1QT9A

Oxidized [2fe-2s] ferredoxin from anabaena pcc7119
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
b'ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN I
molecule tags Electron transport
publication title Refined X-ray structures of the oxidized, at 1.3 A, and reduced, at 1.17 A, [2Fe-2S] ferredoxin from the cyanobacterium Anabaena PCC7119 show redox-linked conformational changes.
pubmed doi rcsb
total genus 26
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 1999-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qt9A00
2H89B 2N0SB 3AE4B 3AEBB 5G5GA 4C7YA 1VLBA 1DOIA 1ZP0B 2W3SA 3LB8C 3EUB2 4JX1C 1N63A 1E10A 4US9A 1YQ3B 3LXFA 4ZHOA 1DOYA 1I7HA 1KF6B 2WDRB 4C80A 2BS4B 1RWSA 1QOAA 2L52A 3DWMA 2DWQA 5EE3A 5EE0A 3AE9B 3P1MA 2PKOA 1JALA 1QOBA 2E3TA 2PVGC 1E9MA 1JROA 1FIQA 2MH7A 4N58A 3VRAB 1GPXA 2DBYA 3AEEB 3AB5A 2WDQB 3AE5B 1B9RA 2WS3B 3AE7B 1J7BA 2Q5WD 1FM0D 1R7SA 2B76B 3AE1B 3FAHA 1J7CA 1VDVA 1ZUD2 2MJ3A 3ETRA 4N59A 3KWLA 1E0ZA 1AYFA 1L6UA 1CZPA 3WCQA 1V97A 3HRDD 1YJIA 2JX5A 1TYGB 2CJNA 1EWYC 1PFDA 4IDIA 3ZYYX 1E6EB 2K5PA 2W3RA 4N6EB 1JW9D 1J7AA 3AH7A 3NRZA 1ZXIA 1OQQA 3SFDB 2CU3A 4US8A 2MJEA 1N62A 2W54A 3NVWA 5H8YE 2HTME 4A9AA 3B2FA 1UWMA 3AM9A 2FBWB 1F0ZA 2LEKA 1FRDA 1XLOA 1RM6C 2H88B 3B2GA 3CIRB 3BIID 3L4PA 4YSYB 5H92C 3VRBB 1OQRA 1WXQA 1QF6A 3P4RB 3P4SB 1NENB 1FFVA 2WQYB 1L0VB 4HRSA 4KX6B 1FRRA 1TJEA 4P6VF 1FXIA 4ZOHC 5EE9A 3VR9B 1PUTA 2ACZB 1L6VA 1IUEA 1XO3A 4YSXB 3AV8A 1QOGA 1NI3A 1DGJA 1N60A 1GAQB 1N5XA 5MPOA 2KAJA 2WU2B 3W9CB 3AE2B 1YJJA 1SIJA 2WLBA 4JWUC 4JWSC 5AUIA 1FFUA 3AEDB 4YSZB 1WYGA 1JWBD 5C2TB 1JRPA 3AE8B 1PDXA 1FMAD 1XLNA 1QOFA 3AEFB 1WRIA 1AWDA 3AE3B 4YTNB 3W5UB 2WU5B 2OHFA 3VR8B 5EE1A 3AEAB 4ZHPA 2BS2B 3P4PB 5AUKA 3HUIA 1TKGA 3W5VB 4YXDB 2Y5CA 2QJLA 3DWGC 2G1EA 3SR6A 3P4QB 1OFFA 1VJKA 2WDVB 4HROA 1FXAA 2K9XA 1CJEA 4C7ZA 2AX5A 2MJDA 3AMZA 1YQ4B 1KRHA 2JQRB 3B9JA 4YTMB 3HVZA 4USAA 1NYQA 2QIEB 3PO0A 4WQMA 1A70A 1JQ4A 1NVID 1RFKA 2WP9B 3ABVB 2KMMA 1TKYA 2M19A 1DOXA 3RPFC 4YT0B 1QT9A 1WGKA 1L5PA 3AN1A 1T3QA 1QLBB 3AE6B 4WWMA 3SFEB 3NVZA 1FO4A 1N5WA 1ZOYB 2CJOA 1NYRA 2M56B 2PIAA 1SF0A 1E7PB 4FXCA 1XLPA 1N61A 1V8CA 5GXGB 2W55A 1XLQA 1TKEA 1RYJA 1ROEA 3CWIA 3FC4A 3NS1A 2EKIA 4YTPB 3AEGB 3NVYA 5C3JB 1WWTA 4LTUA 3P63A 4ITKA 3NVVA 1JWAD 5G5HA 2BT6A 1NEKB 2K22A 2PVOD 2BS3B 1KFYB 3AECB 2L83A 1SB3C
chains in the Genus database with same CATH superfamily
1LQBA 1E90A 4ZHOA 3UINB 3I57A 3Q3NC 1HXYD 3DBHI 4OVZA 1QOBA 4QAYA 2VRRB 2NBUA 1WZ3A 3IAM1 2ASQA 2KLCA 3NUHB 4PYUA 2L8JA 4EUTA 1WSPA 1PYWD 2BKRB 3FAHA 3BK2A 2FCQA 3VUWA 1HTQA 4E71A 1YIWA 2Y5PA 3BINA 1GUAB 4GDLB 3BYTB 1ACCA 4ANXA 3GB1A 3I9V1 3VRBB 2FCSA 3P4RB 1WYWB 1KH0A 1N6ZA 4PS3A 4W9HA 4GU2A 4M0WA 4YSXB 1C76A 3W1SC 3UGBB 5C23A 4KKJA 3LYYA 1L0XB 4EKUA 3VUXA 1A5RA 3ML9A 2ZW1A 1SEBD 3LJ3A 3W5VB 2ZCBA 1WR6E 3M95A 1J19A 2DZJA 1GB4A 3DWGC 2CKHB 2KTFA 2N7EA 4I6PA 2IGGA 3B9JA 1F9JA 3C0RB 2TSSA 1EO6A 2BYTA 1JQ4A 3HM6X 4RMAA 3ZVVA 1L2NA 2ZPNA 1T3QA 2KTRA 1TS5A 2X8XX 2XBBC 4D2KA 2V9HA 2RGFA 3V60A 2DYBA 1V49A 2IDYA 5J18A 4HDOA 4GDLA 5AZHA 4P1BC 2WXRA 4WAFA 4C56C 2PKOA 4MH8A 3B08A 3VRAB 3AEEB 2NVUI 2O6VA 3PRPB 2L7RA 2GBJA 1AN8A 2N9PC 2ZNVB 1E0ZA 1CQVA 1X1MA 1V97A 3HRDD 4X57B 2ONQA 1ZXIA 3SFDB 1C4AA 2ZVNA 1K51A 2KFJA 2HTME 1TY0A 4MACA 2WXLA 1SBBB 3B2GA 4B0MA 4YSYB 1P1AA 3DBLI 2DAFA 4P16A 3ZJVA 1NENB 4GDKA 2KK8A 1L6VA 2OJRA 3A9KB 1UBQA 3ZJUA 1FNUA 2KLGA 1YJJA 4W9KA 4B0EA 5IN7A 2D5GA 5G2NA 3ZRCA 3AE3B 4YTNB 1Q1OA 2C9WB 2WU5B 3A4SC 3P4PB 4J3OD 3NOBA 4XDDA 1OFFA 1ZPSA 3DBHB 4UDUC 1FXAA 3L0WB 3UIOB 1PGAA 3M63B 3RUIB 4KIKA 3HIZA 2KJ6A 4ZDVA 1NDDA 3R7RA 4WQMA 2G45B 3PTFC 1WX8A 4MSMB 4R3DA 2IJ0A 1WGKA 1L5PA 3AN1A 3M62B 1FCLA 2MCNB 2AL3A 3MHZA 1SF0A 2LHEA 1WMHA 3NZUA 5CHFA 1T5XD 3NS1A 1EWCA 5HKHA 4OZAA 4MM3A 1NEKB 1Q10A 2ZCCA 1SJHD 2JU6X 3AEBB 5G5GA 4ZYSA 3Q3FA 4G0NB 3H9DA 1C3TA 1WIAA 2L52A 1C1YB 3P1MA 3RCZA 1XF5L 2M1MA 1MHHE 2K39A 2X38A 4BOSC 4FJVB 1R7SA 2HJ1A 5FR3A 2IPKD 1ZUD2 1WJ6A 1WF9A 4MH0E 4FLHA 4LDTB 1MJDA 2A5UA 4HJKA 3VH4B 1EWYC 2BYEA 5BMHA 4FADA 3TMPB 1T0RC 4JIOU 4XGAB 4W9DA 1KTKA 2CU3A 1R4MB 4EEWA 4TKNA 4B6WA 2DENB 3N9YC 3I63C 1L4ZB 4KKIA 1OGWA 3PVLA 2Z0EB 2I1KA 2KVZA 4WWOA 4REZA 1FRRA 2IGDA 4MJSA 2ACZB 4CO7A 1BT0A 1XCQL 2J52A 2PLPA 3K9PB 4BKSD 2MLBA 1XD3B 4E74A 4MGZE 2J0KA 4W9CA 3DBRI 4MM3B 1WR1A 2I1JA 3D32A 1QOFA 3BWUD 4IM3A 2J4XA 1PQSA 4LK0M 2JT4B 1UUPA 2BQQA 1OTRB 3BK1A 2KWUB 3V3XA 2WWZA 3IAS1 1M4VA 2KNBA 3QC8B 3VQIA 3T3OA 2JYTA 3Q6BA 2PE9A 2L3ZA 3RZFA 4DHJD 2NMQA 4IOIE 3WAOA 4ZRKA 4L1BA 3PZ8A 2RD0A 2A4ZA 3H6NA 2HD5B 2N9LA 1AW7A 2AYOB 2KFKA 2M0XA 1PGBA 1QQRA 1F52A 4A20A 4GGQA 4AQ7A 4DHZE 3M3JA 4C80A 2KWCA 2D3AA 2Z8LA 3PRMB 1KJTA 1IGCA 2KWVB 3MC0B 3QA8A 2LWPA 4IW0A 3Q8EA 4DHZB 4RF0A 4LNNA 4HCNB 1C78A 4N59A 3WCQA 3EGRA 1D5ZC 3ZYYX 3UQAA 2Z59B 4A8XC 3NRZA 3DBSA 5IO9A 4HJGE 2MJEA 3URYA 5BYRA 5GMVA 1IP9A 1C9FA 2LEKA 3OJ3A 4A55A 4TUUA 2G9HD 3MTNB 4ARCA 3AU5A 4K7WA 4KZCA 3PHWB 1L4DB 2QHOA 1N60A 3SU8X 2D07B 3IFWB 4M02A 2KWDA 1WGHA 1MHXA 2D10A 2XK5A 5EE1A 2KX3A 1UF0A 3RNEC 3ZNZB 1XCTL 4HXDA 4F7ZA 1YQ4B 4FN2A 5HG2A 2LGIA 2BBCA 2V1YA 4XWTA 2WP9B 4B9KA 1XQQA 3Q8AA 5AEKB 2CHZA 3Q69A 5IP4D 2LGYA 1E7PB 3N1XC 4FXCA 5GXGB 1WI0A 2JXXA 2EKIA 1WWTA 4I6LB 2JY6A 5HI1A 1WGRA 3KLSX 3NHEB 4BAXA 4EE2A 2PMVA 3QHTA 1GC7A 2RR9A 1RWSA 5EE0A 3P42A 3DVGY 3JVZX 1FIQA 5JHAA 3DBRB 4TQ1A 4ICVA 1V1PA 4WWPA 3H7PB 1TY2A 1WGGA 3VVWB 3TEZA 2GBRA 4IKGA 2I2YA 4IDIA 4N6EB 1JW9D 4US8A 2MBQA 1YJ1A 3WAPA 3A9JB 3AM9A 4WAAA 1FRDA 2H88B 3BVMA 2DZMA 3PREA 5L95C 2J7QB 4F8CB 5LNK1 1E7VA 5EE9A 2XK5B 3QWZB 2GMIC 1P9DU 3S2AA 2BTEA 4II2B 2INCC 5CHVC 3L10B 4NQKE 2NBVB 1WRDB 3R3MA 3VTVA 1JRUA 3DOWA 1HZ6A 2BS2B 4OZBA 1HQRD 3T3NA 2MEKA 1QKZA 3AMZA 4EOYA 3QQ8B 2MSED 4HWIB 1SJED 4USAA 3PO0A 4KDLB 4KSKC 1TKYA 3L13A 3RPFC 3IHPC 2SAKA 2M56B 2KJRA 3AU4A 2QMTA 3CWIA 2INDC 3FC4A 2XNAC 4YL8A 2BYVE 3IG3A 5G5HA 4EZKA 1ZW7A 2BB6A 2IO2B 3BY4B 2LRWA 3U7ZA 3VDZA 5EE3A 2LUMA 1EF1A 2UYZB 5DPSA 1I4RA 1R4NB 2ZNVC 2ON8A 2C60A 1GPXA 1EU4A 3U7DA 1B9RA 4DK5A 2BPSA 3TL5A 1D4BA 4MDKE 2DYMA 4II3B 2WXQA 4AP4C 1F1HA 5I4DA 1U4AA 3RT3B 4XDCA 1KLVA 2O2VB 3CIRB 1ISNA 3Q2AC 1V5OA 5CX3A 4FHJA 4WH4A 3GS2A 4N9F4 4ZOHC 2PPHA 4NAWA 3W1YA 1DGJA 2LGDA 3NS8A 3ZLZA 3WA0A 3AEDB 2L76A 1JWBD 4OVVA 1V81A 3ZDMC 3MC9A 3FKYA 1YX5B 5EDSA 2LASA 3ZRFA 2G4SA 1WM3A 2MJDA 1C4PA 5G55A 3GP7A 3IVFA 2HDEA 3APDA 4RGTA 1WJNA 4S17A 1TT5B 4MEMA 4BOZB 2AWTA 3DBLB 2M17A 4NY0A 4ANWA 2JZPA 2BF8B 1Z2MA 1TZ1A 4ZYNA 2LVQA 1K8RB 1C4CA 3SHQA 2JRIB 3MP9A 4HDQA 3QCAA 3ALBA 5E6NA 1E8ZA 1V86A 2C7HA 1I42A 3CF6E 3DVNV 4P1CC 3QARA 1YN3A 1Z5SB 5BO4B 2WS3B 2Q5WD 4IC7B 3U4EG 2LVOA 1WGYA 1P3QU 4OW0A 4FJZA 1M94A 1B1ZA 1K53A 2D3CA 2FIDA 2V4LA 3LDZE 1E7UA 3N32A 5DPWA 3NVWA 1SGHA 4A9AA 4P7IA 3Q14C 2AQ2B 2N4FA 4MJSB 1YOVB 4LCDE 3VHTC 1MI0A 2NPTB 1K52A 3VH3B 5D94A 4J6IA 1KOTA 2YLMA 3AV8A 1YQBA 4NPNA 2KD0A 3OAWA 1P98A 1WM2A 1P0RA 5AUIA 3EECA 4HPMB 1CMXB 1DYQA 2LRUA 1TTNA 1F77A 2L0FA 1JRPA 1FMAD 3HHMA 3AEFB 3PZDA 4GXBA 2Z0DB 2OHFA 2REXA 1TKGA 3MJWA 2QCZA 3ZKJC 1VJKA 2HJ8A 1KLUD 1CJEA 1Q0WB 2MHJA 2EMSA 4F1SA 4PK1A 2R2OA 3H7PA 4H2AA 2WXIA 2ZPYA 3L54A 4HKQA 1RFKA 3DVNU 1QT9A 2INPE 4W9IA 4ANVA 4M8MA 1SSNA 2CJOA 4ARIA 1WX9A 3RZWC 1ESFA 3Q3MC 2W55A 5J2RA 1KM7A 4RM8A 3AXCA 4HLEA 4LTUA 4CYEA 2PW9A 3BYYB 3A9KA 1RLFA 2W3SA 3LB8C 1WJUA 3VAWA 4US9A 1ET9A 3E56A 3WAMA 1DOYA 2BS4B 2WX1A 4MT5A 1JROA 3RI7C 3ZNHB 4KIKB 3ZQ4A 3AE1B 3KUZA 2IY0B 2MJ3A 4IUMB 2ZW0A 3ZXRA 2PJHA 1TYGB 2WXJA 1WY8A 3HK0A 3ZW3A 2V3NA 1N62A 1UWMA 2DLBA 2K1FA 3SR6A 3UI3A 1SE3A 1OQRA 3PLVA 1FFVA 1WFYA 2IBIB 1VZ6A 3U8ZA 4KVGB 2FE8A 1AARA 2WU2B 2KDBA 3KYCD 1FFUA 4RFBA 4B95A 1HTOA 1WYGA 4M01A 1L0YB 1Y8RC 1XLNA 1VD2A 2AQ1B 4ZHPA 3Q8BA 5DPTA 2KYWA 2Y5CA 1RRBA 2IO0B 4MSQB 1SE2A 1D5MC 4WURA 1YX6B 5E6JA 3I5JC 1JMLA 4OVUA 3PZ7A 1OQYA 1H8CA 1DOXA 2JSVX 5C1ZA 1E5WA 4GB9A 3AE6B 4RNAA 2K25A 4EZJA 3JYUA 1LXDA 3EHVA 2WGSA 2RPQA 3P63A 2RDBC 3SD5A 2O2VA 4ZRQA 4ZRIA 4BBNC 5JXVA 3V62A 3TEWA 2KDEB 4CHKA 2FCNA 1GJZA 4AJWA 1UNSA 1VZ7A 1VLBA 1ZP0B 2WXHA 2N7JA 2WXKA 1I7HA 1D3ZA 2MH7A 1T0SC 2JRHA 3AE5B 1VZ8A 4LNOA 4DXFA 1I4GA 2MBHA 3V6EB 4BKTA 1K50A 3ETRA 1L6UA 4LLGM 3ZXVA 3H1UA 1PGXA 3IT4B 2L1AA 4DWFA 2V3SA 4HPLB 2PTLA 2QC8A 1OQQA 2DNFA 3RNBC 4RGOS 2PE6B 2JWUA 2K6QA 1GC6A 1I4XA 1V6EA 5AZGA 2BWFA 1IUEA 1XO3A 2LD9A 1QOGA 1JWSD 4WJQA 2KAJA 1MPEA 4GSWA 2N7DA 5FK9C 2LXCA 3AE8B 4BKSA 1WRIA 3DVGX 3HUIA 3N3KB 2FAZA 2WDVB 3B1LX 2K6DB 1WXAA 4KV2A 1KRHA 1UGJA 2JQRB 1E8WA 1NYQA 3TBLD 2QILA 3IXSA 3GZNB 2KMMA 1JWUD 4LJOB 4ACFA 3DHIC 5KHOA 2MWSB 3DDCB 1QLBB 2AL6A 1TIFA 4WWMA 4TQ0A 1HZ5A 2CHWA 2GBMA 4DQOC 2RDHA 1RYJA 4ZRJA 2R2QA 3GE8C 2K8BA 2W9NA 3O13A 1TZOA 2K0PA 4Q2JA 4C4VA 4M00A 4C7YA 4DDGD 2EELA 3WIMA 3LXFA 3RNGC 3PPAA 4M0WB 2E3TA 2PVGC 1I4PA 4JL9A 1T0YA 2WXMA 4DHJB 1IBXA 2UWQA 3ZNGC 1J7BA 1J7CA 1IYFA 1UZXB 1STEA 4L2YA 4ASWC 3RD2A 1VCBA 3Q8FA 3CMMB 2D3GA 2BGFA 5H8YE 2VH2A 3WANA 3B2FA 1QZEA 3EA6A 4G3XB 2Y5BB 5H92C 3P4SB 2IYDB 2WQYB 3AULA 3GOEA 4P6VF 4TV3A 4KGRA 4WWNA 2FCMA 2KDIA 2DZKA 3GE3C 1E8XA 4K3BA 3DQVA 5FKAC 3VUYA 2KN5A 2KX0A 3JSVB 4JLCA 2J42A 1LM8B 3KH0A 3W2DA 1SE4A 1WH3A 2RSUA 1WE6A 2KQSA 2KJHB 1UH6A 2JF5A 2HTHA 4IG7B 4K7UA 3OLMD 5JH5C 2MP2A 5IAAC 3APCA 2MA9B 1FD6A 4C4VB 1GOZA 2KO3A 1NI2A 3L17A 3NZ3A 3BZDB 4E3CA 1VR9A 1WE7A 4K7SA 1S3SG 5LXHA 3EUB2 1E10A 1YQ3B 1MFWA 3TEYA 2NPTA 4FHKA 4IM2A 4W9LA 4GOCA 2N9KA 2KDFB 1E9MA 3SEBA 5IOIA 2GB1A 2QEJC 3A1QA 3AE7B 1TBEA 1LO5D 2LI5A 2JX5A 1EU3A 2PEAA 4GDKB 2GBKA 4LNIA 2FBWB 1F0ZA 4LNKA 4RM9A 1XLOA 1RM6C 5D3DA 2MW5A 4KX6B 2KQ4X 4NJ6A 1PUTA 3AI5A 1KLGD 4G11A 3RYTA 5MPOA 2BYFA 1SIJA 4JWSC 4GN1A 1ZKHA 4NJ7A 2BWES 4YSZB 3MFGA 1BUIC 4XE0A 2DAJA 3PHXB 2VZKB 5KHQA 4OZCA 1ZE3D 4A3OA 3W5UB 4NQLB 3DPDA 4W9GA 1Q5WB 5FR6A 5AUKA 3P4QB 2L05A 2LVPA 4GMVA 2GBNA 2JZ3B 2WNMA 1EM7A 3ABVB 3H7SA 3UQBA 4HKZE 3QK0A 1NYRA 2INNE 2IZVB 3VXWA 1I4QA 3R2IA 1N61A 1XLQA 2JUOA 3QIJA 1LGRA 3NVYA 5JHBA 4KGTA 2K22A 2KC1A 3AECB 4L23A 3RNCC 1G6JA 1P7EA 1SB3C 4IWPA 1MG4A 1DOIA 3ZDTA 5LXIB 3KWVA 3OG5A 4A6QA 3APFA 5J17A 1L7YA 3V6CB 1HEZE 1QOAA 3DWMA 3N1ZC 1MVKA 4BVUC 2RDGA 3T8MA 3AB5A 2WDQB 2B76B 4PS8A 2N9EB 1YNTE 3X0WA 1JWMD 1V1PB 1AYFA 5BYQA 1UWXA 1LFDA 2WXFA 4I6NB 2W3RA 1J7AA 1GNUA 3TEXA 2YEPF 4XYCA 2KZRA 4NAWB 2KDMA 3QAQA 1OEYA 1RFAA 3T9LA 2M8SA 1YMHE 2KACA 3VTWA 3B0AA 1ENFA 1C79A 4FBJB 1WZ0A 4RF1A 2LHDA 2LFIA 2JYEA 1D6EC 3KQ4A 1PDXA 4NZLB 2ZVOA 3L08A 4WIPA 3RNFC 3BVGA 2G1EA 3DCGA 1CK1A 2O6VB 5HFYA 5D3IB 3KYDD 4BFRA 3GZNI 4JQWC 1V9JA 2LGSA 3SFEB 2DHZA 2PIAA 4RH6A 2MQJA 3RN9C 1ZGUB 3U2SC 1TS2A 3MC8A 4TSSA 1ET6A 3C8YA 2ZZPB 1J8CA 2HE7A 4JX1C 4EFOA 2NBWB 3JSVA 2DWQA 2J53A 3C19A 3Q8CA 3HM3A 2R61A 2WXGA 4N58A 1V1OA 2DBYA 2QSDA 2BW2A 2D3BA 1SIFA 1FM0D 3NY5A 1P7FA 3RULA 4YWGG 2LGXA 3J9CA 3PS6A 5CTRC 4NNJB 1H4RA 1ZXHA 3ZTDA 3PV1A 2VH1A 4MGYE 5BMIA 3SDLC 4DDID 2W54A 2RPVA 4KGSA 1ZDVA 4S0RA 4HPPA 2ZEQA 1ZDXA 1L0VB 1TJEA 1YD8U 4A3PA 1V5TA 1TGZB 3TJPA 2AEHA 3NG0A 4C00A 4IWQA 4JWUC 2B3AA 2JPHA 4NJCA 3V61A 2J0JA 2L0TA 5C2TB 4WJPA 4RCOA 1EF5A 3DHGC 4YXDB 2SEBD 3RNAC 1UBIA 2I38A 4HROA 3ZJTA 2K9XA 5HHDG 2KN4A 3N30A 3A1QB 2QIEB 1A70A 1NVID 2G4DB 2OOBB 2M19A 2KTRB 2MX2A 1TS4A 3IBEA 2UU7A 2JVCA 1IBXB 3EC8A 4XZ4A 1F2RC 3ECIA 5LLIA 1XLPA 3N20C 4JE3B 4XX5A 1V8CA 1TKEA 2C7MB 3AEGB 2LUEA 2IO3B 3ENEA 4ITKA 2KHWB 3R7QA 3UF8A 4MGKE 2DX5B 1KFYB 2C5LC 4ANUA 2L83A 2KC2A 2WYQA 2N0SB 3VTUA 3EFUA 1N63A 1FNWA 1KF6B 3ONSA 4XWWA 2IO1B 4WQOB 4K3CA 1JALA 2KFKB 3TCAA 1JCKB 1UD7A 2MBOA 5D6JB 3KUCB 3R66C 2OJWA 3FILA 2GOWA 3KWLA 4URKA 2FUHB 3TUOA 2C7NB 1YJIA 1FCCC 4DBGA 4HEA1 2MBEA 3CSFA 1HA5A 5DCNA 4GLSC 2K8HA 1QF6A 3W1SA 2AQ3B 2WXPA 3K9OB 1WXQA 3PGEA 3NZSA 1I4HA 2WDTB 4GIVA 3KVFB 1FXIA 4K81A 2JWZA 3E9SA 5T8IA 2DZIA 1NI3A 4M8NA 3ZNID 2KVRA 2KQ7A 1WMHB 2E6XA 2WLBA 4HK2A 3OWEB 1SXTA 3MJ5A 1YN4A 3IT6B 4PT5A 5L83A 2BB5A 4CQNA 3VR8B 5IA7A 3AEAB 4JPSA 2LJIA 4C7ZA 2K8CA 2NS5A 1S1QB 3EFCA 4AUQC 4MGIE 2MBBB 4A90A 2G3QB 1WXVA 4FULA 3RMKC 3U52E 3I3TB 4YT0B 1Y56A 3OJ4B 4WJNA 2EMTA 1EUVB 4KSLC 3NVZA 5CHWA 1XT9B 4LDTD 4PYZA 4BBNF 2KXJA 2CS4A 2D2QA 2CU1A 2KT7A 3NVVA 1JWAD 2YEPB 1T6BX 3QX1A 3ZO5B 4ICUA 3JW0X 3TSSA 2H89B 2L00B 4BZAA 2BVCA 3ZUNA 2N9XA 2GI9A 3Q3JA 5TR5A 2IGHA 1I35A 1BMLC 1FEHA 4KDIC 3RFZB 3AE9B 2EKEC 3PLUA 4FA6A 1D5XC 4NAMA 4RGNA 3X23A 1R4NI 4LJPB 5E6PA 3U30A 1OEYJ 2WXOA 4BKGA 1FNVA 2LJ5A 4AWJA 5DPRA 2CJNA 2W82A 1UGMA 1E6EB 2K5PA 2VZKD 5AZFA 4O1NA 3AH7A 2FIFA 4RGMA 1QILA 1C77A 1WXSA 5TSSA 4K1RB 2KOXA 3V05A 5D2MB 3UIPB 4DXAB 1UELA 3VR9B 2M0AA 2N1WA 3PT2B 2V0GA 1SE9A 2XN9C 1GAQB 1N5XA 2L32A 2NTTA 1GB1A 3W9CB 4XC2A 4DXGA 2NTSA 1T0QC 1FPYA 5JZEB 2CR5A 3TIXA 2J0MA 2V3PA 2ICIA 2AX5A 1WGDA 2LZ6A 2KMCA 4YTMB 4FJYA 4HCPB 1RAXA 2CHXA 3O65B 2BKFA 1F2RI 1FO4A 1N5WA 4JGHB 1ZOYB 4AOFA 4TMAB 2FNJB 4IM0A 1XXGA 4YTPB 3A9JA 2K3UA 3HVDA 4G50A 3R2TA 5BYSA 4OHJA 3QJZA 1IPGA 2OEDA 1YN5A 2PVOD 2BS3B 4W9FA 2M4NA 3BVZA 3AE4B 1E8YA 4HVBA 3ZIMA 4LNFA 4AS1A 1MG8A 3H8HA 2QDFA 2WDRB 2WHIA 1WX7A 2DYOA 4KZ0A 1WXMA 1GG3A 2NCNA 4ZRPA 2JZZA 2IY1B 3CSTA 5IKCM 1VDVA 3ZGZA 2V4IB 2LXAA 1CZPA 2RMMA 1NBFC 1V2YA 1J0GA 2KKCA 1PFDA 1R4MI 2GLSA 1HE8A 3A4RA 3WALA 2MP2B 5E6OA 2KANA 3MHSD 3L4PA 1V80A 3BIID 4PS7A 4HRSA 3DHHC 1BXTA 1WJ4A 3KW5B 2D11A 1FXTB 1TS3A 1IGDA 4AJYB 3AE2B 3P2BA 1AWDA 4WJOA 2XEWA 2N1VA 2YVCA 3N1YC 3NJTA 1VRAB 2ZJDA 2QJLA 3PRZA 4W9EA 3R8BA 2MRPA 2GRIA 5D7GA 3HVZA 3KUDB 3Q3OC 3A33B 3FILB 3L16A 3ML8A 4IWOA 2WX0A 3VFKA 1XEEA 4EZLA 2NR2A 3ZTCA 2WXNA 1ROEA 4MELA 5C3JB 2FUG1 2BT6A 2JXTA 2Y3AA 3PSEB 5BMGA 2LMCA 2KMAA 4W9JA 2O6VD
chains in the Genus database with same CATH topology
1UNSA 1VZ7A 1VLBA 1ZP0B 4EE2A 2PMVA 2WXHA 4JX1C 2N7JA 4ZHOA 2WXKA 1I7HA 3I57A 1HXYD 1RWSA 5EE0A 2DWQA 2J53A 4OVZA 3Q8CA 3P42A 1QOBA 1FIQA 2R61A 2WXGA 2MH7A 1V1OA 4N58A 2DBYA 2QSDA 4TQ1A 3IAM1 3AE5B 3NUHB 2BW2A 1VZ8A 1WSPA 1V1PA 1PYWD 1FM0D 3FAHA 1I4GA 3BK2A 4DXFA 1K50A 1TY2A 3ETRA 1P7FA 4YWGG 1L6UA 3TEZA 3J9CA 4LLGM 4IKGA 2I2YA 1PGXA 3IT4B 2L1AA 1ZXHA 4IDIA 4N6EB 2Y5PA 1JW9D 2PTLA 5BMIA 1OQQA 4US8A 4GDLB 2W54A 2RPVA 4KGSA 3BYTB 4RGOS 1ACCA 1ZDVA 3AM9A 2JWUA 3GB1A 3I9V1 1FRDA 2H88B 1I4XA 3BVMA 3VRBB 3P4RB 1ZDXA 1KH0A 1L0VB 1TJEA 5LNK1 5EE9A 4M0WA 1IUEA 1XO3A 4YSXB 1QOGA 1C76A 1JWSD 2BTEA 2KAJA 4KKJA 1MPEA 4JWUC 3LYYA 1L0XB 4NJCA 5FK9C 5C2TB 3AE8B 4RCOA 1WRIA 2ZW1A 1HZ6A 1SEBD 2BS2B 4YXDB 3W5VB 3HUIA 2SEBD 4OZBA 1HQRD 1GB4A 3DWGC 3T3NA 2I38A 4HROA 2MEKA 2WDVB 3ZJTA 2K9XA 1QKZA 5HHDG 2KN4A 3AMZA 2IGGA 1KRHA 1UGJA 2JQRB 3B9JA 2TSSA 1SJED 4USAA 1NYQA 2QIEB 3PO0A 2BYTA 1A70A 1JQ4A 1NVID 2QILA 3IXSA 2KMMA 1TKYA 2M19A 1JWUD 3RPFC 1TS4A 1IBXB 1T3QA 2SAKA 1QLBB 4WWMA 4TQ0A 2M56B 1F2RC 1HZ5A 1TS5A 4DQOC 1XLPA 2RDHA 4JE3B 1V8CA 2QMTA 1TKEA 1RYJA 3CWIA 3FC4A 4D2KA 2XNAC 3AEGB 4ITKA 2IDYA 5G5HA 2BB6A 1KFYB 2L83A 3O13A 1TZOA 2K0PA 2N0SB 4Q2JA 4C7YA 2EELA 1N63A 1FNWA 3LXFA 1KF6B 3U7ZA 4XWWA 2WXRA 4WAFA 5EE3A 2LUMA 4C56C 2PKOA 1JALA 2E3TA 2PVGC 4MH8A 1I4RA 1I4PA 1GPXA 2ON8A 2WXMA 3VRAB 1EU4A 1IBXA 3AEEB 1B9RA 1JCKB 1J7BA 1D4BA 1AN8A 1J7CA 3FILA 1E0ZA 1CQVA 3KWLA 1V97A 3HRDD 3TUOA 1YJIA 1STEA 1FCCC 4L2YA 4HEA1 2DYMA 1HA5A 2ONQA 3Q8FA 1ZXIA 3SFDB 2WXQA 1C4AA 1K51A 5H8YE 2HTME 1TY0A 4MACA 2WXLA 3B2FA 1SBBB 4GLSC 5I4DA 4XDCA 3EA6A 3CIRB 3B2GA 4B0MA 4YSYB 1QF6A 5H92C 2AQ3B 2WXPA 3W1SA 1WXQA 3P4SB 4P16A 3ZJVA 1NENB 2WQYB 1I4HA 4WH4A 3GS2A 4P6VF 1FXIA 4ZOHC 4KGRA 1L6VA 3E9SA 5T8IA 1NI3A 3ZJUA 1DGJA 1FNUA 1YJJA 2E6XA 2WLBA 3AEDB 5FKAC 3OWEB 1SXTA 4B0EA 3MJ5A 1JWBD 2D5GA 1YN4A 3IT6B 4PT5A 3AE3B 4YTNB 2BB5A 2WU5B 4CQNA 3VR8B 2J42A 3AEAB 3P4PB 4J3OD 4XDDA 4JPSA 3W2DA 2LJIA 4C7ZA 1OFFA 1SE4A 1ZPSA 4UDUC 1FXAA 2MJDA 1C4PA 1PGAA 3GP7A 4WQMA 4A90A 2HDEA 4R3DA 2IJ0A 3U52E 4YT0B 1WGKA 1L5PA 1Y56A 3AN1A 4RGTA 1FCLA 3MHZA 3NVZA 1SF0A 1FD6A 2LHEA 2JZPA 1GOZA 1T5XD 3NS1A 1EWCA 3NVVA 1JWAD 2YEPB 3NZ3A 4OZAA 1C4CA 1T6BX 1NEKB 3BZDB 1Q10A 1SJHD 3MP9A 1VR9A 3TSSA 2JU6X 2H89B 3AEBB 5G5GA 2GI9A 3EUB2 4ZYSA 1E10A 1YQ3B 2IGHA 1BMLC 1FEHA 3TEYA 2L52A 2N9KA 3RFZB 3AE9B 3P1MA 1XF5L 1E9MA 1D5XC 3SEBA 2GB1A 4NAMA 4RGNA 1MHHE 2QEJC 1YN3A 2X38A 2WS3B 3AE7B 2Q5WD 1R7SA 5FR3A 2IPKD 1ZUD2 3U4EG 1LO5D 4OW0A 2WXOA 1FNVA 2JX5A 1EU3A 1B1ZA 1K53A 1EWYC 2CJNA 2W82A 4GDKB 5BMHA 1E6EB 2K5PA 2VZKD 4O1NA 3AH7A 4RGMA 1QILA 1KTKA 2CU3A 1C77A 3NVWA 4A9AA 5TSSA 3N9YC 2AQ2B 2FBWB 1L4ZB 1F0ZA 4KKIA 1XLOA 3V05A 1RM6C 5D3DA 1MI0A 4REZA 1K52A 4KX6B 2KQ4X 1FRRA 2IGDA 3VR9B 2M0AA 1PUTA 2ACZB 2V0GA 3AV8A 1KLGD 2XN9C 1GAQB 1N5XA 2L32A 2NTTA 1XCQL 5MPOA 1GB1A 2J52A 2PLPA 3W9CB 5AUIA 1SIJA 4JWSC 4YSZB 1DYQA 3MFGA 1F77A 1BUIC 4XE0A 4DXGA 2NTSA 1JRPA 2VZKB 1FMAD 4MM3B 4OZCA 1ZE3D 1QOFA 3AEFB 3BWUD 3W5UB 2OHFA 2J4XA 5AUKA 1TKGA 4LK0M 3P4QB 1VJKA 2V3PA 1UUPA 1KLUD 2ICIA 1CJEA 2AX5A 4YTMB 3BK1A 2WNMA 4H2AA 2WXIA 4HKQA 1EM7A 1RFKA 3ABVB 3V3XA 4HKZE 1QT9A 2INPE 3IAS1 1F2RI 1M4VA 1FO4A 3VQIA 1N5WA 1SSNA 2JYTA 1NYRA 1ZOYB 2CJOA 2INNE 4ARIA 4TMAB 3T3OA 1I4QA 3R2IA 1N61A 1XXGA 1ESFA 2W55A 1XLQA 4YTPB 2NMQA 3NVYA 2K3UA 3HVDA 4LTUA 3R2TA 4IOIE 5BYSA 4L1BA 4OHJA 3PZ8A 2OEDA 1YN5A 2K22A 2PVOD 2BS3B 2N9LA 4KGTA 2PW9A 3BYYB 1AW7A 3AECB 4L23A 1PGBA 1P7EA 1SB3C 1QQRA 3BVZA 3AE4B 1DOIA 4AS1A 2W3SA 3H8HA 3LB8C 3KWVA 4AQ7A 4US9A 1ET9A 3E56A 4A6QA 1DOYA 2WDRB 4C80A 2BS4B 1HEZE 2DYOA 1QOAA 3DWMA 2Z8LA 4MT5A 1MVKA 1JROA 2RDGA 1IGCA 3MC0B 4ZRPA 3AB5A 2WDQB 3Q8EA 3ZQ4A 3AE1B 2B76B 4RF0A 1YNTE 1C78A 1VDVA 2MJ3A 4N59A 2V4IB 1JWMD 2ZW0A 1V1PB 1AYFA 3ZGZA 1CZPA 2RMMA 3WCQA 3EGRA 5BYQA 1UWXA 1TYGB 1D5ZC 2WXJA 2WXFA 1PFDA 3ZYYX 2W3RA 4A8XC 1J7AA 3TEXA 3NRZA 2YEPF 4HJGE 4NAWB 2V3NA 2MJEA 1N62A 3URYA 2KDMA 5BYRA 1UWMA 2DLBA 1C9FA 2LEKA 3SR6A 4A55A 3L4PA 1SE3A 1YMHE 3UI3A 3BIID 1OQRA 2G9HD 4ARCA 1FFVA 4HRSA 1BXTA 1VZ6A 2KACA 1L4DB 1TS3A 1N60A 1ENFA 1C79A 2FE8A 1IGDA 2WU2B 2LHDA 4RF1A 2LFIA 3AE2B 1FFUA 4RFBA 2JYEA 1WYGA 2KWDA 1D6EC 1L0YB 1MHXA 3KQ4A 1PDXA 1XLNA 2AQ1B 4NZLB 1AWDA 4WIPA 5EE1A 4ZHPA 3Q8BA 1VRAB 2Y5CA 1XCTL 2QJLA 3BVGA 2G1EA 1CK1A 3R8BA 2GRIA 1SE2A 1D5MC 1YQ4B 5D7GA 4WURA 5HFYA 5E6JA 3HVZA 1JMLA 5D3IB 5HG2A 2LGIA 3PZ7A 3FILB 2BBCA 4XWTA 2WP9B 3Q8AA 1DOXA 2JSVX 3Q69A 3AE6B 3SFEB 4RNAA 2PIAA 1E7PB 4FXCA 1XEEA 4RH6A 5GXGB 2WXNA 1ROEA 2EKIA 5C3JB 3U2SC 2FUG1 1TS2A 1WWTA 3P63A 4ZRQA 2BT6A 5HI1A 2JXTA 2Y3AA 5BMGA 5JXVA 4TSSA 1ET6A 3TEWA 2LMCA 3C8YA 3KLSX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H89 B;  2N0S B;  3AE4 B;  3AEB B;  5G5G A;  4C7Y A;  1VLB A;  1DOI A;  1ZP0 B;  2W3S A;  3LB8 C;  3EUB 2;  4JX1 C;  1N63 A;  1E10 A;  4US9 A;  1YQ3 B;  3LXF A;  4ZHO A;  1DOY A;  1I7H A;  1KF6 B;  2WDR B;  4C80 A;  2BS4 B;  1RWS A;  1QOA A;  2L52 A;  3DWM A;  2DWQ A;  5EE3 A;  5EE0 A;  3AE9 B;  3P1M A;  2PKO A;  1JAL A;  1QOB A;  2E3T A;  2PVG C;  1E9M A;  1JRO A;  1FIQ A;  2MH7 A;  4N58 A;  3VRA B;  1GPX A;  2DBY A;  3AEE B;  3AB5 A;  2WDQ B;  3AE5 B;  1B9R A;  2WS3 B;  3AE7 B;  1J7B A;  2Q5W D;  1FM0 D;  1R7S A;  2B76 B;  3AE1 B;  3FAH A;  1J7C A;  1VDV A;  1ZUD 2;  2MJ3 A;  3ETR A;  4N59 A;  3KWL A;  1E0Z A;  1AYF A;  1L6U A;  1CZP A;  3WCQ A;  1V97 A;  3HRD D;  1YJI A;  2JX5 A;  1TYG B;  2CJN A;  1EWY C;  1PFD A;  4IDI A;  3ZYY X;  1E6E B;  2K5P A;  2W3R A;  4N6E B;  1JW9 D;  1J7A A;  3AH7 A;  3NRZ A;  1ZXI A;  1OQQ A;  3SFD B;  2CU3 A;  4US8 A;  2MJE A;  1N62 A;  2W54 A;  3NVW A;  5H8Y E;  2HTM E;  4A9A A;  3B2F A;  1UWM A;  3AM9 A;  2FBW B;  1F0Z A;  2LEK A;  1FRD A;  1XLO A;  1RM6 C;  2H88 B;  3B2G A;  3CIR B;  3BII D;  3L4P A;  4YSY B;  5H92 C;  3VRB B;  1OQR A;  1WXQ A;  1QF6 A;  3P4R B;  3P4S B;  1NEN B;  1FFV A;  2WQY B;  1L0V B;  4HRS A;  4KX6 B;  1FRR A;  1TJE A;  4P6V F;  1FXI A;  4ZOH C;  5EE9 A;  3VR9 B;  1PUT A;  2ACZ B;  1L6V A;  1IUE A;  1XO3 A;  4YSX B;  3AV8 A;  1QOG A;  1NI3 A;  1DGJ A;  1N60 A;  1GAQ B;  1N5X A;  5MPO A;  2KAJ A;  2WU2 B;  3W9C B;  3AE2 B;  1YJJ A;  1SIJ A;  2WLB A;  4JWU C;  4JWS C;  5AUI A;  1FFU A;  3AED B;  4YSZ B;  1WYG A;  1JWB D;  5C2T B;  1JRP A;  3AE8 B;  1PDX A;  1FMA D;  1XLN A;  1QOF A;  3AEF B;  1WRI A;  1AWD A;  3AE3 B;  4YTN B;  3W5U B;  2WU5 B;  2OHF A;  3VR8 B;  5EE1 A;  3AEA B;  4ZHP A;  2BS2 B;  3P4P B;  5AUK A;  3HUI A;  1TKG A;  3W5V B;  4YXD B;  2Y5C A;  2QJL A;  3DWG C;  2G1E A;  3SR6 A;  3P4Q B;  1OFF A;  1VJK A;  2WDV B;  4HRO A;  1FXA A;  2K9X A;  1CJE A;  4C7Z A;  2AX5 A;  2MJD A;  3AMZ A;  1YQ4 B;  1KRH A;  2JQR B;  3B9J A;  4YTM B;  3HVZ A;  4USA A;  1NYQ A;  2QIE B;  3PO0 A;  4WQM A;  1A70 A;  1JQ4 A;  1NVI D;  1RFK A;  2WP9 B;  3ABV B;  2KMM A;  1TKY A;  2M19 A;  1DOX A;  3RPF C;  4YT0 B;  1QT9 A;  1WGK A;  1L5P A;  3AN1 A;  1T3Q A;  1QLB B;  3AE6 B;  4WWM A;  3SFE B;  3NVZ A;  1FO4 A;  1N5W A;  1ZOY B;  2CJO A;  1NYR A;  2M56 B;  2PIA A;  1SF0 A;  1E7P B;  4FXC A;  1XLP A;  1N61 A;  1V8C A;  5GXG B;  2W55 A;  1XLQ A;  1TKE A;  1RYJ A;  1ROE A;  3CWI A;  3FC4 A;  3NS1 A;  2EKI A;  4YTP B;  3AEG B;  3NVY A;  5C3J B;  1WWT A;  4LTU A;  3P63 A;  4ITK A;  3NVV A;  1JWA D;  5G5H A;  2BT6 A;  1NEK B;  2K22 A;  2PVO D;  2BS3 B;  1KFY B;  3AEC B;  2L83 A;  1SB3 C; 
#chains in the Genus database with same CATH topology
 1LQB A;  1E90 A;  4ZHO A;  3UIN B;  3I57 A;  3Q3N C;  1HXY D;  3DBH I;  4OVZ A;  1QOB A;  4QAY A;  2VRR B;  2NBU A;  1WZ3 A;  3IAM 1;  2ASQ A;  2KLC A;  3NUH B;  4PYU A;  2L8J A;  4EUT A;  1WSP A;  1PYW D;  2BKR B;  3FAH A;  3BK2 A;  2FCQ A;  3VUW A;  1HTQ A;  4E71 A;  1YIW A;  2Y5P A;  3BIN A;  1GUA B;  4GDL B;  3BYT B;  1ACC A;  4ANX A;  3GB1 A;  3I9V 1;  3VRB B;  2FCS A;  3P4R B;  1WYW B;  1KH0 A;  1N6Z A;  4PS3 A;  4W9H A;  4GU2 A;  4M0W A;  4YSX B;  1C76 A;  3W1S C;  3UGB B;  5C23 A;  4KKJ A;  3LYY A;  1L0X B;  4EKU A;  3VUX A;  1A5R A;  3ML9 A;  2ZW1 A;  1SEB D;  3LJ3 A;  3W5V B;  2ZCB A;  1WR6 E;  3M95 A;  1J19 A;  2DZJ A;  1GB4 A;  3DWG C;  2CKH B;  2KTF A;  2N7E A;  4I6P A;  2IGG A;  3B9J A;  1F9J A;  3C0R B;  2TSS A;  1EO6 A;  2BYT A;  1JQ4 A;  3HM6 X;  4RMA A;  3ZVV A;  1L2N A;  2ZPN A;  1T3Q A;  2KTR A;  1TS5 A;  2X8X X;  2XBB C;  4D2K A;  2V9H A;  2RGF A;  3V60 A;  2DYB A;  1V49 A;  2IDY A;  5J18 A;  4HDO A;  4GDL A;  5AZH A;  4P1B C;  2WXR A;  4WAF A;  4C56 C;  2PKO A;  4MH8 A;  3B08 A;  3VRA B;  3AEE B;  2NVU I;  2O6V A;  3PRP B;  2L7R A;  2GBJ A;  1AN8 A;  2N9P C;  2ZNV B;  1E0Z A;  1CQV A;  1X1M A;  1V97 A;  3HRD D;  4X57 B;  2ONQ A;  1ZXI A;  3SFD B;  1C4A A;  2ZVN A;  1K51 A;  2KFJ A;  2HTM E;  1TY0 A;  4MAC A;  2WXL A;  1SBB B;  3B2G A;  4B0M A;  4YSY B;  1P1A A;  3DBL I;  2DAF A;  4P16 A;  3ZJV A;  1NEN B;  4GDK A;  2KK8 A;  1L6V A;  2OJR A;  3A9K B;  1UBQ A;  3ZJU A;  1FNU A;  2KLG A;  1YJJ A;  4W9K A;  4B0E A;  5IN7 A;  2D5G A;  5G2N A;  3ZRC A;  3AE3 B;  4YTN B;  1Q1O A;  2C9W B;  2WU5 B;  3A4S C;  3P4P B;  4J3O D;  3NOB A;  4XDD A;  1OFF A;  1ZPS A;  3DBH B;  4UDU C;  1FXA A;  3L0W B;  3UIO B;  1PGA A;  3M63 B;  3RUI B;  4KIK A;  3HIZ A;  2KJ6 A;  4ZDV A;  1NDD A;  3R7R A;  4WQM A;  2G45 B;  3PTF C;  1WX8 A;  4MSM B;  4R3D A;  2IJ0 A;  1WGK A;  1L5P A;  3AN1 A;  3M62 B;  1FCL A;  2MCN B;  2AL3 A;  3MHZ A;  1SF0 A;  2LHE A;  1WMH A;  3NZU A;  5CHF A;  1T5X D;  3NS1 A;  1EWC A;  5HKH A;  4OZA A;  4MM3 A;  1NEK B;  1Q10 A;  2ZCC A;  1SJH D;  2JU6 X;  3AEB B;  5G5G A;  4ZYS A;  3Q3F A;  4G0N B;  3H9D A;  1C3T A;  1WIA A;  2L52 A;  1C1Y B;  3P1M A;  3RCZ A;  1XF5 L;  2M1M A;  1MHH E;  2K39 A;  2X38 A;  4BOS C;  4FJV B;  1R7S A;  2HJ1 A;  5FR3 A;  2IPK D;  1ZUD 2;  1WJ6 A;  1WF9 A;  4MH0 E;  4FLH A;  4LDT B;  1MJD A;  2A5U A;  4HJK A;  3VH4 B;  1EWY C;  2BYE A;  5BMH A;  4FAD A;  3TMP B;  1T0R C;  4JIO U;  4XGA B;  4W9D A;  1KTK A;  2CU3 A;  1R4M B;  4EEW A;  4TKN A;  4B6W A;  2DEN B;  3N9Y C;  3I63 C;  1L4Z B;  4KKI A;  1OGW A;  3PVL A;  2Z0E B;  2I1K A;  2KVZ A;  4WWO A;  4REZ A;  1FRR A;  2IGD A;  4MJS A;  2ACZ B;  4CO7 A;  1BT0 A;  1XCQ L;  2J52 A;  2PLP A;  3K9P B;  4BKS D;  2MLB A;  1XD3 B;  4E74 A;  4MGZ E;  2J0K A;  4W9C A;  3DBR I;  4MM3 B;  1WR1 A;  2I1J A;  3D32 A;  1QOF A;  3BWU D;  4IM3 A;  2J4X A;  1PQS A;  4LK0 M;  2JT4 B;  1UUP A;  2BQQ A;  1OTR B;  3BK1 A;  2KWU B;  3V3X A;  2WWZ A;  3IAS 1;  1M4V A;  2KNB A;  3QC8 B;  3VQI A;  3T3O A;  2JYT A;  3Q6B A;  2PE9 A;  2L3Z A;  3RZF A;  4DHJ D;  2NMQ A;  4IOI E;  3WAO A;  4ZRK A;  4L1B A;  3PZ8 A;  2RD0 A;  2A4Z A;  3H6N A;  2HD5 B;  2N9L A;  1AW7 A;  2AYO B;  2KFK A;  2M0X A;  1PGB A;  1QQR A;  1F52 A;  4A20 A;  4GGQ A;  4AQ7 A;  4DHZ E;  3M3J A;  4C80 A;  2KWC A;  2D3A A;  2Z8L A;  3PRM B;  1KJT A;  1IGC A;  2KWV B;  3MC0 B;  3QA8 A;  2LWP A;  4IW0 A;  3Q8E A;  4DHZ B;  4RF0 A;  4LNN A;  4HCN B;  1C78 A;  4N59 A;  3WCQ A;  3EGR A;  1D5Z C;  3ZYY X;  3UQA A;  2Z59 B;  4A8X C;  3NRZ A;  3DBS A;  5IO9 A;  4HJG E;  2MJE A;  3URY A;  5BYR A;  5GMV A;  1IP9 A;  1C9F A;  2LEK A;  3OJ3 A;  4A55 A;  4TUU A;  2G9H D;  3MTN B;  4ARC A;  3AU5 A;  4K7W A;  4KZC A;  3PHW B;  1L4D B;  2QHO A;  1N60 A;  3SU8 X;  2D07 B;  3IFW B;  4M02 A;  2KWD A;  1WGH A;  1MHX A;  2D10 A;  2XK5 A;  5EE1 A;  2KX3 A;  1UF0 A;  3RNE C;  3ZNZ B;  1XCT L;  4HXD A;  4F7Z A;  1YQ4 B;  4FN2 A;  5HG2 A;  2LGI A;  2BBC A;  2V1Y A;  4XWT A;  2WP9 B;  4B9K A;  1XQQ A;  3Q8A A;  5AEK B;  2CHZ A;  3Q69 A;  5IP4 D;  2LGY A;  1E7P B;  3N1X C;  4FXC A;  5GXG B;  1WI0 A;  2JXX A;  2EKI A;  1WWT A;  4I6L B;  2JY6 A;  5HI1 A;  1WGR A;  3KLS X;  3NHE B;  4BAX A;  4EE2 A;  2PMV A;  3QHT A;  1GC7 A;  2RR9 A;  1RWS A;  5EE0 A;  3P42 A;  3DVG Y;  3JVZ X;  1FIQ A;  5JHA A;  3DBR B;  4TQ1 A;  4ICV A;  1V1P A;  4WWP A;  3H7P B;  1TY2 A;  1WGG A;  3VVW B;  3TEZ A;  2GBR A;  4IKG A;  2I2Y A;  4IDI A;  4N6E B;  1JW9 D;  4US8 A;  2MBQ A;  1YJ1 A;  3WAP A;  3A9J B;  3AM9 A;  4WAA A;  1FRD A;  2H88 B;  3BVM A;  2DZM A;  3PRE A;  5L95 C;  2J7Q B;  4F8C B;  5LNK 1;  1E7V A;  5EE9 A;  2XK5 B;  3QWZ B;  2GMI C;  1P9D U;  3S2A A;  2BTE A;  4II2 B;  2INC C;  5CHV C;  3L10 B;  4NQK E;  2NBV B;  1WRD B;  3R3M A;  3VTV A;  1JRU A;  3DOW A;  1HZ6 A;  2BS2 B;  4OZB A;  1HQR D;  3T3N A;  2MEK A;  1QKZ A;  3AMZ A;  4EOY A;  3QQ8 B;  2MSE D;  4HWI B;  1SJE D;  4USA A;  3PO0 A;  4KDL B;  4KSK C;  1TKY A;  3L13 A;  3RPF C;  3IHP C;  2SAK A;  2M56 B;  2KJR A;  3AU4 A;  2QMT A;  3CWI A;  2IND C;  3FC4 A;  2XNA C;  4YL8 A;  2BYV E;  3IG3 A;  5G5H A;  4EZK A;  1ZW7 A;  2BB6 A;  2IO2 B;  3BY4 B;  2LRW A;  3U7Z A;  3VDZ A;  5EE3 A;  2LUM A;  1EF1 A;  2UYZ B;  5DPS A;  1I4R A;  1R4N B;  2ZNV C;  2ON8 A;  2C60 A;  1GPX A;  1EU4 A;  3U7D A;  1B9R A;  4DK5 A;  2BPS A;  3TL5 A;  1D4B A;  4MDK E;  2DYM A;  4II3 B;  2WXQ A;  4AP4 C;  1F1H A;  5I4D A;  1U4A A;  3RT3 B;  4XDC A;  1KLV A;  2O2V B;  3CIR B;  1ISN A;  3Q2A C;  1V5O A;  5CX3 A;  4FHJ A;  4WH4 A;  3GS2 A;  4N9F 4;  4ZOH C;  2PPH A;  4NAW A;  3W1Y A;  1DGJ A;  2LGD A;  3NS8 A;  3ZLZ A;  3WA0 A;  3AED B;  2L76 A;  1JWB D;  4OVV A;  1V81 A;  3ZDM C;  3MC9 A;  3FKY A;  1YX5 B;  5EDS A;  2LAS A;  3ZRF A;  2G4S A;  1WM3 A;  2MJD A;  1C4P A;  5G55 A;  3GP7 A;  3IVF A;  2HDE A;  3APD A;  4RGT A;  1WJN A;  4S17 A;  1TT5 B;  4MEM A;  4BOZ B;  2AWT A;  3DBL B;  2M17 A;  4NY0 A;  4ANW A;  2JZP A;  2BF8 B;  1Z2M A;  1TZ1 A;  4ZYN A;  2LVQ A;  1K8R B;  1C4C A;  3SHQ A;  2JRI B;  3MP9 A;  4HDQ A;  3QCA A;  3ALB A;  5E6N A;  1E8Z A;  1V86 A;  2C7H A;  1I42 A;  3CF6 E;  3DVN V;  4P1C C;  3QAR A;  1YN3 A;  1Z5S B;  5BO4 B;  2WS3 B;  2Q5W D;  4IC7 B;  3U4E G;  2LVO A;  1WGY A;  1P3Q U;  4OW0 A;  4FJZ A;  1M94 A;  1B1Z A;  1K53 A;  2D3C A;  2FID A;  2V4L A;  3LDZ E;  1E7U A;  3N32 A;  5DPW A;  3NVW A;  1SGH A;  4A9A A;  4P7I A;  3Q14 C;  2AQ2 B;  2N4F A;  4MJS B;  1YOV B;  4LCD E;  3VHT C;  1MI0 A;  2NPT B;  1K52 A;  3VH3 B;  5D94 A;  4J6I A;  1KOT A;  2YLM A;  3AV8 A;  1YQB A;  4NPN A;  2KD0 A;  3OAW A;  1P98 A;  1WM2 A;  1P0R A;  5AUI A;  3EEC A;  4HPM B;  1CMX B;  1DYQ A;  2LRU A;  1TTN A;  1F77 A;  2L0F A;  1JRP A;  1FMA D;  3HHM A;  3AEF B;  3PZD A;  4GXB A;  2Z0D B;  2OHF A;  2REX A;  1TKG A;  3MJW A;  2QCZ A;  3ZKJ C;  1VJK A;  2HJ8 A;  1KLU D;  1CJE A;  1Q0W B;  2MHJ A;  2EMS A;  4F1S A;  4PK1 A;  2R2O A;  3H7P A;  4H2A A;  2WXI A;  2ZPY A;  3L54 A;  4HKQ A;  1RFK A;  3DVN U;  1QT9 A;  2INP E;  4W9I A;  4ANV A;  4M8M A;  1SSN A;  2CJO A;  4ARI A;  1WX9 A;  3RZW C;  1ESF A;  3Q3M C;  2W55 A;  5J2R A;  1KM7 A;  4RM8 A;  3AXC A;  4HLE A;  4LTU A;  4CYE A;  2PW9 A;  3BYY B;  3A9K A;  1RLF A;  2W3S A;  3LB8 C;  1WJU A;  3VAW A;  4US9 A;  1ET9 A;  3E56 A;  3WAM A;  1DOY A;  2BS4 B;  2WX1 A;  4MT5 A;  1JRO A;  3RI7 C;  3ZNH B;  4KIK B;  3ZQ4 A;  3AE1 B;  3KUZ A;  2IY0 B;  2MJ3 A;  4IUM B;  2ZW0 A;  3ZXR A;  2PJH A;  1TYG B;  2WXJ A;  1WY8 A;  3HK0 A;  3ZW3 A;  2V3N A;  1N62 A;  1UWM A;  2DLB A;  2K1F A;  3SR6 A;  3UI3 A;  1SE3 A;  1OQR A;  3PLV A;  1FFV A;  1WFY A;  2IBI B;  1VZ6 A;  3U8Z A;  4KVG B;  2FE8 A;  1AAR A;  2WU2 B;  2KDB A;  3KYC D;  1FFU A;  4RFB A;  4B95 A;  1HTO A;  1WYG A;  4M01 A;  1L0Y B;  1Y8R C;  1XLN A;  1VD2 A;  2AQ1 B;  4ZHP A;  3Q8B A;  5DPT A;  2KYW A;  2Y5C A;  1RRB A;  2IO0 B;  4MSQ B;  1SE2 A;  1D5M C;  4WUR A;  1YX6 B;  5E6J A;  3I5J C;  1JML A;  4OVU A;  3PZ7 A;  1OQY A;  1H8C A;  1DOX A;  2JSV X;  5C1Z A;  1E5W A;  4GB9 A;  3AE6 B;  4RNA A;  2K25 A;  4EZJ A;  3JYU A;  1LXD A;  3EHV A;  2WGS A;  2RPQ A;  3P63 A;  2RDB C;  3SD5 A;  2O2V A;  4ZRQ A;  4ZRI A;  4BBN C;  5JXV A;  3V62 A;  3TEW A;  2KDE B;  4CHK A;  2FCN A;  1GJZ A;  4AJW A;  1UNS A;  1VZ7 A;  1VLB A;  1ZP0 B;  2WXH A;  2N7J A;  2WXK A;  1I7H A;  1D3Z A;  2MH7 A;  1T0S C;  2JRH A;  3AE5 B;  1VZ8 A;  4LNO A;  4DXF A;  1I4G A;  2MBH A;  3V6E B;  4BKT A;  1K50 A;  3ETR A;  1L6U A;  4LLG M;  3ZXV A;  3H1U A;  1PGX A;  3IT4 B;  2L1A A;  4DWF A;  2V3S A;  4HPL B;  2PTL A;  2QC8 A;  1OQQ A;  2DNF A;  3RNB C;  4RGO S;  2PE6 B;  2JWU A;  2K6Q A;  1GC6 A;  1I4X A;  1V6E A;  5AZG A;  2BWF A;  1IUE A;  1XO3 A;  2LD9 A;  1QOG A;  1JWS D;  4WJQ A;  2KAJ A;  1MPE A;  4GSW A;  2N7D A;  5FK9 C;  2LXC A;  3AE8 B;  4BKS A;  1WRI A;  3DVG X;  3HUI A;  3N3K B;  2FAZ A;  2WDV B;  3B1L X;  2K6D B;  1WXA A;  4KV2 A;  1KRH A;  1UGJ A;  2JQR B;  1E8W A;  1NYQ A;  3TBL D;  2QIL A;  3IXS A;  3GZN B;  2KMM A;  1JWU D;  4LJO B;  4ACF A;  3DHI C;  5KHO A;  2MWS B;  3DDC B;  1QLB B;  2AL6 A;  1TIF A;  4WWM A;  4TQ0 A;  1HZ5 A;  2CHW A;  2GBM A;  4DQO C;  2RDH A;  1RYJ A;  4ZRJ A;  2R2Q A;  3GE8 C;  2K8B A;  2W9N A;  3O13 A;  1TZO A;  2K0P A;  4Q2J A;  4C4V A;  4M00 A;  4C7Y A;  4DDG D;  2EEL A;  3WIM A;  3LXF A;  3RNG C;  3PPA A;  4M0W B;  2E3T A;  2PVG C;  1I4P A;  4JL9 A;  1T0Y A;  2WXM A;  4DHJ B;  1IBX A;  2UWQ A;  3ZNG C;  1J7B A;  1J7C A;  1IYF A;  1UZX B;  1STE A;  4L2Y A;  4ASW C;  3RD2 A;  1VCB A;  3Q8F A;  3CMM B;  2D3G A;  2BGF A;  5H8Y E;  2VH2 A;  3WAN A;  3B2F A;  1QZE A;  3EA6 A;  4G3X B;  2Y5B B;  5H92 C;  3P4S B;  2IYD B;  2WQY B;  3AUL A;  3GOE A;  4P6V F;  4TV3 A;  4KGR A;  4WWN A;  2FCM A;  2KDI A;  2DZK A;  3GE3 C;  1E8X A;  4K3B A;  3DQV A;  5FKA C;  3VUY A;  2KN5 A;  2KX0 A;  3JSV B;  4JLC A;  2J42 A;  1LM8 B;  3KH0 A;  3W2D A;  1SE4 A;  1WH3 A;  2RSU A;  1WE6 A;  2KQS A;  2KJH B;  1UH6 A;  2JF5 A;  2HTH A;  4IG7 B;  4K7U A;  3OLM D;  5JH5 C;  2MP2 A;  5IAA C;  3APC A;  2MA9 B;  1FD6 A;  4C4V B;  1GOZ A;  2KO3 A;  1NI2 A;  3L17 A;  3NZ3 A;  3BZD B;  4E3C A;  1VR9 A;  1WE7 A;  4K7S A;  1S3S G;  5LXH A;  3EUB 2;  1E10 A;  1YQ3 B;  1MFW A;  3TEY A;  2NPT A;  4FHK A;  4IM2 A;  4W9L A;  4GOC A;  2N9K A;  2KDF B;  1E9M A;  3SEB A;  5IOI A;  2GB1 A;  2QEJ C;  3A1Q A;  3AE7 B;  1TBE A;  1LO5 D;  2LI5 A;  2JX5 A;  1EU3 A;  2PEA A;  4GDK B;  2GBK A;  4LNI A;  2FBW B;  1F0Z A;  4LNK A;  4RM9 A;  1XLO A;  1RM6 C;  5D3D A;  2MW5 A;  4KX6 B;  2KQ4 X;  4NJ6 A;  1PUT A;  3AI5 A;  1KLG D;  4G11 A;  3RYT A;  5MPO A;  2BYF A;  1SIJ A;  4JWS C;  4GN1 A;  1ZKH A;  4NJ7 A;  2BWE S;  4YSZ B;  3MFG A;  1BUI C;  4XE0 A;  2DAJ A;  3PHX B;  2VZK B;  5KHQ A;  4OZC A;  1ZE3 D;  4A3O A;  3W5U B;  4NQL B;  3DPD A;  4W9G A;  1Q5W B;  5FR6 A;  5AUK A;  3P4Q B;  2L05 A;  2LVP A;  4GMV A;  2GBN A;  2JZ3 B;  2WNM A;  1EM7 A;  3ABV B;  3H7S A;  3UQB A;  4HKZ E;  3QK0 A;  1NYR A;  2INN E;  2IZV B;  3VXW A;  1I4Q A;  3R2I A;  1N61 A;  1XLQ A;  2JUO A;  3QIJ A;  1LGR A;  3NVY A;  5JHB A;  4KGT A;  2K22 A;  2KC1 A;  3AEC B;  4L23 A;  3RNC C;  1G6J A;  1P7E A;  1SB3 C;  4IWP A;  1MG4 A;  1DOI A;  3ZDT A;  5LXI B;  3KWV A;  3OG5 A;  4A6Q A;  3APF A;  5J17 A;  1L7Y A;  3V6C B;  1HEZ E;  1QOA A;  3DWM A;  3N1Z C;  1MVK A;  4BVU C;  2RDG A;  3T8M A;  3AB5 A;  2WDQ B;  2B76 B;  4PS8 A;  2N9E B;  1YNT E;  3X0W A;  1JWM D;  1V1P B;  1AYF A;  5BYQ A;  1UWX A;  1LFD A;  2WXF A;  4I6N B;  2W3R A;  1J7A A;  1GNU A;  3TEX A;  2YEP F;  4XYC A;  2KZR A;  4NAW B;  2KDM A;  3QAQ A;  1OEY A;  1RFA A;  3T9L A;  2M8S A;  1YMH E;  2KAC A;  3VTW A;  3B0A A;  1ENF A;  1C79 A;  4FBJ B;  1WZ0 A;  4RF1 A;  2LHD A;  2LFI A;  2JYE A;  1D6E C;  3KQ4 A;  1PDX A;  4NZL B;  2ZVO A;  3L08 A;  4WIP A;  3RNF C;  3BVG A;  2G1E A;  3DCG A;  1CK1 A;  2O6V B;  5HFY A;  5D3I B;  3KYD D;  4BFR A;  3GZN I;  4JQW C;  1V9J A;  2LGS A;  3SFE B;  2DHZ A;  2PIA A;  4RH6 A;  2MQJ A;  3RN9 C;  1ZGU B;  3U2S C;  1TS2 A;  3MC8 A;  4TSS A;  1ET6 A;  3C8Y A;  2ZZP B;  1J8C A;  2HE7 A;  4JX1 C;  4EFO A;  2NBW B;  3JSV A;  2DWQ A;  2J53 A;  3C19 A;  3Q8C A;  3HM3 A;  2R61 A;  2WXG A;  4N58 A;  1V1O A;  2DBY A;  2QSD A;  2BW2 A;  2D3B A;  1SIF A;  1FM0 D;  3NY5 A;  1P7F A;  3RUL A;  4YWG G;  2LGX A;  3J9C A;  3PS6 A;  5CTR C;  4NNJ B;  1H4R A;  1ZXH A;  3ZTD A;  3PV1 A;  2VH1 A;  4MGY E;  5BMI A;  3SDL C;  4DDI D;  2W54 A;  2RPV A;  4KGS A;  1ZDV A;  4S0R A;  4HPP A;  2ZEQ A;  1ZDX A;  1L0V B;  1TJE A;  1YD8 U;  4A3P A;  1V5T A;  1TGZ B;  3TJP A;  2AEH A;  3NG0 A;  4C00 A;  4IWQ A;  4JWU C;  2B3A A;  2JPH A;  4NJC A;  3V61 A;  2J0J A;  2L0T A;  5C2T B;  4WJP A;  4RCO A;  1EF5 A;  3DHG C;  4YXD B;  2SEB D;  3RNA C;  1UBI A;  2I38 A;  4HRO A;  3ZJT A;  2K9X A;  5HHD G;  2KN4 A;  3N30 A;  3A1Q B;  2QIE B;  1A70 A;  1NVI D;  2G4D B;  2OOB B;  2M19 A;  2KTR B;  2MX2 A;  1TS4 A;  3IBE A;  2UU7 A;  2JVC A;  1IBX B;  3EC8 A;  4XZ4 A;  1F2R C;  3ECI A;  5LLI A;  1XLP A;  3N20 C;  4JE3 B;  4XX5 A;  1V8C A;  1TKE A;  2C7M B;  3AEG B;  2LUE A;  2IO3 B;  3ENE A;  4ITK A;  2KHW B;  3R7Q A;  3UF8 A;  4MGK E;  2DX5 B;  1KFY B;  2C5L C;  4ANU A;  2L83 A;  2KC2 A;  2WYQ A;  2N0S B;  3VTU A;  3EFU A;  1N63 A;  1FNW A;  1KF6 B;  3ONS A;  4XWW A;  2IO1 B;  4WQO B;  4K3C A;  1JAL A;  2KFK B;  3TCA A;  1JCK B;  1UD7 A;  2MBO A;  5D6J B;  3KUC B;  3R66 C;  2OJW A;  3FIL A;  2GOW A;  3KWL A;  4URK A;  2FUH B;  3TUO A;  2C7N B;  1YJI A;  1FCC C;  4DBG A;  4HEA 1;  2MBE A;  3CSF A;  1HA5 A;  5DCN A;  4GLS C;  2K8H A;  1QF6 A;  3W1S A;  2AQ3 B;  2WXP A;  3K9O B;  1WXQ A;  3PGE A;  3NZS A;  1I4H A;  2WDT B;  4GIV A;  3KVF B;  1FXI A;  4K81 A;  2JWZ A;  3E9S A;  5T8I A;  2DZI A;  1NI3 A;  4M8N A;  3ZNI D;  2KVR A;  2KQ7 A;  1WMH B;  2E6X A;  2WLB A;  4HK2 A;  3OWE B;  1SXT A;  3MJ5 A;  1YN4 A;  3IT6 B;  4PT5 A;  5L83 A;  2BB5 A;  4CQN A;  3VR8 B;  5IA7 A;  3AEA B;  4JPS A;  2LJI A;  4C7Z A;  2K8C A;  2NS5 A;  1S1Q B;  3EFC A;  4AUQ C;  4MGI E;  2MBB B;  4A90 A;  2G3Q B;  1WXV A;  4FUL A;  3RMK C;  3U52 E;  3I3T B;  4YT0 B;  1Y56 A;  3OJ4 B;  4WJN A;  2EMT A;  1EUV B;  4KSL C;  3NVZ A;  5CHW A;  1XT9 B;  4LDT D;  4PYZ A;  4BBN F;  2KXJ A;  2CS4 A;  2D2Q A;  2CU1 A;  2KT7 A;  3NVV A;  1JWA D;  2YEP B;  1T6B X;  3QX1 A;  3ZO5 B;  4ICU A;  3JW0 X;  3TSS A;  2H89 B;  2L00 B;  4BZA A;  2BVC A;  3ZUN A;  2N9X A;  2GI9 A;  3Q3J A;  5TR5 A;  2IGH A;  1I35 A;  1BML C;  1FEH A;  4KDI C;  3RFZ B;  3AE9 B;  2EKE C;  3PLU A;  4FA6 A;  1D5X C;  4NAM A;  4RGN A;  3X23 A;  1R4N I;  4LJP B;  5E6P A;  3U30 A;  1OEY J;  2WXO A;  4BKG A;  1FNV A;  2LJ5 A;  4AWJ A;  5DPR A;  2CJN A;  2W82 A;  1UGM A;  1E6E B;  2K5P A;  2VZK D;  5AZF A;  4O1N A;  3AH7 A;  2FIF A;  4RGM A;  1QIL A;  1C77 A;  1WXS A;  5TSS A;  4K1R B;  2KOX A;  3V05 A;  5D2M B;  3UIP B;  4DXA B;  1UEL A;  3VR9 B;  2M0A A;  2N1W A;  3PT2 B;  2V0G A;  1SE9 A;  2XN9 C;  1GAQ B;  1N5X A;  2L32 A;  2NTT A;  1GB1 A;  3W9C B;  4XC2 A;  4DXG A;  2NTS A;  1T0Q C;  1FPY A;  5JZE B;  2CR5 A;  3TIX A;  2J0M A;  2V3P A;  2ICI A;  2AX5 A;  1WGD A;  2LZ6 A;  2KMC A;  4YTM B;  4FJY A;  4HCP B;  1RAX A;  2CHX A;  3O65 B;  2BKF A;  1F2R I;  1FO4 A;  1N5W A;  4JGH B;  1ZOY B;  4AOF A;  4TMA B;  2FNJ B;  4IM0 A;  1XXG A;  4YTP B;  3A9J A;  2K3U A;  3HVD A;  4G50 A;  3R2T A;  5BYS A;  4OHJ A;  3QJZ A;  1IPG A;  2OED A;  1YN5 A;  2PVO D;  2BS3 B;  4W9F A;  2M4N A;  3BVZ A;  3AE4 B;  1E8Y A;  4HVB A;  3ZIM A;  4LNF A;  4AS1 A;  1MG8 A;  3H8H A;  2QDF A;  2WDR B;  2WHI A;  1WX7 A;  2DYO A;  4KZ0 A;  1WXM A;  1GG3 A;  2NCN A;  4ZRP A;  2JZZ A;  2IY1 B;  3CST A;  5IKC M;  1VDV A;  3ZGZ A;  2V4I B;  2LXA A;  1CZP A;  2RMM A;  1NBF C;  1V2Y A;  1J0G A;  2KKC A;  1PFD A;  1R4M I;  2GLS A;  1HE8 A;  3A4R A;  3WAL A;  2MP2 B;  5E6O A;  2KAN A;  3MHS D;  3L4P A;  1V80 A;  3BII D;  4PS7 A;  4HRS A;  3DHH C;  1BXT A;  1WJ4 A;  3KW5 B;  2D11 A;  1FXT B;  1TS3 A;  1IGD A;  4AJY B;  3AE2 B;  3P2B A;  1AWD A;  4WJO A;  2XEW A;  2N1V A;  2YVC A;  3N1Y C;  3NJT A;  1VRA B;  2ZJD A;  2QJL A;  3PRZ A;  4W9E A;  3R8B A;  2MRP A;  2GRI A;  5D7G A;  3HVZ A;  3KUD B;  3Q3O C;  3A33 B;  3FIL B;  3L16 A;  3ML8 A;  4IWO A;  2WX0 A;  3VFK A;  1XEE A;  4EZL A;  2NR2 A;  3ZTC A;  2WXN A;  1ROE A;  4MEL A;  5C3J B;  2FUG 1;  2BT6 A;  2JXT A;  2Y3A A;  3PSE B;  5BMG A;  2LMC A;  2KMA A;  4W9J A;  2O6V D; 
#chains in the Genus database with same CATH homology
 1UNS A;  1VZ7 A;  1VLB A;  1ZP0 B;  4EE2 A;  2PMV A;  2WXH A;  4JX1 C;  2N7J A;  4ZHO A;  2WXK A;  1I7H A;  3I57 A;  1HXY D;  1RWS A;  5EE0 A;  2DWQ A;  2J53 A;  4OVZ A;  3Q8C A;  3P42 A;  1QOB A;  1FIQ A;  2R61 A;  2WXG A;  2MH7 A;  1V1O A;  4N58 A;  2DBY A;  2QSD A;  4TQ1 A;  3IAM 1;  3AE5 B;  3NUH B;  2BW2 A;  1VZ8 A;  1WSP A;  1V1P A;  1PYW D;  1FM0 D;  3FAH A;  1I4G A;  3BK2 A;  4DXF A;  1K50 A;  1TY2 A;  3ETR A;  1P7F A;  4YWG G;  1L6U A;  3TEZ A;  3J9C A;  4LLG M;  4IKG A;  2I2Y A;  1PGX A;  3IT4 B;  2L1A A;  1ZXH A;  4IDI A;  4N6E B;  2Y5P A;  1JW9 D;  2PTL A;  5BMI A;  1OQQ A;  4US8 A;  4GDL B;  2W54 A;  2RPV A;  4KGS A;  3BYT B;  4RGO S;  1ACC A;  1ZDV A;  3AM9 A;  2JWU A;  3GB1 A;  3I9V 1;  1FRD A;  2H88 B;  1I4X A;  3BVM A;  3VRB B;  3P4R B;  1ZDX A;  1KH0 A;  1L0V B;  1TJE A;  5LNK 1;  5EE9 A;  4M0W A;  1IUE A;  1XO3 A;  4YSX B;  1QOG A;  1C76 A;  1JWS D;  2BTE A;  2KAJ A;  4KKJ A;  1MPE A;  4JWU C;  3LYY A;  1L0X B;  4NJC A;  5FK9 C;  5C2T B;  3AE8 B;  4RCO A;  1WRI A;  2ZW1 A;  1HZ6 A;  1SEB D;  2BS2 B;  4YXD B;  3W5V B;  3HUI A;  2SEB D;  4OZB A;  1HQR D;  1GB4 A;  3DWG C;  3T3N A;  2I38 A;  4HRO A;  2MEK A;  2WDV B;  3ZJT A;  2K9X A;  1QKZ A;  5HHD G;  2KN4 A;  3AMZ A;  2IGG A;  1KRH A;  1UGJ A;  2JQR B;  3B9J A;  2TSS A;  1SJE D;  4USA A;  1NYQ A;  2QIE B;  3PO0 A;  2BYT A;  1A70 A;  1JQ4 A;  1NVI D;  2QIL A;  3IXS A;  2KMM A;  1TKY A;  2M19 A;  1JWU D;  3RPF C;  1TS4 A;  1IBX B;  1T3Q A;  2SAK A;  1QLB B;  4WWM A;  4TQ0 A;  2M56 B;  1F2R C;  1HZ5 A;  1TS5 A;  4DQO C;  1XLP A;  2RDH A;  4JE3 B;  1V8C A;  2QMT A;  1TKE A;  1RYJ A;  3CWI A;  3FC4 A;  4D2K A;  2XNA C;  3AEG B;  4ITK A;  2IDY A;  5G5H A;  2BB6 A;  1KFY B;  2L83 A;  3O13 A;  1TZO A;  2K0P A;  2N0S B;  4Q2J A;  4C7Y A;  2EEL A;  1N63 A;  1FNW A;  3LXF A;  1KF6 B;  3U7Z A;  4XWW A;  2WXR A;  4WAF A;  5EE3 A;  2LUM A;  4C56 C;  2PKO A;  1JAL A;  2E3T A;  2PVG C;  4MH8 A;  1I4R A;  1I4P A;  1GPX A;  2ON8 A;  2WXM A;  3VRA B;  1EU4 A;  1IBX A;  3AEE B;  1B9R A;  1JCK B;  1J7B A;  1D4B A;  1AN8 A;  1J7C A;  3FIL A;  1E0Z A;  1CQV A;  3KWL A;  1V97 A;  3HRD D;  3TUO A;  1YJI A;  1STE A;  1FCC C;  4L2Y A;  4HEA 1;  2DYM A;  1HA5 A;  2ONQ A;  3Q8F A;  1ZXI A;  3SFD B;  2WXQ A;  1C4A A;  1K51 A;  5H8Y E;  2HTM E;  1TY0 A;  4MAC A;  2WXL A;  3B2F A;  1SBB B;  4GLS C;  5I4D A;  4XDC A;  3EA6 A;  3CIR B;  3B2G A;  4B0M A;  4YSY B;  1QF6 A;  5H92 C;  2AQ3 B;  2WXP A;  3W1S A;  1WXQ A;  3P4S B;  4P16 A;  3ZJV A;  1NEN B;  2WQY B;  1I4H A;  4WH4 A;  3GS2 A;  4P6V F;  1FXI A;  4ZOH C;  4KGR A;  1L6V A;  3E9S A;  5T8I A;  1NI3 A;  3ZJU A;  1DGJ A;  1FNU A;  1YJJ A;  2E6X A;  2WLB A;  3AED B;  5FKA C;  3OWE B;  1SXT A;  4B0E A;  3MJ5 A;  1JWB D;  2D5G A;  1YN4 A;  3IT6 B;  4PT5 A;  3AE3 B;  4YTN B;  2BB5 A;  2WU5 B;  4CQN A;  3VR8 B;  2J42 A;  3AEA B;  3P4P B;  4J3O D;  4XDD A;  4JPS A;  3W2D A;  2LJI A;  4C7Z A;  1OFF A;  1SE4 A;  1ZPS A;  4UDU C;  1FXA A;  2MJD A;  1C4P A;  1PGA A;  3GP7 A;  4WQM A;  4A90 A;  2HDE A;  4R3D A;  2IJ0 A;  3U52 E;  4YT0 B;  1WGK A;  1L5P A;  1Y56 A;  3AN1 A;  4RGT A;  1FCL A;  3MHZ A;  3NVZ A;  1SF0 A;  1FD6 A;  2LHE A;  2JZP A;  1GOZ A;  1T5X D;  3NS1 A;  1EWC A;  3NVV A;  1JWA D;  2YEP B;  3NZ3 A;  4OZA A;  1C4C A;  1T6B X;  1NEK B;  3BZD B;  1Q10 A;  1SJH D;  3MP9 A;  1VR9 A;  3TSS A;  2JU6 X;  2H89 B;  3AEB B;  5G5G A;  2GI9 A;  3EUB 2;  4ZYS A;  1E10 A;  1YQ3 B;  2IGH A;  1BML C;  1FEH A;  3TEY A;  2L52 A;  2N9K A;  3RFZ B;  3AE9 B;  3P1M A;  1XF5 L;  1E9M A;  1D5X C;  3SEB A;  2GB1 A;  4NAM A;  4RGN A;  1MHH E;  2QEJ C;  1YN3 A;  2X38 A;  2WS3 B;  3AE7 B;  2Q5W D;  1R7S A;  5FR3 A;  2IPK D;  1ZUD 2;  3U4E G;  1LO5 D;  4OW0 A;  2WXO A;  1FNV A;  2JX5 A;  1EU3 A;  1B1Z A;  1K53 A;  1EWY C;  2CJN A;  2W82 A;  4GDK B;  5BMH A;  1E6E B;  2K5P A;  2VZK D;  4O1N A;  3AH7 A;  4RGM A;  1QIL A;  1KTK A;  2CU3 A;  1C77 A;  3NVW A;  4A9A A;  5TSS A;  3N9Y C;  2AQ2 B;  2FBW B;  1L4Z B;  1F0Z A;  4KKI A;  1XLO A;  3V05 A;  1RM6 C;  5D3D A;  1MI0 A;  4REZ A;  1K52 A;  4KX6 B;  2KQ4 X;  1FRR A;  2IGD A;  3VR9 B;  2M0A A;  1PUT A;  2ACZ B;  2V0G A;  3AV8 A;  1KLG D;  2XN9 C;  1GAQ B;  1N5X A;  2L32 A;  2NTT A;  1XCQ L;  5MPO A;  1GB1 A;  2J52 A;  2PLP A;  3W9C B;  5AUI A;  1SIJ A;  4JWS C;  4YSZ B;  1DYQ A;  3MFG A;  1F77 A;  1BUI C;  4XE0 A;  4DXG A;  2NTS A;  1JRP A;  2VZK B;  1FMA D;  4MM3 B;  4OZC A;  1ZE3 D;  1QOF A;  3AEF B;  3BWU D;  3W5U B;  2OHF A;  2J4X A;  5AUK A;  1TKG A;  4LK0 M;  3P4Q B;  1VJK A;  2V3P A;  1UUP A;  1KLU D;  2ICI A;  1CJE A;  2AX5 A;  4YTM B;  3BK1 A;  2WNM A;  4H2A A;  2WXI A;  4HKQ A;  1EM7 A;  1RFK A;  3ABV B;  3V3X A;  4HKZ E;  1QT9 A;  2INP E;  3IAS 1;  1F2R I;  1M4V A;  1FO4 A;  3VQI A;  1N5W A;  1SSN A;  2JYT A;  1NYR A;  1ZOY B;  2CJO A;  2INN E;  4ARI A;  4TMA B;  3T3O A;  1I4Q A;  3R2I A;  1N61 A;  1XXG A;  1ESF A;  2W55 A;  1XLQ A;  4YTP B;  2NMQ A;  3NVY A;  2K3U A;  3HVD A;  4LTU A;  3R2T A;  4IOI E;  5BYS A;  4L1B A;  4OHJ A;  3PZ8 A;  2OED A;  1YN5 A;  2K22 A;  2PVO D;  2BS3 B;  2N9L A;  4KGT A;  2PW9 A;  3BYY B;  1AW7 A;  3AEC B;  4L23 A;  1PGB A;  1P7E A;  1SB3 C;  1QQR A;  3BVZ A;  3AE4 B;  1DOI A;  4AS1 A;  2W3S A;  3H8H A;  3LB8 C;  3KWV A;  4AQ7 A;  4US9 A;  1ET9 A;  3E56 A;  4A6Q A;  1DOY A;  2WDR B;  4C80 A;  2BS4 B;  1HEZ E;  2DYO A;  1QOA A;  3DWM A;  2Z8L A;  4MT5 A;  1MVK A;  1JRO A;  2RDG A;  1IGC A;  3MC0 B;  4ZRP A;  3AB5 A;  2WDQ B;  3Q8E A;  3ZQ4 A;  3AE1 B;  2B76 B;  4RF0 A;  1YNT E;  1C78 A;  1VDV A;  2MJ3 A;  4N59 A;  2V4I B;  1JWM D;  2ZW0 A;  1V1P B;  1AYF A;  3ZGZ A;  1CZP A;  2RMM A;  3WCQ A;  3EGR A;  5BYQ A;  1UWX A;  1TYG B;  1D5Z C;  2WXJ A;  2WXF A;  1PFD A;  3ZYY X;  2W3R A;  4A8X C;  1J7A A;  3TEX A;  3NRZ A;  2YEP F;  4HJG E;  4NAW B;  2V3N A;  2MJE A;  1N62 A;  3URY A;  2KDM A;  5BYR A;  1UWM A;  2DLB A;  1C9F A;  2LEK A;  3SR6 A;  4A55 A;  3L4P A;  1SE3 A;  1YMH E;  3UI3 A;  3BII D;  1OQR A;  2G9H D;  4ARC A;  1FFV A;  4HRS A;  1BXT A;  1VZ6 A;  2KAC A;  1L4D B;  1TS3 A;  1N60 A;  1ENF A;  1C79 A;  2FE8 A;  1IGD A;  2WU2 B;  2LHD A;  4RF1 A;  2LFI A;  3AE2 B;  1FFU A;  4RFB A;  2JYE A;  1WYG A;  2KWD A;  1D6E C;  1L0Y B;  1MHX A;  3KQ4 A;  1PDX A;  1XLN A;  2AQ1 B;  4NZL B;  1AWD A;  4WIP A;  5EE1 A;  4ZHP A;  3Q8B A;  1VRA B;  2Y5C A;  1XCT L;  2QJL A;  3BVG A;  2G1E A;  1CK1 A;  3R8B A;  2GRI A;  1SE2 A;  1D5M C;  1YQ4 B;  5D7G A;  4WUR A;  5HFY A;  5E6J A;  3HVZ A;  1JML A;  5D3I B;  5HG2 A;  2LGI A;  3PZ7 A;  3FIL B;  2BBC A;  4XWT A;  2WP9 B;  3Q8A A;  1DOX A;  2JSV X;  3Q69 A;  3AE6 B;  3SFE B;  4RNA A;  2PIA A;  1E7P B;  4FXC A;  1XEE A;  4RH6 A;  5GXG B;  2WXN A;  1ROE A;  2EKI A;  5C3J B;  3U2S C;  2FUG 1;  1TS2 A;  1WWT A;  3P63 A;  4ZRQ A;  2BT6 A;  5HI1 A;  2JXT A;  2Y3A A;  5BMG A;  5JXV A;  4TSS A;  1ET6 A;  3TEW A;  2LMC A;  3C8Y A;  3KLS X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...