1QSGA

Crystal structure of enoyl reductase inhibition by triclosan
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
b'GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE
publication title Structural basis and mechanism of enoyl reductase inhibition by triclosan.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 88
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 1999-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1qsgA00
1GV1A 2DUWA 2VOJA 5KJ1A 3GGOA 3K96A 4S3MA 1SAYA 5ES3A 2VYNA 4RL6A 4H7PA 3NT2A 4D79A 3SLGA 1T2EA 1E1MA 4BO7A 4NMHA 4S1VA 4X54A 1FDWA 1LSOA 5JDIA 3G1UA 2X0JA 3OETA 2BFMA 4E5KA 3HDJA 3DFZA 4MDHA 2Q1WA 4N18A 4YT5A 4RPLA 4TRJA 4DUPA 1B8UA 2O3QA 3GRKA 2D3TA 1QYVA 1Y8RB 3WYCA 1ADCA 3R3SA 3H9EO 3GHYA 3UAGA 3OQBA 3FR8A 3KTDA 3BTVA 3AUUA 2NU8A 1O9BA 3G49A 1GQ2A 2VZ8A 3PQFA 5B1YA 2YHUA 5DBGA 4GWKA 1XGKA 2FP4A 2QIOA 1PJLA 5A3VA 4CQMB 3FF4A 4FGWA 5C3MA 4J9VA 2HRZA 1DDOA 3PGXA 4KP7A 3KLMX 2RBEA 3PLRA 5A9TA 2PKQO 1Q7BA 5CP8A 3V8BA 4ZRNA 1UP4A 3EK2A 2GSDA 4XGNA 1LLCA 1VKNA 2NNLD 4L4RA 4J1QA 3OJ0A 2W4QA 4OXKA 2D5AA 3GMDA 1NBOA 1F17A 1ZSNA 2VQ3A 1IHXA 1ISIA 4TZTA 3ZNPA 3DMYA 3GRPA 2HAEA 3NYWA 1I30A 4OOEA 4JQCA 3E6AA 1WP4A 4CLRA 1TT5B 2ZKLA 4WKGA 1N9GB 1UAGA 9LDTA 1V8BA 1XWFA 3INGA 3W4JA 5JMPA 2CDAA 1BDBA 1T1SA 4XGKA 4CUJA 4DBVO 2Q1TA 3CKYA 3AOGA 1DAPA 3UFXA 1Q0QA 1ZEMA 3D4PA 3HADA 2C2XA 3ITDA 5CPFA 4F6LA 4BKPA 3JQ6A 4NNJA 4F6CA 3ZNNA 5JNLA 4IIUA 1YRLA 4L8VA 4N7RA 2FSSA 3DOOA 3CEAA 2BF7A 2FPPA 4RF3A 2IRWA 5F1PA 1E3SA 3DBRA 4Z3DA 1TB4A 1G1AA 4LW8A 4UUMA 3JQGA 5ENDA 1H2HA 1U8FO 1EK5A 2DTDA 2QRLA 3PIIA 4RLHA 4ZJUA 1J6UA 2J3HA 3GA0A 1VC2A 3BHIA 3HWRA 1FK8A 4JNKA 3TJRA 3M2TA 2DBVO 5L4LA 1MC5A 4XWYA 4B4WA 3QRWA 5TJHA 3TDKA 4TZKA 1M2WA 4XR4A 1EE2A 2CDBA 3OMLA 4PVCA 2GN6A 1ZKMA 1Y8QA 2C7VA 2CZCA 5KVVA 1EQ2A 2Q50A 1TA4A 5A03A 3G0OA 4CMGA 4P22A 3KB6A 3P7MA 2O2SA 3VPHA 3GZNA 3OA0A 1ORRA 3SXPA 3C24A 2VNSA 5T5QA 4Y6RA 2GUGA 3ZCXA 4AJ1A 5CDSA 1QRRA 1P74A 1MX3A 4D3FA 3DONA 1AN9A 3O38A 5EESA 2I99A 2Y1CA 5IN4A 3DBVO 3S2FA 3LF1A 4XX0A 3QVSA 1QLJA 4Z0HO 3KYCB 1I3NA 2YDYA 3F5SA 2WJPA 3QWIA 4BB5A 1H6BA 2PTGA 4I08A 4CMEA 3VTFA 2POQX 3DL2A 1QYXA 4P4NA 5JAQA 4R4JA 4JJGA 1KC3A 4MVJA 4GX1A 4AL4A 5JW6A 1SO8A 2Q4BA 4O1MA 3FNGA 3PJFA 4IJVA 1XYGA 1FDSA 1SNYA 2GRAA 5COAA 4Q3CA 4R16A 2B4TO 4Z9FA 3AFNA 3FD8A 1EUZA 2Q2QA 5FEUA 1UXKA 1TXGA 3GOHA 1E5QA 4ZD6A 4E6PA 3FTPA 1XLTA 1YOVA 1RWBA 2YQ5A 2OP1A 1GYPA 4GI2A 2Y0EA 3ONDA 3V1TC 1K6IA 1DFIA 2CY0A 5G0SA 3HUDA 2X58A 1B26A 1E3WB 3I6QA 3UHAA 2W2LD 4YA6A 2D2IA 2JFGA 1CYDA 4JBIA 4BGVA 4ZICA 4XA8A 5I8ZA 1ID1A 1DC4A 4YB8A 1LDYA 1DFHA 3KYDB 3QA9A 4GH5A 1VSUA 3RFVA 1BHSA 2A92A 4NR0A 4I5GA 1VRWA 4IQ0A 1A5ZA 1U3WA 1E3IA 3ROQA 2JFFA 4TWRA 4TVOA 3TL2A 4CV3A 1ZK4A 1V35A 3N74A 3GNSA 4GKVA 2DKNA 4B8ZA 3DAPA 1X0XA 3HQ4O 1GPDG 2HO5A 2O48X 2PD3A 4OXNA 3INTA 2IYPA 1I2BA 4WECA 1PGJA 5G2OA 4BNGA 3SJUA 3DWFA 1X0VA 3ZHBA 2W98A 2UUOA 5DN9A 4GSKA 4IDAA 4XR9A 3LQFA 1Q0HA 4D42A 5GZ1A 4YBZA 4NI5A 4O59O 5F1KA 2YHIA 4R69A 1YE3A 3ZV5A 4YAGA 4J4TA 2V65A 2ZJ1A 3GMSA 3PHIA 3VTZA 3X2FA 2VOEA 3H3FA 4ONEA 4QX6A 3VPXA 1V3UA 2GN9A 5TT1A 4J1TA 4CLXA 3OIGA 4BMVA 1HLDA 4DQXA 3B70A 2EP5A 4MVJP 2HMTA 2X9NA 1VSVA 3CPSA 1PR9A 3IKVA 4R1SA 4WEQA 1T4BA 5COBA 3DBHA 5FI5A 4E31A 1LDNA 1QYDA 2FPGA 3E9MA 4FB5A 4Z6KA 5JCJD 2X22A 4TMFA 1FDVA 2JHGA 3GVIA 3CZMA 3QVXA 1MV8A 2GZ2A 3HN2A 3PVZA 4ZQHA 3WIEA 1DLIA 2NTNA 1YQGA 5FYDA 4D43A 3CUKA 4J2OA 2VZ9A 4XGIA 4CM5A 1K5HA 3KSUA 4H15A 4N5LA 4DMLA 1B14A 3CE6A 2OXIA 3I83A 3T4EA 3JV7A 3U0BA 1R4NB 2DUUA 4WLEA 3F4BA 1K6JA 1PEDA 3BIOA 4L76A 5G0TA 5G4LA 4EJ0A 3VKUA 2CUKA 3KEOA 2PZKA 5JO0A 2PKQP 3DZFA 1UXIA 3WTCA 1NVGA 3OH8A 3TFQA 3E03A 4PG4A 4Q9NA 5KOIA 3DHYA 2B35A 4R5HA 3GFGA 4MO2A 4J4HA 1WMAA 2IYOA 1P1KA 3CINA 5C7LO 1E1KA 5ICSA 2CF5A 4CL8A 3ANMA 4NK5A 4J90A 2C82A 2ZTUA 3LK7A 1NPDA 3FNEA 1GEGA 4YAIA 3P5SA 1N92A 3JSAA 4ZA2A 3GAFA 3RUEA 4BUCA 1JKIA 4PLVA 2JAPA 4R3NA 2BFPA 2IDZA 2O7SA 5HWSA 5JCXA 3LF2A 3O8QA 3IQDB 2I6TA 4RPKA 5COQA 4CM3A 2Q99A 3T7CA 4FFMA 3BTOA 4M49A 4O6VA 4FFNA 1NAIA 2ZK7A 3DZIA 4Y6PA 1ZNQO 4IMRA 3IUSA 5I7SA 3L6DA 3MWEB 3IS3A 2ZCVA 3ROKA 1ENYA 1N1GA 3QW2A 4CM1A 3P2OA 1LDMA 2NSDA 1KVSA 5JO9A 2LDBA 5JC1A 4CLOB 1DPGA 2B5VA 4QUKA 1HYGA 2JCVA 2AXQA 3DQPA 4IXWA 1T2CA 4BNZA 3CH6A 4GX0A 1OC2A 1QYCA 3WGZA 3ABIA 3I6IA 1MXHA 3I5MA 3F3SA 1T25A 5EINA 4G65A 2I66A 3NGLA 3WLEA 4CUKA 1NHWA 1PJTA 4DQVA 1I5RA 4J9UE 4MVJH 5L9AA 3M6IA 1U4SA 4UVIA 4DYVA 4FSHA 4ND5A 3O4RA 1B7GO 1H5QA 2J6IA 3QVTA 4A7PA 1XQ1A 3L6EA 2HJSA 4HFNA 4AFNA 5C7IO 3E5MA 3CIFA 4EI2A 4GMFA 5DP2A 4ZQFA 3AM5A 2P2SA 4GGPA 2UV8A 5JPIA 3KOUA 1E1NA 4IINA 3JQDA 4NFYA 4ZN6A 3K2BA 3COSA 3GEGA 4XIYA 1EVZA 4MVJI 4AICA 4JN6B 4CR8A 2J3JA 3SC4A 3GVHA 4I5DA 1A7AA 2AQKA 3GF4A 4MKZA 1YS4A 5I7EA 2O3TA 4EUFA 3FHLA 3WGGA 4W99A 2X4GA 1GY8A 1WWKA 1A4UA 3BMOA 4IJWA 1XCBA 1KVQA 3GPIA 1G0NA 2O3JA 3GC6A 3WOHA 1ULUA 3F1KA 1RM5A 1ZZEA 4IPTA 4OH1A 2FOIA 3GVXA 3RUIA 1HKUA 1P33A 2Y0DA 1ULSA 1BTOA 4MVJD 4MOWA 2D0IA 1VL8A 4CM8A 5IDQA 4OIMA 4OJNA 4RDIA 3QIVA 4WCFB 4HX5A 5JAZA 1HSZA 3F5QA 1H0KA 2NADA 2HJRA 4RQTA 4YJDA 2NWQA 3FN4A 3ZWWA 3ZWVA 1W4ZA 3T4XA 3STHA 5GZ3A 4J1NA 1P1IA 4E2ZA 4YCAA 1Y5RA 2H6EA 2DVMA 1LDEA 1DHTA 1EDOA 5JXWA 2IEDA 3HFGA 1WDMA 4K6FA 4FC6A 3SLKA 3Q9UA 4OHUA 4Q3DA 2NQ8A 3HSKA 4BO5A 3VOSA 4NHEA 1UXGA 1RYDA 1NFFA 5B4UA 1WXDA 1Z45A 2JCYA 5ILGA 1PL8A 3AOEC 4KZPA 1VL0A 2JD1A 4CJXA 4NQZA 4BNYA 4PFJA 2AEMA 3ZGYA 2P91A 1X14A 3HDHA 2NVUA 5HS4A 2GERA 1MFZA 4L4XA 5AXDA 3UCFA 1EFKA 3WBBA 1ZJYA 3DBLB 3GG9A 4A03A 2PFGA 4W4TA 3BA1A 4NH4A 5C7OO 1ZUD1 2HMUA 4G2NA 1JAXA 2GPTA 5LCXA 4WNCA 2Q45A 5KVSA 1GCUA 4XYBA 3DFUA 2D59A 4EGFA 1KY4A 3NDJA 1UZLA 4BNNA 3OA2A 2D1YA 5CDGA 2AQIA 3HDQA 4UUNA 1CETA 2PV7A 3I9OA 3AUAA 2YV2A 1PU2A 4WLUA 1ZIDA 1MA0A 2YUTA 1YDEA 3LVFO 3UW3A 1DC6A 3AI3A 4FD3A 3ZDFA 2I5PO 3MJEA 4YT2A 2OBNA 3WB9A 3OFSA 3S2IA 1ARZA 1KS9A 3RKUA 3RU7A 4YR9A 2HRBA 4M8SA 4UAGA 2IZZA 3EY4A 3U09A 3KM0A 4FW8A 1SEVA 1IHYA 5BQFA 4M89A 4GX5A 1Z74A 3WSWA 2WTBA 3RFTA 1N8KA 1ZSYA 3IL2A 4IQ8A 2FN7A 4PGFA 3FSRA 3OECA 3L0DA 1Y7TA 4GQAA 4Z9XA 3EVTA 3I4FA 1GZ6A 1A7KA 3GUCA 3IP3A 5JLAA 4CMBA 4BNVA 2VWHA 3EGOA 1LEHA 1PL7A 3R1IA 1QMGA 3C3XA 4OL9A 5IDWA 5A9RA 4BKOA 3H9GA 5DOZA 4MIEA 2YFHA 4XQEA 4KTVE 1ZVMA 2PLAA 3MEQA 2QZZA 1ISHA 1S7CA 3S8MA 1R15A 3DC2A 5GY7A 1HDCA 2DU8A 4CMIA 3NKLA 1H9BA 3BMNA 4IIVA 4PIVA 3B6ZA 4D3SA 2JKVA 1VL6A 3ZW9A 3C85A 1GFSA 2P9EA 4GBJA 4QXMA 5J23A 2JL1A 3RROA 1F8GA 1VJTA 5K6AC 4RVFA 1PWZA 1YVEI 3VVBA 3JQBC 1HE5A 4RVHA 3I1JA 1BGVA 4JJIA 4J7XA 5ENVA 4AJPA 1P1RA 4OO3A 4CV1A 3PHHA 4GX2A 4ALKA 2QYTA 3TWOA 4YQZA 3NTQA 1EQUA 2W2LA 1I2ZA 3ST7A 4J16A 3TFOA 3C7AA 1UXJA 5A04A 2HSDA 2HQ1A 3EAGA 4MKXA 4WJZA 2X0IA 3PRJA 1X15A 3F1LA 1I33A 2VWQA 1KYQA 3GT0A 1WDKA 1EVYA 4QO7A 4EW6A 2X5JO 2Q49A 3ITKA 3N7UA 2F1KA 1J5PA 1NVTA 7MDHA 4UEJA 3U3XA 2ZCUA 4NU5A 3ZH2A 1DO8A 3H9JA 1P1FA 3OIDA 5EN4A 4AJJA 4EEXA 4FJ1A 4LSMA 1W6UA 5I8WA 4JLWA 2Z5LA 4QT0A 2EKQA 3A28A 3DMTC 5CEFA 3NAQA 3A9WA 4BV9A 3TSCA 4CM6A 4ND3A 8LDHA 3C8MA 3WGIA 3QVWA 4IJKA 4XDZA 4B3JA 2DM6A 5L4SA 2O3RA 4PZEA 3BTSA 4LRSB 4JGBA 3Q11A 2C20A 4GVXA 4MVJG 4YJHA 1PJ4A 4IMPA 1PSDA 4XB2A 5KJEA 4J43A 4E5YA 2C07A 4F46A 3GY0A 3PXXA 3DTTA 4KWHA 1WNTA 1WAMA 2EF1A 1GR0A 3MWDB 1PGQA 2PKRA 2F00A 4J91A 4PLTA 3TOZA 4CM9D 1M76A 3GAZA 2QHXA 5L7WA 1C1XA 2D4AA 4PLYA 4YTEA 3ENKA 3FPCA 4PLCA 3ZWPA 3KYBA 4U0JA 1LLUA 5BSFA 4ZQBA 3K30A 3V5NA 5ADHA 3WTBA 1F12A 3MTGA 3ZU2A 5AXBA 4BNHA 1P3DA 1I3LA 3HN7A 5JCJA 2Z95A 3H2SA 3SEFA 3GFBA 1DHRA 2DAPA 4PLGA 4UULA 4XD2A 1P1JA 5CPBA 3C7CB 3OJEA 2FR8A 1Y9EA 2VWGA 1E7WA 2TMGA 5H82A 4PCVA 4EEZA 1C1DA 2R6JA 1U1IA 3DZGA 4BNLA 4UVGA 4HXYA 3SBOA 2WE7A 3GN2A 2ZB7A 3D3WA 3LT0A 3ZHXA 2JJYA 4B7CA 2FZEA 3DOJA 5JBIA 1W0CA 1GL3A 4IZHA 5ICMA 4A5OA 2FMUA 4PLZA 2WWRA 2EW8A 2G5CA 1NHGA 1GQQA 3BMQB 1PQPA 1N7GA 3ZWXA 2W2KA 1R0SA 1ISMA 1ENZA 1ML3A 1NAHA 1KBZA 2AEJA 3NX4A 3L9XA 2VTEA 1JA9A 3WS7A 2FPIA 1YH3A 1E5LA 3MCVA 1TI7A 5TQVA 3RAJA 5U1PA 4FR5A 3WSVA 1LRJA 4ZQEA 1Z7BA 5F21A 5BNFA 1HZZA 1OFGA 4D3DA 5IDYA 2Y68A 1Z6ZA 3ROPA 4IUYA 1Y5MA 3AOEA 4RZIA 5TJ9A 1P45A 5KCZA 1I2CA 4BO0A 4YJGA 3NRCA 1CF2O 1DRUA 3DBRB 3LLVA 1N7HA 3AY6A 3WYBA 5MGBA 4TROA 3HG7A 3JQGB 3VVCA 4EJMA 1HZJA 2I67A 2C7GA 4AJIA 5DCYA 5JMWA 2EEZA 4M86A 2JCXA 1JVBA 5T64A 1E1LA 3WMWA 3EUWA 1LU9A 4WASA 4L73A 1WDLA 4XYMA 2C54A 1U8XX 4HKTA 2EKPA 2I3GA 2OZPA 3SX2A 4UEKA 4OKIA 2XAAA 1KY5A 4NK4A 1DBVO 5G4KA 4NBTA 2ZQYA 1KC1A 3WJ7A 2UVDA 3HE3A 3K9QO 4ZVVA 4HNGA 1GQYA 5H81A 1JKFA 3KUXA 5HRUA 1B15A 4OXYA 2QRJA 3TQHA 3ICCA 2Q2VA 3GVPA 1YL6A 3GZNB 4BNIA 2YY7A 3PYMA 3F46A 2ZB3A 3S2GA 1ZK0A 3CZRA 4KQWA 4FBGA 1NYTA 4RVSA 3CTMA 1B3RA 5CFZA 4XRGA 3WQSB 3RJ9A 3I4CA 3W6UA 3NJ4A 1PTJA 4TKLA 3U9LA 2EP7A 4XJSA 4IDDA 2NQTA 2WM3A 1A4IA 2HK7A 4Y9DA 3KVOA 4IJUA 3ROMA 1PS0A 1SZJG 3GQVA 3QJ5A 5I9NA 5ITWA 4WUVA 3C7DB 3TN7A 2NLOA 1W8DA 3TL3A 1E7QA 2VZ0A 1E3LA 1HEUA 1Y1PA 3H3JA 3ZWCA 1OOEA 1D3AA 1UP7A 1PZHA 1U3TA 4XEHA 1BRMA 4W7IA 4JP2A 4BQPA 4BS9A 2C5EA 4K6CA 2J5QA 3B1JA 2WD8A 3PWSA 3UF0A 5HBRA 1PQUA 3ADPA 4LRTB 1S6YA 1R4MA 3PFFA 5KJFA 4R1NA 3PDJA 4OOFA 4OSOA 4B3HA 4R51A 4XQGA 2HKIA 1GAEO 4DRYA 5K6AA 3FTNA 3JQBA 2WMDA 5ITVA 1QP8A 1YWGO 2PNFA 2VYVD 3WGYA 3EZYA 3OP4A 1DRWA 4YYZA 3PIDA 3ZHZA 3GH3A 2P5UA 3BHMA 2PZJA 1VPDA 4ILKA 1N1EA 2I9PA 5C5IA 2I3AA 1B8PA 1DAOA 3ZV6A 3G3EA 3HDYA 2CD9A 3BYZA 5I9MA 1PJ2A 4C7KA 4I1IA 3BTUA 2PZLA 2X5OA 3NJ8A 5F5NA 1PJQA 3D1LA 9LDBA 5HM8A 3ORFA 4DPLA 3H5RA 4PRLA 3VZPA 4TVBA 4RCVA 1YKFA 3IOYA 4AJKA 1PS9A 2GYYA 4LVUA 4NBUA 1DJNA 4XDYA 4G5HA 4E5MA 2H63A 1E6UA 4A26A 3WBFA 1E7MA 3F6YA 5CAEA 5JYDA 3DMTA 1TT7A 4KWIA 1RJWA 3VH2A 4FOOA 1AXGA 5TRTA 2LDXA 2DTXA 4FFPA 2G17A 4RQUA 1V0JA 2DBRA 1EBUA 4PLFA 4B79A 5DULA 3Q0EA 2GO1A 3T7EA 3VHRA 4N5NA 1U3VA 1E6EA 1R16A 2E4AA 2NU7A 2PGDA 3GPDG 3PGJA 5A9SB 4BGEA 2QG4A 1O5IA 5FWNA 3QVOA 4UREA 1HDGO 3I9MA 1UZNA 1HSOA 5AQ1A 4YXFA 3E8XA 1X1EA 2E82A 1WVGA 2XXBA 4FFLA 2CDCA 5TIIA 3I9LA 2GNAA 2I76A 2P4QA 3QWAA 3S2EA 4NZ9A 3DBHB 4GGOA 2RAFA 1B3BA 4YAKA 3ENNA 4W9NC 1FJHA 3RC1A 3FI9A 4DIBA 3LC7O 2PA3A 1LNQA 3B20A 3FR7A 4BNKA 2QRKA 2H9IA 2DT5A 3K8ZA 3JYOA 3RC2A 1DOHA 1EMDA 1ENPA 3EC7A 5JE8A 4CQLA 4CUZA 4LMRA 1H6AA 3C1OA 4E32A 1HRDA 4BNTA 4Q39A 4AJ4A 5U4QA 1NR1A 2IEBA 1EVIA 4AJOA 1VE9A 1PGNA 4ND1A 4BGIA 1UZMA 4HY3A 4DIFA 4YRBA 5DOVA 4B4VA 2VCYA 3FBGA 2VRCA 2AG8A 5HTOA 3ANLA 3LYLA 4IDGA 4PLPA 4ZU3A 1XR3A 3IDSA 1IY8A 2A4KA 3AI1A 5IAAA 2VWPA 4BO8A 1ONPA 3DZBA 2IODA 4D44A 1R12A 4A27A 1X13A 4HADA 3AY7A 2PH5A 2VHXA 5B4TA 3JQAD 3WIDA 1PJCA 3ULKA 3ZWYA 3PFWO 4WLFA 1PL6A 5G0UA 1DSSG 1NWHA 1A27A 3EZLA 4LK3A 4ROSA 1GYRA 2NU9A 3RWBA 2OP0A 4J7CA 3U5TA 4ALMA 3OSUA 2A9FA 1KOLA 1GEEA 1WLYA 4I5FA 3PTZA 3O8QB 1WMBA 3TRIA 3BZUA 3G1TA 2ZIZA 1PS8A 3RI3A 4XQCA 4E30A 1AXEA 2EKLA 4E0BA 5EL0A 1H9AA 1NTOA 2E49A 1RKXA 3O26A 3H9UA 4CMHA 2FWMX 4U6SA 3OJLA 5G0VA 4WK6A 1OC4A 1BVRA 5JAIA 4J3FA 1Q1NA 3VPGA 3VC7A 2OL4A 3ZNQA 3IAHA 2AMFA 4KTTE 3LT1A 4RV9A 1NQAO 4MKRA 2ILTA 1YGYA 2AA3A 3LDHA 5L7TA 1LX6A 1UR5A 4NJMB 3NTOA 4TQGA 5DCWA 1C0IA 2FZWA 2VUSA 1CRWG 5BT9A 4CMCA 1SB9A 1PJSA 3RUAA 4CQMD 2HCTA 4DLAA 2Q3EA 1E6WA 3KEQA 3Q2KA 3NT4A 4KDEA 3WMXA 2BI7A 2Y05A 1ZXLA 2R00C 2EHDA 3C1AA 4O0LA 3U4IA 2C59A 5EQFA 4CM9A 2J8ZA 3DO5A 3PHGA 1ZH8A 4HFMA 4CM4A 3W8FA 1BXGA 2X8LA 3I9KA 2O7QA 4L0QA 2GDZA 4NPCA 2BFOA 5HA5A 4R1UA 4DREA 1GADO 2GD1O 4WOKA 1PZGA 3VPSA 5CEEA 1PGOA 1TLTA 3ZU3A 3V2GA 4INAA 5GMOA 3RVDA 5BR7A 3OIFA 4E13A 3BMOB 1WPQA 2V6BA 2Y67A 1NR7A 2OFPA 1DC5A 4JIGA 1IOLA 1MLDA 1E0DA 1C0KA 1EDZA 2AEFA 2Y1EA 3I3OA 3AK4A 3GR6A 3IIEA 2R2GA 2WD7A 1M75A 2YJZA 4II2A 2HUNA 2D5CA 1A71A 4DTIA 1GZ4A 1N2SA 3PJGA 2J3KA 1RYEA 2B83A 3H8VA 1XU7A 1GV0A 1I10A 2WE8A 3MJ4A 1V9LA 4FDAA 4LGVA 4YVFA 4D0SA 5LDHA 5TX7A 2AG5A 1VKOA 1D4FA 2CSUA 3DHNA 2PGJA 4E12A 1XKQA 4NIMA 5KTKA 4M1QA 1H2BA 1QLHA 2EGHA 5H83A 4PG6A 4EYEA 3ONFA 3E82A 3NUGA 4CV0A 3ETDA 4EBFA 2G76A 4RDHA 1KVUA 2B5WA 5G0WA 2CFCA 1V6AA 2EW2A 2WEKA 3K31A 4JX8A 5DBIA 4JXKA 1IL0A 4KUHA 3D3EA 5I7VA 5L51A 4DQUA 4HBGA 1U2DA 2Y1OA 5FF9A 5CDYA 2CVOA 1F0YA 1J0XO 4QQRA 2NVUB 4P8RA 4AJHA 5BSEA 1MC4A 3NV9A 3AW9A 4BL5A 1HL3A 1IE3A 2XPCA 4MVJE 4J0EA 1BW9B 4IGEA 4XKJA 2Y93A 2C5AA 3DB2A 4AG3A 2HK9A 2IE0A 5DCUA 4EUHA 5DZSA 3W1VA 5F5LA 4R5MA 1YJQA 3C1TA 4MINA 2RH8A 4DPMA 1TVEA 3L4SO 1DB3A 1Y6JA 3FWNA 3RUHA 3HFSA 2UAGA 1T2AA 3HB4X 4AJLA 1PJBA 3BMCA 3IMFA 3TZKA 1JU9A 1JVSA 1KEUA 1YQDA 5B37A 1BG6A 2Q46A 3EMKA 1Z82A 3QP9A 1T26A 3S1LA 3DXFA 3LZ6A 4M54A 3ZV4A 1ZK3A 3RFXA 4R01A 4DC0A 3RKRA 1BXKA 3LT2A 1Z75A 3GEDA 4OQZA 1DIGA 5EJ2A 4R41A 1DC3A 4D46A 4DYDA 4U8GA 3K5PA 1M67A 3QY9A 4I5EA 3VPFA 1QYWA 1AGNA 4W9NA 2DLDA 4BNJA 4Z3KA 4XRRA 4BNMA 4LCEA 1OAAA 4MP8A 2D8AA 2BLLA 1IZ0A 3TZ6A 2GN8A 3OBBA 5CDUA 2PK3A 1QR6A 3RU9A 3WNQA 3D64A 1UUFA 3GN1A 4OAQA 2OGUA 5U9CA 1UXHA 2G82A 1E92A 3ADOA 3D7LA 1JWBB 5JDCC 5F1OA 4N5MA 4OYRA 1NWCA 3VKVA 3GVCA 3W8EA 3MTJA 1Q7GA 2J5KA 3A1NA 3W4KA 3RASA 3H4VA 4GAEA 2GGSA 2PH3A 4RORA 4CMIB 4DVJA 3LT4A 4ALIA 2CNBA 3BMNB 3LC2O 1Y81A 4KUEA 3JQ7A 1N5DA 1ZJZA 3KSZO 1DIRA 4CMKA 3RCBA 3E5RA 3O9ZA 5I7FA 1QV6A 1XG5A 3GDFA 3PP8A 5THQA 1DIAA 2VT2A 1E77A 1YL5A 4J6FA 5KVQA 4OGWA 2VRCD 2VUUA 3IP1A 1L7DA 1X7GA 3H5NA 5T67A 3AWDA 5IJZA 2A94A 1SB8A 4FGSA 3WGTA 3I9NA 3KO8A 1D7OA 5FFFA 2X5KO 1FMCA 1ONOA 1DIBA 1O95A 2IZ1A 3SVTA 4XIJA 1T2FA 4OQYA 1XU9A 2VYVA 3D4NA 3TZQA 4FCCA 4K28A 2YYYA 4YEDA 4YRDA 4P4GA 1LQUA 5DT9A 4Z0TA 1MFPA 5C37A 1IB6A 5IG2A 2GF2A 2WSBA 1H6DA 4BO3A 5FI3A 3ZU5A 4FIZA 1X1TA 1DEHA 5JC8A 1T4DA 3TZCA 5IZCC 1KIFA 1ZSVA 4E4YA 3RC7A 5L95A 1HXHA 1T2DA 3NDRA 2Y1GA 4I9UA 2IXAA 1YL7A 3PHJA 1AE1A 4TSKA 4YJHB 2VT3A 4OSPA 5HS6A 1ISJA 2NVBA 2OUIA 2FR1A 3CMMA 4BV8A 3WQRA 4DPKA 2O4UX 3DDNA 5ILOA 4FC7A 4WPGA 1K89A 1T24A 4PLWA 3DAGA 1MP0A 4DC1A 4PVDA 3PLNA 3I9JA 5ER6A 4UUOA 4YAJA 4BIIA 2V6MA 4URFA 3V1YA 3JQCA 4XYLA 4CLHA 3INRA 1LJ8A 4U6QA 3UCEA 4YJFA 5AXCA 5BSGA 3GZ4A 4E2YA 4MVJF 2B0JA 1YJ8A 4MIYA 4PLHA 4DLLA 2UYYA 4BKQA 3PK0A 2Z1MA 1R0LA 2V7PA 1J4AA 2FR0A 3E48A 4CODB 3RUDA 4K26A 2EG9A 3WNVA 5B12A 1C1DB 1ENOA 4NDNE 2A35A 4C4OA 3S55A 4HNHA 1LTHR 1R6DA 2NV6A 2QW8A 2WYUA 5EERA 1XA0A 1IPFA 3WGOA 4ALJA 4WOJA 5F3RA 1XELA 4FJ2A 3D3WB 4WNIA 1FF9A 3JQFC 4QO8A 2ZATA 2RHRA 5JY1A 1IPEA 2YV1A 3UICA 4A10A 4QECA 3KSDO 2PWZA 4W6ZA 1PQWA 1P44A 3KHUA 1NVMB 1LQTA 1ADGA 2BKAA 4R9RA 3ZN2A 1JQBA 3VH1A 2W2KB 4PZCA 4EJ6A 1HWYA 3E9NA 2ZTVA 3G17A 3Q3CA 2YQ4A 4C7JA 3K2EA 3PQDA 3JQ8A 4QEDA 1UDCA 2SCUA 4R54A 1XIVA 1O6ZA 3HJAA 3JQAA 4J1SA 4RF2A 5T8KC 4ESOA 1G6KA 1HDOA 1DXYA 2YZ7A 3RUCA 1HETA 1E7RA 3E18A 5IXYA 4M87A 2VNAA 4NBVA 3JYNA 3OEWA 4ZRMA 1JWAB 4H16A 2GCGA 5IZ4A 1KVRA 1V3TA 5L7YA 4YT4A 5JS6A 2FHSA 4QSMA 4YJGB 1UDBA 4B4OA 1GZ3A 3DZJA 4CLRB 3OQ1A 2OBYA 1KEPA 4J49A 1D1SA 2X6TA 4BMSA 3A06A 3PJDA 2X9GA 1NPTO 4WE3A 3CMCO 4RO0A 4E33A 1ZEJA 3WYEA 1YONA 2YV3A 1SPXA 4D0RA 3UUWA 1I32A 1Y8RA 4MP6A 1F06A 2IZ0A 2ZYDA 2BGMA 1MG5A 5ER9A 1UP6A 3GK3A 4JBHA 5KJ6A 4XYEA 3VH4A 3OJFA 4ZHSA 1DJQA 1A72A 2CF6A 3NDIA 3OF2A 4Z9YA 2ZYGA 5G4KB 4A73A 1JTVA 3H65A 4R3WA 2B36A 1UAYA 5TF4A 1MG0A 2JHFA 3DTYA 1BMDA 3AUSA 3QE3A 3NTRA 3RSHA 4UEOA 3D4OA 4IBOA 4CQMA 5L4NA 3BMQA 4RPGA 4GMGA 2VHZA 1C3VA 4G81A 5DDIP 4JBGA 1NX6A 1R37A 3KRTA 1D8AA 1SOWA 2QQ5A 5TGDA 1NM5A 1EUCA 1TEHA 2DQ4A 1LXCA 1NQOA 1YBVA 4NBRA 3UKOA 1Y8QB 3ZWOA 1EK6A 5I9LA 3MJCA 3JD3A 4Q3AA 2HU2A 1V3VA 5AXAA 3OJOA 2PD6A 4Z0PA 5KJCA 1DFGA 1RPNA 5CDTA 1GU7A 4IGFA 3UGKA 2NUAA 2QZ9A 2FRDA 3MJVA 4DWVA 2Q1SA 2VHYA 3ASUA 1SBYA 3E9QA 2XF8A 4GVLA 4B4UA 1TT5A 1N9GA 1CDOA 3GLQA 1E3EA 2OOSA 2AE1A 4EITA 3D5TA 3X2EA 4B8WA 1FDUA 5JDCA 4LMPA 3EW7A 4CMAA 1GDHA 1U7HA 2WYWA 5A3JA 4RJTA 3H6KA 1U4OA 4PG7A 5BSHA 1EBFA 3LLSA 3GG2A 3OEYA 4IY1A 5EQDA 4B7XA 4IQGA 1NQ5A 2X9VA 3VZSA 1JDJA 4P4LA 2GZ3A 3E1KA 1BVUA 1R4MB 2EJVA 2DBZA 2NM0A 4DGSA 2YW9A 3EDMA 2V6FA 1HDRA 4GPD1 1CWUA 2ZB4A 3HZZA 3OHSX 4F3YA 2O23A 3ETEA 5DP1A 4IXTA 2GLXA 4CL3A 2ET6A 1UJMA 3JYQA 2BHLA 2E37A 3EVNA 1UDAA 1GUYA 3FRJA 1QKIA 4HFJA 4M55A 1U5CA 1YB5A 1YOVB 3DEYX 3R3JA 4IDCA 4MIOA 5AOVA 3V1UA 4ID9A 1CIVA 4EDFA 5TS3A 2RHCA 1AUPA 2ZJ0A 5THKA 4DMMA 2O3UA 1EVJA 3L4BC 1Z73A 4MJLA 2GZ1A 5LC1A 2DC1A 3Q9NA 3GGGA 4OM8A 5JY6A 1X7HA 3HHPA 1VJ1A 1MUUA 3BAZA 1RM4A 4EUEA 5L3ZA 2BELA 2BFAA 3L6OO 5DNAA 5BNTA 4FOSA 3K6JA 5IZCA 3JCZA 1XSEA 4RGBA 3KYCA 4MPDA 4N54A 1CJCA 5TSDA 4CV2A 4U7WA 4XYGA 3RBXA 1O94A 4FFOA 4OKNA 3FWZA 1YQXA 3KETA 1AHHA 2J5RA 3ZZNA 1OZAA 4E21A 1IUKA 4Y6SA 3WR5A 5K9ZA 1I01A 1LRLA 3NEPX 3P19A 4BNWA 4L4SA 2JD0A 2X1HA 4TRNA 3DZHA 3TOXA 3QWHA 4L74A 3RD5A 3R0IA 3GDGA 2AW5A 2P4HX 1GCOA 4K1LA 1YO6A 1OI7A 2B69A 4WCFC 1GUFA 3QQPA 3QLJA 4E2XA 2JD2A 3PQEA 1M6HA 4R68A 2YHIB 2YDXA 1P1HA 3ZWMA 3FBTA 5MDHA 2VRBA 4NFSA 1A9YA 2XOXA 4F45A 1B2LA 1G0OA 1PR3A 3GNQA 4O5OA 4NBWA 1NFRA 5L53A 4HFRA 4CQLB 3V2UA 3IJRA 3PZRA 3IJPA 1E3WA 3ANNA 1E7SA 5KKCA 1B16A 4P38A 3PI7A 2AQ8A 3AU8A 4EZBA 1GUZA 5BNIA 2BD0A 4PG5A 5KWEA 3AM3A 3UCXA 5IN5A 2Y99A 3KYDA 3UN1A 2AE2A 4O63O 4TRMA 3QHAA 3K73O 3SC6A 3UXYA 2Y0CA 2Y66A 8ADHA 4FFRA 5IDXA 1YBAA 3JQFA 4DA9A 2NTJA 3VAZA 4W7HA 4BO4A 4GL4A 1CQJA 2HMWA 4CR7A 1JAYA 2QYSA 5CEJA 4K9DA 2VHVA 4PG8A 3ZWBA 3PPIA 4XCVA 3RBZA 3DOCA 1YDWA 5A9SA 4BMNA 3HB5X 3RBVA 3TNLA 3AUTA 3M2PA 1KEVA 3GNTA 1ZK1A 3WXBA 1HE3A 2ZYAA 4E2WA 3OM9A 3TF5A 2VHWA 1ZFNA 3IUPA 2VYND 3ZNOA 4UVEA 5T8KA 3EYWA 2AQHA 1QORA 1FDTA 2O4CA 2X0NA 1BWSA 1U7TA 1K3TA 4BB6A 2HMSA 2RH4A 3KXDA 1GPJA 1P0FA 4BQRA 4D41A 3GEMA 1D1TA 3I52A 4J0FA 3O03A 1EEHA 3JTMA 1BXZA 4QFCA 5A02A 2NACA 3BXXA 4HV4A 3WFIA 4BNUA 1UH5A 5K0ZA 2J3IA 4U5QA 1HYEA 1CQIA 4BKRA 2X23A 1VJ0A 3ZWNA 2P5YA 3FCOA 4Q3NA 5AVOA 3U4HA 4KMSA 2DBQA 4LVCA 5T57A 5KIAA 1HLPA 2FY8A 4IZIA 4CLDA 3WFJA 1WW8A 3F9IA 3M1AA 1CEQA 1QXSA 3HNPA 3WICA 3DZKA 3TZHA 3LU1A 3G79A 2HDHA 2O50A 3OQ6A 3PHLA 4U0KA 3M1LA 3N58A 1PJ3A 3QSGA 1KVTA 2WDZA 4AJNA 2PGLA 3JD1A 3U4CA 4BO9A 1SOVA 2NU6A 2QX7A 4GWGA 3NT5A 3FPLA 3GGPA 4YAEA 4L9RA 4RLSA 5JAMA 5KNLA 1L1FA 1W73A 1R4NA 2PR2A 2Q1UA 4KDFA 1O0SA 4YT8A 3GHHA 1P9LA 3KV3O 3RJ5A 4CM4B 2GASA 2Q4EA 2CMDA 1BXGB 2WYVA 4RVGA 1NPYA 4TKMA 7ADHA 1R0KA 4GLLA 5A06A 2JAHA 1NXQA 3ONEA 3H5AA 2G0TA 4WEOA 1PWXA 2DPHA 4BVAA 2DFDA 4IS3A 1F14A 5T6BA 1ISGA 1JLLA 5TNXA 3V2HA 1NASA 1BSVA 2BGLA 3JQ9C 4XZ3A 1HYHA 2I65A 5EPOA 1IYZA 3QV1A 3EHEA 4BHTA 3CXRA 1O8CA 1I3MA 5A1TA 4BO2A 2O2YA 4ZGWA 2P68A 2XXJA 1GYQA 2BI8A 4QFDA 4PN3A 1B8VA 3H2ZA 2PD4A 4BKUA 1DRVA 2WD7B 3VDRA 5EIOA 1XDWA 4Y98A 1IZ9A 4RVDA 1SEPA 4NJMA 5IFLA 4J2HA 3ASVA 1XQ6A 1LSSA 3F4LA 2H5LA 3PZBA 4A0SA 1VI2A 3PDUA 4WLOA 3H9QA 2OORA 3PJEA 5KKAA 3B1FA 3VDQA 1ADBA 3FNFA 4GLOA 2W8ZA 3QWFA 5JSFA 3Q2IA 4CM8B 4CLOA 2EJWA 4LCJA 1Q0LA 4NU6A 4YQYA 4MP3A 3P2YA 3ZU4A 5A5EA 1EE9A 2HK8A 2ZTMA 2PY6A 1R66A 3ZWAA 4ITUA 1XHLA 3MZ0A 1MGOA 1C0PA 1E7YA 3D5QA 1PZFA 4MVJM 4YACA 1X7DA 1F8FA 1PGPA 5JDIC 1ISFA 1QSGA 1MXFA 3L4BA 1VLLA 4PZDA 3FNHA 2B37A 1LA2A 3UH1A 1ZXBA 3ZHYA 1NFQA 5DF1A 3WWZA 5KVCA 4I8XA 1ZK2A 2HLPA 3VZRA 4DXHA 3L9WA 2JFHA 5A05A 4DIOA 1T1RA 5CHEA 2B4RO 2UDPA 3ETGA 1BDMA 4XQ9A 5DBFA 1FXSA 1WZIA 3JD0A 4ND2A 1JKJA 3VH3A 4YRAA 1K6XA 2C29D 1P77A 1Q2XA 2ZQZA 3WGQA 1LLDA 3A14A 4FS3A 1AHIA 3BMCB 3PYLA 4JCOA 4ALLA 4LISA 3U49A 4WGGA 4AJEA 3WQQA 1LC0A 2EXXA 2TMDA 1WZEA 1OBFO 1LBEA 4AVYA 3ON5A 2FSVA 4BO6A 4BNXA 3RC9A 4WCFA 4I9NA 1HDXA 1JW9B 3NGXA 4ALNA 2O3SA 3D0OA 1M66A 4CLEA 3DHEA 2DPGA 1MB4A 3MJTA 2YFQA 1O89A 5IF3A 1EZ4A 4E5PA 1SC6A 4H3VA 1LI4A 4J4BA 4KUGA 3IKTA 3DR3A 4L75A 5TT0A 4UVHA 1PIWA 3JYLA 1ZO8A 3KBOA 2X86A 2W90A 2BH9A 3AU9A 3DAFA 2VN8A 3AY3A 1LUAA 3GUYA 5A4DA 1BW9A 4UUPA 4BO1A 1P31A 1LDGA 1P0CA 4R1TA 1M6WA 3RIHA 3AM4A 3PWZA 1ZBQA 4IDEA 4Q3BA 3U4DA 3JD4A 2BMAA 2BGKA 3MJSA 2VTDA 1C14A 2CVQA 3JQ7B 1OMOA 4BGUA 1H93A 3ZW8A 1HT0A 4JJFA 1K2WA 3UOGA 4D7AA 2HMVA 1K0UA 1QV7A 4WLVA 2PZMA 1LDBA 4XB1A 3DBLA 4JROA 1HE4A 1U9JA 3MOIA 2OMEA 1I0ZA 1XEAA 2C0CA 3ICPA 4TRRA 3JQEA 1SMKA 4E5NA 4KQXA 1YB1A 4NG5A 4HWKA 3H7AA 2Y1FA 3OICA 4CMJA 5LDGA 5TC4A 2RCYA 2P9CA 3RQSA 3R6DA 4JK3A 5EMHA 1ADFA 1RM0A 2BRUA 3WJAA 1L7EA 4RPHA 4YWJA 3L77A 1I8TA 4OMUA 1DLJA 3IC5A 5GZ6A 3WWYA 3MOGA 2NVWA 6ADHA 4IDBA 4YDRA 2EERA 5B4VA 3B1KA 6LDHA 3RUFA 2E6UX 1LSJA 1Q7CA 2NTVA 3F47A 3U62A 4XJTA 1E3JA 4PRKA 5L45A 1JN0A 3AI2A 1GTMA 1Y9AA 2X0RA 1C0LA 4FPXA 2EIHA 2Z1NA 1RM3A 3LC1O 1Z7EA 3I23A 4FN4A 4RF4A 1GD1O 1I36A 3ZI0A 1ZW1A 2AHRA 4BNFA 3W6ZA 5TLSA 2DFVA 3VZQA 1J49A 2E48A 4R9SA 3L07A 2EWMA 3QWBA 2X7HA 4DLBA 3W4IA 4CMEC 3WX0A 1B0AA 1U2GA 1HTBA 1HDYA 2OO5A 3PWKA 4D45A 5L40A 2C2YA 2B4QA 4DBZA 4UVDA 1U3UA 4YPOA 4IS2A 4IM7A 1HF3A 1PZEA 1ZMTA 4NFHA 4IDFA 3WDSA 4W82A 1H6CA 4B3IA 3UVEA 4BOYA 2OHXA 1YBMA 3CSDA 3JD2A 3Q1LA 3GDOA 5A5FA 4WLNA 3WG9A 3BHJA 3AFMA 4AJ2A 1NP3A 1YB4A 1H94A 3AJRA 1KERA 1LRKA 1IULA 1CERA 4LN1A 4RF5A 3TPCA 2EGGA 4JP3A 3W8DA 4Y8VA 3Q6IA 4CR6A 4E3ZA 4Q3EA 5JYEA 4YJFB 3LSYA 4FJ0A 4NJOA 4A2CA 4J7UA 3WLFA 2UUPA 2EV9A 1NNUA 4CPDA 1ZMOA 1HE2A 1VM6A 1C1XB 2R00A 1LLQA 3ZV3A 4GSLA 5CG1A 2Q2WA 1NQTA 4HP8A 1KEWA 2ZB8A 3PEFA 4QTZA 4ND4A 3KZVA 4I9HA 2VUTA 1SCUA 2DTEA 4KOAA 5JFOA 3JQ9A 1U5AA 4LSWA 4II3A 4FQ8A 1LC3A 2H1SA 1QG6A 2V6GA 4WCDA 2RIRA 2P9GA 3A4VA 3SJ7A 1ONNA 1EFLA 1KETA 4RPJA 1LSUA 5CG2A 2GN4A 1YXMA 4RZHA 1DIHA 2G1UA 4B7UA 2Y1DA 1ZCJA 2CVZA 3KLPX 4DL9A 3WGHA 2IXBA 4ZQGA 1I24A 1U28A 3PYXA 1I3KA 1A9ZA 4RVUA 3JYPA 5AYVA 5IXSA 3JQ8B 4GKBA 3K92A 4Y67A 4CM7A 2ZTLA 1PX0A 1HDZA 3JQAB 1EUDA 4HUJA 2GR9A
chains in the Genus database with same CATH superfamily
4TQAA 3GGOA 3D8SA 5D7BA 4BPRA 3DPIA 4YUVA 5TEVA 4EB3A 3NTUA 3E53A 5ES3A 2GXUA 2VAWA 3LPLA 2QJFA 3JWPA 2BZSA 4H7PA 4L5BA 5K3AA 3MIIA 1BQ4A 2YL2A 4IH9A 6GPBA 4YMLA 4H7JA 4R9UC 1E1MA 1G66A 3EIEA 3K6SB 5JASA 1JDZA 1AMUA 4I4TB 4NMHA 3COVA 4S1VA 1K7XB 3U48A 3A6DA 3G1UA 4L9SA 3VR4H 4MYHA 3NHWA 2BFMA 3K09C 4NONA 5DYYA 2GZAA 4E5KA 5KYXA 4PSCA 5EIWA 1SQSA 1E58A 1D6MA 1EX9A 1N0VC 3DFZA 4G4SP 3ENZA 1I1OA 2F1IA 3B60A 4ICIA 2Q1WA 3OX3A 4MDHA 4RNDB 4W5JA 5CA1A 3OIWA 3DCNA 4OQNA 1EKXA 1W2HA 1Y8RB 4MMXB 5P21A 2EEPA 1FRZA 2K5UA 4BJHB 3NEYA 3IJ5A 4MEAA 2ZZKA 3HWWA 1T5LA 5BW8A 1QVVA 3E8MA 4G8BA 3AUXA 3FNBA 4LNUB 2H4XA 4MGZR 3UAGA 3MD9A 4P36A 4DGQA 4X8MA 3FR8A 4I6EA 3KTDA 4JHXA 3GOQA 3UTCA 2O2IA 3ED5A 2XYGA 2NU8A 3QBEA 3GQBA 4CKWB 3BL8A 3PUKA 2VZ8A 2HC9A 4MWCA 4CVNA 1XGKA 2MOKA 4TXLA 4XPIA 2ADOA 3A10A 4KPUB 1PJLA 3Q6NA 3DEHA 3DEJA 2C9BA 5A6SB 3EH1A 3FF4A 4FGWA 3DYVA 2WMYA 1G20B 4M37A 4J9VA 2E1PA 4IAOA 4RD0A 3U61B 4J3NA 4WZAE 3BS4A 4FM9A 3GA7A 3BJMA 3UM9A 3O91A 4EF5A 1Z62A 1VKHA 4UHHA 4Q4JB 4Z9AA 2OCLA 2LVBA 3K3PA 4RKWA 5A9TA 5C7YA 4LVOA 1Q7BA 5CP8A 3FDXA 3H2BA 4WV3A 3VR4D 3AV3A 1JR4A 3ER6A 1UP4A 2GSDA 4HB4A 2NNLD 3CR7A 4RE6A 3OJ0A 2W4QA 4OXKA 5H5JA 2C7PA 1YA8A 2FJUA 3H3XA 3GMDA 4NE2A 1NBOA 4FI3C 3P2EA 5FNVA 3IP9A 4EYOA 2VQ3A 2XQGA 2E4ZA 2EBWA 2P9HA 2P4EA 2P9BA 4R0MA 1TYAE 4CGYA 3UMVA 3LXUX 4OOEA 4P9NA 4Z53A 1UOOA 3DJYA 3E6AA 1WP4A 2XVMA 5FV7A 5J2TB 1ZONA 2ZKLA 3ZHRA 1DKUA 1N9GB 1QJCA 4FMCF 4QXAA 1PG5A 3INGA 4TT3D 2CDAA 2GHQA 1WCXA 4CBVA 1T1SA 1CY0A 4F4IA 1Q0QA 1AJEA 4F6CA 5CPFA 2C2XA 1J90A 4NNJA 4BKPA 2AOUB 5C8YA 4IIUA 1JTEA 1YRLA 1HLGA 2DQSA 2BY4A 3UHPA 3ZNNA 3QE9Y 3CEAA 2P1RA 4DANA 3SAJA 1GRCA 3DBRA 1TB4A 1IBRA 1RI5A 4LPKA 4MR9A 3JQGA 5AJYA 5F4BA 5BWLA 1VCNA 1CUBA 1T36A 2HA5A 2CHUA 3P4YA 1TZ2A 4E4RA 1HQKA 1C0EA 3DTVB 2XUKA 1EFRA 1L7AA 4FINA 4GPAA 4OHKA 2XUJA 3D6VA 3NBXX 3PPVA 3VGPA 5K4GA 1FK8A 1UFOA 3W8RA 2V5UA 2RGRA 5AI5A 3RE1A 2QJTA 2QK4A 3A31A 2DBVO 4CU5A 1IG3A 1YF3A 3VYWA 3O92A 4KGZA 1M2WA 3TDKA 5L3QB 2CDBA 2IY8A 2XGJA 4H0CA 3RIGA 2XZOA 4B7AA 2RKWA 1R6AA 4WFJA 1ZH4A 2R5WA 3GRCA 1OZFA 3Q85A 3SC3A 2Q50A 3G0OA 3BQNB 1MZVA 2RD2A 1K88A 4UXJA 5BW4A 1RWQA 4DV5B 2O2SA 3CX4A 3II6X 3VPHA 4LG1A 1ORRA 1MABB 3NRBA 5T5QA 4Y6RA 1G8PA 5CFQA 1LK5A 2BKUA 4C6RA 1FTWA 2GFHA 3WLMA 2HN9A 4RVNA 1P74A 1J8DA 1MX3A 1KF0A 4UHCA 3UMFA 3DONA 3FVRA 2ZRDA 1AN9A 1XJCA 2P7HA 3O38A 3IB6A 5EESA 3VR3A 2FOXA 2I99A 3IVMA 4HUTA 1I4TD 3M6FA 3LF1A 3S2FA 1SVNA 4X1YB 5H4GA 5HNKA 1Z2NX 4K8RB 4Z0HO 1JU4A 1W2WB 1X8JA 2AYZA 2WJPA 3WMGA 4M22A 1KKUA 3TIIA 4DDHA 1JILA 2PTGA 4I08A 1BU8A 1DRJA 2Q07A 2UXCB 1N5OX 3VTFA 3IAFA 3DL2A 2GYVA 3KSRA 1TQ6A 4P4NA 2RFLA 3PI6A 4JJGA 3ZKWB 2WKPA 3O6VA 4INPA 5JW6A 2QD4A 1BHQ1 2G9VA 2VJPA 4O1MA 2HBYA 1JQJC 2QG6A 2A57A 4F11A 2UXBB 4IJVA 3I72A 5CH3A 4PTYA 5CAEB 1FDSA 1XWWA 1VLJA 3R6TA 2PUHA 2VBGA 4R2LA 3UK0A 1P9RA 2Q4RA 1TJ4A 4F3RA 2FNAA 4KI0A 3BFJA 4Q3CA 1NJ1A 1S2IA 2BR5A 5KSOA 3PFGA 3F78A 3MT9A 4EPVA 1QGUB 2PFKA 4Z9FA 5AW2A 3AFNA 2J59A 3FD8A 3D7SA 1EUZA 1P4JA 1MEJA 4FIDA 1K8ZB 1IJEA 1UBSB 3UOAB 1TXGA 2GBLC 3FOBA 4LY9A 1VIMA 4DWJA 1JSLA 3EZFA 3FTPA 1AA9A 4E6PA 2FSUA 4NKRA 2AFHB 4A6EA 4AU1A 4E7PA 2V1UA 3FNIA 3D0QA 2W2XA 1RWBA 3IOBA 3NFRA 2HSZA 4QPPA 4LOIA 4PYOA 1ZOSA 3G2HA 4FGZA 4JEMA 5H59A 4F21A 4GI2A 3SGLA 3TOSA 4LJAA 1K6IA 1JIXA 1W5EA 3E9ZA 1DFIA 1X1AA 2XTMA 3TI9A 3HUDA 4BBZA 1B26A 4FOLA 3N6RA 4AMUA 4GC9A 4KVZA 1PRYA 1Z5GA 2W2LD 2ZRLA 2Z8YM 3OJXA 4YA6A 4UJ5A 3SX4A 4AYXA 2A8YA 3OBIA 4GI3A 5KSWB 1KMHA 2ONZA 1CE8B 1IHOA 2HGSA 2VDPB 3BH7A 3DE6X 3OZGA 4YB8A 3FOWA 2WTNA 1QTQA 2QZSA 1AHNA 1T4CB 4Q1AA 2WR8A 4QWWA 5ALDA 3L8GA 2XYQA 3L41A 3H4TA 1RI4A 5A4DA 1RT9A 3RRZA 3TBKA 4M1SA 1VRWA 2BMJA 2EW1A 1A5ZA 1U3WA 4M9ZA 1C8BA 4CV3A 2GO7A 2JFFA 2MHCA 3EJ6A 3GJ0A 4PC1A 3AP1A 1W49A 3ISVA 1V35A 4IXNA 2FXVA 5FHQA 4GKVA 5KYVA 1J1ZA 2C8KA 1NQUA 2H18A 3FNQA 5G1OA 1OCEA 3JW8A 4KQCA 3W0LB 2O48X 5FL7A 1QGDA 3CLRC 3INTA 2IYPA 5EVCA 4KVFA 3KQLA 2ZIXA 1QHHB 2BP7B 2GJAA 2QV7A 3K53A 4BFTA 2I91A 1Y5IA 1H5UA 1GAWA 3DPSA 3DUFB 2IE8A 4Z7OB 1CZHA 4X7RA 4ZQCB 3SJUA 1CUFA 4KE6A 4K6OA 2HWWA 3OE7D 2QN9A 2W98A 1J0EA 1K7EB 3OIYA 5DN9A 3S68A 3HVJA 4IDAA 5K3DA 4YJ2B 3V1NA 3LWDA 1SD2A 2CXRA 2IXGA 2PEZA 3DEFA 4Q6WA 1PKEA 3R5SA 3ZV5A 1SIOA 4J4TA 1FVOA 2I4IA 5LBUA 2QOEA 3GMSA 5B36A 5BWOA 3VTZA 2AJBA 1JJFA 3Q1KA 1NDUA 1JIKA 3QVGB 4M60A 3RTDA 1XPJA 1AK1A 5DLDA 3L7BA 2WW8A 4NE7A 5TT1A 2I1QA 5FQNA 4BMVA 1UMBA 4XWAA 2RHGB 3Q8KA 3CNQS 1HLDA 2IDJA 5FWYB 1SQ0A 1AQIA 2EP5A 4LPSA 3ZY4A 2PL9A 5BV1A 5LMCA 4GNRA 4WEQA 4F96A 3L6CA 3PPXA 2VDNB 2CBZA 2ACKA 3BRWD 2ZITA 4QRHA 5COBA 3WRYC 5FI5A 8OHMA 5E1OA 1SQGA 4TWZA 2NUBA 2EDCA 2Y6UA 1U9IC 1L7MA 2QVBA 1GSAA 1JPNA 4MUIA 5KYYA 3MFYA 4Y3UA 2TRSB 1KKMA 1XI2A 3DF7A 3OLXA 3RC3A 4HWGA 3B1ZA 2XE4A 4K0RA 1PNTA 2YWCA 2DSNA 3HU3A 4QG7A 5CM8B 2PS1A 3IIIA 2W0MA 4RENA 1BWRA 4ZQHA 5LWQA 4O4IB 3UXEA 5SYAA 3CVWA 5FL3A 4D43A 3OHMA 5C8DA 3D43A 3A1TA 3UJBA 3LVBA 2MMCA 4P54A 4O2BA 2AZMA 3JV7A 4RHCA 1CIJA 4KYIB 3VU9B 2WMOB 1F60A 2BFEA 5FPKA 1WO8A 2AC4A 2O07A 3MT7A 3VKUA 2CUKA 3KEOA 4MUBA 4I0WB 2BGUA 4N8SA 1UXIA 5DRTA 3KQWA 3C6YA 3WBJA 1EAMA 4QJIA 3TFQA 1T5BA 3DHYA 4E08A 4GBED 2QD2A 3T95A 2V96A 4I81A 1I4EB 4IZOA 4K9SA 3R9KA 1LK0A 1W48A 2IFTA 3L8FA 1WMAA 3EQ7A 3OOHA 3KT6A 4ETMA 4ZYXA 4KSYA 1P1KA 2BTQB 5C7LO 1FFEA 1U04A 4DDKA 1PR6A 1LPSA 1U0GA 3CVOA 3GJSA 4EKEA 5IM4A 2DEUA 4CL8A 4JL5A 4BBPA 3U81A 4M8LA 1NLUA 4KQ2A 1VPLA 4BVEA 1J0CA 1NPDA 1UBKS 2DB3A 4US2R 4YAIA 3P5SA 3JSAA 1DG3A 4I4IA 3RUEA 2PSDA 1XEXB 2BFPA 1C9JA 1PT5A 2O7SA 4P2GA 4R3NA 3T1NA 3GT7A 3LF2A 1XFAA 4MJ7A 2IS1A 4DA7A 3IQDB 4Z4QA 4GO1A 4CM3A 3E4DA 4EI8A 3T7CA 1JGTA 5FPHA 4QOGA 4FFMA 2UYOA 3T3HA 3MMPA 1EX7A 4M49A 4O6VA 1NAIA 2ZK7A 4KXWA 2Q7DA 1OLUA 4IMRA 3WO1A 3IUSA 4D5GA 4FR2A 1EQAA 1R1DA 1P2FA 3HCWA 2ZBEA 2H2AA 1F6BA 2ZCVA 3DNFA 2ZM6B 4ZT2A 4ZXPA 1BD3A 4UAJA 2C96A 3PE3A 4PBRA 3O84A 2E4UA 3LJKA 2V7TA 3ETNA 1G5HA 3MM4A 2EHJA 5GGXA 2AXQA 1IMOA 4OJQA 5DTRA 2X3UA 5JI2E 5JS1A 1JX6A 1U81A 3R3WA 1Q6ZA 1QYCA 3M3PA 3NMUF 3F3SA 3BK1A 2XQIA 4V2UA 3JRWA 4G65A 4DQDA 5CFLA 3S1AB 4HH0A 4X97A 4ZVTA 3WSTA 1C3JA 4J9UE 4DQVA 2BSQA 4G0VA 1TCBA 3OFNA 3R0ZA 1NU8A 1XA4A 4CDGA 3N8NA 3V48A 4NG4A 3QVTA 2H11A 4A7PA 3LO8A 1XQ1A 3IPLA 2XR1A 4JT4A 3L6EA 2J9ZB 4HFNA 4AFNA 5C7IO 1DL5A 3E5MA 3GRRA 1Q1EA 1U80A 2ZVPX 4RC9A 2PXXA 5HP4A 3AM5A 1Y7PA 4GGPA 5KYWA 3DT9A 2ACWA 4HVTA 5DWVA 2JCSA 2J09A 1E1NA 3JQDA 1K2VN 1UBUS 4UMDA 1G3UA 4XCQA 1S3IA 4XFDA 3LPDA 3FE2A 1S89A 3I32A 3G2QA 4JN6B 5KZMB 3GEEA 1E2IA 3BL5A 2O6HA 3ZUPA 2RBKA 1BFKA 3GF4A 1T8PA 1O6GA 2QAJA 4GOND 5I7EA 2FR8C 4EUFA 3GLHB 4ZVOA 2CXTA 4D8VA 5EJMA 1GY8A 1WWKA 2D7JA 3IR7A 3PDCA 4IJWA 3SQLA 3GPIA 2D8MA 1FFCA 2HIGA 1UC4B 3F1KA 3U5ZB 1T5HX 2ZT7A 4IPTA 3B9RA 1KQOA 1TM5E 2V58A 4AN0A 2Y0DA 1C1HA 1PR4A 1Z5UA 1VE1A 5M29A 1ULSA 4EHLA 1GNPA 1K8QA 2JI9A 1FMJA 3CXUA 4MS4A 4TS9A 5DTQA 4WN9A 3SFVA 4ZI7F 3QKRA 4B32A 4RDIA 1KSHA 3MOSA 3QIVA 3IIKA 2P30A 2HJRA 3V00A 1T6ZA 5KOHB 4BJ5A 1KO8A 3G59A 3FN4A 1SK9A 2CUZA 3DM5A 1ZW6A 2PKWA 3N87A 1TO2E 2NV2B 3M89A 3UB4A 3ZJUA 5LUAA 2ZJ5A 5GTDA 2JBAA 3T1HB 5GZ3A 5I9BA 4J1NA 5FUVA 1P1IA 4YP5A 4E2ZA 3L7LA 4YCAA 2FPOA 1LDEA 2AXNA 1PV2A 3QUSA 1U8ZA 3KD3A 1H4VB 1UDWA 5H0IA 3CHYA 2JGEA 2I9KA 4B6QA 1Y6QA 4K6FA 1AU9A 3HBAA 1BS9A 4GMDA 4UOZA 4OHUA 3JVEA 5LP6F 4GOKA 1YZQA 3WK9A 2ZVQX 4G5YA 1RYDA 4G37A 1O3YA 1H2FA 3ZLBA 5ILGA 1PL8A 3CUYA 4DV6B 2YWBA 4P7FA 4KZPA 2W22A 1HPLA 4OMDA 1E4YA 1NUPA 1F0PA 3I34X 1K3UB 1PT6A 2V97A 1U2PA 3D6NB 3SEQA 3ZDDA 1A77A 2AEMA 2C5FA 2CFSA 4LGCA 4JBLA 1N1DA 2OCKA 1RYYA 1H2EA 2XZTA 3OKCA 4Y2SA 3MLBA 5HS4A 1UMDA 3EIUA 5JQGF 5CURA 5CXUA 3WBBA 3C8DA 3QOYA 3DBLB 3TJZA 1YUMA 1K8YB 1S5PA 3DEKA 2CEAA 5DVZA 2PFGA 3RJZA 4A03A 2XLCA 3A26A 3ODPA 5DM4A 4TV8B 2PQMA 5IC4A 4NECA 1C3OB 3Q12A 2Q45A 5JCOA 1YASA 3PCRB 3ZCTA 1T6XA 3AEUA 1V96A 1Q1QA 2X8JA 5EXDA 2D74A 4AO6A 4OGKA 2PS3A 3V32A 4EB6A 1ITZA 3GFFA 2CE7A 3VQTA 5JVDA 4TLLB 2FFJA 2VH1A 4I8IA 4XARA 2Q4DA 3I9OA 2RI6A 2ZTSA 1WZCA 2RG1A 2AL7A 1PU2A 1TA9A 2JRLA 4EKDA 3NWOA 1P5FA 4MJXA 5BUSA 3LVFO 3EJWA 3HKDB 4NMXB 2GLUA 2Z6QA 2AUMA 3TCKA 4TMWA 5LZ4A 2M6RA 4G0XA 4MQMA 4IX9A 2JDID 1PR1A 4YT2A 2YCLA 5BV8A 5CYGA 3STTA 1DO0A 3O4JA 1RHQA 2WF5A 3PC3A 4ZOLB 3SQDA 3SYLA 2HRBA 3BGDA 5FTMA 2IZZA 1E3QA 3EY4A 3FLEA 5EEHA 2ISCA 4B48A 5FV4A 1JXMA 1U7UA 1Z74A 3AMVA 3L8HA 4X93A 3NGMA 3OPYA 2H4ZA 3V8PA 3S99A 3IL2A 3OECA 4XWKA 5C53B 3TO5A 2PMWB 4BRUA 1HE8B 4GQAA 1GSOA 1WUKS 1CR4A 2HU8A 2JEYA 1GZ6A 4UCFA 3IP3A 3ZJYA 1E2HA 2I1LA 5PNTA 1CEYA 4UQPA 5DLYA 4YRPA 1ZVQA 1ECJA 1RABA 2CNLA 1SU7A 3JVIA 2FFHA 3OCVA 4WXEA 3NKFA 3N7AA 1CZRA 2H4FA 3H9GA 2JFOA 4KRFA 3RWOA 3WGIA 4BY9E 1GFZA 1KMMA 1DZIA 4JOBA 4XQEA 3K9WA 4KTVE 1DAGA 3MEQA 2QZZA 1ISHA 4QXRA 1NA5A 1N2HA 4OI2A 3G7NA 3SKXA 3W9YA 3CIOA 4B3XA 4NPHA 4X1IA 4CE6A 2P78A 3NKLA 4JI1B 4H17A 1H9BA 4DDMA 3SKVA 2JANA 4ESHA 4GNKA 3MA0A 3ZW9A 5HUJA 3A2LA 1DDGA 3HGTA 2QVZX 1FS5A 2CLCX 1Z37A 5K3FA 3ROTA 3DWIA 4EKGA 2GAJA 2GEBA 3AR2A 5F4ZA 2FN9A 4DSTA 4ARIA 4GBMA 1V5WA 1PLLA 5K6AC 5G1PA 3VVBA 4EKIA 4WXRA 1J97A 3AHGA 2GX6A 2BFFB 2N42A 4JJIA 5ENVA 3NM5A 5CXXA 5HF9A 3CRZA 5HF6A 4MGEA 3KOXA 3PD1A 4CV1A 1LS6A 3PHHA 2D0PB 3MHTA 1N0IA 3BZBA 3H9BA 4S24A 1E5XA 3NTQA 4QPNA 3CZCA 4C0KA 4DCMA 4M21A 3D2AA 2VJAA 4UM9B 1UXJA 1VGVA 5MFZA 3PRJA 1X15A 1VJDA 3G2PA 3IJEB 2IL1A 4RZUA 1XRQA 4MMYB 2A9KA 3EQ9A 1LNZA 5FQOA 1CSEE 1LPNA 4UD6A 1L7XA 1F9AA 4Q24A 3ZH2A 1YDMA 1MIOB 4IZ6A 5DV9A 1IIRA 1EPUA 1V16A 1WOYA 3DLPX 4BTVA 4GXQA 2JGNA 1QBKC 1YT5A 2VDQB 2Z9CA 2HRRA 4HEJA 4ZALA 4AKTA 4C3OB 1QOQB 1BXRB 3NAQA 1TX4B 5JZMA 1Q0ZA 3QVWA 1BKSB 1OGIA 2DR0A 4XASA 4YONB 1U0RA 2H2WA 1SWWA 1WZNA 4LRSB 4JGBA 3Q11A 4KODA 4B46A 2X41A 4M98A 4L16A 4GVXA 4QVGA 3RSGA 4XEUA 4YJHA 1WA5A 5KSZA 4D3YA 2ILVA 2HBZA 3FUXA 4J43A 1JV2B 2YIVX 3P4XA 4QHSA 1Q21A 2W2TA 1HORA 3HXMA 3DTTA 3IPAA 4KWHA 1HV8A 2GNPA 2GK6A 2Y9MB 1U3GA 1WKCA 4H1TA 4QAJA 1GTL1 4DUZB 2Q8QA 2PUGA 3MWDB 4M8KA 4CM9D 1LBQA 1PYOA 2O7RA 3WDLA 2O20A 4F0JA 2I7TA 2QHXA 2ZVJA 2D4AA 5FD8A 5L7WA 2Z98A 4YTEA 2GXSA 2VK1A 3TINA 3KCNA 3FPCA 3ZK8A 3ZW7A 3ZWPA 4C4SA 3KYBA 2OZLB 3UBMA 2AN1A 2ETXA 5G3ZA 3T8YA 1RADA 3OFND 4N49A 4C4ZA 4D81A 1QB7A 1BDHA 1LLUA 2UYQA 4O4JB 3VSDA 5FOXA 1I4LD 4RK7A 3SJZA 1NI4A 5BPFA 1Q19A 2N1MA 2P1DA 5DKFA 2RARA 3VO9A 2Z95A 1PFWA 4BNDA 1MW9X 3SEFA 2O2CA 1DHRA 2HSWA 1CFJA 3O21A 4RKQA 3ZCPA 3I42A 1FJGB 2DJ5A 5NULA 3OJEA 3GGCA 3INNA 3UPTA 1FVFA 4AQ7A 5CFPA 2AG1A 1X1SA 1Y9EA 2VWGA 1T6NA 2AUNA 2YHAA 4IVNA 3W5SA 4PQEA 2IF2A 1PAUA 2YNMA 3BBLA 2ZRMA 3DZGA 4E5NA 3AHJA 4UVGA 2VCEA 3K0FB 4JGIA 5DFAA 3SBOA 3GN2A 3GCGA 1GG2A 3TTUA 2WAYA 2ZB7A 1C7FA 3D3WA 4NAHA 3QHQA 3ZHXA 1T8YA 3NOQA 4BMXA 1NE7A 1WMFA 1YK0A 2EWWA 2VBIA 2WC1A 5EXPA 1XPUA 2FUNB 4MJ3A 2E3JA 4B7CA 2H2DA 1MRNA 1J20A 2DMRA 4IZHA 2WILA 1XTJA 2MT9A 2JW5A 4K5QA 5K3CA 1YJAA 4JBYA 4A5OA 1US8A 5FOUA 2FMUA 2WWRA 2WU8A 5B7QA 2EW8A 2Y71A 3I5YA 1DEOA 1NHGA 1GQQA 3GCZA 3R20A 1DO2A 4U7GA 1KZ7B 1KJQA 3C5HA 4JXJA 3UNXA 4B82A 1TECE 2FZ5A 3A1WA 3H17A 3PXCX 4BMCA 4B6SA 1GG5A 3LTNC 1NAHA 1GFIA 3G2KA 3L06A 4LEIA 4MPJA 4ZOCA 1KJYA 2ATIA 3QKTA 1YVDA 5TQVA 5HZMA 3DB1A 2H1CA 3B1WA 4IDPA 3DDZX 1ZINA 3L1IA 1FFHA 3RAJA 4QU8A 4X1KA 4ZQEA 1Z7BA 2AWNA 4LZWA 1NUQA 3EUFA 1UADA 1ZCFA 1KDYA 2NUAB 1PI3A 2NIPA 2Y68A 3EVDA 3WE7A 3GBSA 1YZYA 1RWOA 1Z6ZA 4G0QA 4JQYA 1Y5MA 3AOEA 4RZIA 3GLGB 2HXGA 1BOFA 4UQLA 1Q6YA 4BO0A 4Y2XA 4FMDF 3NRCA 1PJRA 2A30A 2JKYA 1ZX1A 1HA3A 4TROA 2OGZA 3WC4A 3VX3A 2I67A 4D99A 5I4IA 5HFJA 5JMWA 4P84A 4ZXFA 5AJXA 4M86A 2C98A 1ZU5A 3FVVA 2G71A 2IX3A 1C7EA 5TE9A 3ZXUB 3EUWA 3PNOA 1W94A 1O87A 1QJ4A 2PVPA 4YRLA 1WDLA 1WUIS 3K1YA 2OB2A 1E3TA 4UEWA 2ETVA 3L79A 3NOXA 4G5XA 3B3AA 4TZ6A 1NXVA 4HKTA 4QRDA 4DLVA 1SWVA 2OZPA 1L4FA 4UEKA 3SX2A 2R7LA 2ZBQA 4OXXA 4OKIA 2XAAA 3D8HA 5G4KA 4NBTA 2ZQYA 4IQ4A 2NTYC 4HJXA 3QXCA 4HX2A 2QBYB 3JPWA 5TQ0A 1V7PC 1ZKDA 4EY4A 2C2KA 5L3SA 1WPGA 4C30A 3BH0A 1B15A 2QVGA 4OXYA 4AW9A 1YL6A 1Z6GA 1SVLA 2X42A 2YBEA 3WWOA 2VJYA 4EENA 4RJTA 3WLRA 3PYMA 4MULA 3HXQA 3O1JC 3TX6A 2ZB3A 4KBGA 4IX1A 4C3VA 4TQUS 1NNLA 1RRPA 2AC7A 3KOZA 2Q5CA 4RVSA 4WY5A 2JH3A 4WWHA 3N6XA 3ZCVA 4XRGA 3ZR4B 3H75A 1N36B 5K09A 1P60A 4L7VA 1PQYA 3OE1A 2M2IA 4YNBA 1E1YA 3C6KA 2AMVA 5AUPB 3H4MA 2NUTA 1XMVA 4LRQA 1OAOA 5IAJA 2A6PA 1A4IA 1A9OA 4Q19A 4AWAA 4LBYA 3CVJA 2P9JA 4IJUA 5F2KA 1PS0A 2LKCA 3PNYA 4NOLA 5I9NA 5ITWA 4GKJB 2YJGA 3O31A 1QX3A 1AGRA 4ER3A 1A9QA 3TN7A 3BICA 3FWKA 1W8DA 4UOQA 2FSFA 1LBHA 5B57C 3EIHA 3H3JA 4FEGA 1HEUA 1Y1PA 3CZPA 3IYLW 1OOEA 2B3TA 3L0CA 4PAMA 5I3ZA 1PZHA 1ZVKA 1U3TA 2COKA 2WAMA 3NHMA 1VG0B 1JDBC 2XF2A 4W7IA 1SBTA 2I87A 4JP2A 4BS9A 1NU6A 5JR3A 1PVVA 2QW1A 2C5EA 2RGUA 2XDAA 3FWHA 3H4IA 2WD8A 5EJFA 5HE9A 3SHWA 4FNAA 4LF4B 4Q00A 3M1IA 1LVUA 2DZDA 2ID7A 2NT4A 2GHIA 2FH5B 5IYZF 2JLUA 1V11B 1XZJA 1R4MA 1WR8A 1ODCA 4JC5A 2FMIA 1F2TA 1VCMA 2EL7A 2V54A 5D1NA 3HP4A 5CDYA 4KFCA 3T9CA 5GONF 1CKEA 3CB4A 4R51A 4XQGA 1BEUB 4D98A 5BYKA 4E3WA 4QDTA 1QTNA 3FTNA 3SBDA 4CTJA 1O95D 1L9KA 3X2SA 1RU3A 4KYTA 4BP3A 1POXA 4Q6BA 4OYHA 1RHKA 2PNFA 2VYVD 4MR7B 4OK6A 4RD1A 5K99A 1G1MA 1L3IA 2XODA 3DFIA 3EQ8A 4LJKA 3VZBA 3U7FB 1USIA 4ZO4A 3EXG1 3STVA 3G9ZA 3QBJA 5EP4A 3ZHZA 2G06A 1GAJA 4EVIA 2P5UA 5M2QA 2PZJA 4FUQA 2C2WA 5JSHA 4OA5A 2OV1A 2YX1A 5IC6A 3CX7A 2XWJI 2B0CA 2I3AA 1DAOA 5EZYA 3KZKA 2KB0A 3G3EA 1PV4A 4H4DA 3LHIA 2F59A 4K40A 1J2JA 3UMMA 3BYZA 3RVBA 4YCJA 4DR2B 1PDOA 4UCQA 4BX2A 1I4DD 1W9HA 1EK0A 2ORVA 3MQ2A 4C9BA 3JQQA 5F5NA 4KXMA 3HBMA 3HZRA 3ORFA 4DPLA 1FP1D 3H5RA 4PRLA 3VZPA 4D4GA 2IYUA 5K0JA 1W34A 1YKFA 3IOYA 5KX5F 1PS9A 2X6QA 3AFHA 2A2ZA 1N6RA 1Y3IA 1YRWA 2ZSBA 3LKDA 4XDYA 4RJJA 3DF9A 4G5HA 1MVNA 4MRSA 2IV2X 2H63A 2O0LA 2R85A 4ZEXA 1E6UA 3HGMA 4E5MA 5CB4F 1KI7A 1DG1G 5JYDA 1CNFA 3GUVA 3PNSA 5IUNC 1NMYA 3DMTA 4KWIA 3A7EA 1SIWA 4M0PA 1KXJA 2J0VA 4DMCA 5CCBA 5T6MA 2DBRA 1T5IA 1ESCA 2P4SA 3CF0A 2HTFA 3I2HA 7REQA 4B79A 1YU9A 3V1KA 3ZDZB 5H9WA 3FCAA 3HJTA 2C2HA 3WRVA 3GLIA 1THTA 7MHTA 3TL6A 1KTVA 2XYHA 4F8EA 5KO2A 2PGDA 3FYCA 4RIGA 2BCEA 3OTWA 5AI9A 1G42A 5H80A 3UAXA 3ZK7A 4BGEA 4HVCA 3PTAA 5FUWA 2C4HA 5CNIA 3I9MA 4HYTA 4LTDA 2E82A 1Q91A 5JANA 1JRLA 3FDFA 3KWFA 3G2NA 1SCDA 3QXHA 3WAJA 3ZJTA 2GNAA 3QWAA 4NZ9A 4ZZ3A 1THZA 1P18A 3AGQA 3R9XA 2NSLA 1CULC 4ZAWA 3ENNA 2YWFA 4Q37A 4W9NC 1LV7A 2QMHA 4FEYA 4QYIA 1S3SA 3D7RA 2QLBA 2ZEJA 3BGOS 2QRKA 1X2BA 3A9RA 3AR9A 4P3PA 2QM8A 4QYWA 1XFDA 3TLZA 5FOSA 1USVA 3BFXA 4XIGS 2PT7A 3RC2A 3EC7A 3NWPA 2JHAA 5IKXA 3FOFC 4NYIQ 4IEEA 4CUZA 3T99A 3IQGX 1TUBB 4LDPA 4EL5A 3OO1A 2P6PA 1FXWF 3K0BA 3K35A 4AJ4A 2WIJA 1KI8A 1G9XA 3N39C 4BNTA 1TVMA 3USZA 3PGKA 3BAFA 4A6PA 4M38A 5K4AA 4CN8A 2HMYB 4BGIA 4D02A 4KK4A 2A0KA 2H4JA 4HY3A 1UF9A 3LIPA 3RV4A 4BLWA 5DOVA 2P3OA 2C9OA 1UM8A 2ECOA 3EH2A 4CTMA 3A9TA 3JAWB 2B6NA 3IA2A 3PRHA 1OBVA 4ZZ1A 3ZJ4A 3LYLA 2YNMD 2X0DA 4UZSA 1XR3A 5DLPA 4CF4A 2JLXA 5BWNA 5EXTA 3B6EA 1G98A 3I01M 1MGPA 1QO9A 3DZBA 1G6HA 3PXBA 5C8VA 5TPZA 3TECE 3IO3A 2Q1YA 4YXWA 1EAYA 3F8TA 4HADA 4M0EA 4UTNA 3VUFA 3WZ2A 1ZL0A 1C81A 1ODTC 3JQAD 1PJCA 5FH9A 1U0OC 1PL6A 4WOBA 4OGFA 4MWTA 1O95C 5JBQA 4Q02A 1GRQA 2CJWB 2ABWA 4HLDA 4QJ5A 2OP0A 4M0CA 1P4RA 5CVDA 4BVLA 3U5TA 1Y5NA 1GUDA 2PKXA 1UWKA 5IK2D 1TM1E 2A9FA 3OSUA 1WLYA 3MQ4A 1KOLA 1JHUA 3O8QB 1UPAA 2BOVA 2PGXA 3A2MA 3K4HA 4IVRA 4P1ZA 4R98A 5CK5A 4EG1A 4FFBA 4UFPA 4TYWA 1SRRA 1JE1A 2EKLA 2ODAA 5EL0A 2E49A 3H9UA 1Z2OX 5LB2A 4L3VA 2YXBA 3ORSA 3EXEB 4FB4A 3OJLA 1YQWA 5DTEA 3M9LA 1G3RA 1BVRA 2PYDA 1IM2A 4B0PA 4PGAA 4F4DA 4TL8A 1ZN8A 4J3FA 4PE5B 2G40A 3C3KA 1DQNA 3VC7A 1YRBA 1IXSB 1M83A 2VDVE 3HVKA 3IAHA 1WQ3A 4KC0A 2G63A 4NEGA 3RVRA 4TYNA 3KAPA 1NT4A 1YZHA 3EOAI 1PFYA 1X9IA 1NQAO 3IV7A 1FSGA 1QCDA 3K8QA 3OMWA 1FUYB 3MT8A 3OLVA 4MKRA 5H3HA 4K9NA 2R7KA 4BLPA 1UR5A 2C3OA 3NTOA 4QOFA 1XQYA 2DWQA 2BJHA 1XKTA 1GM5A 4U2FA 4U39A 1N2OA 1P2TA 2VUSA 5ICFA 1O5OA 3KR2A 3RUAA 4TMVA 1DRKA 2HCTA 3C41J 2Q3EA 4UARA 2FMHA 5AHRA 3RW9A 2QRGA 4ND8B 4I4NA 3VDXA 2WKSA 4GOJA 3NOVA 3P9RA 5AIBA 3D8UA 5EXEA 2BHNA 2BI7A 2Y05A 3IEUA 2OLEA 5JTUA 2V9PA 3FXAA 3NHAA 2PX5A 4L2IB 1JFLA 3U4IA 1WBBA 1VGQA 2OHVA 3C6ZA 3K4QA 5JMOA 1IN6A 3I62A 2GM3A 3KR0A 1VXOA 3PHGA 4CM4A 5LDDC 2GF9A 1MAAA 2XMDA 1BXGA 3MMXA 4H7EA 3W8FA 2X8LA 1XALA 2WT8A 1QFYA 1J8YF 3EC2A 1Z22A 3V6LA 2OAEA 4RAQA 3F96A 2PX8A 3K15A 4CKXA 1JMKC 1XD2B 4NPCA 3UPUA 2BFOA 1JIQA 3DTNA 3WGVA 3UQYS 5KU1A 5HA5A 4HNRA 1NMXA 1GADO 3IDFA 3KOMA 4R1UA 1OWMA 4Z1MA 1F5NA 3HUEA 3EN0A 4X3OA 2QSYA 1DGQA 3V2GA 4INAA 1TZMA 5GMOA 3RVDA 4ED9A 2ZRKA 4EA7A 5AT1A 1KH2A 1EB8A 4MB0A 3BMOB 3SZMA 4A0FA 1GGHA 2ON6A 3LHFA 3QI7A 5I7UA 2GF0A 1TYDE 1J8FA 2V6BA 2A9JA 3K9HA 4Y0NA 4DMHA 1SHKA 4EQ6B 1KH1A 2WJAA 2XMPA 4C88A 1ZDMA 1R8QA 5AJZA 3SP1A 1LW6E 1D2EA 3I3OA 3I05A 5DK6A 3W3AH 5JCPA 4HAXA 5AO9A 4BE4A 4RM3A 2WD7A 4QOSA 2BBOA 1V1JA 3UIEA 1EJ6A 3L04A 1KKLA 5GV8A 1C9EA 3PJGA 4O3FA 3UJ9A 3LXRA 2B83A 1YIAA 1GV0A 3AHHA 4MGHA 4HNTA 1V9LA 5HGJA 2ZR7A 4LGVA 3ERCA 4YVFA 5LDHA 2O8EA 3MTIA 2XRFA 2R4TA 3FHJA 2AG5A 4FZVA 1D4FA 1YMVA 3DHNA 2C4TA 4DR4B 3N0WA 2PLFA 2R62A 2FPSA 3FOCA 4JSTA 3W2TA 1CUVA 2VFAA 3ONFA 4J3JA 3RSFA 4S0XA 4CV0A 1W4CA 3RAEC 3SHOA 3D8RA 2OXFA 3NVAA 3LBAA 2XDQB 4EBFA 2CNWA 5C9ZA 1EFUA 4RDHA 3A4YA 5KTNA 1MTZA 1VKRA 2I8AA 4UTRA 2B5WA 3QVVA 3EVGA 2WEKA 1CJTC 1XDGA 4I55F 1H8HA 2APJA 1RRMA 2CFOA 2WFMA 4L8YA 5DBIA 4RSHA 4MWDA 2IZ7A 4HBGA 4DQUA 4LYGA 2AYYA 3W3AD 1CNEA 4KIGA 1R0YA 4RZQA 3AY0A 5EGNA 3DLAA 2NVUB 3HR4A 2XV1A 3S2ZA 5CBPA 3THWA 3COPA 4BL5A 2XSZD 2XPCA 4FDVA 2PWBA 3S2SA 1ZVJA 2XZDA 1AKEA 4Y2PA 2C5AA 3C74A 2OC4A 4FSDA 1WCYA 2HK9A 2IE0A 3CR3C 3ZBTA 4EUHA 3VYSB 1TDJA 2OXEA 1V3QE 4ZCRA 3OE4A 4F4FA 3W1VA 4EG6A 1YJQA 2Z57A 3ITEA 1KI6B 1CUIA 3KB1A 3C1TA 3GJRA 2N46A 1Q12A 2EFDB 4DPMA 3LCRA 1TVEA 3L4SO 1GRNA 1V4NA 3U4QB 1Y6JA 3FWNA 4QEKA 1WW2A 4QGGA 3RUHA 4DAOA 4QVIA 1NXOA 2JASA 1T2AA 1TTQB 2UAGA 3HB4X 1BN7A 2FK7A 2LP4Y 4MQUA 3SFZA 5BSVA 3I9V1 3U4AA 1U2ZA 2ZYWX 3TZKA 1JVSA 3RAPR 3Q5GA 2MYUA 2H57A 3SM3A 2CHQA 2ZWPA 1W36D 1BG6A 1V6SA 2ZS7A 4N3NA 3BUSA 4WAUA 3RYFB 3TMAA 3AEQA 1J5EB 5LKAA 3LZ6A 4LXIA 4M54A 2BBTA 1ZK3A 4NH0A 3UXMA 4EO4A 3MC1A 4UBNA 2XWPA 1MX9A 4HN4B 5TARA 1BXKA 1FRVA 3LT2A 4HAYA 5AKXA 4OQZA 2DWUA 2HDNB 4X6XA 3UV7A 4HLQB 4R41A 2B99A 1H2ZA 3IVRA 3K5PA 3VPFA 1EA7A 3PGMA 1RFGE 2GOYA 1P2VA 3VR6H 1AGNA 1TD9A 1KU0A 4JC8A 4KXLA 2F7SA 4PN7A 4BNMA 2IVFA 3KQYA 4LCEA 1OAAA 4XM1A 5BMOA 1K3FA 2W8BA 3KT0A 1Z2DA 1BWQA 2RH5A 3DE5X 2PZEA 4UHBA 5BOSA 2OUKA 3L92A 1QR6A 5CDUA 3RU9A 3WNQA 3D64A 1E9CA 2QD3A 3GN1A 3NYQA 4C0HA 3B6IA 3MJFA 1KY3A 5KAMA 5E7IA 1Y1SA 5JDCC 2GTHA 2SKDA 2WP0A 4OYRA 5F1OA 4BMOB 4DXAA 3ETHA 3TQSA 4RK0A 1HNZB 2IX9A 2X5NA 1TM2A 1Q7GA 2BT4A 1L8OA 2HF8A 3A1NA 1MQAA 3GV0A 4XFJA 3ZOKA 2C92A 1QHYA 5F35A 4GAEA 1FSFA 2WUWE 2GGSA 3ILYA 3JRNA 4PYMA 4JV5B 5LYJA 2Y0BA 3LT4A 4CIVA 2Q3CA 3E7WA 3LC2O 4KUEA 4CQNA 1KE1A 2WBLC 3X1YA 3K05A 1JQKA 3A58B 3O9ZA 3DAHA 5BQ5A 4DMUB 5L6MB 1XG5A 4P34A 5THQA 5H7XA 3WV4A 3QW4B 4J6FA 3D6FA 1A4RA 3F8SA 4OGWA 4E03A 4KDCA 3KWLA 3HR8A 4H1HA 5FFNA 1F7VA 3VR6D 5MN4A 1BN6A 1R00A 4EBBA 4MWOA 4BE7B 4EABA 4UTXA 1NZDA 4WA8A 1D7OA 2X0FA 1F3LA 4L4ZA 3SVTA 4MI1A 4ETIA 4PYJA 1T2FA 4OQYA 3OD1A 3OC0A 5FI1B 4EPRA 1JBQA 4K7JA 4PCAA 1C8VB 4JLVA 1YHNA 2OQRA 1KIMA 2WIFA 4IIYA 4DEXA 4Z0TA 5C37A 4F7DA 1QCZA 1QIFA 3QPUA 1O6CA 4W1PA 4A8TA 1LI5A 3L8MA 2NSYA 5LMNB 3UATA