1QRWA

Crystal structure of an alpha-lytic protease mutant with accelerated folding kinetics, r102h/g134s, ph 8
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCHSGRTTGYQCGTITAKNVTANYAEGAVRGLTQSNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALHPA-LYTIC PROTEASE
publication title A Genetic Screen That Targets Specifically the Folding Transition State of Alpha-Lytic Protease
rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase
total genus 60
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1999-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrwA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qrwA01
2R3YA 5TCAA 1NRRH 1SG8B 3PLBA 2QF3A 1TNIA 2WPLS 1CQQA 2VWOA 1FY1A 2FOFA 2BHGA 4X2WA 1ELAA 1LO6A 3H7TA 3SV8A 2Q6FA 5EW1H 1LMWB 4K3JA 3TGJE 1EB2A 3GY4A 3QTOH 4O3UA 1F0TA 4QT8C 4FU8A 1FNIA 1OX1A 2EI6A 1GCTC 1GBJA 2G5VA 1Y8TA 1Z1JA 4FUCA 2ZHEH 2BX4A 2FEQH 3UY9A 2BOKA 1QQUA 2A0QB 1CU1A 5DP3A 1MH0A 5EQSA 1TA6A 4GVUA 5T3HA 1TAWA 2PSXA 1DITH 5A8ZA 2V3OH 3KNXA 3ZVBA 1P12E 1JRTA 5F8TA 2GVFA 1TGCA 3RXAA 1H9LB 2B8OH 2ZIQH 1V2NT 3A7YA 1SL3A 2UUYA 1VGCB 4D9RA 3UOPA 2FOBA 2QIQA 4DW2U 4INHA 1ZGVA 4CREA 5CHAB 5GPIB 1A1RA 2VH0A 4XBDA 2FWWA 1MKWH 3MNBA 7GCHG 1DM4B 1KXCA 1AVWA 3UIRA 1W0ZU 4YT6H 1HAZB 4NWLA 1TQ7B 3A84A 3URCA 2GX4A 5GCHF 1PYTC 4AZ2B 1PFXC 6GCHG 1AZ8A 1BMMH 2OBOA 3VPKA 1PPZA 2H9HA 1CT2E 2QXJA 1GHXH 1IHTH 1MTNB 1OOKB 8GCHF 1P03A 5C5NA 3RC4A 2IPHA 1JRSA 2P3UB 2BYAX 1C1QA 4OS5A 5ABWA 2G55A 3VGCB 1MTSA 5GWZA 3F1SB 3QO6A 2Y5GA 5HGGA 3DUXH 4CH8B 2Z3CA 4ZHAA 5LPFA 5DP4A 1A0JA 1Y3WA 3RXCA 3MH4A 4U32A 1UK2A 2BD5A 4JYUH 1P0SH 1C4Y2 3ITIA 2VIQA 2ZKSA 1KTSB 1Z8IB 1O5AB 3V3MA 1GVZA 1RGQA 1QRXA 1KXBA 5C20A 3ZVCA 4BTIB 2SGFE 1BCUH 1N1LA 3RMOH 3UQOA 4JK5A 4AN7A 3F9FA 1V2VT 3S69A 3IG6B 1CO7E 1NT1A 1AE5A 1D6RA 4FUBA 3UNQA 4ABAA 3AAUA 1ETTH 1K9OE 3GDSA 3KIDU 1SQOA 2BZAA 1EJMA 1MQ5A 1QFKH 1KDQA 4CRBA 1O3KA 1QB6A 5LH8A 4HGCA 2XTTB 2P8OB 1FY4A 2QC2A 1BB0B 1GHBF 1INCA 3KCGH 1NM6A 2FOEA 2PSYA 3OY5U 1C1VH 1FN8A 1VITH 2EC9H 3M3SA 2G52A 4IN1A 1W8BH 1SGPE 1GBAA 4X1SU 3MFJA 3NK8A 1TPOA 1AIXH 1WTGH 1QB1A 4KP0A 2BQWB 1HPGA 1GDQA 4FVDA 1HIAB 2AS9A 2PFEA 4OS2A 2G00A 1YP9A 1O34A 1Z6EA 4U2WA 2GD4B 1HAIH 1BTWA 2XWBI 2VNTA 1SHHB 1MTUA 3P8OA 1VJ9U 5DPAA 1FY5A 2UUKB 1O38A 5J4QA 1J9CH 3K65B 2PTCE 1C5MD 2VU8E 3A86A 3PB1E 4DT7B 1Y3XA 2AIPA 4MVNA 2F9OA 4ABIA 1O3EA 1JMOH 2TPIZ 1EPTA 1ZHPA 2YNAA 3BG4C 1D9IA 3R0FA 1ZMNA 2THFB 1V2QT 1S0QA 1TNLA 1C5VA 2VWLA 1Y5UT 5A0CA 1T32A 3MHWU 5FX6A 2FOHA 4Y8ZA 1YPLH 2W3KA 3SUEA 1MU6B 1DSUA 3DFLA 4B2AA 3KN2A 1D3TB 2AGEX 2O8UA 1HLTH 2ZCKP 2ZFTA 3MH6A 3MU8A 3BEUA 2J2UA 1SGQE 3NKKA 1C9PA 4X8UH 4B2CA 1P2JA 2GCHF 1WQSA 2CV3A 1SGRE 3ZVGA 3Q76A 5BRRE 4GHTA 1AU8A 3E0PB 1TALA 3JZ1B 3K6YA 3CP7A 4ISLA 4X2VA 1SGFA 2J38A 4GUXA 4NA9H 4DVAU 3S7HB 1ARBA 5E2PA 5A0BA 2VIVA 4A5TS 3OSYA 4KGAA 3PV4A 3WY8A 1V2MT 2VIOA 4MLFB 2HWLB 4KTSA 3PMAB 3RLWH 3ZYEA 2DUCA 1IQHA 2FTMA 3BN9A 4WF8A 3ATKA 4RN6A 4WXVA 4XBCA 3O8CA 4JYTA 1SOTA 5C1XA 1P2KA 1O3IA 1UTOA 1ZJKA 2WPHS 4AOQA 2WUCA 1LQEA 1EAIA 2HPQH 2ZDVH 5E8EH 5C2ZA 5EQQA 3SGBE 2BMGB 3RXUA 4ZXYH 1KY9A 3BTFE 3Q3XA 4CRFA 2O8MA 1Y5AT 5C67A 1BA8B 3RU4E 1L1NA 3GCOA 1EATA 2FP7B 1GL1A 1QIXB 1F2SE 4YZUA 3BSQA 2RA0A 3EDXB 1K1JA 2ULLA 3UUZA 2PKSB 4I33A 4NA7A 2W5EA 1EOLA 1T8MA 3A80A 2A7CA 4YO9A 1KIGH 4D76A 2ZHWH 4ABJA 4AFZA 1F92A 1AO5A 4Q80A 3M7TA 2ALPA 1O0DH 2AFQB 1QBVH 3GYLB 2HNTC 2VB0A 1O2QA 5AVDA 1VJAU 1FIZA 2BM2A 3A83A 2Y82A 2PKAB 3ZV9A 1FDPA 4ABFA 4X8VH 2HNTE 1UCYH 1C2IA 2OC7A 3SV7A 4DG4A 3BTHE 3QLPH 1NY22 5C1YA 2Z94A 2F9VA 3MU5A 3OY6U 1OWJA 4Z0KA 5DP6A 3W94A 1EQ9A 2AIQA 1TRYA 3BTWE 1XUJA 2QF0A 1BTHH 1O3OA 4ABHA 1C5SA 3PMHB 1A3EH 1TPPA 4IS5A 2ZDAH 1GBHA 1EUFA 1SGCA 3GCNA 2R3UA 3SGQE 1ELBA 2WYGA 3HGPA 2C8XB 1CA8B 4WMFA 3V7TA 3Q3YA 2DE8A 1ELTA 2KAIA 1L0ZA 1O3NA 1SQTA 3MH5A 1SI5H 3EE0B 2XXLA 2GCTB 1GJ8B 1O2OA 1O5DH 3PO1B 1S6FA 1XXFA 2K1QA 2QYIA 4NSVA 1LHFH 1YBWA 1TE0A 5TCCA 1ELCA 2FLRH 4X0WU 1A5IA 1FPHH 4JZ1A 1UJ1A 1LKAA 4NZLA 3LC5A 4IC5A 4A1XA 1RRKA 3DD2H 4I32A 1RJXB 3TGKE 1DDJA 1TABE 3RXHA 1V6DA 3HKIB 1O3FA 3TGIE 3KQEA 4D7GA 4ZUHA 4CHAB 3NZIA 3QWCH 2ZGBH 2QN5T 2P59A 5LPRA 1SGTA 2W7UA 2BZ6H 3P8FA 2NU4E 1FMGA 4CRGA 2P3TB 1D3PB 1C5YB 3AAVA 3UTUH 2BVXH 3RXKA 3TK6A 4F4OC 2VIDA 1V2TT 1HGTH 3VB6A 2OBQA 4I8GA 1O2GH 2C90B 1P2NA 3MWIU 2QCYA 4BXWA 1FONA 4BAHB 1V2OT 1FAKH 1BMAA 2ANWA 2CHAB 4BOHA 1ESTA 1E36B 1SHYA 4J2YB 5EPYA 2Y7XA 1S6HA 3BV9B 1NN6A 1DPOA 2XBWA 2BQ7B 2QY0B 4ZXXH 3TPIZ 6ESTA 1BJVA 1X7AC 1YCPM 3SQEE 4Y7BA 3PMBB 3RMMH 4A6LA 2Q1JA 1CT0E 3B9FH 1O5CB 1P11E 1RIWB 3LONA 3HGNA 4D7FA 1TA2A 2HRVA 3I78A 1DWCH 3P95A 1V2WT 4YOGA 1RD3B 2Y80A 1C5UA 1O3AA 3MO9A 2A4OA 1BRUP 1BTXA 4NA8A 3EA7A 3ATLA 1GMHF 1O2XA 2IOTA 4MQAA 4I8JA 2Y81A 2O9QA 3SNBA 2CJIA 2P94A 2I6SA 4ABGA 3FZZA 2BD3A 1G2LA 4NFEA 3RMNH 1ESBA 3RXRA 5E0HA 1SGYE 3MNCA 3SZNA 4Y8YA 1KLIH 1GJCB 5FCRA 1GCTB 1G37A 2PWXA 4U01A 1LHCH 3F68H 1NFYA 3RXQA 1OXGA 2PKAA 3RP2A 1YGCH 1RTLA 3RU4D 4YT7H 2HALA 2O8LA 1O3JA 1LHDH 2C8ZB 7GCHF 3U98H 2ZU4A 1P02A 3KEEA 4B75A 1C1OA 3GCHC 2W3IA 3DHKH 1EJAA 1UVSH 8ESTE 2OC1A 1OPHB 4RKJB 1HAGE 3M37A 6GCHF 1GG6C 2ANMH 3M7UA 1QHRB 1GMDF 1ZSLA 1ZTKA 4X1PU 1DY9A 4FU9A 1F0RA 5EQRA 2O8WA 1TNKA 3SU4A 3M36A 2P95A 3L6PA 4U30A 2G5NA 1TMTH 4B76A 1SLXB 1MAXA 3VB5A 5DO4H 3A8AA 3LGVA 3E90B 1FAXA 2BTCE 3ZZ9A 2VIWA 6CHAC 1MBMA 1UTQA 1P01A 1GHAF 1Y3YA 1LPZB 2FTLE 1T31A 3U8TH 3NXPA 4NSYA 3UOUA 1ZMJA 1UO6A 3E91A 1BHXF 5F8XA 3HPTB 2OCVB 4XFQA 2CMYA 3EQ0H 4INKA 4CR9A 1IOEA 1SR5C 1K21H 1XX9A 1UVUH 1EZSC 3SOSA 4UFGH 1YPMH 3A88A 4Y6DA 1WQVH 1GI6A 3SNEA 3A87A 1FY3A 3RXTA 2UWPA 1C1TA 3STJA 3S9CA 1YC0A 1NFWA 3GCTG 1G3DA 2IN2A 2ZO3H 4MNWA 1K1IA 4B74A 1O2VA 3KF2A 2SGDE 1C2EA 2Y6TA 5ETXA 1TQ0B 1Q31A 2XYAA 5JBBS 3BIUH 1GBFA 3UR6A 1L1JA 3VXFH 1BDAA 1GBMA 1MBQA 1IQMA 2A5KA 2GMTC 3UREA 1GBTA 4A1VA 1ZPBA 1O39A 5GJ4B 1FXYA 1AQ7A 1IHSH 2ZF0H 4NWKA 1T4UH 3OX7U 3D62A 1GBBA 3M5OA 1HDTH 2G4UA 1GWAA 3TK5A 1IQGA 2WV5A 3MU4A 4NGAH 2F9BH 5DK1A 1YPHC 3TJNA 3ATIA 1FI8A 3QX5H 4Y8XA 1GMCG 5J4SA 3IITA 1CHGA 3SO3A 3SU3A 1IQJA 4DGJA 2SGPE 1ELFA 1XUHA 2BD7A 2EEKA 1UTJA 1Y59T 4Z6AH 3S0NA 1IQLA 1YCPK 2Y5HA 4ZHLU 3M5NA 1XM1A 2XNIA 2BDBA 1EOJA 1ABIH 2QXIA 3P92A 2STBE 2ZFRH 1CBWC 4AG1A 1Z1IA 2YOLA 4INLA 5LGOA 1J15A 3RXEA 1AVGH 2FODA 1TLDA 1N6XA 1TPSA 3OU0A 5F8ZA 1GGDC 2H9TH 2FM2A 1NRPH 1AVXA 1O2PA 2PTNA 4ISNA 4BAQB 3TH4H 1XMNB 3GYMA 1GVLA 1LTOA 1PQ8A 3TJOA 1Y5BT 5L6NH 2G4TA 4X2XA 2WINI 1C1RA 3BF6H 1QNJA 2ZPQA 3P6ZB 3RC6A 4Y10E 1T8NA 1A2CH 3SV9A 1HUTH 6LPRA 1AGJA 2LPRA 1C2KA 3LGTA 3F9EA 3BEIB 4XDEA 3L33A 1ZYOA 1XUKA 3KQDA 3TU7H 5GXPA 2BDYA 1NRQH 2OP9A 1G36A 3SUDA 4D9QA 1GI5A 3MYWA 4A7IB 3S9BA 3D23A 4AFQA 5HM2A 1FIWA 1K1MA 1O3HA 4Q7XA 2FI4E 4IMQA 1ZR0A 1Y3VA 2BDGA 1A4WH 1P2QA 4ZKRU 2VGCB 4TWYA 1GJ6A 1AKSB 1P09A 1WAYB 3MH7A 2ZI2H 2SGAA 1THPB 5K7RA 1OP8A 2HPPH 4LZ1H 4X2YA 1CE5A 1XVOA 4TPIZ 1UTPA 1GBLA 1Z8GA 3QK1A 3T2NA 3QGJA 2UUFB 3E6PH 4BAMB 1S81A 5FBEA 4BANB 4A92A 1PPEE 1MZDA 1RXPA 2RG3A 1QL9A 2A32A 4UDWH 2TGDA 3O8BA 2ODQA 1GHYH 1AY6H 3SNCA 1FLEE 3RXPA 2A2XH 1LVYA 3GOVB 4VGCB 4YTAA 2B0FA 3FANA 2UWLA 2AMQA 1D3QB 3GY3A 3SUGA 1F5RA 1CHOG 5JB9S 2J92A 1TMUH 2BVSH 1BBRE 2WUBA 1NO9H 2GV7A 5AFZH 3B8JA 4OS4A 5FPTA 1SFQB 1BJUA 3K2UA 1YLDA 1KXFA 3DT0H 4MPUA 2BY8X 1UTNA 2R2MB 1EZUC 3V12A 3MI4A 1QA0A 2EI8A 1BTUA 2ZP0H 1B5GH 1HYLA 1CA0B 1AB9B 2A45B 1WU1A 3BTME 2ZECA 1O31A 3UWIA 1L4DA 1TPAE 3SUFA 3T26A 2W7SA 1TIOA 1SLWB 2BQ6B 2J9NA 3NCLA 5ESTE 1ARCA 1KTTB 4K8YA 4K1TA 4YLUA 1EPTC 2F83A 4UFEH 1ZZZA 1BITA 5BPEA 3MO6A 2FX4A 1EAWA 1ZMLA 3A89A 2Z9IA 4UEHH 1KXEA 1K2I1 1C2FA 1ZTJA 2FLBH 1HAHH 1W10U 2A4QA 5EXLA 2JKHA 5A8XA 4X1QU 4Y0ZE 2VH6A 1ELGA 1HCGA 2ZFQH 1LDTT 5JBTA 1AWHB 1O2ZA 2C93B 5CHAC 2GTBA 4F49A 4ABEA 4H4FA 1MCVA 2ANYA 3P70B 1ZRKA 4SGAE 5JBCS 1W7GH 2FS9A 4MPVA 2ZPRA 4MPWA 5GDSH 4X6MA 1HAVB 2V6NA 4IMZA 2FS8A 4NFFA 2ZU3A 1P8VC 3SW2B 1H1BA 1KXDA 2CN0H 5C3NA 1P04A 3DA9B 4TWWA 1THSH 1BTZA 2WV4A 4CR5A 1O5FH 1O2KA 5JDUB 1E37B 2NU3E 2VWMA 4JK6A 4K1SA 1P9UA 1P05A 2G81E 2ZGJA 1BTPA 2XBVA 4IW4E 2A2QH 4FXGH 1MZAA 1P06A 1E0FD 1QJ7B 4FUEA 3VGCC 1SGEE 1BZXE 4CBNA 2SNWA 3UNRA 2JH6D 1KYNA 2A7JA 2VVCA 5I25A 1J8AA 1O2TA 3E0NB 1IQNA 2ZU5A 5GCHG 3SNDA 3VB3A 2LNCA 1TWXB 5A2MH 4X8SH 2D26C 3A81A 4Y79A 3RM2H 4FUJA 2BD2A 1AFEH 3PROA 2QA9E 3SHCH 8GCHG 1HXEH 1OYQA 1TX6A 1V2UT 4AFUA 5A8YA 3W95A 1TNJA 1TOCB 2XC4A 4B73A 3SHAH 7LPRA 2ZWLH 1C1NA 2R9PA 4AFSA 4YLQH 1ZTLA 1XVMA 1EXFA 2P16A 4MNVA 1UVTH 3LH1A 2FMJA 1PYTD 1YPGH 5E2OA 3BTKE 3ZV8A 5LPEA 3LDXH 1SMFE 1GJDB 1LPKB 5T6FA 4NIWA 3UWJH 1DFPA 3AW0A 1UHBB 2P8OC 2TGPZ 1PJPA 1ZPZA 3U1JB 2AGGX 3ENSB 1FY8E 1OYTH 1T8LA 1DE7H 4WMDA 2ZDKA 2XC5A 2J4IA 1TMBH 3BG8A 2OC0A 1ZHRA 2EI7A 2ZFSA 1ANCA 4O97A 1K1OA 4X1NU 1ANDA 1HAXB 3MNSA 3UPEA 9ESTA 1LKBA 1U6QA 2ZPSA 4K2YA 5C5OA 1W14U 1DLKB 3GY2A 3MMGA 1YKTA 1GHBG 4MG3A 1F7ZA 3CS7A 1HIAA 4XSKU 1ZLRA 8KME2 2AGIX 1YLCA 1W0YH 3U1IB 1C4V2 1SOZA 2R0LA 2ZFFH 3U8RH 5FCKA 1VCWA 1T4VH 1NC6A 3S7KB 1GJ4H 5EGMA 1PPFE 2ZC9H 4UFDH 1FV9A 1O3GA 2Z9LA 4Y7AA 3ZZ7A 3BTEE 1LCYA 2SGEE 4DCDA 4H6TA 5JPMH 1OKXA 3M5MA 1H4WA 1MTWA 2BB4A 2W26A 4D8NA 1GJBB 1DUEA 1O2IA 1SVPA 2STAE 2VVUA 2GT8A 3LT3A 2ZGCA 1GI2A 1TRNA 4FU7A 1J16A 3SNAA 1C2LA 4FUIA 3ELAH 1QJ1B 1WSSH 1IQFA 3FP7E 3RUOA 4I31A 3GCHB 2VWNA 3RC5A 4NIXA 1CVWH 4X8TH 1HAOH 1C5XB 1ETSH 1GG6B 2XRCA 4R8TB 3V0XA 1C1UH 1NRNH 1W11U 1OP2A 1C1PA 3TITA 4E06H 1DVAH 1GI9B 3NWUA 2GZ9A 2QAAA 7KMEH 2ZU2A 4OGYA 2ZCHP 3A7WA 4R0IA 5E0JA 2WPIS 4ZMAH 1N8OC 6CHAB 1G32B 1HRTH 1A46H 1O3CA 1DXWA 1AUTC 1SLUB 2O8TA 3M7QA 1OWDA 3GY8A 4E7NA 3GCTF 3RXFA 3URDA 1C1WH 1ACBE 2ZTZA 5EU8A 1YPJH 1XKBC 4GSOA 1MKXK 4CH2B 4LOYH 4DY7B 2GCHG 1BMLA 4UE7H 1QBOA 2XBXA 2ZEBA 1GJAB 1TGNA 1QY6A 1C2HA 1G2MA 3S9AA 1GJ5H 1AZZA 5A0AE 2RA3A 1QL8A 4ZAEA 1IQIA 5FPSA 2BD4A 1P3CA 1NU7B 5HYOA 4OS6A 2V3HH 2A31A 2WPJS 4Y71A 2SGQE 2P93A 1E38B 3SJ8A 3GISB 1Z6JH 3KGPA 3ZYDA 3ESTA 2AMPA 4CRAA 1GMCF 1NFUA 1NRSH 3GICB 4YM9A 1ZSKA 2XCFA 1AN1E 3ZVFA 1TX8A 1NFXA 1P2MA 1SLVB 3SI4H 2GT7A 1T7CA 3SORA 4ZKSU 2GMTB 1AFQB 2ZDMA 1AE8H 4LXBH 4YOJA 7ESTE 1O2RA 3F9HA 1ELEE 2PUQH 3SBKA 1GCDA 2TRMA 3F9GA 1EP5A 1P2OA 1OS8A 3A7ZA 5AHGH 2ALVA 3K9XB 1ZRBA 1A3BH 3A7TA 2ZDLA 2F9PA 3MU1A 1O3PB 2C8WB 1UTMA 1UCYE 4XBBA 3PMJA 1GHWH 2UWOA 2FX6A 2Z9JA 1S0RA 3SV6A 5EOKA 1WUNH 5AF9H 1GI7B 4Q7ZA 4HFPB 1D4PB 1E34B 1EX3A 1DT2A 1DXPA 3LIWA 4NIVA 1AI8H 1S84A 1DX5M 2AH4X 1BRAA 5PTPA 1V2RT 3O8RA 2QXHA 2F9NA 2F3CE 3A8CA 2FI3E 1GGDB 1AD8H 1Z71A 1LVOA 4IN2A 4JYVH 4AYVB 4MTBA 1A5HA 2ASUB 2ZQ2A 3TH3H 2GCTC 3GY7A 2NU0E 1K1PA 2H5DA 1OWKA 3P8GA 2BY7X 2QGRA 5DP8A 3PO1C 1G3BA 4Y0YE 1O2SA 1L4ZA 2HGTH 1OWIA 4UONA 5JBAS 5JYIA 3VXEH 4H42U 4HZHA 3TJVA 2DE9A 1NS3A 3KQCA 3QTVH 1XUGA 1ID5H 2BLWA 1K1NA 2BXUH 1HXFH 2BVRH 4WVPE 1GBIA 2B7DH 4WMEA 2XWAA 3G01A 1F0SA 3RXLA 4I8HA 3ZZAA 3AASA 3UFAA 2H9EH 3I29A 2FO9A 1PQ5A 4UFFH 3SV2H 4O3TA 4WWYA 1PPBH 2D2DA 1O2HA 2ZHQH 3A7XA 2GV6A 1F0UA 4I8KA 3Q00A 2OD3B 5FHTA 3M5LA 4FUFA 1GL0E 1B0EA 1EB1H 4K5ZA 3ZZDA 3EGKH 4FVBA 4ZKOU 3QDZB 3CS0A 1MAYA 2FZZA 1ZJDA 4NIYA 3RXJA 2FDAA 1A0HB 1NROH 3U9AH 1AHTH 5A09A 5IDKA 3SJIA 3LH3A 5AFYH 2RCEA 1ZOMA 3E3TA 3HATH 1OWHA 1BBRK 2CHAC 1UK4A 1ZHMA 1C4U2 2WPKS 1QRZA 1KDQB 2PV9B 4ESTE 4GAWA 1Z8RA 3VFEA 2GZ7A 1CGHA 1GVKB 1SBWA 8LPRA 1P57B 1BUIA 4LZ4B 1XKAC 1M9UA 3LU9B 2RDLA 4ISIH 1KLJH 2VJ1A 3QN7A 1O3DA 3ZZ5A 2GGVB 3M35A 1BMNH 3FAOA 2ZHFH 3R3GB 1UK3A 1EAUA 1YPHE 1YYY1 2F9UA 1HJ8A 2OQUA 2ODPA 1CT4E 4X6NA 2FPZA 2B9LA 3D49H 1C5TA 4K1EA 2PHBA 1HBTH 4H6SB 3M3TA 5TJXA 1HJAC 5DP7A 2Y7ZA 2OLGA 1YCPH 2G8TA 1NESE 5H4IB 1FN6A 2FOCA 1EPTB 2JETC 1KLTA 3SU1A 4IGDA 2HLCA 4ZROA 1BRCE 5EG4A 1S82A 3ODDA 1GMHG 4BTUB 5DJ7A 4RSPA 1MKWK 1YPEH 3BG4B 3GY6A 4BXSA 4SGBE 5DKMA 3UNSA 3C1KA 2C3SA 2ZU1A 4TYDA 1DWBH 4NCYA 1O2UA 4AX9H 3NUMA 5T6DA 1NTPA 4CRDA 3T5FH 1LQDB 1MMJN 3PTNA 1O35A 1HJ9A 2J94A 3LOXA 4WXIA 3RXVA 2PW8H 1QB9A 2XCNA 1P9SA 5F03A 3EAJA 1GI4A 1O36A 1SGFG 3EA9A 4DJZB 1MTVA 2BDIA 1XUFA 5GIBA 1V3XA 4IBLH 1W12U 1QL7A 3GDUA 3KL6A 4GCHG 1GMDG 3LPRA 4KTUA 5FBIA 1GBKA 2VINA 3I77A 1WOFA 2Z6BD 3LKWA 5HMAA 5IYTA 1IQKA 3T29A 1L2EA 4GLYA 1EAXA 5G4BA 4MNYA 4MDSA 3RM0H 3V13A 1NPMA 3RXSA 5EW2H 1Z8JB 1TGBA 3SI3H 3E8LA 1GI8B 2JH0D 3TNTA 1A61H 3SJKA 3TNSA 1GHAG 2BD8A 2R0KA 2Z9KA 1DS2E 3D65E 5DP9A 1C5OH 1TGTA 3RLYH 2WYJA 1LVMA 4Y11E 1P10A 1C2GA 5C1UA 3SQHE 4KTCA 1BHXB 1ETRH 1BIOA 2V35A 3SU6A 1FQ3A 5SGAE 1XXDA 1HNEE 1NZQH 1O33A 2ZZUH 1GHZA 1V2KT 4AG2A 1TGSZ 4KELA 1C5NH 1G30B 2GKVE 1ELVA 1TB6H 5F6MA 1WCZA 4HTCH 3SU0A 4ASHA 2C4FH 4LK4A 4DIIH 1NU9A 1D6WA 1V2JT 3RXBA 1VITG 2QV1A 4AGKA 1ZSJA 2AMDA 1WTHD 3LC3A 2OUAA 1DSTA 3RMLH 3PLKA 2TIOA 1QR3E 3Q77A 4K8BA 4FUDA 3TIUA 1QQ4A 4AORA 1K28D 4JCNA 1OWEA 2TGAA 4X6PA 2TBSA 5I46H 2BY5X 1JIRA 3TLOA 1SSXA 1TONA 4MNXA 3BTGE 2BY6X 4BAKB 1CSOE 1FPCH 3O8DA 4K69A 1W13U 4M7GA 2SFAA 2ZG0H 2FYQA 4NZQA 4ABBA 2ZGXH 3L3TA 2OC8A 3LGUA 1H8DH 2SNVA 3FP8E 4MPXA 1VGCC 2IJOB 2BDAA 3E16B 3P17H 1H8IH 3HKJB 3Q3KA 1ORFA 5E0GA 3MTYA 5JB8S 1P3EA 2FOMB 4THNH 4B1TA 3SU2A 3QZRA 2KAIB 2TGTA 1HAPH 2A5IA 1TBZH 4ISHH 1LVBA 3LGYA 3A8DA 1A7SA 4BTTB 2J95A 1YM0A 2R2WU 3BTQE 2B5TB 2ZHDA 3QGNB 4GPGA 4PROA 4I8LA 3F6UH 1A5GH 5L2ZH 2ESTE 1J17T 1MTNC 1OP0A 1PQAA 2BY9X 1ESAA 2M5TA 2FESH 3SGAE 2GDEH 2CXVA 2HVXA 3A85A 3MO3A 2VGCC 4IC6A 3T25A 1C2JA 4ZHMU 1EZXC 2BXTH 1JOUB 3SJOA 3OTJE 4KKDA 2XW9A 2Y5FA 3TVJB 4FUHA 1HAYB 1N8OB 2A4RA 4JZIA 2EA3A 3HK6B 1AKSA 1BT7A 2H1UA 4OS1A 1SFIA 1UVPA 1N6YA 3KHVA 2H6MA 4YESB 3RXGA 2PUXB 1RFNA 1D3DB 5HM9A 2Z9GA 1ZGIA 1KSNA 4VGCC 3K6ZA 1O5EH 4X6OA 2AEIH 1BOQA 2F91A 5B6OA 1UTLM 2G51A 1DICA 1AUJA 2BLVA 1GDUA 4HI3A 3KQBA 1DANH 1TBRH 1ABJH 3UQVA 3GY5A 4JMYA 1C2MA 1UMAH 2Q6GA 2ODYB 3SN8A 1GBCA 2QXGA 2FI5E 2VVVA 1CA0C 1AB9C 1B7XB 1SQAA 3PLPA 3T62A 5HXFA 2ILNA 5FPYA 3T28A 5T6GA 1QGFA 1OSSA 4Q7YA 2GP9B 2XBYA 2FYRA 3MNXA 1UCYK 1H9IE 1MD8A 3LGWA 4BAOB 1GPZA 1C5WB 1BTYA 4GHQA 1EP6A 3QUMP 3TH2H 1J14A 1GI1A 4Q2KA 1O3MA 3EYDA 1DUAA 2A4GA 3A82A 2PGQB 1WV7H 1C1SA 3UR9A 4DURA 5L2YH 2NWNA 3A7VA 1JXPA 5CE1A 4B2BA 1GDNA 1VR1H 1Q2WA 1WBGB 2GDDA 3SJ9A 2V0BA 1K1LA 2FXRA 1O32A 3IWMA 4WH8A 1O3BA 2FOAA 5DP5A 1LPGB 4AB9A 4UD9H 1DOJA 1E35B 4J1YA 4NG9H 4CBOA 3BIVH 1RTKA 4Y76A 2C8YB 1V2ST 5DG6A 1C2DA 4AYYB 3A8BA 2BDHA 2Q6DA 3VB4A 1PQ7A 1TNHA 1IQEA 5L30H 1GI3A 4TY6A 1JBUH 4X1RU 3HK3B 1HAVA 1O2YA 1TX7A 1VCQA 3LJOA 4TPYA 1BQYA 4DIHH 1CGIE 1O2LA 1F5KU 3M3VA 3AW1A 1DY8A 3C27B 1HV7A 1V2PT 4XOJA 3QZQA 1DWEH 1ANBA 3MU0A 3T27A 2AERH 2A5AA 1G3CA 4JZFH 1K22H 3EA8A 3OYPA 1C5PA 1G9IE 2YNBA 1UVOA 1VCPA 2FOGA 4CRCA 4O9VA 4O03A 1TBQH 1DWDH 2D8WA 9LPRA 2Z3DA 1QBNA 1FJSA 1YPKH 4ISOA 3VEQB 1THRH 1KXAA 3VB7A 1MKXH 2HOBA 5EXNA 1W2KH 1PPGE 1GBEA 1C5RA 2ZTXA 1QA7A 4OGXA 4BNRA 1F5LA 3RXIA 3PTBA 3U69H 3ZVDA 5FXLA 1GBDA 1EKBB 1MCTA 2PKSC 3P8NA 1O5GH 1ANEA 2PLXA 2ANKH 1PPHE 3E1XB 2BLQA 3MOCA 4WH6A 5ESBA 1S5SA 1C9TA 1RTFB 2BX3A 2P3FH 5K0HA 2BLOA 4AGJA 1GI0A 3FP6E 1TRMA 1UHBA 1O2MA 2CGAA 2A7HA 5FX5A 1QCPA 1HB0B 1SGDE 2ZNKH 3ZZBA 1MUEB 3N7OA 2CF8H 2J34A 2UUJB 3FVFB 1W7XH 4E05H 1S83A 1P2IA 2ZTYA 1ZPCA 1O5BB 1TOMH 3ZZ6A 2BDCA 3H7OA 2VIPA 1BRBE 3STIA 3B23B 2AYWA 2H2ZA 3PWBA 1CBWB 3H5CB 1GJ9B 1Q3XA 2XC0A 4WY3A 4K60A 1ELDE 2A1DB 3ZVAA 2H5CA 3PWCA 1SPJA 1Z7KA 1HJAB 1L1GA 1MQ6A 2ZDNA 2ZGHA 3ODFA 4JZEH 5EXMA 1O3LA 3LGIA 3GDVA 1EASA 4ZKNU 4A1TA 1QJ6B 3PM3A 2JETB 5EODA 3SU5A 4AB8A 2ZCLP 2NU2E 2OTVA 1SGNE 3ZVEA 1O2JA 1AMHA 1QTFA 1DLEA 1O2NA 3BEFB 1SGIB 4I7YH 1C5LH 3BTTE 1SB1H 1O37A 4GCHF 3RU4T 2WPMS 1B0FA 1JIMA 2JH5D 2ZA5A 3AVZA 1O2WA 5FAHA 1LHEH 2OXSA 2Z7FE 2BOHB 5CMXH 1PPCE 2NU1E 3RDZA 1VZQH 3BTDE 1MU8B 2ZQ1A 1GHVH 4ZH8A 3LJJA 4CHAC 4OS7A 4WJG2 3ZZ8A 3TK9A 1T8OA 1FUJA 1S85A 4FUGA 1EZQA 1GJ7B 1FZZA 2OQ5A 4RKOB 1YF4A 3ZZ3A 3RXOA 2FIRH 1G3EA 2CF9H 5EPNA 1V2LT 1TNGA 1RS0A 1TFXA 3ZZ4A 1C1MA 2GZ8A 1LHGH 1TYNA 1W3CA 2ZFPH 2PR3A 3CENA 1CHOF 1MD7A 1JWTA 3PYHA 1SC8U 1H9HE 3FFGA 2Z3EA 1O30A 1C5QA 1EJNA 1WYKA 1XUIA 1QURH 4YOIA 4TY7A 3FZDA 3TJUA 3ZZCA 3NPSA 2OINA 1C5ZB 1UTKA 3ATWA 1CGJE 1QRWA 1AWFH 4JZDH 3JZ2B 1IAUA 2D1JA 3U8OH 1Y3UA 3DFJA 1VITF 2BD9A 4B71A 2I6QA 4ABDA 1BBRH 3RXDA 1RIWC 3M61U 1HFDA 3RXMA 1A0LA 2HNTF 3ATMA 4DOQA 4XE4A 4E7RG 2PGBB 5DGJA 1AFQC
chains in the Genus database with same CATH superfamily
2R3YA 5CHBA 5TCAA 1NRRH 1SG8B 3PLBA 2QF3A 1TNIA 2WPLS 1CQQA 2VWOA 2AHME 1FY1A 2FOFA 2BHGA 4X2WA 4P00A 1ELAA 1LO6A 3H7TA 3SV8A 2Q6FA 5EW1H 3U28C 1LMWB 4K3JA 3TGJE 1EB2A 3GY4A 3QTOH 4O3UA 1F0TA 4QT8C 4FU8A 1FNIA 1OX1A 2EI6A 1GCTC 2L74A 1GBJA 2G5VA 1Y8TA 1Z1JA 4FUCA 2ZHEH 2BX4A 2FEQH 3UY9A 2BOKA 1QQUA 2A0QB 1CU1A 5DP3A 1MH0A 5EQSA 1TA6A 4GVUA 5T3HA 1TAWA 2PSXA 1DITH 5A8ZA 2V3OH 3KNXA 3ZVBA 1P12E 1JRTA 5F8TA 2GVFA 1TGCA 3RXAA 1H9LB 2B8OH 2ZIQH 1V2NT 3A7YA 1SL3A 2UUYA 1VGCB 4D9RA 3UOPA 2FOBA 2QIQA 4DW2U 4INHA 1ZGVA 4CREA 5CHAB 5GPIB 1A1RA 2VH0A 4XBDA 2FWWA 1MKWH 3MNBA 7GCHG 1DM4B 1KXCA 2GJGA 1AVWA 3UIRA 1W0ZU 4YT6H 1HAZB 4NWLA 1TQ7B 3A84A 3URCA 2GX4A 5GCHF 1PYTC 4AZ2B 1PFXC 6GCHG 1AZ8A 1BMMH 2OBOA 3VPKA 1PPZA 2H9HA 1CT2E 2QXJA 1GHXH 1IHTH 1MTNB 1OOKB 8GCHF 1P03A 5C5NA 2JIZD 3RC4A 2IPHA 1JRSA 2P3UB 2BYAX 1C1QA 4OS5A 5ABWA 2G55A 3VGCB 1MTSA 2LP6A 5GWZA 3F1SB 3QO6A 2Y5GA 5HGGA 3DUXH 4CH8B 2Z3CA 4ZHAA 5LPFA 5DP4A 1A0JA 1Y3WA 3RXCA 3MH4A 4U32A 1UK2A 2BD5A 4JYUH 1P0SH 1C4Y2 3ITIA 2VIQA 2ZKSA 1KTSB 4ASUD 1Z8IB 1W0JD 1O5AB 3V3MA 1GVZA 1RGQA 1QRXA 1KXBA 5C20A 3ZVCA 4BTIB 2SGFE 1BCUH 1N1LA 3RMOH 3UQOA 1VKYA 4JK5A 4AN7A 3F9FA 1V2VT 3S69A 3IG6B 1CO7E 1NT1A 1AE5A 1D6RA 4FUBA 3UNQA 4ABAA 3AAUA 1ETTH 1K9OE 3GDSA 3KIDU 1SQOA 2BZAA 1EJMA 1MQ5A 1QFKH 1KDQA 4CRBA 1YY3A 1O3KA 1QB6A 5LH8A 4HGCA 2XTTB 2P8OB 1FY4A 2QC2A 1BB0B 1GHBF 1INCA 3KCGH 1NM6A 2FOEA 2PSYA 3OY5U 3SYJA 1C1VH 1FN8A 1VITH 2EC9H 3M3SA 2G52A 4IN1A 1W8BH 1SGPE 1GBAA 4X1SU 3MFJA 3NK8A 1TPOA 1AIXH 1WTGH 1QB1A 4KP0A 2BQWB 1HPGA 1GDQA 4FVDA 1HIAB 2AS9A 2PFEA 4OS2A 5C0UA 2G00A 1YP9A 4F48B 1O34A 1Z6EA 4U2WA 2GD4B 5HIZA 1HAIH 1BTWA 2XWBI 2VNTA 1SHHB 1MTUA 3P8OA 2QF5A 1VJ9U 5DPAA 1FY5A 2UUKB 1O38A 5J4QA 1J9CH 3K65B 4DT4A 2PTCE 1C5MD 2VU8E 3A86A 3PB1E 4DT7B 1Y3XA 2AIPA 4MVNA 2F9OA 4ABIA 1O3EA 1JMOH 2TPIZ 1EPTA 1ZHPA 2YNAA 3BG4C 1D9IA 3R0FA 1ZMNA 2THFB 1V2QT 1S0QA 1TNLA 1C5VA 2VWLA 1Y5UT 5A0CA 3F2FA 1T32A 3MHWU 5FX6A 2FOHA 4Y8ZA 1YPLH 2W3KA 3SUEA 3NRLA 5KECA 1MU6B 2KCAA 1DSUA 3DFLA 4B2AA 3KN2A 4M9FA 1D3TB 2AGEX 2O8UA 1HLTH 2ZCKP 2ZFTA 3MH6A 3MU8A 3BEUA 2WV9A 2J2UA 1SGQE 3NKKA 1C9PA 4X8UH 4B2CA 1P2JA 1YLNA 2GCHF 1WQSA 2W6ID 2CV3A 1SGRE 3ZVGA 3Q76A 5BRRE 4GHTA 1AU8A 3E0PB 1TALA 3JZ1B 3K6YA 3CP7A 4ISLA 4X2VA 1SGFA 2J38A 4GUXA 4NA9H 4DVAU 3S7HB 1ARBA 5E2PA 5GNDA 5A0BA 2VIVA 5T1VA 4A5TS 3OSYA 4KGAA 3PV4A 3WY8A 1V2MT 2VIOA 4MLFB 2HWLB 4KTSA 3PMAB 3RLWH 3ZYEA 2DUCA 1IQHA 2FTMA 3BN9A 4WF8A 3ATKA 4RN6A 4WXVA 4XBCA 3O8CA 4JYTA 1SOTA 5C1XA 1P2KA 2LELA 1O3IA 2XOKD 1UTOA 1ZJKA 2WPHS 4AOQA 2WUCA 1LQEA 1EAIA 2HPQH 2ZDVH 5E8EH 5C2ZA 5EQQA 3SGBE 2BMGB 3RXUA 4ZXYH 1KY9A 3BTFE 3Q3XA 4CRFA 2O8MA 1Y5AT 5C67A 1BA8B 3RU4E 1L1NA 3GCOA 1EATA 2FP7B 1GL1A 1QIXB 1F2SE 4YZUA 3FN8A 3BSQA 2RA0A 3EDXB 1K1JA 2ULLA 3UUZA 2PKSB 4I33A 4NA7A 2W5EA 1EOLA 1T8MA 3A80A 2A7CA 4YO9A 1KIGH 4D76A 2ZHWH 4ABJA 4AFZA 1F92A 1AO5A 4Q80A 3M7TA 2ALPA 1O0DH 2AFQB 1QBVH 3GYLB 2HNTC 2VB0A 1O2QA 4P02A 2L6OA 5AVDA 1VJAU 1FIZA 2BM2A 3A83A 4RT0A 4OM9A 2Y82A 2PKAB 3ZV9A 3UAIC 1FDPA 3N7DA 4ABFA 4X8VH 2HNTE 1UCYH 1C2IA 2OC7A 3SV7A 4DG4A 3BTHE 3QLPH 1NY22 5C1YA 2Z94A 2F9VA 3MU5A 3OY6U 1OWJA 4Z0KA 5B6LA 5DP6A 3W94A 1EQ9A 2AIQA 4FOUC 1TRYA 3BTWE 1XUJA 2QF0A 1BTHH 1O3OA 4ABHA 1C5SA 3PMHB 1A3EH 1TPPA 4IS5A 2ZDAH 1GBHA 1EUFA 1SGCA 3GCNA 2R3UA 3SGQE 1ELBA 2WYGA 3HGPA 2C8XB 1CA8B 3PRBA 4WMFA 3V7TA 1NBME 3Q3YA 2DE8A 1ELTA 2KAIA 1L0ZA 1O3NA 1SQTA 3MH5A 1SI5H 3EE0B 2XXLA 2GCTB 1GJ8B 1O2OA 1O5DH 2KM0A 3PO1B 1S6FA 1XXFA 2KCOA 2K1QA 2QYIA 4NSVA 1LHFH 1YBWA 1TE0A 5TCCA 1ELCA 1UW7A 2FLRH 4X0WU 1A5IA 1FPHH 4JZ1A 1UJ1A 1LKAA 4NZLA 3LC5A 4IC5A 3DSOA 4A1XA 1RRKA 3DD2H 4FETA 2HLDD 4I32A 1RJXB 3TGKE 1DDJA 1TABE 3RXHA 5FL7D 1V6DA 3HKIB 1O3FA 3TGIE 3KQEA 4D7GA 4ZUHA 4CHAB 3NZIA 3QWCH 2ZGBH 2QN5T 2P59A 5LPRA 1SGTA 2W7UA 2BZ6H 3P8FA 2NU4E 1FMGA 4CRGA 2P3TB 1D3PB 1C5YB 3AAVA 3UTUH 2BVXH 5EJ1A 3RXKA 1SQRA 3TK6A 4F4OC 2VIDA 1V2TT 1HGTH 3VB6A 2OBQA 4I8GA 1O2GH 2C90B 1P2NA 2KR7A 3MWIU 2QCYA 4BXWA 1FONA 4BAHB 1V2OT 1FAKH 5KEDA 1BMAA 2ANWA 2CHAB 4BOHA 2KFWA 1ESTA 1E36B 1SHYA 4J2YB 5IK2D 5EPYA 2Y7XA 1S6HA 3BV9B 1NN6A 1DPOA 2XBWA 2BQ7B 2QY0B 4ZXXH 3TPIZ 6ESTA 1BJVA 1X7AC 1YCPM 3SQEE 4Y7BA 3PMBB 3RMMH 4A6LA 2Q1JA 1CT0E 3B9FH 1O5CB 1P11E 1RIWB 3LONA 1E1RD 3HGNA 4D7FA 1TA2A 2HRVA 3I78A 1DWCH 3P95A 1V2WT 4YOGA 1RD3B 2Y80A 1C5UA 1O3AA 3MO9A 3AK5A 2A4OA 1BRUP 1BTXA 5HKKD 4NA8A 3EA7A 3ATLA 1GMHF 1O2XA 2IOTA 4MQAA 4I8JA 2Y81A 2O9QA 3SNBA 2CJIA 2P94A 2I6SA 4ABGA 3FZZA 2BD3A 1G2LA 4NFEA 3RMNH 1ESBA 3RXRA 5E0HA 1SGYE 3MNCA 3SZNA 4Y8YA 1KLIH 1GJCB 5FCRA 1GCTB 1G37A 2PWXA 4U01A 1LHCH 3F68H 1NFYA 3RXQA 1OXGA 2PKAA 3RP2A 1YGCH 1RTLA 3RU4D 4YT7H 2HALA 2O8LA 1O3JA 1LHDH 2C8ZB 7GCHF 3U98H 2ZU4A 1P02A 3KEEA 4B75A 1C1OA 3GCHC 2W3IA 3DHKH 1EJAA 1UVSH 8ESTE 2OC1A 1OPHB 4RKJB 1HAGE 3M37A 6GCHF 1GG6C 2ANMH 3M7UA 5HIYA 1QHRB 1GMDF 1ZSLA 1ZTKA 4X1PU 1DY9A 4FU9A 1F0RA 5EQRA 2O8WA 1TNKA 3SU4A 3M36A 2P95A 3L6PA 4U30A 2G5NA 1TMTH 4B76A 1SLXB 1MAXA 3VB5A 5DO4H 3A8AA 3LGVA 3E90B 1FAXA 2BTCE 3ZZ9A 2VIWA 6CHAC 1MBMA 2XNDD 1UTQA 1P01A 1GHAF 1Y3YA 1LPZB 2FTLE 1T31A 3U8TH 3NXPA 4NSYA 3UOUA 1ZMJA 1UO6A 3E91A 1BHXF 5F8XA 3HPTB 2OCVB 4XFQA 2CMYA 3EQ0H 4INKA 4CR9A 1IOEA 1SR5C 1K21H 1XX9A 2WSSD 1UVUH 1EZSC 3SOSA 4YXWD 4UFGH 1YPMH 3A88A 4Y6DA 1WQVH 1NBMD 1GI6A 3SNEA 3A87A 1FY3A 3RXTA 2UWPA 1C1TA 3STJA 3S9CA 1YC0A 1NFWA 3GCTG 1G3DA 2IN2A 2ZO3H 4MNWA 1K1IA 1KMHB 4B74A 1O2VA 3KF2A 2SGDE 1C2EA 3KQ5A 2Y6TA 5ETXA 1TQ0B 5EIYA 1Q31A 2XYAA 5JBBS 3BIUH 1GBFA 3UR6A 1L1JA 3VXFH 1BDAA 1GBMA 3F0OA 1MBQA 1IQMA 2A5KA 2GMTC 3UREA 1GBTA 4A1VA 1ZPBA 1O39A 5GJ4B 5F53A 1E79D 1FXYA 1AQ7A 1IHSH 2ZF0H 4NWKA 1T4UH 3OX7U 3D62A 1GBBA 3M5OA 1HDTH 2G4UA 1GWAA 3F2HA 4Q63A 1IQGA 2WV5A 3MU4A 3TK5A 4NGAH 1COWD 2F9BH 1YPHC 5DK1A 3ATIA 1FI8A 3QX5H 3TJNA 4Y8XA 1GMCG 5J4SA 3IITA 1CHGA 3SO3A 3SU3A 1IQJA 4DGJA 2SGPE 1ELFA 1XUHA 2BD7A 2EEKA 1UTJA 3EE7A 1Y59T 4Z6AH 3S0NA 1IQLA 1YCPK 2Y5HA 4ZHLU 3M5NA 2J97A 1XM1A 2XNIA 2BDBA 1EOJA 1ABIH 2QXIA 3P92A 1H8ED 2STBE 2ZFRH 1CBWC 4AG1A 1Z1IA 2YOLA 4INLA 5LGOA 1J15A 3RXEA 1AVGH 2FODA 1TLDA 1N6XA 1TPSA 3OU0A 5F8ZA 1GGDC 2H9TH 2FM2A 1NRPH 1AVXA 1O2PA 2PTNA 4ISNA 4BAQB 3TH4H 1XMNB 3GYMA 1GVLA 1LTOA 1PQ8A 3TJOA 3N99A 1Y5BT 5L6NH 2G4TA 4X2XA 2WINI 1C1RA 3BF6H 1QNJA 2ZPQA 3P6ZB 3RC6A 4Y10E 1T8NA 1A2CH 3SV9A 1HUTH 6LPRA 1AGJA 2LPRA 1C2KA 3LGTA 3F9EA 3BEIB 4XDEA 3L33A 1ZYOA 1XUKA 3KQDA 3TU7H 5GXPA 2BDYA 1NRQH 2OP9A 1G36A 3SUDA 4D9QA 1GI5A 3MYWA 4A7IB 3S9BA 2OK5A 3D23A 4AFQA 5HM2A 1FIWA 1K1MA 1O3HA 4Q7XA 2FI4E 4IMQA 1ZR0A 1Y3VA 2BDGA 1A4WH 1P2QA 4ZKRU 2VGCB 4TWYA 1GJ6A 1AKSB 4AC9A 1P09A 1WAYB 3MH7A 2ZI2H 2SGAA 1THPB 5K7RA 1OP8A 2HPPH 4LZ1H 4X2YA 1CE5A 1XVOA 4TPIZ 1UTPA 1GBLA 1Z8GA 3QK1A 3T2NA 3QGJA 2UUFB 3E6PH 4BAMB 1S81A 5FBEA 4BANB 4A92A 1PPEE 1MZDA 1RXPA 2RG3A 1QL9A 2A32A 4UDWH 2TGDA 3O8BA 2ODQA 1GHYH 1AY6H 3SNCA 1FLEE 3RXPA 2A2XH 1LVYA 3GOVB 4VGCB 4YTAA 2B0FA 3FANA 2UWLA 2AMQA 1D3QB 3GY3A 3SUGA 1F5RA 1CHOG 5JB9S 2J92A 1TMUH 2BVSH 1BBRE 2WUBA 1NO9H 2GV7A 5AFZH 3B8JA 4OS4A 5FPTA 1SFQB 1BJUA 3K2UA 1YLDA 1KXFA 3DT0H 4MPUA 2BY8X 1UTNA 2R2MB 1EZUC 3V12A 3MI4A 1QA0A 2EI8A 1BTUA 2ZP0H 1B5GH 1HYLA 1CA0B 1AB9B 2A45B 1OHHD 1WU1A 3BTME 2ZECA 1O31A 3UWIA 1L4DA 1TPAE 3SUFA 3T26A 2W7SA 1TIOA 1SLWB 2BQ6B 2J9NA 3NCLA 5ESTE 1ARCA 1KTTB 4K8YA 4K1TA 4YLUA 1EPTC 2F83A 3FOAA 4UFEH 1ZZZA 1BITA 5BPEA 3MO6A 2FX4A 1EAWA 1ZMLA 3A89A 2Z9IA 4UEHH 1KXEA 1K2I1 1C2FA 1ZTJA 2IPQX 2FLBH 1HAHH 1W10U 2A4QA 5EXLA 2JKHA 5A8XA 4X1QU 4Y0ZE 2VH6A 1ELGA 1HCGA 2ZFQH 1LDTT 1QZ8A 5JBTA 1AWHB 1O2ZA 2C93B 5CHAC 2GTBA 4F49A 4ABEA 4H4FA 1MCVA 2ANYA 3P70B 1ZRKA 4SGAE 5JBCS 1W7GH 2FS9A 4MPVA 2ZPRA 4MPWA 5GDSH 4X6MA 1HAVB 2V6NA 4IMZA 2FS8A 4NFFA 2ZU3A 1P8VC 3SW2B 1H1BA 1KXDA 3F2GA 2CN0H 5C3NA 1P04A 3DA9B 4TWWA 1THSH 1BTZA 2WV4A 4CR5A 1O5FH 1O2KA 5JDUB 1E37B 2NU3E 2VWMA 4JK6A 4K1SA 1P9UA 1P05A 2G81E 2ZGJA 1BTPA 2XBVA 4IW4E 4I86A 2A2QH 4FXGH 1MZAA 1P06A 1E0FD 1QJ7B 4FUEA 3SZEA 3VGCC 1SGEE 1BZXE 2EY4C 4CBNA 2SNWA 2K0QA 3UNRA 2JH6D 1KYNA 2A7JA 2VVCA 5I25A 1J8AA 1O2TA 3E0NB 1IQNA 2ZU5A 5GCHG 3SNDA 3VB3A 2LNCA 1TWXB 5A2MH 4X8SH 2D26C 3A81A 4XD7D 4Y79A 3RM2H 4FUJA 2BD2A 1AFEH 3DSPA 3PROA 2QA9E 3SHCH 8GCHG 1HXEH 1OYQA 1TX6A 1V2UT 4AFUA 5A8YA 3W95A 1TNJA 1TOCB 2XC4A 4B73A 3SHAH 7LPRA 2ZWLH 1C1NA 2R9PA 4AFSA 4YLQH 1ZTLA 1FX0B 1XVMA 1EXFA 2P16A 4MNVA 1UVTH 3LH1A 2FMJA 1PYTD 1YPGH 5E2OA 3BTKE 3ZV8A 5LPEA 3LDXH 1SMFE 1GJDB 1LPKB 5T6FA 4NIWA 3UWJH 1DFPA 3AW0A 1UHBB 2P8OC 2TGPZ 1PJPA 1ZPZA 4Z1MD 3U1JB 2AGGX 3ENSB 1FY8E 1OYTH 1T8LA 1DE7H 4WMDA 2ZDKA 2XC5A 2J4IA 1TMBH 3BG8A 2OC0A 1ZHRA 2EI7A 2ZFSA 1ANCA 4O97A 3N7EA 1K1OA 4X1NU 1ANDA 1HAXB 3MNSA 3UPEA 9ESTA 1LKBA 1U6QA 2ZPSA 4K2YA 5C5OA 1W14U 1DLKB 3GY2A 3MMGA 1YKTA 1GHBG 4MG3A 1F7ZA 3CS7A 1HIAA 4XSKU 1ZLRA 8KME2 2AGIX 1YLCA 1W0YH 3U1IB 1C4V2 1SOZA 2R0LA 3DSGA 2ZFFH 2J98B 3U8RH 5FCKA 1VCWA 1T4VH 1NC6A 3S7KB 1GJ4H 5EGMA 1PPFE 2ZC9H 4UFDH 1FV9A 1O3GA 5C94A 2Z9LA 4Y7AA 3ZZ7A 3BTEE 1LCYA 2SGEE 4DCDA 4H6TA 5JPMH 1OKXA 3M5MA 1H4WA 1MTWA 2BB4A 2W26A 4D8NA 1GJBB 1DUEA 1O2IA 1SVPA 2STAE 2VVUA 2GT8A 3LT3A 2ZGCA 1GI2A 1TRNA 4FU7A 1J16A 3SNAA 3KYFA 1C2LA 4FUIA 3ELAH 1QJ1B 1WSSH 1IQFA 3FP7E 3RUOA 4I31A 1WXRA 3GCHB 2VWNA 3RC5A 4NIXA 1CVWH 4X8TH 1HAOH 1C5XB 1ETSH 1GG6B 2XRCA 4R8TB 3V0XA 1C1UH 3PV2A 1NRNH 1W11U 1OP2A 1C1PA 3TITA 4E06H 1DVAH 1GI9B 3NWUA 2GZ9A 2QAAA 7KMEH 2ZU2A 4OGYA 2ZCHP 3A7WA 4R0IA 3WWFA 4HG6A 5E0JA 2WPIS 4ZMAH 1N8OC 6CHAB 1G32B 1HRTH 1A46H 1O3CA 1DXWA 1AUTC 1SLUB 2O8TA 3M7QA 5DSFA 1OWDA 3GY8A 4E7NA 3GCTF 3RXFA 3URDA 1C1WH 1ACBE 2ZTZA 5EU8A 1YPJH 1XKBC 4GSOA 1MKXK 4CH2B 4LOYH 4DY7B 2GCHG 1BMLA 4UE7H 1QBOA 2XBXA 2ZEBA 1GJAB 1TGNA 1QY6A 1C2HA 1G2MA 4ACBA 3S9AA 1GJ5H 1AZZA 5A0AE 2RA3A 4B6FA 1QL8A 4ZAEA 1IQIA 5FPSA 2BD4A 1P3CA 1NU7B 5HYOA 4OS6A 2V3HH 2A31A 3OAAD 2WPJS 4Y71A 2SGQE 2P93A 1E38B 3SJ8A 3GISB 1Z6JH 3KGPA 3ZYDA 3ESTA 2AMPA 4CRAA 1GMCF 1NFUA 1NRSH 3GICB 4YM9A 1ZSKA 2XCFA 1AN1E 3ZVFA 1TX8A 1NFXA 1P2MA 1SLVB 3SI4H 2GT7A 1T7CA 3SORA 4ZKSU 2GMTB 1AFQB 2ZDMA 2W6JD 4B6EA 1AE8H 4LXBH 4YOJA 7ESTE 1O2RA 3F9HA 1ELEE 2EQNA 2PUQH 3SBKA 1GCDA 4ZCNA 2TRMA 3F9GA 3W1EA 1EP5A 1P2OA 1OS8A 3A7ZA 5AHGH 2ALVA 3K9XB 1ZRBA 1A3BH 3A7TA 4TT3D 2ZDLA 2F9PA 3MU1A 1O3PB 2C8WB 1UTMA 1UCYE 4XBBA 3PMJA 1GHWH 2UWOA 2FX6A 2Z9JA 1S0RA 3SV6A 5EOKA 1WUNH 5AF9H 3OE7D 4RT1A 1GI7B 4Q7ZA 4HFPB 1D4PB 1E34B 1EX3A 1DT2A 1DXPA 3LIWA 4NIVA 1AI8H 1S84A 1DX5M 2AH4X 1BRAA 5PTPA 1V2RT 3O8RA 2QXHA 2F9NA 2F3CE 3A8CA 2FI3E 1GGDB 1AD8H 1Z71A 1LVOA 4IN2A 4JYVH 4AYVB 4MTBA 1A5HA 2K8IA 2ASUB 2ZQ2A 3TH3H 2GCTC 3GY7A 2NU0E 1K1PA 2H5DA 1OWKA 3P8GA 2BY7X 2QGRA 5DP8A 3PO1C 1G3BA 4Y0YE 1O2SA 1L4ZA 2HGTH 1OWIA 4UONA 5KGOA 5JBAS 5JYIA 3VXEH 4H42U 2IJD1 4HZHA 3TJVA 2DE9A 1NS3A 3KQCA 3QTVH 1XUGA 1ID5H 2BLWA 1K1NA 2BXUH 1HXFH 2BVRH 4WVPE 1GBIA 2B7DH 4WMEA 2XWAA 3G01A 1F0SA 3RXLA 1WDIA 4I8HA 3ZZAA 3AASA 3UFAA 2H9EH 3I29A 2FO9A 1PQ5A 4UFFH 3SV2H 4O3TA 4WWYA 1PPBH 2D2DA 3OEHD 1O2HA 2ZHQH 3A7XA 2GV6A 1F0UA 4I8KA 3Q00A 2OD3B 5FHTA 3M5LA 5CDFE 4FUFA 1GL0E 1B0EA 1EB1H 4K5ZA 3ZZDA 3EGKH 4FVBA 4ZKOU 3QDZB 3CS0A 1MAYA 2FZZA 1ZJDA 4NIYA 3RXJA 2FDAA 1A0HB 1NROH 3U9AH 1AHTH 5A09A 5IDKA 3SJIA 3FO8D 3LH3A 5AFYH 2V3MA 2RCEA 1ZOMA 3E3TA 3HATH 1OWHA 1BBRK 2CHAC 1UK4A 1ZHMA 1C4U2 2WPKS 1QRZA 1KDQB 2PV9B 4ESTE 3DCLA 4GAWA 1Z8RA 3VFEA 2GZ7A 1CGHA 1GVKB 3GS9A 1SBWA 8LPRA 1P57B 1BUIA 1S6LA 4LZ4B 1XKAC 1M9UA 1E1QD 3LU9B 2RDLA 4ISIH 1KLJH 2VJ1A 3QN7A 1O3DA 3ZZ5A 2GGVB 2KCPA 3M35A 1BMNH 3FAOA 2ZHFH 4ACAA 3R3GB 1UK3A 1EAUA 1YPHE 1YYY1 2F9UA 3H09A 1HJ8A 2OQUA 2ODPA 1CT4E 4X6NA 2FPZA 2B9LA 3D49H 1C5TA 4K1EA 2PHBA 1HBTH 4H6SB 3M3TA 5TJXA 1HJAC 5DP7A 2Y7ZA 2OLGA 1YCPH 2G8TA 2HVYB 1NESE 5H4IB 5C17A 1FN6A 2FOCA 1EPTB 2JETC 1KLTA 3PV5A 3SU1A 1H8HD 4IGDA 2HLCA 4ZROA 1BRCE 5EG4A 1S82A 3ODDA 1GMHG 4BTUB 5DJ7A 4RSPA 1MKWK 1YPEH 3BG4B 3GY6A 4BXSA 4SGBE 5DKMA 3UNSA 3C1KA 2C3SA 2ZU1A 4TYDA 3MQKC 1DWBH 4NCYA 1O2UA 4AX9H 3NUMA 5T6DA 1NTPA 3UB0A 4CRDA 3T5FH 1LQDB 1MMJN 3PTNA 1O35A 1HJ9A 2J94A 3LOXA 4WXIA 3RXVA 2PW8H 1QB9A 2XCNA 1P9SA 5F03A 3EAJA 1GI4A 1O36A 1SGFG 3EA9A 4DJZB 1MTVA 2BDIA 1XUFA 5GIBA 1V3XA 4IBLH 1W12U 1QL7A 3GDUA 3KL6A 4GCHG 5DN6D 1GMDG 3LPRA 4KTUA 5FBIA 1GBKA 2VINA 3I77A 1WOFA 2Z6BD 3LKWA 5HMAA 5IYTA 1IQKA 3T29A 1L2EA 4GLYA 2YMSC 1EAXA 5G4BA 4MNYA 4MDSA 3RM0H 3V13A 1NPMA 3RXSA 5EW2H 1Z8JB 1TGBA 3SI3H 3E8LA 1GI8B 2JH0D 3TNTA 1A61H 3SJKA 3TNSA 1GHAG 2BD8A 2R0KA 2Z9KA 1DS2E 3D65E 5DP9A 1C5OH 1TGTA 3RLYH 2WYJA 1LVMA 4Y11E 1P10A 1C2GA 2WHXA 5C1UA 3SQHE 4KTCA 1BHXB 1ETRH 1BIOA 2V35A 3SU6A 1FQ3A 5SGAE 1XXDA 1HNEE 1NZQH 1O33A 2ZZUH 1GHZA 1V2KT 4AG2A 1TGSZ 4KELA 1C5NH 1G30B 2GKVE 1ELVA 1TB6H 5F6MA 1WCZA 4HTCH 3SU0A 4ASHA 2C4FH 4LK4A 4DIIH 1NU9A 1D6WA 1V2JT 3RXBA 1VITG 2RFKC 2QV1A 4AGKA 1ZSJA 2AMDA 1WTHD 2JJ2D 3LC3A 3KYGA 2OUAA 1DSTA 3RMLH 3PLKA 2TIOA 1QR3E 3Q77A 4K8BA 4FUDA 3TIUA 1QQ4A 4AORA 1K28D 4JCNA 1OWEA 2TGAA 4X6PA 2TBSA 5I46H 2BY5X 2CK3D 1JIRA 3TLOA 1SSXA 1TONA 4MNXA 3BTGE 2BY6X 4BAKB 1CSOE 1FPCH 3O8DA 4K69A 1W13U 4M7GA 2SFAA 2ZG0H 2FYQA 4NZQA 4ABBA 2ZGXH 3L3TA 2OC8A 3LGUA 1H8DH 2SNVA 3FP8E 4MPXA 1VGCC 2IJOB 2BDAA 3E16B 3P17H 1H8IH 3HKJB 3Q3KA 1ORFA 5E0GA 3MTYA 5JB8S 1P3EA 2FOMB 4THNH 4B1TA 3SU2A 3QZRA 2KAIB 2TGTA 1HAPH 2A5IA 1TBZH 4ISHH 1LVBA 3LGYA 3A8DA 1A7SA 4BTTB 2J95A 1YM0A 2R2WU 4RI0A 3BTQE 2B5TB 2ZHDA 3QGNB 4GPGA 4PROA 4I8LA 3F6UH 1A5GH 5L2ZH 2ESTE 1J17T 1MTNC 1OP0A 1PQAA 2BY9X 1ESAA 2M5TA 2FESH 3SGAE 2GDEH 2CXVA 2HVXA 3A85A 3MO3A 2VGCC 4IC6A 3T25A 1C2JA 4ZHMU 1EZXC 2BXTH 1JOUB 3SJOA 3OTJE 4KKDA 2XW9A 2Y5FA 4Q4LA 3TVJB 4FUHA 1HAYB 2WPDD 1N8OB 2A4RA 4JZIA 2EA3A 3HK6B 1AKSA 1BT7A 2H1UA 1W0KD 4OS1A 1SFIA 1UVPA 1N6YA 3KHVA 2H6MA 4YESB 1K0HA 3RXGA 2PUXB 1RFNA 4TSFD 3OEED 1D3DB 5HM9A 2Z9GA 1ZGIA 1KSNA 4VGCC 3K6ZA 1O5EH 2PP6A 4X6OA 2AEIH 1BOQA 2F91A 5B6OA 1UTLM 2G51A 1DICA 1AUJA 2BLVA 1GDUA 4HI3A 3KQBA 1DANH 1TBRH 1ABJH 3UQVA 3GY5A 4JMYA 1C2MA 1UMAH 2Q6GA 2ODYB 3SN8A 1GBCA 2J5UA 2QXGA 2FI5E 4F55A 2VVVA 1CA0C 1AB9C 1B7XB 1SQAA 3PLPA 3T62A 5HXFA 2ILNA 5FPYA 3T28A 2QE7D 5T6GA 1QGFA 1OSSA 4Q7YA 2GP9B 2XBYA 2FYRA 3MNXA 1UCYK 1H9IE 1MD8A 3LGWA 4BAOB 1GPZA 1C5WB 2YMSD 1BTYA 4GHQA 1EP6A 3QUMP 3TH2H 1J14A 1GI1A 4Q2KA 1O3MA 3EYDA 1DUAA 2A4GA 3A82A 2PGQB 1WV7H 1C1SA 3UR9A 4DURA 5L2YH 2NWNA 3A7VA 1JXPA 5CE1A 3F0PA 4XRNA 1GDNA 4B2BA 1VR1H 1Q2WA 1WBGB 3VG8A 2GDDA 3SJ9A 2V0BA 1K1LA 2M2AA 2FXRA 1O32A 3IWMA 4WH8A 1O3BA 2FOAA 2QF4A 5DP5A 1LPGB 4AB9A 4UD9H 1DOJA 1E35B 4J1YA 4NG9H 4CBOA 3BIVH 1RTKA 4Y76A 2C8YB 1V2ST 5DG6A 1C2DA 2RDEA 4AYYB 3A8BA 2BDHA 3WW7A 2Q6DA 3VB4A 1PQ7A 1TNHA 1IQEA 5L30H 1GI3A 4TY6A 1JBUH 4X1RU 3HK3B 1HAVA 1O2YA 1TX7A 1VCQA 3LJOA 4TPYA 1BQYA 4DIHH 1CGIE 1O2LA 1F5KU 3M3VA 3AW1A 1DY8A 3C27B 3FKSD 1HV7A 1V2PT 5C0TA 4XOJA 3QZQA 1DWEH 1BMFD 1ANBA 3MU0A 3T27A 2AERH 2A5AA 1G3CA 4JZFH 1K22H 3EA8A 3OYPA 1C5PA 1G9IE 2YNBA 1UVOA 1VCPA 2FOGA 4CRCA 4O9VA 4O03A 1TBQH 1DWDH 2D8WA 2KZ4A 2Z3DA 9LPRA 1QBNA 1FJSA 1YPKH 4ISOA 3VEQB 1EFRD 1THRH 1KXAA 3VB7A 2KX4A 1MKXH 2HOBA 5EXNA 1W2KH 1PPGE 1GBEA 3WWBA 1C5RA 2ZTXA 1QA7A 4OGXA 4BNRA 2JDID 1F5LA 3RXIA 3PTBA 3U69H 3ZVDA 5FXLA 1GBDA 1EKBB 1MCTA 3F3BA 2PKSC 3P8NA 1O5GH 1ANEA 2PLXA 2ANKH 1PPHE 3E1XB 2BLQA 3MOCA 4WH6A 5ESBA 1S5SA 1C9TA 1RTFB 2BX3A 2P3FH 5K0HA 2BLOA 4AGJA 1GI0A 3FP6E 1TRMA 1UHBA 1O2MA 2CGAA 2A7HA 5FX5A 1QCPA 1HB0B 1SGDE 2ZNKH 3ZZBA 1MUEB 3N7OA 2CF8H 2J34A 2UUJB 3FVFB 2JJ1D 1W7XH 4E05H 1S83A 1P2IA 2ZTYA 5EJLA 1ZPCA 1O5BB 1TOMH 3ZZ6A 2BDCA 3H7OA 2VIPA 1BRBE 3STIA 3B23B 2AYWA 2H2ZA 3PWBA 1CBWB 3H5CB 1GJ9B 1Q3XA 2XC0A 4WY3A 4K60A 1ELDE 2A1DB 3ZVAA 2H5CA 3PWCA 1SPJA 1Z7KA 1HJAB 1L1GA 1MQ6A 2ZDNA 2ZGHA 3ODFA 4JZEH 5EXMA 1O3LA 3LGIA 3GDVA 1EASA 4ZKNU 2J98A 4A1TA 1QJ6B 3PM3A 2JETB 5EODA 3SU5A 4AB8A 2ZCLP 2NU2E 2OTVA 1SGNE 3ZVEA 1O2JA 1AMHA 1MABB 1QTFA 1DLEA 1O2NA 3BEFB 1SGIB 4I7YH 1C5LH 1YWUA 3BTTE 1SB1H 2F4LA 1O37A 4GCHF 3RU4T 2WPMS 1B0FA 1JIMA 2JH5D 2ZA5A 3AVZA 1O2WA 5FAHA 1LHEH 2OXSA 2Z7FE 2BOHB 5CMXH 1PPCE 2NU1E 3RDZA 1VZQH 3BTDE 3OFND 1MU8B 3OTPA 2ZQ1A 1GHVH 3PRDA 3ZIAD 4ZH8A 3LJJA 4CHAC 4OS7A 4WJG2 3ZZ8A 3TK9A 1T8OA 1FUJA 1S85A 4FUGA 1EZQA 1GJ7B 1FZZA 2OQ5A 4RKOB 1YF4A 3ZZ3A 3RXOA 2FIRH 1G3EA 2CF9H 5EPNA 1V2LT 1TNGA 1RS0A 1TFXA 3ZZ4A 1C1MA 2GZ8A 1LHGH 1TYNA 1W3CA 2ZFPH 2PR3A 3CENA 2VBCA 1CHOF 1MD7A 1JWTA 3PYHA 1SC8U 1H9HE 3FFGA 2YMSB 2Z3EA 2KCYA 1O30A 1C5QA 1EJNA 1WYKA 1XUIA 1QURH 4YOIA 4TY7A 2WZQA 3FZDA 3TJUA 3ZZCA 3NPSA 2OINA 1C5ZB 1UTKA 3ATWA 1SKYE 1CGJE 1QRWA 1AWFH 4JZDH 2V7QD 3JZ2B 1IAUA 2D1JA 3U8OH 1Y3UA 3DFJA 1VITF 2BD9A 4B71A 2F43B 2I6QA 4ABDA 1BBRH 3CNRA 3RXDA 1RIWC 3M61U 1HFDA 3RXMA 1A0LA 2HNTF 3ATMA 4DOQA 4XE4A 5EJZA 4E7RG 2PGBB 5DGJA 1AFQC
chains in the Genus database with same CATH topology
2R3YA 5TCAA 1NRRH 1SG8B 3PLBA 2QF3A 1TNIA 2WPLS 1CQQA 2VWOA 1FY1A 2FOFA 2BHGA 4X2WA 1ELAA 1LO6A 3H7TA 3SV8A 2Q6FA 5EW1H 1LMWB 4K3JA 3TGJE 1EB2A 3GY4A 3QTOH 4O3UA 1F0TA 4QT8C 4FU8A 1FNIA 1OX1A 2EI6A 1GCTC 1GBJA 2G5VA 1Y8TA 1Z1JA 4FUCA 2ZHEH 2BX4A 2FEQH 3UY9A 2BOKA 1QQUA 2A0QB 1CU1A 5DP3A 1MH0A 5EQSA 1TA6A 4GVUA 5T3HA 1TAWA 2PSXA 1DITH 5A8ZA 2V3OH 3KNXA 3ZVBA 1P12E 1JRTA 5F8TA 2GVFA 1TGCA 3RXAA 1H9LB 2B8OH 2ZIQH 1V2NT 3A7YA 1SL3A 2UUYA 1VGCB 4D9RA 3UOPA 2FOBA 2QIQA 4DW2U 4INHA 1ZGVA 4CREA 5CHAB 5GPIB 1A1RA 2VH0A 4XBDA 2FWWA 1MKWH 3MNBA 7GCHG 1DM4B 1KXCA 1AVWA 3UIRA 1W0ZU 4YT6H 1HAZB 4NWLA 1TQ7B 3A84A 3URCA 2GX4A 5GCHF 1PYTC 4AZ2B 1PFXC 6GCHG 1AZ8A 1BMMH 2OBOA 3VPKA 1PPZA 2H9HA 1CT2E 2QXJA 1GHXH 1IHTH 1MTNB 1OOKB 8GCHF 1P03A 5C5NA 3RC4A 2IPHA 1JRSA 2P3UB 2BYAX 1C1QA 4OS5A 5ABWA 2G55A 3VGCB 1MTSA 5GWZA 3F1SB 3QO6A 2Y5GA 5HGGA 3DUXH 4CH8B 2Z3CA 4ZHAA 5LPFA 5DP4A 1A0JA 1Y3WA 3RXCA 3MH4A 4U32A 1UK2A 2BD5A 4JYUH 1P0SH 1C4Y2 3ITIA 2VIQA 2ZKSA 1KTSB 1Z8IB 1O5AB 3V3MA 1GVZA 1RGQA 1QRXA 1KXBA 5C20A 3ZVCA 4BTIB 2SGFE 1BCUH 1N1LA 3RMOH 3UQOA 4JK5A 4AN7A 3F9FA 1V2VT 3S69A 3IG6B 1CO7E 1NT1A 1AE5A 1D6RA 4FUBA 3UNQA 4ABAA 3AAUA 1ETTH 1K9OE 3GDSA 3KIDU 1SQOA 2BZAA 1EJMA 1MQ5A 1QFKH 1KDQA 4CRBA 1O3KA 1QB6A 5LH8A 4HGCA 2XTTB 2P8OB 1FY4A 2QC2A 1BB0B 1GHBF 1INCA 3KCGH 1NM6A 2FOEA 2PSYA 3OY5U 1C1VH 1FN8A 1VITH 2EC9H 3M3SA 2G52A 4IN1A 1W8BH 1SGPE 1GBAA 4X1SU 3MFJA 3NK8A 1TPOA 1AIXH 1WTGH 1QB1A 4KP0A 2BQWB 1HPGA 1GDQA 4FVDA 1HIAB 2AS9A 2PFEA 4OS2A 2G00A 1YP9A 1O34A 1Z6EA 4U2WA 2GD4B 1HAIH 1BTWA 2XWBI 2VNTA 1SHHB 1MTUA 3P8OA 1VJ9U 5DPAA 1FY5A 2UUKB 1O38A 5J4QA 1J9CH 3K65B 2PTCE 1C5MD 2VU8E 3A86A 3PB1E 4DT7B 1Y3XA 2AIPA 4MVNA 2F9OA 4ABIA 1O3EA 1JMOH 2TPIZ 1EPTA 1ZHPA 2YNAA 3BG4C 1D9IA 3R0FA 1ZMNA 2THFB 1V2QT 1S0QA 1TNLA 1C5VA 2VWLA 1Y5UT 5A0CA 1T32A 3MHWU 5FX6A 2FOHA 4Y8ZA 1YPLH 2W3KA 3SUEA 1MU6B 1DSUA 3DFLA 4B2AA 3KN2A 1D3TB 2AGEX 2O8UA 1HLTH 2ZCKP 2ZFTA 3MH6A 3MU8A 3BEUA 2J2UA 1SGQE 3NKKA 1C9PA 4X8UH 4B2CA 1P2JA 2GCHF 1WQSA 2CV3A 1SGRE 3ZVGA 3Q76A 5BRRE 4GHTA 1AU8A 3E0PB 1TALA 3JZ1B 3K6YA 3CP7A 4ISLA 4X2VA 1SGFA 2J38A 4GUXA 4NA9H 4DVAU 3S7HB 1ARBA 5E2PA 5A0BA 2VIVA 4A5TS 3OSYA 4KGAA 3PV4A 3WY8A 1V2MT 2VIOA 4MLFB 2HWLB 4KTSA 3PMAB 3RLWH 3ZYEA 2DUCA 1IQHA 2FTMA 3BN9A 4WF8A 3ATKA 4RN6A 4WXVA 4XBCA 3O8CA 4JYTA 1SOTA 5C1XA 1P2KA 1O3IA 1UTOA 1ZJKA 2WPHS 4AOQA 2WUCA 1LQEA 1EAIA 2HPQH 2ZDVH 5E8EH 5C2ZA 5EQQA 3SGBE 2BMGB 3RXUA 4ZXYH 1KY9A 3BTFE 3Q3XA 4CRFA 2O8MA 1Y5AT 5C67A 1BA8B 3RU4E 1L1NA 3GCOA 1EATA 2FP7B 1GL1A 1QIXB 1F2SE 4YZUA 3BSQA 2RA0A 3EDXB 1K1JA 2ULLA 3UUZA 2PKSB 4I33A 4NA7A 2W5EA 1EOLA 1T8MA 3A80A 2A7CA 4YO9A 1KIGH 4D76A 2ZHWH 4ABJA 4AFZA 1F92A 1AO5A 4Q80A 3M7TA 2ALPA 1O0DH 2AFQB 1QBVH 3GYLB 2HNTC 2VB0A 1O2QA 5AVDA 1VJAU 1FIZA 2BM2A 3A83A 2Y82A 2PKAB 3ZV9A 1FDPA 4ABFA 4X8VH 2HNTE 1UCYH 1C2IA 2OC7A 3SV7A 4DG4A 3BTHE 3QLPH 1NY22 5C1YA 2Z94A 2F9VA 3MU5A 3OY6U 1OWJA 4Z0KA 5DP6A 3W94A 1EQ9A 2AIQA 1TRYA 3BTWE 1XUJA 2QF0A 1BTHH 1O3OA 4ABHA 1C5SA 3PMHB 1A3EH 1TPPA 4IS5A 2ZDAH 1GBHA 1EUFA 1SGCA 3GCNA 2R3UA 3SGQE 1ELBA 2WYGA 3HGPA 2C8XB 1CA8B 4WMFA 3V7TA 3Q3YA 2DE8A 1ELTA 2KAIA 1L0ZA 1O3NA 1SQTA 3MH5A 1SI5H 3EE0B 2XXLA 2GCTB 1GJ8B 1O2OA 1O5DH 3PO1B 1S6FA 1XXFA 2K1QA 2QYIA 4NSVA 1LHFH 1YBWA 1TE0A 5TCCA 1ELCA 2FLRH 4X0WU 1A5IA 1FPHH 4JZ1A 1UJ1A 1LKAA 4NZLA 3LC5A 4IC5A 4A1XA 1RRKA 3DD2H 4I32A 1RJXB 3TGKE 1DDJA 1TABE 3RXHA 1V6DA 3HKIB 1O3FA 3TGIE 3KQEA 4D7GA 4ZUHA 4CHAB 3NZIA 3QWCH 2ZGBH 2QN5T 2P59A 5LPRA 1SGTA 2W7UA 2BZ6H 3P8FA 2NU4E 1FMGA 4CRGA 2P3TB 1D3PB 1C5YB 3AAVA 3UTUH 2BVXH 3RXKA 3TK6A 4F4OC 2VIDA 1V2TT 1HGTH 3VB6A 2OBQA 4I8GA 1O2GH 2C90B 1P2NA 3MWIU 2QCYA 4BXWA 1FONA 4BAHB 1V2OT 1FAKH 1BMAA 2ANWA 2CHAB 4BOHA 1ESTA 1E36B 1SHYA 4J2YB 5EPYA 2Y7XA 1S6HA 3BV9B 1NN6A 1DPOA 2XBWA 2BQ7B 2QY0B 4ZXXH 3TPIZ 6ESTA 1BJVA 1X7AC 1YCPM 3SQEE 4Y7BA 3PMBB 3RMMH 4A6LA 2Q1JA 1CT0E 3B9FH 1O5CB 1P11E 1RIWB 3LONA 3HGNA 4D7FA 1TA2A 2HRVA 3I78A 1DWCH 3P95A 1V2WT 4YOGA 1RD3B 2Y80A 1C5UA 1O3AA 3MO9A 2A4OA 1BRUP 1BTXA 4NA8A 3EA7A 3ATLA 1GMHF 1O2XA 2IOTA 4MQAA 4I8JA 2Y81A 2O9QA 3SNBA 2CJIA 2P94A 2I6SA 4ABGA 3FZZA 2BD3A 1G2LA 4NFEA 3RMNH 1ESBA 3RXRA 5E0HA 1SGYE 3MNCA 3SZNA 4Y8YA 1KLIH 1GJCB 5FCRA 1GCTB 1G37A 2PWXA 4U01A 1LHCH 3F68H 1NFYA 3RXQA 1OXGA 2PKAA 3RP2A 1YGCH 1RTLA 3RU4D 4YT7H 2HALA 2O8LA 1O3JA 1LHDH 2C8ZB 7GCHF 3U98H 2ZU4A 1P02A 3KEEA 4B75A 1C1OA 3GCHC 2W3IA 3DHKH 1EJAA 1UVSH 8ESTE 2OC1A 1OPHB 4RKJB 1HAGE 3M37A 6GCHF 1GG6C 2ANMH 3M7UA 1QHRB 1GMDF 1ZSLA 1ZTKA 4X1PU 1DY9A 4FU9A 1F0RA 5EQRA 2O8WA 1TNKA 3SU4A 3M36A 2P95A 3L6PA 4U30A 2G5NA 1TMTH 4B76A 1SLXB 1MAXA 3VB5A 5DO4H 3A8AA 3LGVA 3E90B 1FAXA 2BTCE 3ZZ9A 2VIWA 6CHAC 1MBMA 1UTQA 1P01A 1GHAF 1Y3YA 1LPZB 2FTLE 1T31A 3U8TH 3NXPA 4NSYA 3UOUA 1ZMJA 1UO6A 3E91A 1BHXF 5F8XA 3HPTB 2OCVB 4XFQA 2CMYA 3EQ0H 4INKA 4CR9A 1IOEA 1SR5C 1K21H 1XX9A 1UVUH 1EZSC 3SOSA 4UFGH 1YPMH 3A88A 4Y6DA 1WQVH 1GI6A 3SNEA 3A87A 1FY3A 3RXTA 2UWPA 1C1TA 3STJA 3S9CA 1YC0A 1NFWA 3GCTG 1G3DA 2IN2A 2ZO3H 4MNWA 1K1IA 4B74A 1O2VA 3KF2A 2SGDE 1C2EA 2Y6TA 5ETXA 1TQ0B 1Q31A 2XYAA 5JBBS 3BIUH 1GBFA 3UR6A 1L1JA 3VXFH 1BDAA 1GBMA 1MBQA 1IQMA 2A5KA 2GMTC 3UREA 1GBTA 4A1VA 1ZPBA 1O39A 5GJ4B 1FXYA 1AQ7A 1IHSH 2ZF0H 4NWKA 1T4UH 3OX7U 3D62A 1GBBA 3M5OA 1HDTH 2G4UA 1GWAA 3TK5A 1IQGA 2WV5A 3MU4A 4NGAH 2F9BH 5DK1A 1YPHC 3TJNA 3ATIA 1FI8A 3QX5H 4Y8XA 1GMCG 5J4SA 3IITA 1CHGA 3SO3A 3SU3A 1IQJA 4DGJA 2SGPE 1ELFA 1XUHA 2BD7A 2EEKA 1UTJA 1Y59T 4Z6AH 3S0NA 1IQLA 1YCPK 2Y5HA 4ZHLU 3M5NA 1XM1A 2XNIA 2BDBA 1EOJA 1ABIH 2QXIA 3P92A 2STBE 2ZFRH 1CBWC 4AG1A 1Z1IA 2YOLA 4INLA 5LGOA 1J15A 3RXEA 1AVGH 2FODA 1TLDA 1N6XA 1TPSA 3OU0A 5F8ZA 1GGDC 2H9TH 2FM2A 1NRPH 1AVXA 1O2PA 2PTNA 4ISNA 4BAQB 3TH4H 1XMNB 3GYMA 1GVLA 1LTOA 1PQ8A 3TJOA 1Y5BT 5L6NH 2G4TA 4X2XA 2WINI 1C1RA 3BF6H 1QNJA 2ZPQA 3P6ZB 3RC6A 4Y10E 1T8NA 1A2CH 3SV9A 1HUTH 6LPRA 1AGJA 2LPRA 1C2KA 3LGTA 3F9EA 3BEIB 4XDEA 3L33A 1ZYOA 1XUKA 3KQDA 3TU7H 5GXPA 2BDYA 1NRQH 2OP9A 1G36A 3SUDA 4D9QA 1GI5A 3MYWA 4A7IB 3S9BA 3D23A 4AFQA 5HM2A 1FIWA 1K1MA 1O3HA 4Q7XA 2FI4E 4IMQA 1ZR0A 1Y3VA 2BDGA 1A4WH 1P2QA 4ZKRU 2VGCB 4TWYA 1GJ6A 1AKSB 1P09A 1WAYB 3MH7A 2ZI2H 2SGAA 1THPB 5K7RA 1OP8A 2HPPH 4LZ1H 4X2YA 1CE5A 1XVOA 4TPIZ 1UTPA 1GBLA 1Z8GA 3QK1A 3T2NA 3QGJA 2UUFB 3E6PH 4BAMB 1S81A 5FBEA 4BANB 4A92A 1PPEE 1MZDA 1RXPA 2RG3A 1QL9A 2A32A 4UDWH 2TGDA 3O8BA 2ODQA 1GHYH 1AY6H 3SNCA 1FLEE 3RXPA 2A2XH 1LVYA 3GOVB 4VGCB 4YTAA 2B0FA 3FANA 2UWLA 2AMQA 1D3QB 3GY3A 3SUGA 1F5RA 1CHOG 5JB9S 2J92A 1TMUH 2BVSH 1BBRE 2WUBA 1NO9H 2GV7A 5AFZH 3B8JA 4OS4A 5FPTA 1SFQB 1BJUA 3K2UA 1YLDA 1KXFA 3DT0H 4MPUA 2BY8X 1UTNA 2R2MB 1EZUC 3V12A 3MI4A 1QA0A 2EI8A 1BTUA 2ZP0H 1B5GH 1HYLA 1CA0B 1AB9B 2A45B 1WU1A 3BTME 2ZECA 1O31A 3UWIA 1L4DA 1TPAE 3SUFA 3T26A 2W7SA 1TIOA 1SLWB 2BQ6B 2J9NA 3NCLA 5ESTE 1ARCA 1KTTB 4K8YA 4K1TA 4YLUA 1EPTC 2F83A 4UFEH 1ZZZA 1BITA 5BPEA 3MO6A 2FX4A 1EAWA 1ZMLA 3A89A 2Z9IA 4UEHH 1KXEA 1K2I1 1C2FA 1ZTJA 2FLBH 1HAHH 1W10U 2A4QA 5EXLA 2JKHA 5A8XA 4X1QU 4Y0ZE 2VH6A 1ELGA 1HCGA 2ZFQH 1LDTT 5JBTA 1AWHB 1O2ZA 2C93B 5CHAC 2GTBA 4F49A 4ABEA 4H4FA 1MCVA 2ANYA 3P70B 1ZRKA 4SGAE 5JBCS 1W7GH 2FS9A 4MPVA 2ZPRA 4MPWA 5GDSH 4X6MA 1HAVB 2V6NA 4IMZA 2FS8A 4NFFA 2ZU3A 1P8VC 3SW2B 1H1BA 1KXDA 2CN0H 5C3NA 1P04A 3DA9B 4TWWA 1THSH 1BTZA 2WV4A 4CR5A 1O5FH 1O2KA 5JDUB 1E37B 2NU3E 2VWMA 4JK6A 4K1SA 1P9UA 1P05A 2G81E 2ZGJA 1BTPA 2XBVA 4IW4E 2A2QH 4FXGH 1MZAA 1P06A 1E0FD 1QJ7B 4FUEA 3VGCC 1SGEE 1BZXE 4CBNA 2SNWA 3UNRA 2JH6D 1KYNA 2A7JA 2VVCA 5I25A 1J8AA 1O2TA 3E0NB 1IQNA 2ZU5A 5GCHG 3SNDA 3VB3A 2LNCA 1TWXB 5A2MH 4X8SH 2D26C 3A81A 4Y79A 3RM2H 4FUJA 2BD2A 1AFEH 3PROA 2QA9E 3SHCH 8GCHG 1HXEH 1OYQA 1TX6A 1V2UT 4AFUA 5A8YA 3W95A 1TNJA 1TOCB 2XC4A 4B73A 3SHAH 7LPRA 2ZWLH 1C1NA 2R9PA 4AFSA 4YLQH 1ZTLA 1XVMA 1EXFA 2P16A 4MNVA 1UVTH 3LH1A 2FMJA 1PYTD 1YPGH 5E2OA 3BTKE 3ZV8A 5LPEA 3LDXH 1SMFE 1GJDB 1LPKB 5T6FA 4NIWA 3UWJH 1DFPA 3AW0A 1UHBB