GDEH 2ZGCA 2GTBA 1WSSH 1NRRH 2JH6D 3KN2A 3LOXA 1UK4A 1IHTH 4IC6A 3SV7A 1NM6A 5E0JA 2QXJA 1XKAC 1TMUH 2ZO3H 4Q63A 1N6XA 1FAXA 9ESTA 1C2IA 5EXMA 1YF4A 3GCTF 2ZHEH 1UTKA 3SNBA 1O3HA 3ZVCA 5C1UA 1PPHE 1CVWH 2D2DA 1PYTD 2BQ7B 3P70B 1C2MA 2JDID 1W12U 1TIOA 2H9EH 2A1DB 2PFEA 2YMSB 2ZPSA 1YGCH 4K69A 1QFKH 2A7JA 2BMGB 2BY7X 1HB0B 4ASUD 1P9UA 5C67A 1E34B 4ZUHA 1SQRA 2ZU1A 2A5AA 2A4GA 3I77A 1VCQA 1D6WA 1GI6A 1EX3A 3SI4H 2QF3A 1XUJA 3SUEA 2L74A 1B0FA 1OWIA 1P2IA 1WQSA 4ASHA 2BX3A 1AFQB 2CK3D 3D23A 4Y8ZA 1ELGA 2CJIA 1C1WH 1HPGA 4Y7BA 2V3MA 1SQTA 1MKXH 2BVSH 4K60A 5LH8A 2NWNA 4YT6H 1PYTC 2C3SA 2QIQA 1MCTA 2PP6A 3SOSA 3UAIC 5EPYA 1A4WH 1GCTB 3SUDA 2ILNA 3ZVAA 1EZUC 1MQ5A 1V2LT 4LZ1H 1C5RA 4BAOB 2F91A 4AYVB 5CMXH 4CREA 2DE8A 1G2MA 1ETTH 4ABEA 3M36A 2A4QA 1DPOA 2NU1E 1BHXB 1S0RA 3MU5A 1Y59T 2XC5A 4JCNA 4THNH 3GY3A 5DP5A 2HVXA 5T6DA 4TSFD 1GHAF 3B9FH 3UQVA 2PW8H 1X7AC 4AGKA 3BG4C 3HK3B 1BTYA 1THSH 2PKSC 3SZEA 1A5IA 2WYJA 2G5NA 1OOKB 2BVXH 5HM2A 1GL1A 4XRNA 3E91A 3BTDE 1YPJH 3NCLA 2GCHG 2HALA 1M9UA 1AWFH 2C8ZB 2FYQA 4IMQA 3SV6A 3BG4B 3HKIB 1C1PA 3TNTA 4GVUA 5JBCS 5EODA 2PSYA 1H8IH 2QGRA 2PSXA 2QXHA 3O8DA 1AE5A 1LHFH 3IG6B 4B75A 2GJGA 1C2LA 1BQYA 1ANDA 5F53A 1SB1H 1Z8GA 4MNWA 1CHOF 1Z8RA 2A31A 3GYLB 1TBZH 1DXWA 1O37A 3STIA 2VIWA 3JZ2B 1Y5UT 1NBMD 1O36A 3HPTB 3U1JB 1ESAA 4YXWD 3LU9B 4K8YA 2VBCA 1QB6A 1RS0A 4I7YH 2RFKC 4SGAE 1GJ5H 1GVZA 1P3CA 4INKA 1L1NA 5JDUB 3LIWA 3DFLA 1SFQB 1ZZZA 3N7DA 3U8TH 3VGCC 5C17A 1WU1A 5T1VA 1JIMA 1TGCA 1V2RT 1JMOH 1NC6A 2BLQA 2ZPQA 5IYTA 3ZV9A 7LPRA 5G4BA 1SGFA 1QJ6B 3BTQE 5E2PA 3ZZCA 3KNXA 1QQ4A 1GBFA 4KTUA 2Z7FE 2GV6A 1EJAA 5DJ7A 4UONA 2EC9H 2RDLA 1E0FD 3SU0A 2WINI 2ANYA 2OINA 4U30A 1ZR0A 2BDCA 5DN6D 3P92A 1SGQE 1JRTA 1SI5H 3EA9A 6ESTA 3S7HB 3SQEE 2TGPZ 4B73A 2NU0E 8ESTE 3V12A 3TU7H 1CQQA 1UVOA 2PGQB 1RIWB 3SORA 3KL6A 4DCDA 1F0RA 4GUXA 2XWAA 4FUIA 4MPXA 4FUHA 3VXEH 1O3CA 1LHEH 1MTNB 1TBRH 3L33A 1QJ7B 1AZ8A 2P3UB 5EPNA 1ELEE 4ISOA 3RUOA 1Q2WA 2VU8E 1WUNH 5LPRA 1XXDA 4GAWA 4A7IB 2OCVB 1FDPA 1RTKA 1A0HB 1EZSC 1UHBB 6CHAC 2H1UA 1LKBA 3A89A 1TX6A 1GI7B 1BMMH 3OFND 4ABAA 1GBTA 1ZGIA 3QO6A 2ZGXH 2WPKS 1ZTKA 2FOGA 4Y71A 3BTTE 4D7FA 1YPLH 1LPGB 2YNBA 3OX7U 1O30A 3TJNA 2NU4E 1QB9A 3NZIA 2VH6A 1YPKH 1C2GA 1O2NA 2LELA 1C5UA 1O5AB 2ZZUH 2YOLA 4AFSA 1ESBA 2XWBI 3FZZA 1SOZA 4JYTA 3LH1A 1TNGA 2Z3DA 2ZHDA 1G9IE 2O8WA 2PLXA 2ZGJA 3PRBA 5HKKD 3DSPA 1C1UH 3E3TA 4ABDA 1VITF 1EB2A 5EQSA 5DPAA 3M3SA 5GNDA 1LMWB 2STAE 1GI2A 3MH6A 5JYIA 1GHBF 5A8XA 4IN2A 1HAPH 4WWYA 5AF9H 4KTCA 2OP9A 2ZDKA 3PWCA 3QTOH 1KYNA 1H1BA 1TPOA 4NCYA 1J8AA 1SLUB 2H9HA 1W7GH 2P3FH 2XOKD 1BJVA 2ZHQH 3SNCA 4AGJA 1TPPA 1ZHPA 1C5WB 3TH3H 1KXBA 2JKHA 4MPVA 1C1VH 1T8MA 1JOUB 1SGCA 1QY6A 1C5YB 1S85A 3CP7A 1ZSKA 2VWOA 1AD8H 4I8LA 2ODYB 2O8MA 4GSOA 1ZRKA 2FOHA 3GDVA 4P00A 1S0QA 4PROA 2G00A 1DFPA 1W8BH 2OC7A 2ZGBH 3M5MA 1AIXH 2RG3A 5JBAS 2J9NA 4RN6A 1C2EA 1GHVH 3RXGA 2W3KA 4A92A 4A5TS 4DT4A 2KM0A 1F5LA 1IQKA 4Y11E 3A83A 2FIRH 3GY2A 2AMPA 1ANCA 5GCHF 2JH5D 3BN9A 1O3AA 4DJZB 1THPB 1J14A 2BOHB 1ARBA 4Z6AH 3AVZA 2TGDA 2TIOA 5CDFE 3GCNA 2UWPA 4WF8A 1TBQH 2ZHFH 3GDSA 1YLNA 1O3EA 1MBQA 5DP8A 1O5DH 4GHTA 4ZH8A 1A61H 1HAIH 2Z3CA 2FP7B 2PTNA 1IQNA 2VINA 4HG6A 4ABGA 5L2ZH 4U2WA 3GDUA 1ESTA 1DLEA 1CSOE 1GHYH 1SFIA 2G51A 1G36A 5K7RA 5C0UA 4OS7A 2F9UA 3UR9A 4F55A 1AB9B 1VJAU 3SU6A 2BD7A 4NFFA 3SV8A 2SGQE 5C1YA 3LJOA 1G3BA 3RXIA 3MO3A 1AZZA 2GT8A 5F8ZA 3RXHA 3GY5A 3SYJA 1DWDH 1V2QT 3P95A 2ZQ1A 1PQAA 3BEIB 4MQAA 3RXUA 1GVLA 1NRQH 3ZZ6A 4FUJA 1OS8A 1DUAA 3STJA 2R9PA 1GJ8B 1W2KH 1T4VH 1H9HE 5HIYA 5BPEA 3K6YA 4ISIH 4BXSA 1E35B 4NZQA 1S5SA 3F6UH 4A1VA 3QLPH 3T5FH 2UWOA 1TGSZ 1PPEE 4AB8A 3A80A 2ODPA 2GP9B 1GBJA 1EJNA 1FZZA 3FN8A 1GBBA 3LGUA 2UUYA 2VWMA 4UFGH 1B5GH 1A2CH 2SGAA 3L6PA 2XRCA 4D7GA 5E0GA 2J38A 1BT7A 3LGTA 1HAHH 5KGOA 1T8OA 3N7EA 3SGAE 5HYOA 6CHAB 1BTPA 4YT7H 1T8NA 4HI3A 4A6LA 2UUFB 2F9PA 1T8LA 2RA3A 3ZZ7A 2VIVA 1BIOA 4Y10E 5H4IB 2ZFPH 2BD4A 3ZV8A 4CHAB 2G5VA 3DFJA 1K9OE 3ENSB 2EI8A 1AWHB 1GDQA 1FN8A 1K28D 1CT4E 2G55A 1K1LA 2EQNA 4TYDA 1RIWC 1EUFA 2ZG0H 1BMNH 3KQEA 2J92A 3QX5H 1JWTA 3GOVB 5FXLA 2JETC 3KQCA 4JMYA 4O97A 2XC0A 2F4LA 1XUKA 4Y79A 5T6FA 1WQVH 4ABBA 3GISB 2Z9LA 1ELBA 1GHXH 1WYKA 2QF4A 5C5NA 2W26A 3PMAB 4WH6A 1Q31A 3A7YA 3PMHB 1FY1A 1Z6EA 2GMTB 3QTVH 4WJG2 2WHXA 1B7XB 1O2GH 1ZPCA 2Y82A 1C2FA 3SV2H 3RXQA 2HLCA 1MMJN 2VVVA
chains in the Genus database with same CATH topology
3GY4A 3VB3A 5GJ4B 1SMFE 4Y0ZE 2C93B 4MNYA 1GJDB 2VJ1A 5FAHA 2F83A 4QT8C 1XX9A 1ACBE 1QIXB 4VGCC 2WUBA 3TJUA 1AVGH 3P8NA 3A7TA 1ZRBA 2HNTE 1Z1JA 4BAKB 4WMEA 4ZMAH 1CA0B 1CA0C 1P04A 4CRDA 4GCHG 1QQUA 4B2AA 3SNDA 3UTUH 1P8VC 2BHGA 3OSYA 3MI4A 2VGCC 4LZ4B 4K3JA 1O34A 1SSXA 4JZEH 1H9LB 1TRMA 1Y5AT 1FPHH 4NA8A 3TK5A 4DW2U 1G37A 1MUEB 2CGAA 2Y5FA 3B8JA 1GBCA 2B0FA 2R3YA 1AB9C 3BF6H 3SUGA 2ZU2A 1GI1A 4YZUA 1UTLM 2FPZA 4I31A 2FS8A 1O2JA 1TA6A 4UDWH 4YESB 1O2IA 3S9AA 2P16A 3U69H 1AUJA 3K2UA 1ZGVA 1QR3E 1MKXK 1S82A 2VB0A 1LHDH 1OWDA 1TX7A 4B76A 1UVPA 2FESH 4I8GA 1OWEA 2VWNA 1NS3A 4X2YA 2TGAA 1W14U 2ZF0H 1JRSA 1O3PB 1IQGA 3H7TA 1SQAA 1OKXA 2HWLB 1BTHH 3SI3H 3UIRA 1HAVB 1EASA 1GI5A 1TNIA 1EJMA 1U6QA 4E05H 4YOIA 4X8SH 4NZLA 1FI8A 1C5PA 1CE5A 1DWEH 1CGIE 2Z3EA 1BRBE 4AG2A 5DP9A 1ZJDA 1EKBB 1FAKH 4Q7YA 1AUTC 1A3BH 3BEFB 3NPSA 4R8TB 2BX4A 1DICA 4JZ1A 1P9SA 5L30H 3TK9A 1KTSB 1TGNA 2P59A 3LGVA 4XFQA 1O39A 1SLVB 2XCFA 2RA0A 1TRNA 1HIAA 1MTVA 1G3CA 3M3TA 4MPWA 3ZZAA 5GDSH 2OXSA 5DK1A 3C27B 1GI8B 4BXWA 4UE7H 1GMDG 1SGEE 4OGYA 1BUIA 3FFGA 3Q3XA 1A3EH 2P93A 3NWUA 1L2EA 4FXGH 4GPGA 4WMDA 1O3MA 5EGMA 3SN8A 4K1TA 4YOGA 1DVAH 2W3IA 5I46H 4AN7A 3BTFE 1EAWA 3ELAH 1EATA 2F9BH 3BV9B 1K1OA 3Q3YA 4AFZA 1VGCB 1ABJH 1O5CB 1NU9A 1ETSH 1IQLA 3T2NA 3PO1B 1KY9A 4X8VH 3MU4A 3SHAH 5A0CA 2ZP0H 2OBOA 3RM0H 4CHAC 3TH4H 1TX8A 2BLOA 4X1PU 2GDDA 2ZQ2A 1VR1H 5EOKA 1MH0A 1IQFA 4DIHH 4K5ZA 2HNTC 4ZAEA 5A0AE 1DLKB 3E90B 1KXCA 4NIVA 1RFNA 4ZXYH 3OU0A 1AN1E 2ZFSA 1SG8B 3BTEE 1XXFA 2ALVA 1F0UA 3S0NA 4FU7A 2HPPH 4GLYA 1C1NA 1C5LH 5A09A 4IN1A 4FUCA 1YYY1 4ZHMU 2H2ZA 3MFJA 1VCWA 2G4UA 2ESTE 1L4DA 2PTCE 4BTTB 2OBQA 1UTNA 1CBWC 2VWLA 2F3CE 2FODA 1MQ6A 2FI4E 5GIBA 3HKJB 2ZECA 2VIOA 2GZ8A 3ODFA 2GZ9A 1IHSH 2GCTC 3HK6B 2PUXB 3OY6U 4O03A 3A81A 3SJKA 1XUIA 2IOTA 3FP6E 4ABHA 4Y8YA 1J16A 1V2OT 1ZHMA 2WV5A 2Y7XA 1SOTA 2BXTH 4E7NA 1O3LA 2G81E 3RXBA 1KXAA 1MAYA 1RRKA 1KXEA 1SC8U 2ZA5A 1LDTT 1UO6A 1NZQH 3UOUA 1GMHG 3V13A 3EAJA 5EXLA 2FI3E 3PB1E 5F8XA 3VEQB 4J1YA 1SHHB 1EAIA 1GL0E 1HJAB 2A32A 3PM3A 3ZVBA 1W3CA 3RXEA 3UWIA 3BTME 1N1LA 1PPGE 1WV7H 2F9OA 4NWKA 3E1XB 1F5RA 1QRXA 3UNSA 4ZKRU 5FCRA 3MO9A 3UWJH 2BD9A 2CN0H 5EG4A 1UK2A 1N8OB 4GCHF 2UWLA 4H6TA 2XCNA 1KLTA 2Z9GA 2XYAA 1Z6JH 4WY3A 1QB1A 2BD5A 2BDIA 2F9NA 5HXFA 2QAAA 3SUFA 3GY8A 2ZCLP 1SGPE 1GMDF 2P94A 1GMHF 1DY9A 1A46H 3P8FA 4ABJA 2ZC9H 2BY9X 1TNKA 1W0YH 2ZU4A 3PMBB 2AMDA 4CBNA 2BDGA 4CR9A 2ZCHP 3PTBA 1LVMA 4ABIA 3QK1A 1FQ3A 3BG8A 1Z8IB 2FOCA 1Z7KA 3LGIA 3LT3A 1VZQH 2WPLS 1TRYA 4AFQA 2V0BA 3LC5A 2QN5T 2ZDNA 1WBGB 2BQ6B 4IMZA 5T3HA 2ZDLA 2V35A 4NFEA 1KXFA 2BZAA 1O2ZA 4FVDA 2W7UA 1G32B 4ZHAA 3NUMA 4OS6A 3RC4A 3DD2H 1MTNC 4Y0YE 1ZMLA 4D9QA 1UJ1A 5EU8A 3M7UA 1C1MA 5TCCA 9LPRA 5GXPA 1XVOA 1V2NT 1AY6H 1F0SA 4MDSA 1GBIA 2GT7A 2R2MB 2HOBA 1D3PB 3ODDA 4LK4A 2BDYA 1DOJA 1OYQA 1HJ8A 2GZ7A 2GCHF 3MH4A 3QUMP 3MU1A 4FUDA 4D76A 2ZFRH 1TA2A 5JB9S 2ULLA 5A0BA 1O3DA 2FYRA 1CHGA 2XBWA 3URCA 1TOMH 2R0LA 2BY8X 5FPYA 1C1OA 5K0HA 3GCOA 1ELCA 1IOEA 4I8HA 4YOJA 1MZAA 3C1KA 5AHGH 3TNSA 1O2SA 4X6NA 1K1NA 1XM1A 3EQ0H 2ZDAH 1QJ1B 1PQ8A 1QL9A 2FOMB 5C5OA 4BANB 2Y81A 1P2OA 1HBTH 2EEKA 3ITIA 1LHGH 1P09A 1O3FA 1OP0A 3MWIU 1E36B 1HLTH 4ZHLU 3B23B 1P3EA 3KCGH 1P2QA 1O2RA 1VITG 2VIQA 2FOEA 2ZU3A 4FU9A 3H7OA 5TCAA 2P8OB 4TY7A 2QCYA 4MPUA 1XUHA 1W11U 1KDQB 3V7TA 1O3OA 2FWWA 1G3DA 1QL7A 3V3MA 5AFYH 4Y8XA 3BIVH 4NGAH 1O5EH 1TE0A 1NESE 5SGAE 2SGPE 3RLYH 1O2OA 4UFDH 4HTCH 4WXIA 1V2ST 1BMAA 1SLWB 5PTPA 2ZWLH 3P8GA 5DP6A 3RXDA 2C8XB 3PMJA 2F9VA 4NIYA 1PPZA 3ZYDA 1SGIB 1K1PA 7KMEH 5HMAA 3RC6A 1TQ0B 1O2WA 3M37A 4RSPA 4AZ2B 1ZMJA 2PKSB 1GJCB 1F0TA 3K9XB 4KGAA 4AOQA 5A8ZA 1AGJA 4FU8A 5DP4A 3LONA 3RMLH 2AIPA 2FOFA 4NWLA 3NKKA 3OTJE 1FJSA 1QBNA 4INHA 1EB1H 2ZTXA 3BTKE 3DHKH 1TLDA 3TVJB 1RTLA 1IQEA 2ZDMA 3FANA 2AIQA 1HJAC 3TPIZ 2OD3B 2M5TA 4X1RU 4A1XA 1AI8H 3S9CA 3LKWA 4BTIB 5JB8S 4YM9A 3SO3A 4Y7AA 3A86A 1TGTA 3UREA 1P02A 1LHCH 1YCPH 4XSKU 2GVFA 4D9RA 1DWCH 2ZPRA 3SZNA 5C1XA 2QC2A 3RXOA 2V6NA 1Y3UA 2XTTB 4IBLH 4FUFA 2ZFQH 3W94A 2FOAA 4OS4A 5J4SA 1UMAH 2QF0A 3EE0B 3KEEA 3ZZ8A 3AW1A 1C5VA 3FAOA 2JETB 1BRAA 3U98H 4KELA 2GD4B 3SQHE 4U32A 2OQUA 1HRTH 5DP3A 1YM0A 2P95A 8GCHF 2V3HH 2ODQA 2BD8A 1QHRB 4UFEH 1GI3A 3T26A 1FIZA 2SFAA 2VVUA 3HGNA 1T31A 1BBRE 2ZNKH 3F9GA 2A5KA 2GX4A 1C4V2 1YPEH 1OXGA 2Q1JA 2SGDE 1K22H 3A85A 1S6FA 1SPJA 1TONA 8GCHG 1BRUP 5T6GA 1DS2E 1UCYK 4DT7B 3T62A 1BB0B 4I32A 1DXPA 4OS1A 1S83A 3GY6A 2CHAC 1GDNA 3TGIE 1FN6A 3MMGA 4MNVA 1D6RA 2AS9A 3U1IB 2UUKB 5BRRE 2O8UA 1FV9A 1A0JA 1LVYA 3KQBA 4BOHA 3E0PB 4FVBA 2AMQA 1KIGH 4Q80A 1P12E 1LVBA 1YCPM 3RXCA 4A1TA 3SU4A 3QZQA 4ZXXH 2A7CA 4X1QU 4RKJB 3RXPA 3U9AH 3KIDU 2QXGA 1FUJA 1TPSA 4ABFA 1C1RA 1C9TA 1YCPK 2O8TA 2KAIB 1EAUA 2RCEA 2ZFFH 3I29A 1AU8A 2TGTA 3QZRA 3CENA 4Q2KA 2B7DH 5J4QA 1D3TB 2FTMA 2WPHS 4DOQA 2JH0D 1GHBG 1PPFE 2P3TB 3DA9B 1XUFA 2C8YB 4RKOB 3MO6A 5ETXA 3WY8A 4K1SA 1O2UA 1IQHA 2J94A 1LCYA 1ELDE 1QRZA 1PFXC 1EXFA 4JZDH 4CR5A 1V6DA 1SR5C 1YC0A 3BTWE 1YP9A 3SBKA 3MHWU 4BAHB 4NIWA 1W7XH 1AFQC 3SHCH 1YLCA 4GHQA 1V2TT 1SGDE 1P06A 1G3EA 1ORFA 1O33A 1QBVH 3I78A 4H42U 2PR3A 3O8CA 1BCUH 2TPIZ 1SGNE 1LTOA 1F5KU 3ZZBA 3DT0H 1DT2A 1K1IA 1QBOA 4X1NU 5ESBA 1ELAA 1O3KA 1PQ7A 1SHYA 4CRAA 3A7XA 5EW1H 1JIRA 4MNXA 3LGWA 2OC1A 3ZZDA 1BRCE 1EAXA 3RXFA 2XC4A 2XBVA 1E37B 5GCHG 1V2VT 3SJOA 1NT1A 1H8DH 1K1MA 1T4UH 1LVOA 1ZHRA 2NU3E 1EPTB 2TBSA 1FPCH 1O2YA 3SNEA 1E38B 5FX6A 3EDXB 5JBBS 2VGCB 3QN7A 5DP7A 1YPHC 4I8JA 1QTFA 2WPIS 1INCA 3V0XA 3EA7A 2O9QA 4LXBH 1MTWA 1EP5A 3EA8A 1HNEE 4XOJA 1C4Y2 3UY9A 2LNCA 2FLBH 2ANKH 3RXRA 2UUJB 2BZ6H 4DURA 1HJ9A 1HGTH 4OS2A 6GCHF 1FONA 3BIUH 1GCDA 1C5TA 3TLOA 1IQIA 2WPMS 1N8OC 7GCHF 1TWXB 1GPZA 1DWBH 3LH3A 3T28A 4BAMB 2Z94A 4TY6A 4E06H 4Z0KA 1BTUA 1C1QA 3RXJA 2FZZA 1C5QA 1GG6C 4SGBE 1C5OH 2WPJS 2W7SA 1MTSA 2ZU5A 4YLQH 1GBHA 1C4U2 1C5MD 1A7SA 2R0KA 3A87A 1BDAA 4CRGA 1NRPH 1DUEA 3AAVA 2WYGA 1T32A 1EZXC 2SNVA 3E0NB 1NY22 1FY4A 3E16B 3F68H 5E0HA 1O31A 4NSVA 1DDJA 4MTBA 2A4OA 3SJ8A 3TITA 3T29A 3BTHE 4X2VA 3LPRA 1UVTH 5FCKA 1OP8A 4JZFH 3PO1C 1UCYE 1BBRH 1SVPA 3VB5A 4AYYB 1KLIH 1P0SH 1QA0A 2SGEE 2H6MA 1BBRK 2CHAB 1O2HA 3N7OA 1HAVA 5L6NH 1Y3XA 1BOQA 3AASA 1GI0A 1XMNB 1LPKB 3GCHC 1Y3YA 4XE4A 3GCTG 4HFPB 4Q7XA 3O8RA 1SGTA 2BD3A 1EPTA 1A5HA 4VGCB 2OC8A 3SJIA 2Z6BD 5EW2H 1HXEH 2STBE 3A8CA 3PTNA 1J17T 1KTTB 4WVPE 2Y5HA 1H9IE 3MTYA 1UTMA 3RDZA 1Y3WA 3S69A 4CRBA 2B9LA 4AX9H 1C5NH 1HUTH 1CA8B 1FLEE 1J15A 1B0EA 4IS5A 4DIIH 1TMBH 2SGFE 1GVKB 4AORA 4J2YB 2CV3A 1NTPA 1GJBB 3KF2A 1SGYE 4IC5A 1A1RA 1NO9H 4K2YA 3A88A 1V2PT 2B5TB 5B6OA 1O2MA 2VIDA 1UCYH 1MD7A 1K21H 1Z1IA 2A0QB 5F8TA 2ZTYA 1CGHA 4NG9H 3O8BA 1F2SE 3A8AA 1HAYB 2SNWA 4B2BA 1YPHE 3BSQA 1O2LA 1GMCF 2AGEX 4FUEA 1AVWA 3L3TA 4NSYA 3T27A 2I6QA 1ARCA 3ATKA 6GCHG 2AGGX 3KHVA 2ZGHA 3F9HA 1WTGH 3ATWA 1NFXA 1GBKA 5FPSA 4F4OC 1NFUA 4XBDA 5JPMH 2PKAA 5CHAB 3URDA 4XBBA 3SW2B 3UNRA 3PWBA 4UEHH 3F9FA 4F49A 1D9IA 1O3GA 3A8DA 4DG4A 2A45B 4B2CA 3IWMA 1IQMA 4I33A 2FS9A 5LPFA 3Q3KA 1ZTLA 2FMJA 1AKSB 3TIUA 3UQOA 1NRSH 3MNCA 2BOKA 3FZDA 2A2QH 1ZPBA 1NFYA 4X8UH 5FBEA 2BQWB 3NK8A 3Q00A 1SQOA 1CBWB 2H5DA 3ATMA 3RXKA 1T7CA 2ZTZA 2AH4X 2BXUH 1LQDB 3TH2H 1WTHD 3LDXH 4TWYA 3VPKA 3OYPA 1VCPA 3A8BA 1CHOG 1VITH 1Y5BT 2Q6DA 3A7ZA 1TGBA 1GJAB 2OQ5A 1GCTC 2Y80A 3FP7E 5FBIA 2EI7A 1YKTA 2ASUB 3PV4A 2VNTA 1O3NA 2D8WA 2AERH 4B74A 2C90B 5ESTE 1NROH 1HYLA 2ZDVH 3UFAA 1AQ7A 5EXNA 2AFQB 1O2VA 1C2KA 1O3BA 2XNIA 2O8LA 3VFEA 3SNAA 1TNLA 2GCTB 3GICB 1TYNA 2FX6A 1BMLA 1IQJA 2QV1A 1XKBC 1DX5M 3BEUA 4Y76A 4K1EA 4I8KA 2Z9JA 3PLPA 1WOFA 2J95A 3RU4D 1C9PA 5LGOA 1ZTJA 3W95A 3SGQE 1GBAA 5C2ZA 1YLDA 1V2UT 1TPAE 1LKAA 1MBMA 4B71A 2EI6A 2ZFTA 1S84A 3K6ZA 1AE8H 3VGCB 1GMCG 3MYWA 1JBUH 2BLWA 3UR6A 4FUGA 3QWCH 4JYVH 4X1SU 1W0ZU 3UUZA 1O5FH 2BDAA 2OUAA 1EOJA 2BTCE 1V2MT 1TOCB 1C5ZB 3GCHB 1LO6A 3GYMA 3RU4T 1GHAG 1L1JA 3MNSA 2FX4A 1TFXA 1GJ6A 1MU6B 1MCVA 1FY8E 3MU0A 1GI4A 3K65B 1EPTC