1QSGA

Crystal structure of enoyl reductase inhibition by triclosan
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis and mechanism of enoyl reductase inhibition by triclosan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
total genus 88
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1999-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1qsgA00
1V35A 1V6AA 3E18A 4CMBA 3DWFA 4R4JA 1DC4A 4BNTA 1H2HA 3HHPA 2Y1GA 1Y6JA 1I10A 1KVRA 1BDBA 2JKVA 1E6WA 2FSVA 5DBIA 1GPJA 3KRTA 5BNFA 4JROA 1K0UA 3NRCA 4FFRA 4TROA 3TL3A 4YACA 3N74A 1UP6A 1WDKA 3DZHA 2PNFA 3AM4A 4RGBA 3GN2A 5F1OA 4DA9A 4IQ0A 1IY8A 5I9MA 2EKPA 3U4CA 1CDOA 4KMSA 3OMLA 2JAHA 1JQBA 4W99A 4GX5A 3PPIA 4OOEA 2FZWA 2YHIB 2RH8A 3Q2KA 2JHGA 3ZWAA 1I2BA 4OSOA 3K30A 4D3FA 3AUUA 3ROKA 3ZWVA 1LJ8A 2QZZA 1J0XO 4B8WA 3TRIA 3K96A 4ZQEA 2I67A 4DC0A 1T1SA 3AUTA 3RIHA 3TJRA 1DC6A 1P44A 4LSWA 4II3A 5CHEA 2NSDA 4XWYA 5DBFA 5H81A 4U6QA 1ADBA 3QRWA 1E7WA 4PVDA 1RM0A 2HDHA 5AYVA 5KJ6A 1Y9EA 4ALJA 1Z75A 4D3DA 2BMAA 4RF4A 3JQ8A 4L73A 3S2GA 4RPJA 1O5IA 1DFGA 1HE4A 4A26A 5KVSA 1NWCA 3ZCXA 4CJXA 4IJUA 3KUXA 4XYLA 3OIDA 3LDHA 4BNLA 4JJGA 3D3WA 1ZVMA 1ZW1A 4IQ8A 1B26A 4BNZA 3ZWCA 1BHSA 5CFZA 1W6UA 3WQQA 1VKOA 3PZBA 2NTNA 3K5PA 4YA6A 5IJZA 2Z1MA 1PJTA 4IBOA 3QY9A 4R1NA 4ZD6A 4GGOA 3QWAA 2P2SA 1M6WA 3GGOA 2ZIZA 4Y67A 1I2CA 1UDCA 4EZBA 2A35A 4UULA 5KKCA 1VPDA 4MPDA 3DAFA 1QYWA 2HU2A 1T26A 4BMNA 2HQ1A 4E6PA 3NDJA 2B83A 2I66A 1T1RA 3ADOA 3OJLA 3H5AA 4FCCA 4MVJG 5G4LA 4LCJA 1N7GA 1I32A 4U6SA 3WJ7A 4NFHA 1PSDA 4Q3AA 5DNAA 1AGNA 3PIDA 1HDGO 2HMWA 1NQAO 4MDHA 1ZK0A 3AM5A 5JFOA 5BSFA 5ENVA 4W4TA 1JA9A 5ILGA 3RQSA 2VRCD 2HJRA 5KKAA 4RPKA 5C3MA 6ADHA 4HADA 4YXFA 2CVZA 3OIGA 4R1UA 2HMUA 4CODB 1GCUA 4B4WA 4IDGA 2PH3A 3OF2A 1D8AA 1XLTA 3L07A 4MJLA 4JQCA 4TSKA 2ZQZA 1WZEA 1FDUA 3PYMA 3ADPA 3GN1A 3PHIA 4ALMA 3UHAA 3TZHA 1HLPA 4DPLA 4U7WA 3U49A 2AG5A 2OORA 3MTJA 1HXHA 1ENPA 1OC4A 1PR3A 3G1UA 3KHUA 3ONFA 4IZHA 4XGIA 4AJJA 3TOZA 4R68A 5KVCA 4BQPA 2JD2A 2FZEA 4AJEA 1ISGA 3LYLA 4OXNA 2X8LA 3W1VA 2BLLA 2RCYA 3ZWNA 4BNXA 2FSSA 4UVEA 2XXJA 4NK5A 1FDWA 4BNIA 5JMWA 2EWMA 4R3NA 2CVQA 5JAZA 4GGPA 4FOSA 3RROA 7ADHA 1LRJA 1D1TA 3PGJA 2VWHA 2Y66A 3CE6A 3ZWOA 4WCDA 1IHXA 4J7CA 3M6IA 1PZEA 1WMBA 4MVJI 4G2NA 4P4LA 4PIVA 1KC3A 1NQ5A 2GZ1A 4ID9A 1QXSA 1T2AA 1XU7A 4JX8A 3CUKA 1E7SA 3PLNA 3AUSA 4UVDA 3CXRA 4BO0A 4XYMA 5BSHA 4ND3A 4E2WA 1M2WA 1LXCA 1SB9A 3FBGA 2WYUA 3MJVA 5TS3A 5KOIA 1OZAA 1QP8A 5TF4A 4I5DA 4DIFA 3KTDA 5CDUA 5I7EA 3WB9A 3AJRA 4AJKA 4PLFA 4CLOB 4BB5A 2WE8A 1U8FO 3GNTA 3E9QA 3C7CB 1GQYA 1RYEA 5TRTA 3RI3A 1W8DA 1LRLA 1PX0A 3DFUA 3NJ4A 4BNHA 1ML3A 4L74A 3M1LA 4QO7A 4HX5A 5T5QA 3I9KA 2ZTLA 3V1UA 1W4ZA 1TT5A 3KYDA 1B8PA 4OO3A 4FFNA 4B7XA 3WOHA 1NR1A 4WASA 1SOVA 4E5YA 3RU9A 4NK4A 5T64A 4TRMA 5JYEA 1A5ZA 4TRNA 1LUAA 3AK4A 4CMGA 5JCJD 4UAGA 1E3JA 2G0TA 2C7VA 1Y8RB 3PDJA 4PRKA 2GUGA 3CPSA 2X86A 1KVSA 2Q2VA 4G65A 4CLOA 2Q1UA 3OJFA 5AXBA 2QX7A 4BGIA 4DLBA 4YQZA 4IDCA 2I6TA 1HETA 1YQGA 1EK6A 4R69A 4FIZA 1VJ1A 3VKUA 5B37A 5BSEA 1MX3A 3JQFA 3MOGA 3ROQA 1ONPA 5I7SA 2VZ0A 1LSUA 4AJNA 5L40A 4AFNA 2OP0A 2PH5A 4D43A 4BO3A 5HRUA 1MG0A 3WGHA 5L7YA 3C1TA 3GA0A 1PGOA 2Y0DA 3PP8A 4PCVA 3QWHA 3DBRB 4AG3A 2B4QA 2VZ9A 3KETA 1H5QA 2VOEA 1OOEA 4RDIA 3MOIA 5C7IO 4E12A 1P74A 1EVJA 1YBAA 4GX1A 1ZEJA 1I30A 4MVJE 3ZH2A 4MP6A 3AFNA 3MWEB 3HFGA 2VZ8A 2J5KA 3VZQA 2X5JO 1T2DA 4B8ZA 4MVJP 4BS9A 5CDYA 2X0IA 4JP3A 1Y81A 3F4BA 4FOOA 3F1LA 1EVZA 3JV7A 3VAZA 2ZJ0A 1ZBQA 2YZ7A 3O26A 4CQLA 4XYBA 4CLHA 2X9VA 3I9OA 1LA2A 4WNIA 2GCGA 1NXQA 1C0IA 1W0CA 2BRUA 3ZWMA 1HWYA 4NZ9A 4XDZA 4CLEA 2EF1A 4HKTA 3UVEA 1DBVO 5MDHA 1FDVA 4EW6A 1E7YA 4BO7A 4JNKA 2IODA 3L0DA 4IM7A 3UH1A 1IOLA 4YCAA 4WGGA 3JQGA 4GL4A 3LT0A 4Q3NA 4P4NA 1VL0A 2D5CA 4A0SA 1T2CA 3WQRA 1BVUA 3UXYA 3RUIA 3ZWBA 1K2WA 3B1KA 2BGLA 3KXDA 3AY3A 1NR7A 3VTFA 3H9UA 3ZNNA 1KY4A 1IPEA 3M2TA 4B4VA 5COBA 4GLLA 4CLXA 4CM6A 1IULA 3SX2A 4D7AA 2Q49A 3AU9A 1YB1A 4E3ZA 3HUDA 1ZMOA 4C7JA 1JVBA 3C1AA 5HS6A 2I5PO 3D4OA 4D0SA 2JL1A 3AFMA 2PV7A 4YJDA 4DRYA 4DWVA 3HWRA 1H6AA 4WK6A 1ZZEA 3F5SA 1HYEA 1I3MA 2C0CA 3WSVA 5TQVA 4YRAA 5TIIA 4YWJA 1EUCA 1GR0A 1AUPA 4JLWA 1S7CA 4BKPA 3E8XA 1Q1NA 1E7MA 1BXKA 2QRKA 4Y98A 2Y1CA 4DPKA 1DDOA 3WR5A 4EITA 4R54A 5IDYA 1PWXA 4CMKA 3C24A 1M67A 3ZHYA 1U5AA 1ENZA 2DLDA 4P22A 3V2UA 3JQGB 2FPPA 5A3JA 3D7LA 2GN6A 2P4HX 1P9LA 3INGA 2NU8A 3DZGA 2GN4A 2CF5A 5EERA 5L3ZA 2JD0A 3ON5A 3IS3A 3M1AA 3PFFA 1K89A 4GX2A 1QKIA 1S6YA 4Z0TA 4JK3A 4DXHA 5JC1A 3LLSA 1DEHA 2I3AA 5CDSA 2DUUA 4YJGB 1EQUA 3LT4A 4UUOA 3U09A 2BFOA 4NBTA 1GDHA 4L4RA 4O5OA 1J4AA 4CMCA 2EKQA 1G1AA 3RWBA 1Y8RA 5L4LA 4TZTA 2DVMA 5A5EA 3Q1LA 3MEQA 3GF4A 1I3KA 4R51A 1ZEMA 2X9GA 1WNTA 3BXXA 3Q9UA 3PQEA 1U7HA 4PZDA 3HADA 1Y5MA 4WE3A 4CM8A 5EINA 5DP1A 4WPGA 2Y68A 4E4YA 3DHYA 3IJPA 3STHA 4LMRA 4YVFA 4A7PA 3H9QA 2B36A 3AU8A 2C29D 4XA8A 4OGWA 4I5GA 2C7GA 3GZNB 3VZSA 3JQ7B 4RQUA 2VHZA 3NX4A 1OMOA 3GUCA 4YJHA 1XYGA 2SCUA 2YYYA 2Q1TA 2IE0A 1DLJA 1XDWA 4A73A 1ZK2A 2O50A 5DCWA 1C0PA 1ZSNA 3L6DA 2TMGA 3E9MA 1WXDA 3M2PA 3NEPX 1E5QA 2BI8A 2ZJ1A 3ENKA 3FTPA 5EQDA 2AG8A 1ZK4A 2CFCA 1GU7A 1NYTA 3SLGA 2AQ8A 2UDPA 3MJSA 1WDMA 4CMIB 3JQAA 4GWGA 3ZW9A 1GUFA 2ZK7A 4LVUA 4M49A 1IPFA 2NQ8A 2V6FA 3QHAA 1Y8QA 5U1PA 3I9JA 2I76A 1FMCA 1QLHA 2AEJA 1IZ9A 3KZVA 4RVDA 3RASA 4NHEA 1JKIA 4E31A 1UUFA 3RFXA 4LRSB 1U4OA 3RC1A 4YB8A 5G0SA 1H6BA 3C3XA 3OM9A 4DMLA 4RL6A 4KZPA 2Q45A 4NJMB 4KUEA 3IL2A 4MVJF 5FI3A 3ZWPA 1GADO 1LDNA 2O3TA 3PWSA 1IZ0A 3I6IA 1CJCA 3D4PA 5F3RA 3UCEA 2EG9A 4ALKA 3E9NA 2PFGA 3GHHA 4Z3DA 2HMSA 5U4QA 4YPOA 1EE2A 3WGQA 2NV6A 3PXXA 4GAEA 3GFGA 2HK7A 1YONA 1KC1A 3IMFA 1SB8A 2DT5A 1XKQA 1Z45A 3BMQB 1ID1A 5C37A 3PFWO 4S3MA 1PJLA 2YFQA 1MC5A 1PR9A 2YQ4A 1F8GA 1UH5A 1HE3A 3WBBA 2BH9A 4QSMA 2VUUA 4M1QA 1TT7A 3A14A 3GVIA 4IPTA 2IZZA 4C7KA 3PLRA 4AVYA 3DDNA 3JYQA 3KEQA 4FBGA 3VPHA 1UXHA 3IP3A 3I1JA 3GNQA 5HBRA 3W4IA 4BKUA 1Z6ZA 1LQUA 1BRMA 3S2EA 2O3RA 1C0KA 3PHJA 5BSGA 5F5LA 5EMHA 4KQXA 3LVFO 1LSSA 4BO5A 5IZ4A 5KJ1A 4ZJUA 2NACA 3TN7A 4FSHA 4EYEA 1NFQA 1GZ4A 2NU6A 1DRVA 4KUGA 3H3FA 1H9AA 2YJZA 2DAPA 1V0JA 3DTTA 5KWEA 4XD2A 1NTOA 2QG4A 4FD3A 1YO6A 4BIIA 1NX6A 3ZNQA 5CDGA 2WD7A 3FF4A 3K73O 1TLTA 5THKA 1GYPA 3JTMA 3LT1A 4ZGWA 1X13A 2DBQA 3I9LA 5U9CA 2GASA 1QV7A 1NFFA 1P0FA 1Z74A 5LDHA 1YQDA 5BNIA 4JJFA 3TZ6A 1DRWA 4NIMA 2UVDA 5L51A 3FCOA 1RKXA 5LDGA 4GBJA 1TA4A 2PD4A 2PD3A 1VM6A 1U2DA 1T2FA 3VH2A 3RUFA 3WLEA 1ENOA 3EW7A 4E33A 4RO0A 3R3SA 1ISHA 1CYDA 1P0CA 3PJFA 2G5CA 1XSEA 4DQVA 1RPNA 4IDDA 1LRKA 3OIFA 5F1PA 4CUZA 1ISFA 3C85A 3H4VA 3NUGA 4N18A 4D41A 4UEOA 4WLUA 2C5EA 1N9GB 3GDGA 3GGPA 2EW8A 3PQDA 4YYZA 1XELA 1YVEI 1MUUA 3LC2O 5CG2A 2E6UX 1X0VA 3EZYA 3TSCA 4XR9A 4BKQA 3D5TA 1PJSA 3L77A 2X4GA 1E1NA 4IIUA 3FSRA 2DC1A 5JDCC 2EHDA 4CMEA 3WX0A 3K9QO 3ASVA 1KIFA 4URFA 4B3IA 4TVBA 4DREA 2X5KO 5IZCC 1AXEA 1Q7CA 1Y1PA 3I52A 3RUCA 2X0RA 4D79A 4CR7A 2F00A 4OKNA 4ZICA 3I83A 1K5HA 1OI7A 3DOJA 1R0KA 4QUKA 3PDUA 4WLEA 1JVSA 3ZNOA 4EEZA 5JCXA 1EK5A 1GAEO 3VTZA 3MZ0A 5L7WA 2IYOA 1PJBA 2I99A 4HFNA 4E30A 4BO9A 1ZKMA 2ILTA 3RC2A 4M86A 3ROMA 3AUAA 2YHIA 4Z9YA 4AJLA 2NUAA 1MFPA 1MG5A 3MJEA 4FFPA 1B7GO 4M8SA 4P38A 1UXIA 5TJ9A 3L6OO 3NGXA 1NHGA 3ZN2A 3PWZA 1DIHA 1HZJA 1HRDA 1YL6A 4JBHA 3IKTA 3F5QA 3IC5A 2DPHA 4R9RA 1SEPA 5JY6A 2B5VA 2DU8A 4WOJA 4BGEA 3Q6IA 1CEQA 3R1IA 4F6CA 4PRLA 2D5AA 1DB3A 3U4IA 2DFVA 3GGGA 4R41A 2DUWA 4ZRNA 4R16A 5IN4A 4KWIA 4A03A 4JBIA 3NV9A 2O7QA 4UVHA 3U4HA 2J3HA 4CMAA 2WE7A 4E5NA 3TL2A 4XGNA 2BGMA 2GD1O 4W7HA 4LSMA 4RVFA 3ZDFA 2DM6A 1E3LA 1E3WA 4O59O 2VT2A 4ZVVA 1CQJA 4H3VA 1DIGA 3ZHZA 3KV3O 1ONOA 2QRLA 2W90A 5IAAA 5B1YA 4BNKA 2OBYA 1O6ZA 3RUEA 4Y6SA 3RJ9A 4H15A 2IZ1A 4NBRA 2GDZA 4RDHA 1YL5A 5JC8A 1YJ8A 2Q46A 4E5PA 4RVHA 3SXPA 2JHFA 4CM3A 1GY8A 4OIMA 1DPGA 1I33A 4IY1A 3ZU2A 1KVQA 2Q1WA 2OOSA 3GRPA 4HFMA 3ZWXA 3EVNA 3BTOA 3DL2A 5ER6A 4JBGA 4QFDA 2HSDA 4BO6A 4YT4A 3GUYA 5KNLA 5L53A 3EAGA 3GRKA 3O38A 4QXMA 3ZU3A 2PTGA 4NBWA 4RLSA 1BSVA 1P1HA 3CIFA 1SCUA 4GWKA 1B8VA 4L0QA 2BI7A 2YW9A 3VDQA 2A94A 4GX0A 1JAYA 4M89A 2LDXA 2H63A 5F1KA 3GAFA 1ZJZA 3EK2A 3FWZA 4BNJA 1I24A 2NVBA 2V6MA 3JQCA 2PY6A 1E0DA 1U3WA 3FHLA 3HN2A 4JGBA 3WJAA 2BGKA 2H5LA 4RCVA 3DR3A 3TOXA 4MINA 5A4DA 5L7TA 4YAKA 3BA1A 4DYDA 4CLRA 3RJ5A 1VI2A 3R3JA 4LMPA 4MO2A 4RF2A 4CM9D 1ZNQO 5DT9A 2CVOA 3AY6A 3OHSX 3AOEC 2EP7A 5JPIA 1LDGA 3U0BA 1AHHA 4CMJA 4F46A 1HZZA 1ISIA 1C1XB 5GZ3A 2VUTA 2CNBA 2XOXA 3G3EA 3W6ZA 1KEUA 4EGFA 4BNGA 1K6XA 4Q3CA 2GZ3A 2XAAA 5EIOA 2VHWA 3NKLA 4AL4A 1P3DA 4WCFA 3NT5A 3O8QB 4IDBA 2ZQYA 3ZI0A 3VPFA 4YDRA 5FWNA 4EJMA 3LC1O 2X22A 1BDMA 4J90A 5DOVA 3UUWA 4PLYA 1L7DA 4J1SA 4GI2A 1R37A 4J2OA 1YJQA 4R9SA 1H93A 1X15A 2G17A 1NAHA 3AW9A 3DMYA 3N7UA 4YAJA 3DZIA 3ETDA 3WTBA 1KS9A 4J0FA 3ZV4A 4EDFA 1P45A 2WWRA 3BTVA 3ST7A 2J8ZA 1X7HA 1A9ZA 1EFLA 4HXYA 5I9NA 1AN9A 2X23A 3V2HA 4BNYA 4LGVA 2PZKA 4PFJA 1ULUA 2D3TA 3BMCB 3H3JA 4ILKA 4ZQGA 2J3IA 5JSFA 5HM8A 4ND2A 3D1LA 2P5UA 3QWFA 2HJSA 3LF1A 2JCXA 4HFRA 3RU7A 1LDMA 2VYVA 1GV0A 5JS6A 4EI2A 5JDIA 1CRWG 3BMNB 3ITDA 2O3JA 3WFJA 1XR3A 1JKFA 3UCFA 4BO8A 3VKVA 3EMKA 3DEYX 4XRRA 2D8AA 2BELA 4OAQA 4M87A 3VDRA 4H16A 1F17A 1PL8A 4MVJD 4RVSA 3HB5X 5AXCA 1U2GA 1HT0A 1LDEA 3TZQA 3PK0A 5T57A 1JKJA 2HK8A 3OSUA 2H9IA 4IXWA 3WFIA 1KVTA 1Q7BA 1PL6A 4CLRB 3FTNA 3U9LA 1NP3A 3QQPA 4TZKA 1XHLA 4QT0A 2Y05A 2AMFA 5AOVA 4E2XA 4JIGA 3JD1A 4CM4B 2VYVD 3Q3CA 5G4KB 3U62A 1DOHA 1LSOA 3CKYA 2O2SA 4KOAA 1UAYA 1YRLA 3B1FA 4IXTA 2OL4A 3H9EO 1WP4A 3GOHA 4WLNA 5TT1A 1BXGA 3QVXA 1JN0A 2GGSA 4CM1A 1UP7A 2BFAA 4QO8A 3FPCA 4CV3A 4J6FA 2I3GA 1HKUA 2Q3EA 3E5MA 3EGOA 4RPLA 1XGKA 4KUHA 3UCXA 5K0ZA 3TF5A 1BW9A 1SZJG 2DQ4A 4I08A 4NPCA 2WYWA 5THQA 4B4UA 2AXQA 2WD8A 2AQKA 2ZB4A 2D4AA 3G1TA 2QW8A 1XIVA 2CDAA 2WM3A 1IL0A 3NAQA 4RVUA 4FS3A 5EPOA 4CLDA 3EYWA 5G0VA 5CDTA 3C8MA 1SEVA 3GR6A 2AE1A 1ORRA 1SAYA 4GVXA 5A5FA 4NH4A 5A9SA 4Y6RA 2DTEA 1SPXA 4CUJA 1N7HA 2PKRA 4HUJA 4XJTA 4YAEA 3DTYA 3GMSA 2V6BA 4YTEA 4K28A 1YDWA 5AQ1A 5AXDA 5FFFA 4W7IA 5COAA 2E82A 3JQ9A 5DN9A 3PQFA 4YAGA 5L95A 4LRTB 2Y1OA 2X1HA 2PD6A 3BMOB 1R66A 1QYDA 5JAIA 1GEGA 2E4AA 4GMFA 5JE8A 3EHEA 2W2KB 1BXGB 2NU7A 4J4TA 3RKRA 5IG2A 3H9GA 4JCOA 3AWDA 1YOVA 2FRDA 3H2SA 3DZBA 2ZB8A 1QLJA 3IUPA 1X0XA 4F3YA 2Q2WA 3IJRA 1B16A 3JCZA 3EDMA 4L76A 1ZXBA 4A2CA 4QFCA 1HDCA 3GT0A 3LQFA 5KVVA 2E37A 1V3TA 4TQGA 5ENDA 4J7UA 2QIOA 5I9LA 3GDFA 1ZXLA 1I2ZA 3WS7A 1A71A 8ADHA 3H65A 4CMIA 4GSLA 2GR9A 3E1KA 3IUSA 5JY1A 2VRBA 3QWIA 2POQX 2O3SA 4I5FA 4CV2A 2FR8A 1FDSA 3DB2A 2RAFA 4GLOA 1R4NA 1PQUA 1KY5A 1X1TA 3UICA 3INTA 2NQTA 1B2LA 3Q0EA 3G0OA 1R4NB 3ROPA 1HDOA 2UV8A 4ZU3A 2PLAA 2VHVA 1PQPA 2WYVA 5TSDA 5JBIA 2B69A 4DVJA 4M54A 5GMOA 1R12A 2YDYA 1GZ6A 2X58A 3DBVO 4KTVE 4NQZA 1T4BA 3D3EA 4BKRA 4CR6A 3HG7A 1GYQA 4XKJA 4AJ2A 3EUWA 3P2YA 1SNYA 3PZRA 3S55A 2YV3A 3DZFA 3QW2A 2Q50A 1NNUA 4PVCA 3A9WA 4OXYA 1C3VA 2RBEA 3GQVA 4YJFA 5I8WA 1O94A 1E3EA 5IXSA 2ZYGA 2ZKLA 4NMHA 5IF3A 4G5HA 2VOJA 3E6AA 4X54A 1ZSYA 4KTTE 1YB5A 1EVYA 1NASA 2EEZA 1HSZA 4TKLA 4CR8A 4D3SA 4U0KA 2WEKA 3BIOA 3RVDA 2HMTA 3ZWYA 4WEQA 1IHYA 2PGLA 3KYCB 4HNGA 2GZ2A 2VYNA 5G2OA 2D0IA 3IP1A 3G17A 2BF7A 6LDHA 4IIVA 3DONA 3QV1A 4ND4A 3AOEA 3T4XA 4IJWA 5BQFA 4Z3KA 3ENNA 4UVIA 5EL0A 3RCBA 2JFFA 3A1NA 3CMCO 4BMVA 1GFSA 3L9XA 1NQTA 1YBVA 3KLPX 4J2HA 2CDBA 1QG6A 4HV4A 3DMTA 3OQBA 4INAA 3DMTC 2O48X 1PWZA 3O03A 2RH4A 3I4CA 1CWUA 4ZQBA 2BFMA 4DBVO 3P5SA 1H6CA 1U5CA 3ITKA 4XQGA 2O23A 1TXGA 1O9BA 1UZLA 1PZFA 4Z9FA 3RC9A 2ZTUA 3SVTA 3BAZA 4O6VA 2HLPA 2VHYA 2DPGA 3RBZA 1B14A 1OBFO 4XQEA 5B4UA 3PI7A 4WLFA 3OJOA 4PG7A 2CUKA 3OFSA 3ANNA 4B4OA 1EUZA 9LDTA 4RZHA 1DHTA 2VWGA 5H83A 5K6AA 4CV1A 3I3OA 4J0EA 1ARZA 4BKOA 3B6ZA 5DULA 1NVMB 4MVJM 4XQ9A 3ZU4A 1GQ2A 2OGUA 3I5MA 4E2ZA 2Q2QA 2X6TA 1G6KA 4LK3A 2D2IA 4JXKA 5DBGA 8LDHA 4L75A 5KIAA 1LTHR 4J4BA 3IKVA 4UVGA 2NM0A 4I9HA 2A92A 3GVHA 1QYVA 4OQZA 1UR5A 2OFPA 1U28A 2BKAA 1EBUA 2YFHA 4CQMA 5A9SB 1GTMA 3MJ4A 4WCFC 4C4OA 3ZNPA 1LNQA 3JQEA 4DUPA 1YGYA 5BNTA 3F3SA 1ZFNA 2OXIA 4NU6A 4XR4A 3VH4A 4EJ6A 1A72A 1DJNA 3ANLA 1I0ZA 3HN7A 4NG5A 4CM9A 4IMPA 5A9RA 1B3RA 1LEHA 4RVGA 3DQPA 4CQLB 1C14A 4WLVA 4XGKA 4I9UA 3L6EA 3MTGA 2B0JA 1E6UA 3KVOA 3H2ZA 3HDYA 3ANMA 3W4JA 1D3AA 1BMDA 2UUPA 5ITVA 2YUTA 3MCVA 1PQWA 3DZKA 4FFMA 1VL8A 4IUYA 4XCVA 1XA0A 4YJFB 3ETEA 5JCJA 3CINA 3DHNA 4D42A 2Y1FA 4PGFA 4J1TA 1Q7GA 5H82A 3JD4A 3RBXA 3K92A 2UAGA 2CDCA 3DBRA 4RLHA 3QJ5A 4EUFA 3WGYA 1LI4A 3BTUA 1VSVA 4U0JA 4W9NA 2FP4A 2DKNA 3DZJA 1NAIA 1GZ3A 4IDFA 4IS2A 4A27A 4IDEA 1PIWA 3FNFA 4B3HA 1HDYA 4HBGA 3KB6A 1F8FA 5DDIP 3RKUA 4PG8A 5MGBA 2Q99A 4FGWA 5TX7A 3B1JA 1XQ6A 1MA0A 4G81A 1XU9A 1DFHA 3KSUA 1G0OA 3IQDB 3PYLA 2NWQA 5DZSA 5T8KC 1XEAA 1YE3A 4Z6KA 2V65A 2NLOA 4J4HA 2DFDA 1EDZA 2YV1A 4PLTA 3JQ7A 2YQ5A 3WNQA 2VHXA 5IZCA 3VVBA 1A9YA 4YRBA 3BMCA 3EY4A 1EFKA 4PLPA 1CF2O 3OQ1A 3RFVA 5DF1A 3ZHBA 1B8UA 4RF5A 3UOGA 4DPMA 2B37A 4CMHA 5G0TA 2HAEA 1Z7EA 3H8VA 3BHIA 5ITWA 2ZTVA 4TRJA 1MXHA 3PTZA 1ZK3A 1SMKA 3GG9A 3X2EA 4XDYA 2ZCVA 4YBZA 1HL3A 3DBHA 5KJCA 4E2YA 2C2XA 3BHJA 2IXBA 2VTEA 4GQAA 4YRDA 5HS4A 2C2YA 4IGFA 1HYHA 3V8BA 2GN8A 1SOWA 4Q9NA 3AI3A 1R4MB 3QE3A 1TB4A 4EBFA 4AJHA 1KYQA 3T4EA 1GPDG 3GC6A 2CZCA 1PS8A 3RFTA 4MVJA 1MGOA 5L4SA 1Z7BA 5LCXA 2WJPA 4B79A 3GPIA 2EP5A 5LC1A 2GRAA 5A3VA 4RORA 2IZ0A 5C5IA 1YWGO 1MFZA 2O4CA 1TEHA 3CSDA 4ZRMA 3B70A 1KVUA 1PGNA 3NTOA 3AY7A 9LDBA 3GHYA 1KOLA 2WD7B 3QIVA 4NBUA 1KEPA 3L4BC 1HDRA 3O4RA 1O0SA 2HK9A 4ONEA 2RIRA 1P1JA 2RHCA 2FR0A 2I65A 4LN1A 4UUMA 3H9JA 1U9JA 1K3TA 4WLOA 4O0LA 3O9ZA 2R00C 3IAHA 4BO4A 4D46A 4DBZA 1N2SA 1NHWA 1UDBA 3H6KA 1R16A 1F06A 2B5WA 1C1DA 3FNGA 1QV6A 2VWQA 3FI9A 3I9NA 1PJCA 2A4KA 1DSSG 1ZK1A 4GSKA 4MKRA 4IZIA 4BB6A 4YT5A 3UW3A 3FBTA 1M76A 2J3JA 5T67A 2AW5A 3KBOA 3SBOA 1I36A 1RM5A 1A4IA 4FR5A 2PR2A 1OC2A 1A7KA 3CZMA 5FEUA 4GVLA 1Y7TA 4B7CA 1N1EA 3A28A 4DLAA 1PS0A 2XPCA 1LLQA 1W73A 3NTRA 4PG4A 5EQFA 3PHGA 1HTBA 3LZ6A 1NVTA 4CL8A 4I8XA 5COQA 4BNMA 1DC3A 2A9FA 1C1DB 4JP2A 3GVXA 5ICMA 1ZMTA 1BXZA 4Z9XA 1R0SA 3P2OA 2Y67A 2NNLD 1J5PA 5JXWA 3OH8A 4Y9DA 4BNUA 5TT0A 3RBVA 2PGDA 1LDBA 2O3UA 3GVPA 3K6JA 1FDTA 4FB5A 1XWFA 4K6FA 1KEVA 1N5DA 1ULSA 2C54A 1EE9A 1HYGA 2OP1A 5EN4A 3D4NA 1LU9A 1YS4A 3JQ9C 1HEUA 1YQXA 1PS9A 1GQQA 3VZPA 2IRWA 4D44A 4ESOA 2VWPA 1ZH8A 5GZ1A 3C7AA 2YHUA 3A4VA 1N1GA 4K6CA 3SJ7A 3OJ0A 3AOGA 5CEJA 3QLJA 5IDWA 3QVOA 1A4UA 1R4MA 4NI5A 1MXFA 5CPFA 2HRBA 2P4QA 5B4TA 1T25A 4MP8A 2OBNA 4UEKA 5GY7A 4LCEA 2E49A 1UXKA 2O2YA 2WDZA 3PHHA 1EEHA 3ONEA 4OMUA 3N58A 4TKMA 5KJFA 3WBFA 1PTJA 4YJHB 5KJEA 2FR1A 3WYCA 2IYPA 4A10A 2QYTA 1VSUA 1NFRA 2JFHA 3WYBA 4J16A 3C1OA 2GO1A 2FWMX 1LQTA 4RPGA 5TNXA 3NT4A 5TJHA 4RJTA 4QQRA 1EDOA 3GAZA 1BVRA 3RAJA 5CEEA 2ET6A 1TT5B 4KP7A 1U3VA 4WJZA 1UAGA 4XIJA 3OEYA 4F6LA 3VHRA 3VPGA 3WNVA 4ALIA 4FQ8A 4O1MA 1E6EA 4U8GA 4NFSA 5ES3A 3GEMA 2YDXA 2Q1SA 3HFSA 1PJ3A 4AJOA 3OBBA 4PZCA 4QEDA 3UAGA 3O8QA 2O3QA 1AE1A 4K26A 3F47A 2QHXA 1ADGA 3QVWA 3VPXA 3ZV6A 1QRRA 1JW9B 2WMDA 3GY0A 3JYLA 4E32A 4CQMB 2V6GA 1UP4A 4O63O 2NVUB 2Y1DA 2PGJA 1F0YA 2FPGA 3SEFA 4ZQHA 5A03A 2Y1EA 1LBEA 3AI2A 4DL9A 5AVOA 3CEAA 4BV8A 1BW9B 3GEDA 4J3FA 3GEGA 3JQBA 4MIYA 2FN7A 4J49A 3E5RA 4Q39A 2ZATA 3RSHA 2Y0EA 1IB6A 4GPD1 3HDHA 4GMGA 4AJPA 3ZHXA 1QORA 4OOFA 2PKQO 4KQWA 4CQMD 5KTKA 1RM4A 3NTQA 4IGEA 5TC4A 4FN4A 5HWSA 3GK3A 3HZZA 4L8VA 1C0LA 3W8DA 4PLVA 4F45A 5L9AA 2X7HA 4K9DA 2W2KA 3JD3A 3UN1A 4OSPA 3TNLA 2DBZA 3L4BA 5T6BA 2NU9A 1JU9A 1K6JA 2C59A 3RUAA 3DFZA 1LLCA 3VPSA 3KYBA 4W6ZA 3PHLA 1QYCA 3DOCA 3ZU5A 4IS3A 1YH3A 3WYEA 3AM3A 3WLFA 5EJ2A 2AE2A 1NVGA 4ZN6A 4NBVA 1PJ4A 1HSOA 2FHSA 3CZRA 4IJVA 3BYZA 2GF2A 1X7DA 3DXFA 5A05A 4OL9A 2EIHA 2AQHA 3GLQA 1RM3A 1RJWA 3PJGA 1E1LA 1OAAA 1E92A 3WIEA 1I5RA 3RUDA 2R6JA 4CV0A 4XYEA 5JYDA 3NGLA 4TWRA 2IDZA 2HMVA 4HP8A 2VNAA 2LDBA 3LF2A 4YT2A 3QVSA 1E7QA 4N7RA 3GZNA 3I6QA 4KDFA 3DBLA 3W8EA 2VQ3A 1R6DA 4MVJH 4DQXA 1P1IA 4XB2A 1VJTA 1CETA 4RV9A 3TPCA 3F46A 4YR9A 3FR8A 4FJ2A 4OHUA 1DFIA 1WPQA 3U3XA 4CM8B 4CUKA 4EUEA 1LSJA 3TQHA 4J43A 5I8ZA 3WWYA 3LLVA 3OA2A 3QA9A 2HUNA 1YB4A 4E5MA 1T4DA 2BD0A 2X5OA 1P31A 3B20A 3EC7A 4II2A 5K6AC 5G4KA 5K9ZA 4BUCA 5ILOA 1D4FA 5J23A 1O89A 1P1KA 3L4SO 1N9GA 3S1LA 3ZWWA 2TMDA 3PIIA 4BNVA 3FN4A 2G1UA 4FJ0A 4AJIA 1Y8QB 1ADFA 1YL7A 5JMPA 4YJGA 3JQ6A 5IDXA 2CD9A 3IOYA 3NDIA 1X1EA 3SC6A 2B35A 2FOIA 1GEEA 1DAOA 5C7LO 1ISMA 4DIOA 1UZMA 3U5TA 1I8TA 1GUYA 1A7AA 2CF6A 2VCYA 2DBVO 4NJOA 4R01A 3WXBA 5B12A 4PLZA 3S8MA 1PZGA 4HWKA 3IIEA 1DXYA 4RPHA 2P5YA 1VL6A 1NM5A 1YKFA 4ALNA 4AJ1A 1K6IA 3A06A 3D64A 4XRGA 1O95A 5CG1A 2EW2A 2R00A 3MWDB 1EVIA 4HY3A 2W2LA 2G76A 2VYND 3QWBA 4MOWA 3TFQA 1SO8A 1YBMA 4I9NA 2VNSA 5FYDA 5CEFA 1LLDA 3HSKA 2QQ5A 3I4FA 3FWNA 1EMDA 1HF3A 4LW8A 3JQFC 3MJCA 4YEDA 3H7AA 1JAXA 1UDAA 4FJ1A 4OH1A 1D1SA 4BV9A 4NDNE 2EJVA 1U7TA 2ZTMA 2JD1A 3DHEA 2JCYA 3DBLB 3P7MA 2Q4BA 2EV9A 4UUNA 1L7EA 5KVQA 3P19A 1GD1O 1BTOA 3ETGA 3WSWA 3NYWA 4A5OA 4LISA 4BGVA 5JAQA 4ITUA 1ENYA 4DYVA 3V1YA 3OICA 5L4NA 1ZIDA 4WCFB 4S1VA 4OYRA 3GDOA 2P91A 3DC2A 2G82A 4Q3BA 1OFGA 2OO5A 4GKVA 4UUPA 1C1XA 1PEDA 3WQSB 4OKIA 4OXKA 2Z5LA 2X9NA 4Z0HO 3D5QA 5HA5A 1SC6A 4IDAA 3BZUA 3W4KA 4R1TA 3D0OA 3FPLA 5IFLA 4NU5A 2XXBA 2PWZA 1E3WB 5B4VA 3PWKA 1B3BA 1TVEA 5F5NA 2OUIA 4PLHA 5JDIC 3CH6A 3VVCA 1WAMA 3GFBA 1HLDA 1N92A 3MJTA 3W8FA 4M55A 1I3LA 4PLWA 4XEHA 2YY7A 3HQ4O 1Y9AA 1KERA 2GNAA 2ZB7A 4Q3EA 4BO2A 5JW6A 4TVOA 3TFOA 4ND1A 4WKGA 1WMAA 1KBZA 3GZ4A 3HB4X 3DOOA 3FR7A 2EKLA 4MIEA 1R0LA 1JLLA 1V3UA 4GKBA 1N8KA 2ZCUA 2CSUA 1AHIA 3I23A 2NVWA 3AI1A 2NVUA 2AEMA 4FDAA 4RQTA 4KDEA 4H7PA 3V2GA 1CQIA 1GYRA 1BWSA 1HDXA 2J5RA 2CY0A 3Q2IA 5ICSA 2O4UX 3KLMX 1Y5RA 5A02A 5A04A 4XIYA 4EEXA 1JDJA 3S2IA 5BR7A 2WTBA 2PK3A 3JQAD 5T8KA 2R2GA 1A27A 1ADCA 3DBHB 4CMEC 3OJEA 5JDCA 4MKZA 5TGDA 4PZEA 1GUZA 1QR6A 3ZW8A 4PG6A 1NPYA 1NQOA 1P1RA 2PZLA 4EJ0A 4BNWA 2IXAA 1UXGA 2C5AA 5A06A 1P33A 4UREA 3VZRA 2X0JA 4XYGA 2DBRA 1Z82A 4OM8A 4BO1A 2VTDA 2OZPA 3CTMA 1X14A 3H5NA 4EUHA 2HCTA 3JD2A 2EGHA 4FW8A 3ZGYA 1E3IA 1WWKA 1ZSVA 4CM4A 1LC0A 2C20A 4PG5A 1J6UA 3QSGA 1XQ1A 1VE9A 3SJUA 2VUSA 3L9WA 3WMWA 2O7SA 3VC7A 4DGSA 3T7CA 4R1SA 1T2EA 4DIBA 4B7UA 1QYXA 3F9IA 1UZNA 2C82A 3F6YA 3T7EA 1VLLA 2P68A 2GLXA 3NT2A 4DC1A 4R3WA 4QECA 3IDSA 1ZUD1 3PVZA 4OJNA 3VOSA 4XZ3A 4YT8A 2B4RO 3COSA 1WW8A 1PZHA 1KEWA 2Q4EA 2UYYA 3D3WB 4ZA2A 1QSGA 3RD5A 4CM5A 5JAMA 3E03A 4XX0A 3BMNA 3KO8A 1O8CA 3RUHA 1DIAA 1BGVA 3KYCA 4E5KA 3ICCA 4PN3A 3WIDA 4BMSA 4FC7A 2HO5A 1EZ4A 2I9PA 3Q11A 3WGTA 3WGIA 2AEFA 3JSAA 3QVTA 3TWOA 2GSDA 4Q3DA 1DAPA 1NWHA 3NDRA 3VH3A 2V7PA 1IUKA 3KEOA 4DLLA 5GZ6A 2RHRA 4IMRA 2X0NA 4IJKA 1DO8A 2DTXA 4MIOA 2VRCA 4WEOA 2PZMA 1YDEA 2VN8A 5ER9A 5JLAA 4N5LA 4NNJA 4RF3A 1B0AA 3TZCA 2HRZA 3ONDA 1XG5A 1M6HA 3WGOA 3TDKA 2W2LD 4NFYA 1JWAB 4R5HA 2F1KA 2Y93A 1XCBA 1QMGA 3ZV5A 3ZV3A 2H1SA 3ABIA 1KETA 1NPTO 1SBYA 2B4TO 4DTIA 1M66A 1B15A 5DP2A 3OECA 4HFJA 1V8BA 3K2BA 3LU1A 4R5MA 4U5QA 4BVAA 1FXSA 3KOUA 1WLYA 3NJ8A 4XB1A 5DCUA 3JYOA 3Q9NA 5BT9A 3WWZA 1X7GA 1HE5A 3HNPA 5AXAA 3ULKA 4ROSA 4FC6A 3GVCA 1DC5A 5FF9A 4I1IA 1E1KA 1E7RA 3ORFA 5IDQA 3WDSA 5IN5A 2NADA 2OMEA 4P4GA 1H94A 4P8RA 4YAIA 3OQ6A 2P9EA 4HNHA 2JCVA 2GYYA 3S2FA 5F21A 1ISJA 2W98A 1H0KA 1HDZA 4QX6A 3PEFA 1RYDA 1D7OA 3QP9A 1FK8A 1YOVB 2JJYA 2H6EA 2W4QA 4D0RA 3PYXA 2BFPA 2J5QA 3WGZA 1FF9A 1NPDA 5KCZA 1EUDA 3LT2A 2Y99A 2NTVA 1GCOA 3VH1A 4KWHA 5CAEA 1DIRA 1H9BA 4BNNA 1H2BA 3K8ZA 4FFOA 3R0IA 1UJMA 2FMUA 3JQBC 2QZ9A 3HDJA 2XF8A 4N5MA 4ZHSA 2P9GA 3DAPA 3C7DB 3X2FA 1DHRA 4N54A 3ZZNA 4E0BA 2JAPA 1HE2A 1F14A 3FRJA 1JWBB 3OEWA 3JQDA 3BHMA 3JYNA 3KSZO 4FFLA 4J1NA 1U8XX 1PGJA 4CL3A 2AA3A 3DO5A 2ZYDA 2ZB3A 4BGUA 5G0WA 3HE3A 4TRRA 4N5NA 5CP8A 4K1LA 3TZKA 1Q0QA 2AHRA 2QYSA 2Z95A 1WZIA 5I7VA 1EBFA 1GL3A 1ZO8A 3BMQA 4XJSA 5TLSA 2E48A 1F12A 3CMMA 1VKNA 1DJQA 3DAGA 5DOZA 1P77A 1U3UA 3V5NA 2NTJA 3G49A 1EQ2A 4ALLA 2BHLA 1VC2A 1ZJYA 2JFGA 3SC4A 4FPXA 4CM7A 4GH5A 2IEBA 4E13A 2OHXA 5FI5A 3LK7A 5DCYA 2GN9A 4I5EA 4B3JA 3LSYA 1I01A 1MV8A 1U1IA 1BG6A 4WOKA 4BNFA 2EXXA 2AQIA 3UKOA 4CPDA 2QRJA 2EGGA 3H5RA 1PL7A 3WGGA 1V9LA 4JN6B 5IXYA 2EERA 2PKQP 4L4XA 3KM0A 1T24A 3PJEA 1Q0LA 3OP4A 5CPBA 3W6UA 5JNLA 1FJHA 4W9NC 2P9CA 3UGKA 1PJQA 4DQUA 3JQAB 3RC7A 4AICA 4BHTA 4W82A 4NR0A 2IEDA 3ASUA 1UXJA 2ZYAA 3FNHA 3WG9A 4RZIA 4TMFA 1LX6A 3OETA 2J6IA 3EVTA 1MP0A 3JYPA 3KSDO 4J9VA 4BQRA 3PJDA 4UEJA 1LDYA 3GPDG 1M75A 1PGPA 4L9RA 4BL5A 3INRA 3GG2A 4ZQFA 5C7OO 3F1KA 3G79A 1ZCJA 1L1FA 1U4SA 4Z0PA 1ONNA 4L4SA 4PLCA 4Y8VA 3OA0A 2Y0CA 4QTZA 1DIBA 3JD0A 1Z73A 3HJAA 1Q0HA 4OQYA 4WECA 4ND5A 1GV1A 3SLKA 4IQGA 3JQ8B 1PU2A 1JTVA 1YXMA 3K2EA 3K31A 1LLUA 4LVCA 3U4DA 3BTSA 5L45A 3R6DA 1I3NA 5A1TA 4J9UE 1E3SA 1E77A 4J1QA 2DTDA 3E82A 1CERA 3KYDB 3BMOA 4MP3A 2VT3A 4PLGA 2D1YA 1PGQA 5I7FA 1DLIA 3V1TC 1V3VA 5HTOA 3UFXA 5G0UA 2J3KA 1U3TA 1H6DA 2PA3A 1WDLA 3GNSA 2UUOA 3PRJA 2YV2A 2HKIA 1IE3A 1MC4A 1MB4A 1J49A 2GERA 1AXGA 5JO9A 3E48A 1CIVA 3FNEA 4JJIA 1VRWA 3WMXA 2FY8A 1P1FA 4WUVA 1WVGA 2WSBA 1E1MA 3F4LA 4MKXA 5A9TA 2GPTA 5EESA 3GMDA 3ICPA 3UF0A 4D45A 3HDQA 4WNCA 1NBOA 2FPIA 1LC3A 1IYZA 1R15A 4AJ4A 2PZJA 4J7XA 3PGXA 3LC7O 1TI7A 3I9MA 1Q2XA 4J91A 3WICA 1RWBA 4BOYA 2D59A 7MDHA 4YQYA 5JO0A 4XQCA 3EZLA 2Z1NA 5ADHA 4Y6PA 4E21A 4IINA 4FGSA 3WTCA 4NJMA 2CMDA 2W8ZA 1MLDA 1VJ0A 1G0NA 1PJ2A 2C07A 3FD8A 1DRUA 1E5LA 4DMMA 3GH3A 2EJWA
chains in the Genus database with same CATH superfamily
4HLQB 4F93B 3HCAA 1M74A 3KKNA 1GTRA 1EAMA 5DN6D 1PD0A 3L8YA 4KIWA 2UU9B 1KVRA 1BDBA 2HIAA 1Q7EA 1P8AA 3RAEC 1DADA 2IVFA 1AGPA 2JGFA 3D2BA 4H18A 1YFJA 1KYWA 4JROA 5AI4A 4K9OA 1Z07A 4FFRA 4YACA 3BJRA 1WDKA 2BONA 2OK8A 3ML1A 4I1VA 4Z54A 3DVAA 3GN2A 4HWPA 4KN9S 4IGAA 1GZDA 1SVUA 2FA9A 2EKPA 1Z4KA 3TLAA 4EVQA 1SKMA 5CFLA 1BKSB 3AONB 4K6HA 4KMSA 3NUQA 4G9GA 5JZOA 5H7XA 3KJXA 5FD8A 5KTNA 2D7DA 4TYYA 5E0KB 4O0MA 2C3PA 4Q7QA 3WWOA 2Y9MB 1P2SA 1DAFA 3FW1A 3KYIB 5JZ9A 2YHIB 2RH8A 2JHGA 1YZHA 3TGWA 1I2BA 3ZWAA 4NBKA 1JQJC 1P3JA 3C41J 3W8NA 2XZDA 4NX2A 2QRQA 3AUUA 3ZX4A 1WULS 3DHWC 1LJ8A 5FOSA 4B8WA 1C9MA 2VDLB 4IYRA 1V8DA 2W4MA 4DC0A 1TM4E 1T1SA 1JG6A 4DE5A 4AS1A 4L27A 1WO8A 3TJRA 4O4IF 5ILQA 2C31A 2I4RA 3QJGA 4II3A 2HA2A 3IJEB 4X1IB 1OF1A 1KMHB 1T5DX 3HNOA 5G40A 1XCPA 3V1NA 4Q7LA 3OCXA 4D3YA 4QUEA 2WRZA 4U6QA 5LL6P 3C70A 4G0VA 3CCCA 4UEQA 4BTVA 2V7EA 4YRSA 5FL3A 4A9AA 4QBFA 5L3VA 1E64A 3AETB 2EX0A 2JH8A 4U6NA 5EIBD 3ENZA 3PDCA 1ECPA 2UXCB 1U0SY 4YCDA 1L5YA 1DFGA 1LFDB 4Y2YA 2D1SA 1GVHA 2K2QB 4KQ6A 1FXWF 3OZTA 1T6XA 3DV9A 4K0KB 1IRXA 4U7FA 2AH5A 3TB4A 1JXOA 4CJXA 5BMVA 1SXQA 1VP9A 4NBSA 1CJMA 1U3FA 4BNLA 4JJGA 2J87A 2NN3C 3D3WA 4K9LA 2WJGA 4DDUA 4LF9B 4PC1A 1KS2A 1NNI1 1ZVMA 1L3IA 5DWQA 2IHBA 2HRRA 1B26A 4IQ8A 3WB0A 2OBBA 4XPIB 1BHSA 4IIXA 2L18A 3CUUA 1W6UA 3WQQA 1VKOA 2RK3A 2BEWA 3K5PA 3PZBA 3OI7A 5IJZA 2ZJ3A 3GLHA 1IY2A 1VXOA 3UV3A 5K8LA 1PJTA 4MUGA 4XJVA 3EASA 4GGOA 1DKNA 3QWAA 4QNNA 1M6WA 4CIBA 2HM7A 4CF5A 3O4VA 4EAAA 4B81A 2CKDA 2VT7A 3OE4A 2WWYA 5FV7A 1C8KA 4EA9A 1CIJA 1U8UA 3Q7IA 4EZBA 2XCRB 5KKCA 2HLDD 2RBKA 2XKAA 3PPWA 4O2AF 4Y7DA 2CNNA 1QYWA 4BMNA 4CETA 4PRZA 3MAJA 2J0VA 5KX5A 4Q3OA 4NAUA 3O8LA 4C0SA 5GJWC 5LM3A 3AJAA 5G4LA 1JBEA 1MB9A 2VPIA 3CLTC 3ETNA 3C6XA 3EGIA 1T4CB 4U6SA 3WJ7A 1T0IA 1KY2A 3ZDQA 1SVKA 5KQPA 2WG1A 4OQFA 1K63A 2R8XA 4Q4AA 1TFUA 1T13A 1L5LA 2JDIA 5JFOA 5C1IA 4W4TA 1MABA 2YWXA 5EKDA 2H1FA 4MS3A 1THTA 1V26A 5C32A 6ADHA 4CEIB 1WUTA 1Y3CE 5F98A 2HNKA 4YXFA 1FYEA 3OIGA 2Q5HA 3FM9A 2VA9A 2YY6A 3W5AA 4HYYA 2P4SA 1MRZA 1Y8CA 4X8MA 3QMVA 4IDGA 1EWRA 1CE8B 4U00A 3ROXA 1D8AA 4PZAA 3MWLA 1HQDA 4R84A 2PJDA 4OHFA 5IJ9B 1E2QA 5KOHB 4F1JA 3D1VA 1FTGA 1KH1A 2ZQZA 2ZW9A 3ONNA 3Q7QA 4JB2A 2BV3A 4Q19A 3PYMA 2H06A 3DOIA 3PNPA 2YINC 7REQA 3PHIA 4QZVA 4JGIA 4KHPB 3TZHA 1TKAA 1TZJA 1FTYA 3MTJA 1HXHA 3N0RA 1Z56C 1BCRA 5LWQA 3AF6A 3DEJA 4AS2A 1HTWA 4R9NA 4R68A 5KVCA 4UNQA 1WMSA 1MO4A 5BXYA 4NH0A 3PU6A 4UPDA 4TM8A 3BAFA 4UCXA 1ISGA 2Z58A 3FMIA 2JLZA 2HV8A 2X8LA 5EUQB 4A0FA 2XB8A 1O03A 3CH5A 5I4KA 1UJNA 3OZIA 5CX4A 2GNPA 4NK5A 4O4LB 1FDWA 3RTCA 1EK1A 4GUAA 4JYPA 3LOQA 4ZREA 2FQQA 1Y5LA 9ATCA 3NYQA 4R3NA 3IR7A 4N8SA 5K8TA 4E1BA 2QMEA 3Q5EA 1DQPA 1LRJA 2F2TA 5L3RA 2A0UA 3ER9A 3FOWA 2VVTA 1J06A 4K9KA 1L4HA 2H8KA 5FFNA 4I55F 3C2QA 1YI0A 4IQFA 1QQTA 5I47A 5HZHA 2XZLA 5ALPA 3ZWOA 1KR2A 1SRRA 2KJQA 2WWIA 3TDNA 4ID9A 1NQ5A 5EP4A 1Z5OA 2IF0A 3EXEA 5FAXA 4C0WA 1Y3DE 3AEUA 4EHIA 4LGYA 1Q92A 3OEEA 3HMKA 2FFAA 3OLYA 1T2AA 2FSHA 3FCUB 2G4VA 2NPOA 2XDYA 3CUKA 4G8CA 1UMKA 4OP2A 4B2YA 3AUSA 4NBLA 3CXRA 3MG9A 3SVZA 3KOWA 3QKSA 3L7OA 2ERYA 4XYMA 2IS6A 4E2WA 1SBQA 1E4OA 5IJ9A 4D8TA 1UWKA 5KOIA 1OZAA 1QP8A 4UBIA 5TF4A 1US8A 4NAVA 4YLGA 2ZAIA 1X7YA 2GCPA 3SI7A 1GG2A 2F1OA 3KTDA 1N8NA 5EHZA 1ZCZA 1OH6A 1K08A 4BB5A 1SCIA 3E9QA 4K6OA 1GQYA 4EFLA 3D9QX 4QFMA 3HU5A 3AGPA 1EPUA 1PX0A 1W47A 1EZ1A 2I78A 1ML3A 1XMPA 4QO7A 4D1YA 2IZ5A 1N75A 3DNPA 3NHWA 4HX5A 4JS0A 4HS9A 5BSRA 3V1UA 3KYDA 3KQWA 2C3OA 1CHNA 4OO3A 1K6MA 2WJ4A 3LE8A 2QUJA 4QTUB 1LK7A 4EO7A 1RZRA 2XUGA 1NR1A 1VLHA 1C3OA 3FPAA 4M9XA 2QZSA 5KQMA 1CNMA 3VO8A 4IXNA 2Q4RA 3WXMA 8ABPA 1P6QA 1C3XA 1LUAA 3T15A 5FUQA 1ZA2A 1ZOSA 1C4OA 1J1ZA 2WKPA 3PDJA 5EJGA 4YMGA 4Y18A 2VSQA 3NZEA 3LFUA 4XVCA 3E4CA 2AJBA 2BE9A 4I9FA 4TYPA 3UM9A 2X86A 1T9BA 2R7MA 5IFKA 4KR2A 2Q2VA 3D31A 4FK8A 3NHUA 1OGIA 2Q1UA 4KB5A 4ZEWA 4YRIA 1P7VA 3RRZA 4DJFC 3RK4A 2ZSBA 4IDCA 1SCDA 4YV2A 1FU7A 4R69A 2JA1A 4D3XA 4UOEA 1VJ1A 3A3PA 3VKUA 3E3MA 3ORSA 1H42A 3AESB 1MX3A 4RKEA 3THOA 3UAOA 3MOGA 4M1ZA 3ROQA 2FZVA 4AJNA 2OC9A 4AFNA 2OP0A 1DTWB 3ZY3A 3ZDCA 3OPYB 3NTXA 1XZKA 5CYFA 2PUVA 3FPKA 3IV6A 1NXOA 5DBEX 2O0HA 4MYRA 5AKEA 5HRUA 1MG0A 3VDMA 4MXDA 1V1RA 4YXWA 4K6MA 2ZRAA 1F3LA 5IM4F 1PGOA 3SGLA 3V4RA 2FJ0A 1F7UA 3ADKA 3TD6A 5K0GA 2QSUA 3OEHD 2TS1A 4CDGA 1KJIA 2ATEA 3NC0C 2DKFA 4P3KA 4PPYA 1H5QA 3EIFA 3TUIC 4AG3A 4ER5A 2AT1A 2PX3A 3MOIA 4LRUA 1MA3A 3RW9A 1XMQB 4PZPA 3OE1A 1QGUA 1JMVA 3VR6D 1KMMA 5ECYA 3SX4A 1QP0A 3S28A 1I30A 4MP6A 3WK7A 1X7XB 1ECGA 3VR3A 3DVSX 3VZQA 3G6KA 2MSCB 1FDIA 4PYJA 4B8ZA 2HB6A 3ZCQA 5F78A 1UC5B 2WUVA 4MVJP 1HOXA 1Y81A 2R5FA 3F96A 1IOVA 3AEQA 4UHEA 1EDEA 4DMCA 1QJCA 4KFRA 3JV7A 1K06A 4DJJA 2GJKA 1PLJA 4EF6A 3KDAA 3O26A 1N2XA 2ZG6A 3F8SA 2DWPA 2Z6QA 1YRHA 3CZ5A 3HL4A 4CLHA 4EY5A 1E9SA 4IVNA 3QVUA 1C0IA 5IEBA 4YAUA 3QBEA 4MQBA 2GWHA 1LI7A 4JYZA 4ARZA 1Y0BA 3RE1A 5MDHA 5AK6A 1GTG1 1E7YA 4BO7A 1JIUA 1VKZA 2ZJZA 4B3CA 3UH1A 2EZ9A 3QFTA 2MJLA 3JQGA 4YCAA 3DHVA 3MLBA 4M60A 1AUXA 1KU6A 1VL0A 2D5CA 3GCDA 4Q3NA 4UXIA 1WXQA 3NW9A 1BVUA 2CNOA 4YP9A 3MXOA 3UXYA 4BWGA 1MRSA 1UBHS 2ZBPA 3G0CA 4F5WA 3AY3A 5LWHA 3H9UA 3ZNNA 3A6LA 4DXAA 3SSMA 5DXJA 3EC1A 5COBA 4CLXA 4EHHA 4BAGA 1IULA 3ZIAD 1O95D 2WWGA 4EQZA 2Q49A 2RHGB 3PV0A 2G8NA 1DPFA 2W58A 4Q7MB 4G3XA 4QLBA 1RAIA 1PFKA 3HUDA 4R1OA 3JALA 4BZPA 5H59A 4ZYTA 5LQAA 5DTEA 5HS6A 5ABPA 3LPNA 3NG1A 3AKDA 1GVNB 3PC7A 2V0CA 4JMPA 4QUBA 4DRYA 5AHOA 3F7MA 1F2TA 4WK6A 3WGNA 1NJGA 3CNLA 3GLIB 1ZZEA 4P0PB 1HYEA 4H1HA 4DJTA 2D00A 3AR3A 1L0BA 1VE6A 1NBMA 3U3JA 1E9FA 2VKTA 3ISTA 1N57A 1ZN2A 3FIJA 4XCQA 5CLQA 3WGJA 5JI2E 2ZBEA 2QPOA 5CDHA 4JLWA 3ZEIA 4QODA 1S7CA 2JVKA 4BKPA 4YCBA 1VPVA 3QBTA 3B1WA 3WIBA 3E8XA 1E7MA 4LJ6A 4C3ZA 2ZI7A 1G5QA 2JI8A 1C7IA 2Y1CA 4HGRA 4EIWA 4HI0E 1MRNA 3HRKA 1U11A 5IDYA 1N6OA 2WTNA 1ZD8A 4KLNA 3CZ4A 5EKUA 3P0EA 4F86A 1AD2A 2XEDA 3QE0A 1U5AA 1ENZA 2DLDA 4TOIA 4AZSA 3H0KA 2HQRA 3HPRA 3LKBA 4MRAA 3UPTA 3D7LA 2GN6A 4EQ6A 4LJ7A 1Q16A 5NLLA 2VG8A 4W5JA 5EERA 3MIZA 4HK4A 2JATA 4DMGA 3F98A 4GMDA 3IS3A 3BH0A 3PFFA 3A9CA 4L85A 4AW9A 3HHEA 3AR6A 2WOJA 3DDSA 3K9LA 2QZ4A 4NPAA 2I3AA 1F8XA 1EP3B 2HFKA 2PSHA 3UHOA 4A2PA 1TX4B 2Z2YA 1GTJ1 1R9GA 1IZ7A 1UBNA 4X1OA 1D2NA 1QWSA 4O5OA 4CMCA 2EKQA 1PDOA 1G1AA 3OX4A 4JLJA 1Y8RA 3IV7A 4NPHA 3EA4A 1OBHA 1VPEA 1Z6XA 3L82B 2DVMA 4J75A 3RVRA 3Q1LA 5HUJA 2BEUB 2WJHA 3DVLA 1I3KA 3GUVA 4Q01A 4P0TA 1MF7A 2OD7A 1Q6YA 2XRFA 1AQ6A 2YRWA 3HVKA 2I2DA 3M81A 1DI0A 1O7JA 4L4UA 1DXOA 1XALA 2NXJA 1N0VC 1RR6A 4WE3A 1ZISA 2CLDX 3PXAA 4YHBA 3U1BA 3STHA 2YV4A 1VBFA 2V7WA 2YZKA 4YVFA 5ADUS 2B36A 2C29D 4WOCA 1K5GA 1ZM4A 3DCNA 4KVFA 5KEIA 3BB1A 5KNBA 1SKAA 2WYHA 5GTDA 3RG8A 2H52A 3P0HA 5JHGB 2YS6A 3W2EA 2XXAA 3GUCA 1QLWA 1RXUA 1TEXA 4PHFA 1Y1SA 1XYGA 1XZAA 3G5MA 2W5UA 4YJHA 1V43A 5HIJA 3UAVA 2YYYA 2Q1TA 5MN6A 1XDWA 3E15A 4PNZA 1DCMA 2YCLA 5U4XA 1L7XA 3BE8A 3OTQA 4RZSA 1O4WA 5AVYA 4B48A 2B92A 4QAQA 2JEOA 1L4MA 3L6DA 2TMGA 5JG7A 4N5IX 3UB2A 3L5OA 4RIEA 3UJDA 4UCWA 2JFQA 1DAIA 2VDOB 1ODLA 1GU7A 1VE5A 2OWEA 5CYOA 4IIHA 4MLDA 4R0NA 3VKFA 4CMIB 3R6LA 4Q02A 5LSAA 2P0EA 2FP4B 3JQAA 1N6NA 4RPIA 1JIXA 2Z8XA 5BMVB 2OGZA 1GUFA 4D25A 3D2LA 3MJHA 2E5LB 5JXHA 1EWTA 2EEPA 4P93A 5FOVA 5U1PA 4CKCA 1FMCA 1QLHA 2AEJA 2QRNA 4FLEA 2AR0A 2YOFA 4RVDA 4ED9A 2ZUUA 4HLCA 4HGZA 2WF9A 3GO4A 4D4JA 3G2MA 2IZOA 4UW9A 4E31A 1EA7A 3GJXC 3RC1A 4YB8A 1VCIA 3MYRA 3DL4A 2P6NA 3Q8KA 3FGPA 3LDGA 1VA5A 2XB9A 4DAEA 4XFKA 4JU8A 4KZPA 3SEZA 5DM60 3LDFA 4KUEA 1ZOOA 1GNSA 4Z4HA 3CN7A 3UMRA 5IWCA 1S96A 3G8DA 3M5CA 2QX6A 3I6IA 4V0MA 4NMMA 5F3RA 2QN7A 2ERCA 3SF0A 1KPHA 4I4TF 3OC6A 5EYPB 1HFJA 3WLLA 3ZY4A 1KFCB 1XXHE 2HMSA 1M8KA 2BE7A 3WGQA 4CW7A 2CXRA 3VHQA 5ESWA 2PUFA 5JSQA 1QPGA 1XVIA 2XTZA 3KWMA 2ODTX 2DT5A 1XKQA 1Z45A 4NS1A 5C37A 2G88A 1PJLA 2BZSA 1O87A 2D2EA 1MC5A 2PS9A 2YMMA 3ESAA 3FDJA 3IQXA 1RC0A 3P97A 1G8FA 2DX7A 2ROQA 3Q87B 3MS2A 2VUUA 3PR1A 4M1QA 4UC0A 3KVYA 2ODEA 4YX9A 2IZZA 2PMCA 3VNRA 2JRLA 3G9ZA 3EDOA 3L8HA 3PLRA 1IQRA 3KEQA 4QDTA 4AVYA 1OI3A 5HBRA 2JPDA 4Z1OA 1Z6ZA 3UJ3X 1AZTA 1IM8A 4TLMB 1T0HB 3K9BA 3T3DA 4NNPA 4KGXA 1N4AA 3S2EA 1C0KA 2V96A 3IDAA 4BO5A 3CKLA 1CQWA 1BS9A 3TYXA 2JH3A 4RY9A 3TN7A 4ZJUA 4FSHA 1EVLA 2Z6AA 2C2KA 3UUEA 3UJNA 3D3KA 3H3FA 4WY8A 3QXHA 3VQTA 2XYGA 5FYQA 2PMEA 1QF9A 3BCRA 4KO8A 1V0JA 4JVLA 3EYAA 5KQRA 3GLIE 5EPUA 4C05A 3M9WA 2BHTA 1WJGA 3EISA 4CL0A 3W9SA 1RAAA 3CUTA 5E2AA 1PV2A 2FGJA 2WD7A 5CJJA 3FZQA 3K09A 3K73O 3SC2B 3JAMA 3LT1A 1POWA 4H4DA 1M34E 3N5KA 4CBVA 2GASA 4MR9B 3ZW7A 1QV7A 3SFZA 2J9YB 2VUHB 3WGUA 1I1NA 4N3BA 4UPEA 2A1IA 8OHMA 3WSTA 4DEXA 3FNQA 2PRZA 2B7LA 2JZOA 4NIMA 1V5FA 3RPEA 2Q6KA 4BLPA 3FCOA 1DBPA 1RKXA 1FSPA 3LYUA 2GPWA 2XECA 1WUKS 3L8GA 4EHDA 2HMYB 3A1WA 2XYQA 3GLHB 1QFSA 2C96A 3ACBA 4M8IA 4MI3A 4EZIA 1NG9A 2WMNB 1OZ0A 3MUEA 1RWKA 1J8YF 1DNPA 2FAXA 3GFSA 3RUFA 3G2JA 3LHFA 4PPNA 4YGXB 4G1VA 5A3QA 5JFGA 1ENOA 5HKLA 2C7BA 4I1OA 2NQ2C 1XSEA 2BFFA 4DQVA 4IDDA 2XTMA 1F48A 3O95A 1N6KA 4JSRA 5F1PA 4RUKA 4ETWA 1ISFA 2GBLC 5DX1A 3N2LA 3O8DA 4D41A 1KKUA 4OFXA 1AKNA 3GDGA 1FFEA 1Y6RA 3WVNA 1XELA 2XDAA 2G1AA 1AO3A 3LC2O 1Z15A 3KQTA 3DD1A 4PAWA 4Z4QA 2MINA 3AEKB 3DT6A 3TSCA 3UMYA 1UEJA 4BKQA 5EXPA 3D5TA 4W1SA 2XZPA 1JP7A 2XKBA 1CUFA 1G63A 4IDPA 3X1KA 2A3NA 4UBOA 2NYAA 4CMEA 4UQLA 4QOEA 1CCWA 3CPEA 3WX0A 3K9QO 1KIFA 1DRJA 3GRFA 3I09A 1Q20A 1VRVA 5C18A 2BM9A 1KYXA 3O1LA 4W5HA 4MGEA 2WU4A 1MW9X 2AOXA 3IEXA 4UNNA 5E7MA 3KB1A 4TS3A 4ON9A 5EZQA 2XIJA 1G55A 4N3CA 4YIHA 3BKXA 3WLMA 1R0KA 4C5AA 1Q22A 3ZNOA 1OKKD 5BQ3A 1QF7A 5G53C 3HK2A 1VHQA 2IYOA 3O90A 4HNVA 3HJFA 5JCPA 1S2NA 2ILTA 1ZS9A 1NP6A 3NRBA 3B36A 3IA7A 4I81A 2YHIA 4X91A 1IC6A 1R9NA 3VTAA 1RQNA 1IHPA 1EIZA 1MFPA 1MG5A 4FFPA 4GRDA 4B2PA 5ERYA 1SD2A 3TW8A 1AKRA 2VXYA 1ZCFA 2CDNA 3GNLA 4FFSA 2QTNA 2I6UA 1OLSA 2ZSHA 4RTKA 1UJ4A 1PUXA 2X19A 3DL7A 2IY7A 3DVAB 4RHFA 4U2CA 1HZJA 4WZBA 4DV3B 4A36A 4JAVC 1XEXB 3QFRA 4KAFA 4G0QA 4R9RA 3KQSA 4UDYX 2R8BA 4G0XA 3EA0A 2PSJA 4EF5A 3ET4A 3RHFA 1CEQA 2Z57A 1JSRA 4DKJA 1IOWA 2VHCA 2FLVA 4R0VA 1TCCA 2NZVG 3R1IA 2GN2A 4LY9A 4BVJA 4OJMX 4V0RA 3VU9A 2H1OA 1ADYA 3JXEA 3DCYA 4MKGA 2YIJA 1RE0A 4IW3B 4P08A 4BFSA 5B3KA 4MYHA 4HNQA 1II0A 5IN4A 2FW7A 4KWIA 3NV9A 4HS4A 3GJ8A 4UVHA 3JQQA 3U4HA 3CX7A 2JIZD 4O8ZA 1JTEA 2B4YA 2J3HA 4E32A 2WE7A 4E11A 3T1QA 1S4QA 2GYVA 4XGNA 2GD1O 1E1DA 3LY8A 3MQFA 3T3MB 3NHZA 3U1TA 3ZDFA 1XCGB 2RB5A 2DM6A 4Z0TA 5KWSA 4KR7A 1XRPA 3M9XA 2GB4A 3JS5A 1E69A 5A0TA 5IAAA 2YMLA 1O6ZA 3RUEA 4P9NA 3RJ9A 1A04A 1PW5A 5H3HA 2HTEA 2WWHA 3LWZA 4NLLA 4P3PA 2ZJOA 1YJ8A 2Q46A 3GEEA 3M49A 4P5DA 4E5PA 1BX1A 4H6XA 3SXPA 3HJGA 1TAUA 1CZKA 2ZZKA 2JHFA 4CM3A 4DB2A 1OTXA 3X1DA 1DPGA 4L6IA 4UNPA 3ZU2A 5KNCD 2QKYA 3T12A 1JR2A 3OHMA 4KBYA 1W5SA 2O8VA 5DHTA 4ENRA 1KDZA 3AYZB 1TIBA 2L0XA 4WZ6A 5JEEA 2HHLA 3WWCA 1QIJA 3EAGA 1LW7A 5FTWA 5A7HA 4BBJA 4P2BA 2ZIGA 1YZLA 4NBWA 3KSMA 3OG9A 4X3PA 1QHYA 4BWFB 2FZLA 1W30A 1X1BA 4V0OA 3QEBZ 2Q9AA 2C9YA 2WUFA 4URYR 3FLBA 5JAHA 2W2PA 1VMIA 1KJJA 1ADJA 1OFUX 1HLFA 1JB1A 1KBQA 1THGA 3BDIA 4Q4AB 1JEJA 4G5RA 5I51A 2P62A 2NAFA 3LBIA 1M2GA 2ZYRA 1YAJA 5F1KA 1ZC3A 2HSJA 3GAFA 4F2DA 3ZKWB 1N5KA 1ZJZA 2OCGA 1JB9A 3EK2A 1JHPA 1IPHA 2AC7A 1Q1BA 1TF7A 2G28A 4LBVA 5K0LA 3UWDA 4GE0A 3JQCA 1ZJJA 4UM5A 1E0DA 3HN2A 1MAWA 1COZA 2BEVB 3T06B 1FVFA 1IUOA 4YP1A 7AT1A 2BGKA 3DD5A 3OQOA 3E7PA 3I32A 3UXHA 4MINA 5A4DA 5L7TA 5JV5A 1UPFA 4YAKA 3U7JA 1JG7A 4ARCA 3EWNA 1BH2A 3L1JA 1FYFA 5DNVA 3TLBA 4BEWA 5I7OA 2AXNA 2HUPA 3W7AA 2HJGA 4EK9A 2HA7A 2G83A 1XEXA 5TPZA 4RZ2A 3SDSA 3W2IA 4RANA 3B78A 3O94A 4PAOA 3AOEC 1SPBS 2EP7A 4F46A 4CMJA 4GBMA 5JSZB 1C1XB 5HQ3B 2VUTA 4JLNA 3W6ZA 2VNJA 1AVTA 2P2CA 3KYJB 1O8BA 1AIPA 1K6XA 1XEWY 2AR7A 2GZ3A 4N0QA 4X8LA 2YJ4A 5EIOA 2O0MA 3KS9A 3KUKA 1KBOA 7MHTA 1I1OA 4IDBA 1ZX1A 1UKZA 5AUPB 4LRXA 3ZI0A 3D7RA 4HYEA 1CUYA 4IJ6A 1LVGA 2VPPA 3VPFA 3FNIA 2YX1A 4YDRA 5CVJA 5LUBA 3N2KB 4Y2VA 1T3HA 3LC1O 1BDMA 3A2MA 4J90A 4OF4A 1UQRA 4PLYA 3LX8A 1U2QA 1AB6A 2VPZA 5AD1A 2GX6A 2WIJA 4MV8A 1YJQA 4KQHA 4BMDA 1B0ZA 1X15A 4IILA 2C2WA 4N12A 3ZCVA 3DMYA 2XA2A 3N7UA 1U2ZA 4Y9SA 1Q0UA 2BISA 3WTBA 1D4ZA 3AIIA 1C3LA 4GPZA 2J8ZA 2QW1A 1KDVA 1SR8A 5LLSA 2I7CA 4WI1A 3TK1A 1EFVA 4C22A 1S3FA 2GBLA 5CT5A 5KI6A 4BEVA 5BSWA 2FKAA 1Z18A 1EWYA 4LGVA 2DH6A 2PZKA 4PFJA 2D3TA 1A1SA 1A2OA 1BVYF 4IV0A 4D81A 1IDOA 2J3IA 4IEIA 3S8EA 1CKEA 2PQ2A 4CU2A 2PO7A 5HM8A 2HJSA 3GEIA 3NCTA 4K05A 4M1TA 2RGWA 5K0NA 5LP6A 4WK4B 2OV3A 3UK6A 5IVHA 1XTPA 1GV0A 3PFBA 3N2ZB 1VOTA 4XVRA 2X42A 1XR3A 1JKFA 2PFSA 3GJQA 3GYGA 3VKVA 3SXUA 1N34B 2D8AA 2BELA 3UJHA 1TF5A 4F4DA 1UBMS 4NNOA 1I4OA 1KZ4A 4H16A 4YP0A 5EJMA 4KMOA 4RVSA 1T5IA 2FJUA 3HB5X 2OILA 3H11B 1QQBA 1DV2A 2P75A 2VRWA 4IAOA 4Q4JB 3G8YA 3TZQA 3TZEA 3ZG6A 5T57A 1C7JA 3PC4A 4TMYA 1C9YA 2A0YA 16PKA 4RD2A 4OYHA 1PV4A 3QLVC 3KR9A 3OSUA 5BRAA 4BPRA 1IXZA 1SVOA 1PL6A 1POXA 3IRVA 3QTTA 3IMCA 2I3DA 4X1KB 3WKBA 3BPSA 3CTPA 4YUYA 1QPZA 1KSHA 3GJ0A 3LUFA 1XHLA 2OBXA 2Y05A 3QY0A 2XITA 3JD1A 3QF4B 2ZPAA 5DI9A 2VYVD 1YMVA 1W4LA 3UJBA 4R6XA 2PL1A 3U62A 1LSOA 4LZOA 1YVUA 3IPXA 4LBYA 3CKYA 4Q1EA 3GJRA 4XDGA 1UAYA 3ROFA 4RA6B 3WO1A 3Q15C 3H9EO 3GOHA 4U8HA 5ICGA 1P9NA 3OZXA 5LQCA 4DT1B 2QVXX 2NU7B 3FTCA 2J08A 5DM2A 1Z3IX 5A4AA 2R66A 4U2FA 3DBIA 2GGSA 4FYHA 1TJ3A 2BTOA 4CM1A 2P6RA 3FPCA 1B2RA 3R0QA 3ZZTA 4CV3A 1E2UA 1E2DA 4MQEA 3ZYCA 3EGOA 2Q3EA 3E5MA 3EZFA 1H2YA 4BECA 2AR9A 5K0ZA 4Z2AA 3DW1X 1V4VA 4I08A 2R97A 2GM4A 1XVTA 4L6AA 4RMJA 5DE3A 3SP1A 2WD8A 5BY2A 2R8PA 3FZYA 1X7WB 2J3QA 3I9V6 1IL0A 3W5IA 1DO0A 2NZYA 1Q83A 4O2RA 1ZD9A 3EYWA 4EABA 2Q0SA 3CSSA 5DRTA 5FDFA 3C8MA 3ROGA 1SEVA 3C8DA 1GXSB 2AE1A 3PT5A 1VMKA 2LWIA 4L0CA 4QQNA 5JS7A 1SXGA 2EU8A 4HNRA 3O3NB 1CQIB 4Y6RA 4PEVA 3B9QA 4CUJA 3KT3A 2BTQA 3DE7X 1C30A 4HVTA 3SPXA 5FPSA 2PKRA 4HUJA 1U9IC 4I7EA 4YAEA 1UK9A 2FK7A 3UANA 1U7XA 4CXMA 4LF8B 4C0QC 3D6FA 1KH2A 4NEGA 4K28A 5TPWA 4AG5A 1ZNZA 1G18A 3HC7A 5KYKA 4LRWA 2VQEB 1JFRA 1PG2A 2P78A 3D8TA 1WEHA 4NOKA 4W7IA 2LE0A 2VH1A 5COAA 1Z8DA 4I50F 2VDMB 3JQ9A 4G85A 3UKDA 1U9CA 3FY4A 4LRTB 4NCKA 2OYSA 1X1CA 4TUYB 5L95A 3RK1A 3BMOB 4GMKA 4JOBA 3HYTA 4BC0A 5EUCA 5JE8A 2X76A 5IG2A 2D06A 2ZJ8A 2P5SA 1AKTA 3RKRA 4KWTA 3TG8A 1YOVA 3WAJA 2OYRA 1WW3A 2WFMA 4I1RA 2IW1A 1E66A 3ZCTA 1T5HX 1ZINA 2JRCA 4MWDA 3JCZA 1L4YA 1X2BA 2AI1A 1PUJA 3BERA 2I80A 3OQJA 2EC5A 3HFRA 4Q15A 3EUFA 2AXEA 3OPMA 2XRZA 4HX2A 3PEYA 5I9LA 4EJSB 4Y6OA 1ZXLA 1WVMA 1I2ZA 4MX8A 3WS7A 4C4AA 3HCCA 3HS3A 1RQRA 4L5IA 5AJWA 3PHCA 4MVCA 2FPGB 4D8VA 2P5TB 5CFNA 3BIFA 3T5GA 4X61A 1O6BA 2VRBA 2OUKA 4IFIA 1I94B 2GFIA 4Z4IA 3ZHQA 4DLSA 1KXJA 4B83A 2Y8EA 5FOTA 1ULHA 1KY5A 1MEEA 1N7IA 1X1TA 1NN3A 2WZBA 3JVVA 3G0OA 4GOJA 1SVIA 4OBXA 1MT3A 2UV8A 1ZKDA 4BLRA 2PLAA 2GD0A 3EXHC 5FBRB 3UK2A 2QR5A 4NTZA 4DVJA 5JRDS 2BMWA 2C7QA 2A9JA 5EUMA 3GARA 5J4KA 2W6JA 4L8GA 4DR2B 4G0WA 1R12A 4D26A 1FVOA 2X58A 4CR6A 1T4BA 4EDHA 1I4EB 2WF7A 3AUKA 3QKRB 3HBAA 4XKJA 2HWWA 1ECLA 1XLVA 4LC1A 1ZIXA 1GILA 3USZA 5KPDA 2OLJA 2PPLA 1OT3A 4XWGA 1WG8A 4FXPA 1C3VA 2RBEA 3FSEA 3QU4A 4FGUA 3BWMA 4OXYA 4YJFA 5IXSA 1DUSA 1DIOB 3EODA 1M6VA 3E6AA 1NMQA 4KTTE 4MGKR 4Q1FA 4X54A 4BQEA 1THZA 4IHAA 5DWDA 4J8PA 2EEZA 4Q37A 1JHYA 4TKLA 3TLGA 1P9OA 4U0KA 1G2QA 4AKSA 2BMEA 2HMTA 3N3AC 5HIMA 3JZAA 5IM5A 5JBNA 4ZCMA 3Q7TA 1A88A 1NI4B 1W4CA 5E6SA 4PSVA 4Z0NA 1G7TA 2A88A 2Z09A 2BF7A 3QV1A 1I4WA 2H1LA 1KAGA 2ALJA 2ZI5A 2VNIA 3P2MA 1SBNE 3A0RB 3T4XA 5HW0A 2W42A 4WN9A 3ENNA 2MYTA 2GM9A 3RCBA 1YE8A 2ZI9A 3L7DA 1O6GA 4EGSA 2JFFA 1J8FA 2HDOA 3VVMA 2JAXA 3UOAB 1GFSA 3L9XA 4LYHA 1EHCA 1MQ9A 4J2HA 1QG6A 3OOJA 2Z0MA 4BVHA 4HV4A 3OQBA 3EH1A 4INAA 4TSFA 2HF2A 3O03A 2FSPA 2TMYA 4ZI7B 3A31A 3FCCA 5AR1A 2CXPA 3P5SA 3QUSA 4RXMA 3NANA 5E4FA 4QJIA 1UDWA 3EQ9A 2O23A 3N2NA 2XOKA 2XCUA 1PO7A 3HXPA 4LMAA 4FM9A 2RHJA 2AKEA 1JKMA 3WGKA 1PZFA 2EKBA 2PHZA 2ZTUA 1OFHA 1FUUA 3QUQA 3BAZA 3RC9A 3WRYA 6ABPA 1VMAA 2HLPA 3SVTA 3H8JA 3GJTA 4EHKA 1FFGA 2CL6X 2O1XA 4IDOA 2WZCA 4MUNA 4UE6A 4XQEA 4AKEA 4RY2A 3OPQA 4PG7A 2CUKA 2O8EA 4IVPA 2BGUA 5CYGA 3SSOA 3ANNA 2XDQB 5JTTA 9LDTA 2BZ1A 3AKCA 4XAQA 2WD9A 1V96A 5I7HA 1TUBB 2ID4A 4CV1A 3H9BA 1QBKC 4XQ9A 3ZU4A 1GQ2A 2BFCB 1PR1A 4RSHA 5B58T 4F4FA 1LTQA 2CXTA 3BDVA 4EP1A 1G6KA 3K3PA 4LK3A 4OUKX 4H7KA 3LCCA 3DE4X 4D9FA 1L3BA 3DLTA 1LTHR 2HU5A 4ZVQA 3EMVA 2CYAA 5GQSA 1AUVA 2AZMA 2UVQA 3IEIA 1NN0A 1H4TA 4M9UA 5GVSA 4OQZA 4H31A 1U28A 2BKAA 3PEWA 4YLYA 2YVLA 1GTMA 3T0FA 2WBLC 1C9KA 1CD5A 1G5RA 3F3SA 3NIBA 1E4VA 1E9CA 3X2SA 3GLSA 3L7BA 4NU6A 1XLTC 4PYNA 2C99A 3VH4A 5FNVF 3TBFA 4EW1A 4JB0A 3X1XA 1T6NA 2GYWA 4NG5A 1E2NA 1QZXA 1OXMA 3AL2A 1LEHA 4GXTA 1RMQA 4IMPA 3L6BA 1ZD5A 2QLTA 4XJXA 1JJAA 4HRAA 1C14A 3HUFA 9ABPA 4XGKA 4I9UA 1XFDA 5IXJA 3GCGA 3MTGA 1E6UA 1IEQA 3OQIA 3W4JA 3ANMA 2PUGA 2QTHA 1D3AA 4KVGA 4P34A 3R7LA 4B6FA 4PNEA 4X94A 5ITVA 2OSVA 2W48A 4Q5IA 2ECPA 2L2QA 4M76B 4MUKA 5DHAA 3DZKA 5T4EA 4FFMA 4X3CA 3WGVA 1VL8A 5EOVA 1A1VA 3N05A 2IK8A 5HFJA 3OZEA 3ETEA 2WUWE 4PBRA 5IP5A 4IVRA 4AMVA 2GCEA 1T9GS 2Y1FA 1X80A 4PGFA 5HJ5A 3H97A 1A8IA 4KNYA 5BWMA 3VYSB 2E4VA 2J30A 3LO8A 3KZCA 4IOMA 3DBRA 5GONA 1V5IA 5ALXA 3OZGA 1U31A 2AMVA 2PBFA 2GZMA 1XD2B 3GPCA 3LP8A 4W9NA 3M1IA 3NATA 3UENA 5DNWA 4OHCA 3EGXB 1QTNA 2MU1A 1P2BA 6CHYA 3AH8A 3IKJA 1EE1A 1E62A 1GKUB 2O2IA 1EM6A 1HTTA 2IS4A 3KB2A 4KBFA 4XVQA 1KU0A 5KTSA 4BIMA 4QEZA 3HXOA 1DQNA 1HDYA 2CFOA 5EMNA 1SG0A 3KB6A 3LHIA 5BOSA 4FMPA 3LPCA 2G6BA 3TEMA 3MUNA 4FW9A 5KAMA 1MA0A 3L6UA 4G81A 3C3DA 4V2UA 4HLDA 1G0OA 4FONA 1WA5A 3QH4A 1O9HA 3HO8A 2DP4E 4P31A 4B75A 3Q41A 2W00A 4Z6KA 4RHXA 2DFDA 2YV1A 1Z68A 2W0MA 5IZCA 4PM4A 4WW0A 3AKZA 4TZ6A 4E09A 2ATXA 4E1VA 3VNBA 3IQGX 1Y98A 1RI4A 1G8SA 1CF2O 2G3YA 3FYUA 4J0QA 5FNZA 3WBKA 1SC4A 1W581 2RD2A 2IX9A 5GOTA 5LJIA 4LYEA 1PR0A 5K03A 1PVDA 3RSSA 4CMHA 3FCXA 3PQ5A 3OX1A 4D57A 1YZ3A 2ZTVA 1M2OB 3I53A 3HB9A 1MXHA 2FWNA 4TRJA 4QBIA 2PG3A 3PUJA 4WACA 2JLBA 1M1YE 2Z4SA 1QOPB 2V6JA 3GG9A 4XDYA 2ZCVA 3BWVA 4L95C 2JZNA 1KOFA 5KJCA 2XB6A 4M6WB 2GLUA 1Y80A 3UATA 1C9DB 4LE0A 2VAXA 4C4TA 2C2XA 3EDYA 1A9RA 1XDSA 4JJ4A 5ALTA 4DCOA 1RWVA 3Q3VA 4GM0A 4M0CA 5HS4A 3IOEA 2C2YA 1QH8A 1D2MA 3A1SA 4WA7A 4O08A 3PBKA 1A77A 2XNHA 4C78A 5LQNA 4NXMB 1WCWA 2R85A 4BV3A 5B2EA 2F4VB 3L04A 3AI3A 3FHOA 2J0QA 1T35A 2HJWA 4MQMA 3KQMA 3GUUA 2YC2C 1JX6A 1L7MA 1R0WA 3EZ2A 3GC6A 4WESB 1V4BA 4XM0A 3HSSA 3BBLA 2QZPA 2EJBA 3EEFA 4MVJA 1XEFA 5DTMA 3RTDA 3ISJA 1Z7BA 3TINA 5LCXA 4E5SA 2H9YA 3A6GA 3VX4A 4EMBA 4EB3A 1R4AA 1NL3A 3G8CA 4L2IB 5JD6A 5MF6A 5C5IA 3AMVA 2NXCA 1MFZA 4ZI7F 2N46A 4GPTA 3CSDA 1TEHA 2FP3A 4X62B 3B70A 3BXPA 3EN0A 2W6OA 3MJRA 3R5FA 3N70A 4N3NA 4HL6A 1N2ZA 4LY0A 1KEPA 4FHEA 5DSXA 4HDSB 1D03A 2O2HA 3RVLA 1RHKA 2ZSUA 1HR0B 3EGEA 4MUEA 5A7GA 5HCIA 3NBZC 2RHCA 5IVIA 4DIUA 4UUMA 1M2JA 2H4WA 2SBTA 3Q3IA 3R3WA 5F64A 5K99A 3MMPA 4OQDA 3CEMA 1SBZA 3SYKA 4KK4A 5JAQA 1U9JA 2B25A 4DBZA 2R00C 2XOKD 1G20E 3WWEA 1OFIA 1MHTA 1NHWA 3W7BA 6YASA 1F06A 3IAM1 2CBZA 4B6OA 1V5GA 2TRSB 4E14A 2A4KA 4NZMA 2QTVA 1KEEA 1BDHA 2WTXA 3NASA 1FNSA 2KS6A 4IZIA 4BB6A 1WBBA 2H4ZA 4KSCA 2CCJA 4BEBA 3VSCA 4UM9B 3HFJA 1M76A 2DETA 3ZDAA 3W5BA 4ARIA 3IILA 4MWBA 1XEWX 3ESXA 3V3TA 1JA0A 1D8TA 4EYGA 5IJAA 3L2OB 1WBJB 2VAPA 1YQEA 3JRNA 5IU6A 2PR2A 1OC2A 3N1UA 3MELA 5FRDA 4RD3A 5HIIA 6PFKA 1VIYA 3T1YB 4LGMA 4ND8B 4MZXA 4TV9F 2F43B 3I1FA 3EPJA 3A28A 3L18A 1AKYA 3H19A 4J0KA