1QTNB

Crystal structure of the complex of caspase-8 with the tetrapeptide inhibitor ace-ietd-aldehyde
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
b'TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-8
molecule tags Hydrolase/hydrolase inhibitor
source organism Homo sapiens
publication title The atomic-resolution structure of human caspase-8, a key activator of apoptosis.
pubmed doi rcsb
total genus 20
structure length 90
sequence length 90
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 1999-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1qtnB00
2XZDB 2HBRB 2HBZB 4ZVPB 2C1EB 2Y0BB 3QNWB 2QLJB 4LSZB 3KJNB 2H4YB 1RHJB 1IBCB 3GJSB 2CJYB 1SC4B 2XYGB 1RWXB 2XYHB 3EDRB 4JB8B 3P4UB 1SC1B 3GJTB 1ICEB 1F9EB 4DCJB 4ZVSB 3R7NB 1RHRB 2H48B 2H65B 2H5IB 2CJXB 4DCOB 2CNOB 3R6GB 4ZVTB 1RHUB 4ZVRB 2QL9B 3RJMB 3D6HB 2CNLB 2CNKB 2C2ZB 3D6MB 3KJQB 3R5JB 3KJFB 1PYOB 2H54B 1GFWB 5IC6B 2XZTB 2CDRB 2DKOB 2C2KB 2QL7B 1PAUB 1RWOB 2H4WB 1I51B 1QDUB 3P45B 3NS7B 2C2MB 1RWVB 2QLBB 5K20B 3R6LB 1SC3B 2CNNB 5IC4B 3R7SB 3D6FB 2H51B 2QLFB 1RWMB 2FQQB 3R7BB 1RHQB 2C2OB 2HBYB 3EDQB 1RWWB 4DCPB 1RHKB 2HBQB 2P2CB 4ZVUB 4ZVOB 3SIPB 2XYPB 2H5JB 1RWKB 1RWNB 1RE1B 1RHMB 2QL5B 2Y1LB 4ZVQB 1I3OB 3IBCB 1BMQB 1RWPB 3GJQB 3IBFB 1QTNB 3GJRB 1NMEB
chains in the Genus database with same CATH superfamily
1ZAXA 1KHWA 3Q86A 4CH0S 3IWNC 4LMZA 1CQMA 3FEZA 2KG1A 2GVDA 2N3LA 3T6JA 1WELA 5L8RC 1C0TA 4W98A 4FKYA 1IJEB 1FTRA 1A7GE 1RWUA 3LF0A 1U25A 4C48A 2A6OA 5F3TA 1SQGA 5LSOA 2XMUA 5MLCV 3RAMA 2LFVA 3VF0B 2CQ1A 3CNQP 1FFGB 2M52A 2ZVSA 1S1TB 4NPOA 4L74A 4NA3A 3LAMA 3DCAA 3PHEA 2AYGA 1BQMA 2DNZA 1PAEX 2D69A 3L95X 1AXQA 3P4UB 4R0JA 2BUNA 2KH9A 1HNIB 4LF6J 4FYDA 1B0TA 1X0PA 1DLOA 3DU5A 4RKUC 5GAEU 3PIOQ 4H4MA 4DSFA 8ATCB 3CUNA 3HCXA 2HHWA 2QA2A 3IM8A 5GMKa 1N36F 3M8RA 2YXLA 2G2YA 3K8WA 1N5QA 1M1GA 2ZUGA 4NLWA 4DCOB 5DJBA 4ZLPA 1KSPA 1S49A 2H9ZA 5B0DA 3GMGA 1UEVA 4L3KA 4GRSA 4HL9A 2DY9A 4URSA 2JLEA 2H5EA 2ZBPA 3CCZA 3HULA 2GQCA 5AT1B 3MAQA 4OLOA 1T03B 2ZE2A 2V6AA 3KHLA 5HROA 5DQIA 5B09A 3CEDA 1FKAF 4JBCA 3IRWP 4J9SA 2KFNA 2DH8A 2LQ8A 1VQ4S 3TUPA 3DLBA 5HJXA 3FEXB 1G7CB 2RQCA 4KHPJ 3M05A 3TZYA 3UVJB 1Q8LA 2HK3A 2EC2A 4XAKA 4Z2XA 2M8DB 2WBRA 3TA0A 2IMOA 4IO9Q 1FX4A 4G1QA 2QEXS 3CC4S 4IQXA 3Q8PB 3T9ZA 3MPUB 2BEFA 1JJ4A 2V2ZA 3FBFA 3KNAA 3IGVA 1YJVA 3F0NA 4ZCMA 4PPZA 3ZTRA 2N4DA 3PW2A 2GS8A 2RUSA 4IQMA 3J7A1 3M8SA 1U26A 2DNKA 2E5IA 2VJUA 3PACA 4M5HA 2J9DE 2F8MA 3ILIA 4RBUA 1FKPA 1UETA 1SUQB 4HHJA 1IKVB 3SFGA 1M90T 2UXBJ 5D4PA 5F8GA 2DCLA 2AYMA 3GPAA 3CD5A 4L73A 2J6UA 4RUCA 2GIRA 4DFJA 5DQHA 3HJFA 2WW8A 1S6PB 3A1YG 4YP3A 1QM9A 1FDDA 1HNZF 3CJ5A 2OKQA 5KFWA 3CC7S 1VDHA 2HFZA 2MGZB 2MKHA 2HLUA 2V68A 2R42A 3AJ2A 4B02A 4WYLA 2YX4A 4DI6A 4OZ1A 2F65A 2AP6A 3DRYA 1IUJA 1TUVA 1XR5A 1OIAA 1ZA1B 3HHDA 3KG1A 2ROEA 3W9JA 3MMBB 4ES1A 1TKDA 3CT9A 3SQGB 1N56A 1B4SA 1R8AA 2DEIA 5L46A 1X9MA 2GGPB 1EARA 1RWWB 4PEOA 4USVA 3C14A 5KFCA 3KKFA 2EKNA 2XCAA 2G1HA 4ILMA 5KFLA 1TP7A 2ZH4A 5D78A 1M5SA 2F40A 2OELA 4KB7A 3SYZA 2H3EB 2RRAA 5E3QA 2E66A 1RAOA 1NB7A 2XNQA 4OYWA 2CPJA 2EC0A 1AFJA 4ILRA 4DL5A 1WG1A 2WHOA 1U7LA 2L41A 3ZNJ1 1ZTWA 3C16B 3F56A 3H5YA 3KTQA 2AU0A 3R5DA 1YGYA 1VJWA 2R2UA 2MZTA 2ZNZA 3G96A 4OX6A 3GJQB 1LEOA 1Y11A 2ACYA 3UDVA 3VR1A 4F3OA 1RJJA 2BACA 1TFYA 4NZ0A 4WFAQ 4KHPF 1S77D 3O2IA 3I55S 2OI2A 4LBHA 2WVCA 3U7JA 2HNZA 2R4FA 3J7YI 2WB4A 3MAAA 1DZ5A 2HBZB 2M7SA 2VZ9A 4G1PA 3WQPA 1HHSA 2CZ4A 2R7QA 4KC5A 1NCLA 2PFDA 3LWMA 1X4AA 2AX0A 2HEKA 1N5TA 3DKDA 1RT2B 3LP1B 4O4GB 2FHJA 2G2ZA 3ET6B 4USIA 5T7LA 4CLWA 3GJSB 5LSRA 4OIXA 2Q3PA 5HO4A 2HS3A 3G6ES 1BQNB 3KLVA 3B4MA 4C11A 1HQEB 2CG8A 3SQGA 3UR0A 1VQ8S 1CS4A 2DBBA 2MEWA 3M32B 4Q2LA 4RNFA 3THVA 1U1PA 1RYSA 1QAJA 1KLMB 1RAEB 2E7XA 4X4RA 3MZIA 2NQPA 1V3SA 3GR1A 3J7AN 1UJ6A 1YK9A 1H3DA 1MMNA 2QT7A 3LALA 3MCOA 4EO8A 3J7ZT 2ZZMA 3EYZA 4J9UE 4DL0C 2HFSA 2HHSA 2IM2A 1RXOB 5CQGA 4PQUA 2BW7A 1LW0B 1CJTA 2DR9A 2F63A 2EWHA 2HRUA 3BZQA 3EE3A 2XEXA 1DHMA 4KPCA 4X66J 2KG0A 3IWXA 4CIOA 3DLGB 2BVZA 2H5IB 3SCLE 4ZPBA 1HLWA 1NM2A 2VUGA 8RUCA 3D6TB 1NK4A 4OJHA 3V6JA 2ZM6J 3MM7B 1OMSA 4J91A 3VAHA 1ZM4A 3V6DA 1H74A 1IN0A 1Y3JA 2EEYA 2RD5C 4FYXB 3L9ZA 2HQDA 4WWSA 2W8LA 1APSA 1R8BA 2OEJA 1VR6A 2CNLB 2V2VA 3DOKB 3LTOA 3ZO7A 2Z2LA 3VWSA 1EP4A 3QWPA 3IRXA 4FYVB 3UCUP 4K8RA 3UQSA 3HT3A 3T1AA 2VQFF 3TJ8A 3GG0A 4DLEA 1N8RT 4OI0A 4IOAQ 3UPFA 1N32F 2W25A 2RAQA 3SCJE 2XG8A 1KLMA 2MKCA 4LUBA 2KM8B 2FY1A 4TU9A 3DLEB 4H4OA 3D0HE 1UW4A 1I51B 3A4TA 5IQ6A 1N48A 1B0VA 3F44A 5CYQB 3ILLA 4HHUA 3OD2A 3T1YF 1FTCA 2CZ9A 4ID8A 3L4BC 1DTQB 2V34A 3M8QA 5EUHA 3TA2A 2K3IA 1VIXA 2L08A 3T6BA 1FDNA 5ADZA 1WACA 3G82B 1HW8A 2VASA 3SV4A 2C3YA 1X4FA 2LKZA 3A3NB 4IR1A 3RBZA 3N5FA 3K7RA 5T14A 2B9YA 4MFBA 4PWDA 1JLFA 1S10A 2LXIA 3FK4A 4JI6F 2E29A 2YPZA 1W7WA 2CQPA 3POTA 1KONA 3AODA 3QATA 2B4UA 2ASJA 3WZ0A 1XNRJ 5JUMA 1Q0NA 2BQRA 3HO1A 3ISND 3VZHA 4ECQA 4CLLA 1WHXA 2R2TA 4IRDA 2M9KA 4OYIA 1FF2A 1QJHA 2WOMB 4QWDA 4DZ6A 5EHHA 4JV1A 4LQ3A 1IM6A 2W24A 4MJKA 4TY8A 3TW0A 1VQ9S 2QE5A 5E3RA 1JQGA 5F8JA 4RNOA 1RHKB 5DGAA 4DR2F 2BJ1A 2QX0A 1PYSB 4OZ0A 1UW9A 2GCFA 2LQBA 3CJQA 4QW9A 4JI7J 2DISA 4C3KA 1XNRF 1FK9A 3P49B 1FERA 2G13A 5H9FK 4E2FB 1VQ5S 5DQGA 2VA3A 4LSLA 2YWKA 2IYIA 2MDAA 4AT1B 5IFMA 3BDEA 3R5BA 2C3OA 4Y6IA 4F4ZA 1N34J 2O67A 4CH7A 4QIGA 3QZ8A 1JLQA 1F0XA 3K5MA 2BX6A 2C42A 2IA6A 3KOAA 3GSIA 3CJSA 1LWFB 2WVBA 4I2QA 5J1PA 2AGQA 4WIIA 3T5KA 4JI1J 4LF8J 4PWDB 1H2TZ 3GQCA 4I0WA 4DV2J 3KDOA 4G1IA 5M2RA 3QJLA 2QO3A 5J2PA 1BE4A 4CLSA 4ZITA 2CQIA 1N32J 1M1KT 1T05A 2OH2A 4FF1A 3E01A 1ITPA 1KHVA 1OPIA 4TQSA 4DQSA 5A2QY 3QIDA 2VG7B 4J9PA 4FBTA 4IFVA 2OJ3A 4X4TA 1MW7A 1YSJA 1YZ6A 2IRYA 2MQ8A 2OTJS 4NLXA 4LF1A 3FSXA 2JWNA 3T1YJ 2EW9A 5IT4A 4IRCA 5KFNA 1S57A 2MQMA 2FC9A 3Q8RB 4HVZA 4DX8H 4A8SA 1NDCA 4KGVB 3RBEA 1S59A 1PYTA 1RKIA 2PA8D 2MY8A 3H2VE 3MEEA 3OTEA 3TWZA 3PW0A 3UDLA 4BS2A 3QMQA 1DQ9A 5BXIA 4IDKA 3PX4A 1RAIB 2I9SA 1HNXJ 2OFGX 2Y8YA 2FGCA 1D3WA 3R7NB 1YX2A 2GIFA 1HR0J 2BZ2A 3JYTB 3NGKA 1JLQB 1UVLA 5D8HB 4BC9A 4QWEA 3NG8A 4LREA 4LSNA 4U7UK 1M5OC 1H72C 2HQIA 3CCVS 2VFVA 2UVVA 1YBAA 1DLOB 2AF6A 2RT3A 4QU7A 4ZMMA 4I2QB 1S0VA 4OMFG 1EX8A 5B7WA 5DG9A 4G65A 2QYCA 1SCJB 1UA1A 3AH6A 3TARA 4NA2A 2A0FB 2CNKB 1K47A 3ULHA 3QO9B 3D6MB 5LT5A 3UDCA 5J2NA 1RYRA 1HD0A 2ZC3A 5AE1A 3MF5A 2KFYA 2W7AA 3M9OB 3D66A 4UZCA 4JV5F 2QSWA 2XZTB 3C66A 3T41A 3G6YA 4I7FA 4P74A 5L9XA 1S0MA 1U4BA 3MPVA 3TAQA 3MMAB 2DO0A 2A6MA 4NLDA 1RTHB 1AUSL 5HK4A 5LXYA 4UOGA 3UN3A 1I94F 2Q6CA 2JDJA 2DR8A 3DFEA 3RB0A 4MIBA 1R89A 2EI5A 4ZPDA 1QE1A 2JJ4D 1S1UA 2CPZA 3VAMA 1L3TA 4IDKB 3KK2B 2ZH8A 1UCNA 2I0XA 4E98A 4O3QA 1HNVA 1T9UA 1T9TA 1WOSA 2CDQA 3QLHB 1TL3B 4OLPA 2XI3A 4WK1A 2ZH6A 1Q8KA 3THPA 4UQGA 3M2UA 4HHHA 1LKZA 2VG6A 3M7VA 4CYUB 3TANA 3C6TB 2VFSA 5C42B 2XGQA 1KRPA 4WCEQ 3BH6B 2DHSA 5HATA 3BM7A 5KFRA 1L5UA 3AA9A 1H7XA 3E2EA 2V9WA 1XBWA 2NYIA 3BGRB 1FRJA 1KS2A 1UVIA 4A8OA 1VBXA 4USTA 3SDEB 1P1TA 1RT1A 3KLGB 2MZQA 3S6EA 2L3MA 2DT9A 3GE9A 3PJXA 1U0HA 3ILOA 2IA0A 3CMQA 2WK4A 2RE1A 5KFUA 3H4DA 1XTZA 2ZFHA 3K17A 4ZCIA 1PBAA 4JYAF 4OHZA 2GMJA 4ZN1A 3OUYA 4LR8A 1CEZA 1SKSA 2E5LF 2E1RA 3KDNA 2B56A 1N0VC 1TFWA 1CG2A 1X5SA 2B43A 2H5JB 4IG3A 1YG0A 3NGTA 1Q16B 3P96A 4O0NA 2JC1A 1UEUA 2XMVA 3ELHA 3HDSA 1RKJA 1WC1A 2F4VJ 3BKUA 4DX7A 4P10A 4DR5J 3PO5A 1FVQA 4XK8C 1SC6A 3JTNA 5JMNA 5KT3A 3PO4A 1YIJS 2UXBF 1F6TA 1WHYA 4U8YA 1T8EA 1Q86T 4Q7AA 4WFYA 1FXLA 1VS3A 3FNNA 4GVBB 4UOHA 4PUOB 3EJMA 3GR0A 4P71A 3UD5A 3V4MA 2RUGA 2OD4A 4GKKJ 2W01A 1AFIA 1M5HA 1X31C 1XR7A 3M2UB 4YEAA 5IQQA 4ZHRB 1KQSR 2R8KA 1U8WA 1WC4A 5DDOC 4RUBA 1K8AT 2AQ4A 4CM0A 1FJ7A 4M5NA 4FVMA 4ZVPB 1U1KA 2VL1A 3CC2S 3IR5B 4H4KA 1BD6A 1TTHB 4JI7F 3IM9A 2KHCA 1UVMA 2R7VA 3G86A 2J6SA 1U49A 4ANCA 4A4JA 1U0HB 2XNRA 4EEYA 5IWAF 2DGOA 2XYHB 3MM5B 5HVGA 3Q8YA 4JB8B 3HVAA 2J7KA 4CM2A 1FWPA 3KLHB 3FMWA 3M9MB 2MHNA 1QSLA 1FX2A 1RT2A 1S1WA 2YKNA 3LP1A 2FVRA 1HI0P 4KJIA 3VV2B 2VBZA 2ZVIA 1HPZB 1LQ9A 4QZVB 3GJTB 4CQ1A 2BJ3A 1NDLA 2EBEA 4PCQA 3CO9A 4DHVA 2G0JA 2ZH9A 1HWKA 1SXLA 3KHHA 3T1HJ 2LEAA 3NWRA 4OZJA 3RG6A 3MDFA 1FRIA 2DO4A 2PA3A 4KE5A 1RA6A 2MKJA 4PZVA 4DEZA 4PG4A 1HBNB 5JJBA 1ZYQA 1J5EJ 4DSLA 1N5VA 3HSZA 5D0HA 4KGXB 2MB0B 2KB2A 2A2CA 3RW6A 1T0TV 4DPOA 3KFWX 6FDRA 2PFFB 3D54A 3X3UA 2UVWA 3L7PA 3ZZUA 3QZ7A 2RILA 4WE1B 1TZ0A 1Y4ZB 5DETA 3I87A 3PZPA 2OIHA 4LR7A 3C15A 1SL2A 3OTBA 4LF5F 2HPUA 3CMAS 2LECA 4TKTA 2BBEA 3V5RA 3MMCA 3ZTQA 2HZCA 2BKNA 4F4XA 2ZJRQ 1SJRA 4A8YA 3P3DA 4PAAA 4QJVA 1NO8A 1TKTA 2HIQA 2WAQD 1ZETA 2HYIB 2XC9A 2W9CB 1RABB 3DOKA 3OR2A 5HL7Q 3PVXA 5D6GA 2V8VA 1RWOB 3QAUA 2XMAA 1WTBA 4JP8A 4J9QA 5KG3A 3RBDA 2JEIA 5IM0B 2XGPA 2MSSA 4QPTA 2HIYA 4CRJA 2MKIA 3KYLA 2O66A 2RRNA 2I1RA 2XWYA 3FFIA 4QOTA 1NZAA 4LF4J 2V4JB 2VDHA 5EWEA 1PJ5A 2JOQA 1OYDA 2YNHB 3WX8A 3BYRA 5DGBA 4CCHA 4U96A 2DYAA 2F9DA 2OO4A 2L9WA 3MI7X 3H25A 3JAMY 5DM7Q 1T02A 3OJUA 4B9VA 1M5KC 2JEFA 3H42A 2CJQA 1HKAA 4U7UD 1RBOB 1W26A 1X5TA 4UUWA 4N7TA 4DV6F 1K0TA 3JSMA 1LFPA 3IBWA 1G4CA 1S9EA 2Y3YA 1UFWA 2EPIA 5HMYA 5HLFB 1VFJA 2CQGA 3OJSA 1X5PA 2UXCF 4KO0B 4PXDA 4WU2A 4FXVA 2XHCA 2BOPA 1RAFB 2LDYA 2CQ0A 4L6V3 3PR4A 4ID5A 2ALYB 2F4VF 3UNYA 1B7FA 1X4CA 5ETMA 1RTDA 1WDTA 2FUG9 2E9ZA 2C22A 1GNKA 5SZTA 1NSQA 2MJUA 3H98A 2AX1A 4KFBB 3FBCA 3VGSA 5D4OA 4GVLA 1WF0A 4RU2A 4WIQA 1FEHA 3BGLA 5IT9Y 3K89A 5G4DA 3CCWA 1TL1A 4TN2A 4A48A 2YNGA 2VFRA 5C7PA 3CCUS 1PGZA 3QRQA 4JI4J 5KAKA 2G2OA 2HHPA 3L3CA 2J7WA 2VJVA 5SUHA 3CJ8A 1Q95G 4MMOA 1QSSA 3OHAA 1F2HA 2F7VA 5K9FA 1HBMB 1BMQB 2WVFA 1B7YB 5EWFA 2HHUA 4DFMA 4G6VB 4DSKA 1SC4B 3VAJA 4XIUA 4NMLA 1FNOA 2XLKA 5C5JA 1Q5YA 4LRBA 4USHA 4DLGA 4M5IA 4RO0A 3CDAA 3UN5A 4DFPA 2HHTA 4NXMF 1JXEA 2H4YB 3TNVA 3U27A 1RBLA 1YJWS 2HHHF 1QLNA 1JXVA 2JRSA 5L1IA 2CJYB 2CJKA 1NDKA 2M4MA 2XYGB 3MHYA 1IR0A 1R43A 1TV6B 1YRXA 2OAUA 3NEKA 1N0UA 4DS4A 1S9FA 2NUHA 3MECA 3UFCX 2V8DA 2EG1A 2DHAA 1N5SA 1VRUB 2Y1RI 3EGWB 4RBVA 2XY5A 2Z56B 4B3MF 2DNMA 3DDNA 4HH0A 1OQ3A 1VHFA 2Z58B 3C16A 1RTZA 1FKOB 1SC1B 4DR3J 3AB4B 1HNZJ 3PX0A 4B9NA 1NK8A 5FDLB 4M95A 1OWXA 1MU2B 1HQUA 5L1LA 1IM4A 2R7SA 1DJ0A 2YQ0A 2OMOA 4NLRA 1QAIA 2D3ZA 1Y0HA 2CNOB 4K0KF 1FJCA 5I42A 1HNWF 4ZK7M 3TOQA 2HSEB 3DM2B 4ZN3A 3I9ZA 3DDIA 1JXLA 3CCRS 1UAWA 2ZOGA 4ECVA 4N56A 4NEYA 4J9MA 1NHKL 1IR1A 2ILZA 1VQSA 1X9SA 1X5OA 2KJVA 2GHVC 2VPWB 3W8PA 1VBZA 2VOOA 4EBEA 1S1TA 4JI6J 4LF7F 5AE2A 2XM3A 1WSVA 3SEOA 4F02A 4JI2J 1TV6A 2Q1LA 3Q89A 3TUJC 3BDPA 4CTAB 1TAUA 2GX8A 1FFWB 3PRBA 1XMQJ 2CYYA 3CD7A 1C0UB 1FA0A 2XLJA 3RB3A 1IBLJ 3LPEA 4DWIA 1N88A 4RLEA 2BJ7A 4QR0A 3A3OB 1PBUA 5B0GA 4YY3F 2MQPA 3JB9k 2VH7A 2E7WA 4P73A 3L7UA 3OFHA 2IAJB 1VISA 1H2VZ 3TVKA 3RAQA 3PJWA 2CZVC 2D41A 2V8GA 3ADAC 2R7WA 5AXLA 3MEGB 4RX6A 1CC7A 5LMUJ 1M5VC 4HTJA 1SPBP 2YPYA 4PYDA 3W1YC 3TR5A 1JKHB 1HW9A 4YFUA 2ZH1A 2R8GA 1GMUA 4OYOA 1SJ4P 2RKIA 3MCMA 4USUA 3ETMA 1S0NA 4QYRA 5F8MA 1IBMJ 2EG2A 2UP1A 4CLYA 2RJZA 5HMWA 1HMVA 1U1NA 3K2YA 2YKPA 2I5JA 2YNFB 2DR6A 2FQQB 4GC6A 3TQ1A 4W90B 1NH8A 1U0SA 2HURA 1WOPA 4CO2A 3FC9A 2E1PA 4ITSA 3OSPA 1RU2A 1EIYB 5KFHA 3KHGA 1T3NA 4DV1J 5KFFA 1KFDA 1OJ4A 1VLOA 1R0CB 2BKPA 4Q2MA 5CH7B 3I6PA 1HWUA 5D77A 4ZPVR 3H0PA 5E5NA 2W2OP 4I2PB 4RW7B 2RF2A 4ZP6A 3DOLA 3RUBL 3SSSA 3KLGA 4ECWA 2KFZA 1QVFR 1YJTA 3AY0A 1S1VA 2FY8A 3V6HA 2C2NA 5AXKA 5M2PA 2DGTA 3UCZP 1O51A 2CVEA 1N33F 1X9WA 2Y1JA 2BE9B 2DGUA 2KL8A 4FNIA 2LU1A 4MFBB 4CLPA 2DCUB 4WFXA 1SQFA 3BO3A 1KC8T 1LFWA 2NUUG 5J1EA 1MLAA 1RISA 1JKHA 3IBFB 2YBVA 2OPSA 2GMHA 2BDPA 1AUDA 2E1CA 1NKCA 2X1AA 1UVJA 3MMBA 3M9NB 1REGX 3MWBA 5HQ8A 1U8SA 4HYKA 1J27A 5A6PA 1ULRA 1P8GA 3ZC4A 2I5JB 2YNFA 3KJNB 2VPXB 4NL5A 4NYOA 2AV5A 1JLBB 3CTRA 4WXOA 5IV4A 1S79A 4OJ1A 3CCLS 4N5SA 3PW7A 2LYVA 1RT4A 2FLPA 2AHOB 3HPOA 2Q66A 2O3DA 2KN4A 2GO8A 4ZOSA 4OX8A 1S7IA 3GTYX 5EWGA 3AJ1A 1CBKA 4EWTA 1YBTA 3NOCA 3S8SA 1D9AA 2FPHX 2XZWA 4I2PA 2CAJA 3MR2A 4Q8EA 5BYQA 2W2QP 5I3UB 4YR3A 3DRXA 4UF4A 1CJKB 1YKWA 5E7OB 1F9EB 1WC5A 1XNQF 1UFLA 3GU0A 5LSLA 1F9HA 2DNRA 3HHEA 2WSFC 3K5OA 2K1RB 3H5XA 1H7WA 3CCSS 1OPZA 1QAYA 3C8YA 4M5MA 4JI5F 3BPDA 2HNZB 2CJXB 4C0BA 1LW2A 2HK2A 3JSRA 5FD1A 4EU0A 3MEDB 3PR5B 2NSCA 2W2NP 2JL9A 4OI6A 4AE5A 1URRA 2POKA 2YKAA 1HBUB 4LRDA 2D9OA 4LVOP 4MKBA 1KWMA 2VC0A 1PIEA 3NBPA 3D4JA 1HI1A 3RJMB 3VVUA 1UP1A 3CIMA 3ZFVA 5FLXY 3BR9A 3KJQB 3AAWB 3IO1A 4TY9A 2GAGC 3VAIA 1FESA 3DGVA 3KJFB 3Q8SB 1WKKA 3J81j 4DS5A 3R5GA 5A76A 3AJDA 4IRKA 3FCWA 2YKMB 3HFKA 4BLGA 1X0FA 4JV5J 2CKWA 1OQ6A 2DB1A 3QAEA 3PY8A 3G2XA 2BW2A 2YQ1A 2OPQA 3IXQA 4NA1A 1KQFB 5L39A 3W62A 2N82B 2HW3A 4DR1F 4KKOB 2X7IA 2Z4PA 5HVFA 2HFOA 4YR0A 1OO0B 2HG4A 5C2GA 2XO6A 4K0KJ 3HHLD 3RU0A 1RTIB 1CJKA 1RT7A 4NLGA 1F2GA 6AT1B 5I4MA 2GAHC 3PFEA 1HI8A 1SBRA 2B4PA 3BBFA 5L1KA 1GH8A 1IKWA 4DZDA 1HFEL 1PC5A 3DI6B 4PG6A 1WG4A 1SC3B 2B0GA 4C7QA 4QWAA 2W9BB 1GK8A 3QIPA 3D2WA 4ED3A 4NLQA 2C2DA 1CVJA 2GQ2A 4OQJA 3QO9A 1G6BA 3T3FA 3WIVA 3MFHA 1U02A 3BKTA 2BJ9A 3OPKA 3R7SB 1U1LA 4NRTA 2D7SA 3V6KA 1NHUA 2KYXA 2QLFB 5BR8F 3NNHA 1ZM3A 4NZ7A 5KFJA 1F5AA 2EFPA 1VQNS 4PXCA 3V81A 4BWJA 1Y00A 3MMAA 1YVFA 2HBYB 2IRUA 1NPKA 3UE2A 4JI8J 1RTHA 1OSCA 1U09A 2RH3A 3QRRA 1RT6B 4I6WA 4PQAA 5KG2A 4DV3F 1XMOF 1C0TB 4ZVUB 4OFZA 2EFVA 3CCES 1B99A 3N01A 4QIVA 4JI2F 1HNIA 2IDEA 2ZD1A 4Y2AA 3ZZPA 2YNIA 4CDIA 4Q44A 4UQTA 3FCHA 4OYZA 2ZDOA 4AL7A 3QLHA 4HTIA 4ERDA 3W66A 1IQZA 3PKYA 2FIUA 5HP1A 2FJDB 2X3DA 3BREA 4Y65A 1L3UA 4O3RA 3EXYA 2WONA 2CQDA 3I0RA 1RP5A 3BSAA 5E41A 4UUXA 3GIIA 4TXSA 1TKXB 1L3VA 4I67A 4X64F 1EETB 1FDAA 1JLEB 2P8IA 3M2VB 2PI5A 3FVYA 3HFVA 1O0PA 2GW8A 4NZ6A 2WOMA 3Q24A 4YQWA 1U1RA 2IFXA 2V69A 1ACMB 1E6YA 1V3RA 2FJEB 3QT6A 1K44A 2UUCJ 1HBMA 2FLNA 3TZXA 3C3LA 1NAQA 5F3ZA 2QMXA 3FKBA 5KFZA 5HROB 1NJYA 3B82A 3RRGA 2Z0GA 4B3RJ 1WC0A 2AJFE 2ADBA 1XQIA 5CAAA 5EX3A 3MPWA 4FPIA 1AZSA 2J9DA 3E3XA 4CLKA 3H4BA 2M8HA 4NLSA 3BBBA 1EKRA 3KMSA 2Q43A 5GAGI 1VQPS 2R7XA 4X4OA 3EXCX 4LT6A 4K7QA 3FMBA 1G1XA 4R8UA 4IFYA 4AQYJ 3I0SA 4JUZA 1VRTA 1BLUA 3GONA 3V4IB 4HLBA 2V50A 2JNJA 1KOOA 2WVDA 4P75A 5H1SV 5KFVA 3NCRA 3HMJG 1NJZA 2XS7A 2C3UA 3LOUA 4MKAA 2OP5A 3C46A 1IJFB 2YWEA 3BPSP 3N0VA 1EETA 1RLDA 5IOLA 1BC6A 2G1DA 2PD1A 5KFXA 1MN7A 3O3LA 4C0HA 3I56S 4WF9Q 3DRRB 3BH7B 4DPXA 4GO5X 5DRKA 4ZP9A 3HI9A 2LDIA 2IVYA 1F1BB 4GO7X 3VQTA 4J9NA 4A8WA 3BS9A 3BEGB 2GGPA 2PO4A 5MAOA 3GIMA 2ZHBA 5KFEA 1DFDA 1KFSA 3HHNB 4B9LA 2XB2D 1PAUB 1MWZA 3B6BA 4NMXA 2B6AA 4I69A 1FT8A 2CJ9A 2ZHOA 3D1HA 5K5MA 4DL6A 2HRTA 3R1HA 2RU3A 3EGZA 4A8KA 1DTTB 3D0GE 2FHKA 4O44B 1VLYA 4RL1A 3CIZA 3KUEA 4ZS6A 1VC5A 4X84A 2J9CA 2O01C 1V5VA 2N7CA 1NH7A 5E3PA 4TU7A 2E1MC 1FWKA 5KFQA 2XSFA 4B9UA 1H73A 3J7Z5 3TEHB 2B9XA 3N28A 3TEGA 4ETZA 5KFGA 1KN6A 2IBOA 2JHEA 3I32A 5L1JA 4C8LA 2B8PA 2MY7A 3LAKA 2GVZB 5GAGU 2H51B 2Y1IA 5HLFA 2ZH7A 3BO2A 4LF9F 1NPPA 2CPHA 4M5DB 3PG9A 3CJRA 3R7BB 5IXUA 2KT2A 4WP3A 1T9XA 1O6XA 1RTJA 2PC6A 1RQ0A 3H5SA 4Y3CA 4FS1A 2ROGA 3RTVA 2KDOA 2E1AA 1U24A 2CG4A 4IYQA 4P2FA 2OPPB 4DR5F 1UEKA 2BRLA 1MSWD 2ZH2A 1ZZNA 4I6YA 2AW0A 2KZMA 3KJVA 2D74B 2OSRA 2V67A 4LFCF 1ZAVA 4ILLA 1KVIA 3CWJA 1CS4B 3M32A 2YWHA 4HDGA 1TK0A 4X4VA 2O5DA 4DR4F 1BWEA 2YNHA 2GIQA 3TAMA 2IC3A 4OZ2A 1DQ8A 3MM8B 1BQMB 1CJTB 2QSFA 1V9OA 4OI2A 4ED2A 2RHQB 2RB7A 4YB1P 2VG6B 1H6KX 4CYUA 2VB6A 4CLZA 2KM8C 4KHMA 4ZVQB 1IKYB 2QA4G 3BN7A 1ELOA 3DLJA 2AZ3A 3AXKA 2RF2B 1MMLA 1DARA 2Q6BA 3DOLB 4NLOA 5KFDA 2RDJA 1F60B 5H9EJ 2G9OA 4U7CA 7FD1A 3W64A 2R8HA 3SZ2A 1DY3A 1UZDA 3CB4A 2IMWP 2FGOA 4USJC 2YTCA 2XSJB 3CW2C 5C24A 1QUVA 2ZOFA 2CQ4A 5GMEA 2B7CB 2A10A 3QNWB 2E5HA 3TX0A 2B3TB 4ED8A 1JK9B 3JS9A 2MKKA 5CYJA 1XMOJ 1NK7A 3Q2TC 4OL8A 1TL4A 4B9SA 4LIRA 1A9NB 3K0JA 3SCIE 4X62J 4CP5A 1Y3KA 3IMQJ 4RW6B 2KXNB 4JI3J 1ZTTA 2ZH5A 5GAEI 2JLFA 4BC7A 3GFHA 2ZJQQ 3DLEA 5LJ5Y 1K1SA 4X4UA 4ES3A 3KJVB 1Q7YT 1B3TA 2V8PA 2KVQE 4BWMA 4ATNA 3QBCA 2AYBA 2VOPA 4HT5A 4DG1B 3LGNA 4L72B 4V1Ak 5ITHA 3CCQS 2VBWA 1IWAA 1DTQA 3BSCA 5B0CA 2VV5A 5A0YB 1SJFA 1RHRB 5CYQA 4DV5F 3RB6A 2NPIA 4TLQA 1TQLA 4K50A 3A12A 1WHVA 1WTFA 4USMA 1Q79A 1JLFB 3M8ZA 4HEA9 4UY85 4F04B 3KLEB 2QL9B 4Y0FA 1YJUA 4WU3A 1HNWJ 3CJ4A 3FQKA 4RR5A 1JX4A 3D6HB 2YWGA 1XK8A 2F5GA 3B8HA 3CDEA 2AD9A 3S7RA 2UZAA 3MM6B 1YTYA 3POTB 3R5JB 1SQEA 3TJAA 2CUYA 4DV5J 1R3NA 2ATLA 1S72S 3EICA 3RB4A 2YKNB 4OZLA 2C2KB 3SFUA 4RNMA 4AL6A 3PCOB 2DHXA 4TY8B 1X4DA 4P7TA 4ZPWR 3Q23A 4EBDA 3PW5A 2QFIA 4KYZA 4I1TA 4OZ3A 2J7UA 5T41A 1QDUB 4LSLB 4ZP7A 3HD1A 3W63A 2E9RX 5D0GA 3WC0A 2Z2YB 4O3SA 3NL0A 5DO2A 2CRLA 2YKMA 4NCGB 1RA7A 1V3ZA 2L9NA 1YRTA 4FN5A 3OL6A 3KK1A 5I42B 1S9GA 3PYEA 2X1BA 4NLUA 4CLUA 2MZJA 1XR6A 4XDCA 3VGUA 3PYFA 1LWFA 3CULA 4ZKAA 2V63A 4R5PB 2ERRA 3ZTOA 2JEGA 3G9CA 3KMQA 1HD1A 1LK5A 4AXJA 1HWJA 1LXNA 2HQFA 1FO1A 1VIOA 2FZGB 4LF6F 2AEMA 1ZPWX 3CDBA 3WDOA 1ZS6A 2DXEA 3DXSX 3VTIA 3OLAA 2MZSA 3E01B 3MUMP 4DV4J 1KOHA 1TVRB 1FD2A 5KG6A 2DRDA 1TKTB 1JJHA 2IRXA 3OLBA 3NS5A 4O3OA 5DM6Q 4KRWA 2PMZD 5J2QA 3M2RB 3EPIA 2HNDB 2ASLA 5T7LB 1WD6A 2HGMA 2LXUA 2P2CB 2XMTA 3EZOA 4P52A 4C2MA 5C25A 4NOHA 4JV0A 2JEJA 1LXJA 3BQ1A 3LQVA 1IBKJ 1P9YA 4QCLA 4IG0A 4OYAA 5LXRA 2XMKA 4FYYB 3EX7B 4HKQA 3EVOA 5E3CA 4FBUA 2AJ4A 1HBOA 1H98A 5KFIA 2UXCJ 4DR2J 2I38A 5K14B 4NCGA 3K57A 4IOCQ 1ZZFA 2D1CA 4KT0C 1S9GB 2RNEA 3TP2A 4ZVFA 4RW4A 2P9EA 2P6SA 4AD6A 3OQ2A 1JNZB 4ELTA 3QJJA 1VC0A 1ZAWA 5EGYA 3DLHA 1SKRA 1NNDA 4F0KA 5L9NA 1N4LA 5B0AA 2OUGA 1U2CA 2BM1A 2CQ3A 2OGUA 2VF3A 3FBEA 2LP4A 4RNHA 1IKXA 1B64A 3OTCA 3OXGA 4LSZB 4WKYA 3IR6B 5CD4H 1LWEB 3DNCA 3RZAA 1TVRA 3M2VA 3A8KA 3IA0A 5HI7A 4EYHB 1RTDB 1U6BA 1L3SA 3O6QA 2CPEA 4DBQA 1FJEB 2E44A 1FNXH 4H4MB 3GFXA 4K5RA 3M2RA 4RW7A 2AIRB 4X64J 3DN9A 3R9LA 2LA6A 5GADU 3IG1A 4F3MA 3AQOA 1S1VB 4U9RA 2A3JA 1SIZA 1J5OB 2BANB 1EB0A 3D1OA 4P7VA 2WSCC 4XPEA 1JJCB 1Q53A 1S6UA 1XWLA 2AT1B 2YKOA 3HZGA 2FYXA 9ATCB 1C1BB 3MR5A 2MSTA 4IH6A 1HHTP 4X4NA 3NWGA 4DQPA 2AJ1A 3NAHA 3OR1A 3Q8VA 1UWAA 3Q22A 3B54A 2PSZA 4NRUA 5KOWA 3FUYA 2XI2A 2WB1D 1FCAA 5HVHA 2UUBF 2HMIB 1I1GA 1S1UB 2H65B 3M8QB 3GV7B 3R6GB 2QRRA 2KHDA 3M30B 3CJKB 1CQNA 4IFYB 3KK2A 3ENWA 3IS9B 2C28A 1M5PC 2CPIA 2FJWA 2QTWA 2RDIA 4EMDA 1OYEA 2HNYA 2BJEA 2WTFA 3V4IA 2M70A 4P6QA 3LP0B 3PJ9A 1BXNA 3NLCA 4CZCA 2H1YA 2W4DA 2QN6B 3SXLA 3C6UB 4OHWA 3HK2A 1IVZA 2EFNA 1A6LA 2FDNA 1AB8A 1NJWA 1LWEA 5IC6B 3UNGC 2AGOA 2V2QA 4I4BA 4FF4A 2MTLA 3MR6A 4Y34A 1S1XA 3ONQA 2L9DA 4P2XA 4DFKA 4BHQA 3T5JA 4KQZA 4WKRA 3K5NA 3AFGA 1F5CA 3DXBA 3TZZA 3VAGA 1NK5A 4NEZA 1RAAB 3G71S 4WTOB 4NCAA 5D3GA 1T11A 2OFHX 3MR7A 2KI2A 3NGDA 1NSKL 4I6AA 3NS7B 1EKSA 4B3RF 4C98A 3SCKE 5HN0A 1N33J 2M88A 2C2MB 4K4SA 1RWVB 2DJWA 1FRHA 2KKHA 3UCGA 2FVSA 2CXEA 4DMZA 1YBUA 2KXHA 5LMNJ 3I4PA 3D0IE 2CA9A 3NRBA 4LFAJ 3UI3A 3PEHA 3VZIA 2HFVA 2XO7A 4DU7A 3D5MA 1YI2S 2L48A 2HS0A 1WSRA 3M8WA 3JXOA 5AJ3J 2ZHAA 2UXDF 4K4UA 3M30A 2VICA 2HVIA 3BSOA 4E0DA 5E3AA 4ED7A 3W7BA 4KIAA 4DV1F 3T5HA 2OLWA 3BGOP 3M8YA 3FSIA 3O5TB 3BSNA 4TYAA 1RAGB 1UMJA 3DHWC 3NS6A 1PSDA 5FIIA 1NBEB 5AXMA 3O1LA 3UN2A 1KQGB 4UOCA 4BBYA 2W4CA 3DC2A 4J37A 3GSDA 3DGPB 4A8FA 1T05B 1RT3A 2FZKB 4CO4A 4RJVA 2OEMA 3D3BJ 3W60A 3GFZA 4CLFA 1PC4A 3OBIA 5CA5A 1XEZA 4DV4F 4ZVOB 3SIPB 3VGVA 4M5KA 2Z30B 3TJ9A 4V19X 1RWNB 1SV5B 1XERA 2HVHA 1HPZA 2AYEA 1S4FA 2RS8A 5HMXA 1NUEA 3NGUA 5D3GB 4MIAA 4P72A 1REVB 4NLYA 1UKUA 4B9TA 1Y5IB 1N54B 4CT8A 3DMJB 3QPIA 5A6WA 3Q0AA 1NPRA 4CNYA 2RHSB 4A47A 4DUYJ 4OI3A 3PHTA 3QIPB 1U6ZA 4DUYF 4ECUA 5EX0A 3K5LA 4F4WA 1HBNA 3PIPQ 1RDRA 4L3NA 4N76A 3R2CJ 2YX7A 2XZDB 1Q5VA 1YQHA 3KG0A 2HGLA 5HQMA 3I31A 4LSNB 1YLXA 3MURP 1RLCL 4WE1A 1QD1A 2GJFA 3V81B 2HZVA 2VPZB 1LWCB 4OHXA 2EK6A 1S6QB 4Y2MA 4CH1A 4DR7F 4F7VA 4DSJA 1VQYA 1QSYA 5LOQA 2DTJA 2WBMA 3DGPA 1RWXB 3NCPA 1VBKA 1EHWA 5J2NB 1Z4UA 2MLZA 4ED6A 1CULB 4O3PA 1D9DA 1T94A 3TI0A 1FRKA 3BV8A 3QFHA 4C97A 1TK5A 4LF9J 1QY7A 3AHPA 1CJUB 5KFBA 4TQRA 1BQNA 4LFBF 2MYFA 3GB0A 4DV7J 1YJ9S 5RUBA 4DR7J 3OR2B 4PABA 5LM7E 5I3PA 2FC8A 3I96A 3OT9A 1T9YA 1ZPVA 4P9SA 1JLEA 5KG0A 4DCJB 5IT0A 1SL0A 3QJPA 2LA4A 2RDDA 1KR4A 5IM0A 2VPYB 3OXFA 2HS4A 2ZNYA 1EJ7L 3SQOP 3OV7A 5KTQA 3NKYA 2V4JA 4TU8A 5A2QU 2BMBA 1U47A 3HVTA 4DXLA 1RHUB 2NR0A 1E6YB 3PM9A 3Q8UA 1AA1B 3ZZTA 2GVDB 4DR6J 4FXDA 1E6VB 1TL7A 1RT4B 2CQCA 4XPCA 2QFJA 4YB5A 2B51A 4RWXA 4DU8A 2AWZA 2QV6A 2HQCA 3HHLB 2BM0A 3L09A 5IS2A 1NZ8A 1PYOB 3GZ7A 4DL7A 4LBIA 4JI5J 3J7YU 5E2QA 3AOAA 2DKOB 4DDFA 2O1PA 4U67Q 3HT0A 2MQNA 1CULA 2ZH3A 2X1FA 1RAHB 1XMBA 4U6PA 1RAJA 3A8IA 1KEKA 2KZZA 2X3GA 2BE2B 5F0UA 2KXFA 4PRFA 3TVYA 4J5OA 1SKWA 2FHMA 3PYGA 3HM9A 1SVDA 1F9FA 2K7KA 1TAQA 1D8ZA 1Q4RA 2N4CA 2YNGB 4IG3B 4URQU 3MM9B 2C3MA 4D3GA 4YDDB 5E0OA 2R2SA 3TYTA 2XMMA 2CPXA 3HKWA 2GJIA 1YITS 4NXNJ 2V5HG 5K20B 1WKLA 2ZWPA 4ICLA 5CYMA 5F0WA 4LF8F 1AT1B 3NY0A 3OVAA 3BQ2A 2FZCB 2LQJA 3LH2S 4HI2A 3TAPA 1MWQA 1RCOB 3UVJA 1YRUA 5IT9U 4OV6A 1Q78A 4CLTA 1CSJA 4J7CA 3P5TL 2HKEA 2HQ3A 4MT1A 3M6VA 4H54A 4RW8A 3ZXWA 2CWKA 4DQIA 3ENAA 1VQ7S 2B9WA 4KKOA 2OPRB 2B4VA 1IBLF 1JMTA 4M5JA 1KQKA 4C9DA 2DNOA 1UVNA 1OSDA 4ZVGA 3R27A 1WI6A 3MM5A 4RU9A 5ETTA 4EK2A 1PILA 4OV1A 3OL7A 4KTQA 3KLHA 3FQLA 3CSKA 3CVKA 5KFKA 2NSBA 1MROA 3TRGA 1VRUA 2IYGA 4NCBA 1PKUA 3MPDA 4K4VA 2NLWA 1CLFA 1FKOA 2W2MP 4RW9A 4L75A 4ZLLA 3I5AA 2J76E 3QSYB 4ZPTR 4EI2A 3MXHP 2HFUA 4JOUA 5DG8A 3DM2A 1WG5A 1QTNB 5B0FA 2X1GA 4ICLB 5CYMB 4ZPCA 1RBAA 1IBKF 2AEFA 5GMDA 1WEZA 2HGNA 2HBRB 2W2PP 4YDXA 4NYPA 2R8JA 4NX9A 2QYGA 4UW2A 3ISNC 5EN1A 2BE7D 4FNHA 2E5LJ 2PMHA 5A8WA 5KT7A 1WC6A 5A8RA 1DQAA 1L3KA 4DUTA 1VC6A 1VRQC 2BJ8A 3EDRB 4X65F 4PPDA 4CTAA 5LJ3Y 2CIMA 3TAMB 3ZZRA 1HWIA 2WW4A 4N41A 2EFOA 3DLKA 4KV8B 1SB6A 3EGNA 4O3NA 5JXSA 1NSAA 1CC8A 3ZTPA 4NXNF 1C1CB 5F8NA 2JVOA 1VMBA 2VBYA 3M8PB 1VI7A 2SXLA 2DGSA 1CJVA 3AD8C 3LGMA 3RBXA 5KT6A 4ZJLA 2FVQA 1WI8A 2D9PA 3QFWA 4TLRA 4Q0BA 1YWXA 4YS2A 2VQEF 4URGA 4C0OC 5BYRA 3MAAB 2ASYA 4K59A 1C1BA 4KAIA 3CD0A 4PXBA 3C2PA 1TKZA 4NI2A 4ZVRB 2FD2A 3OR1B 3W65A 1HMVB 3KLFA 4DSEA 4LJMA 2VD3A 1S99A 3T5LA 1UJ5A 1W25A 3RRKA 1HQEA 5AE3A 2QJ3A 4BDPA 4ECTA 1YJRA 1AZSB 2JC0A 3CJKA 2YH1A 4F2RA 3QGHA 3WIUA 3IGNA 4ZP8A 3D3CJ 1U2RA 2IJRA 4PWUA 2IVFB 1GMWD 3X1LB 4LFBJ 4A8XA 1S48A 4UY8T 2U1AA 1J2VA 1ZM2A 2M0GB 3CO0P 3ZTSA 2IY5B 4UZBA 4A8QA 4YOEA 2BABA 2DXFA 4HACA 1JLAB 1NLKL 5KT2A 5K8PA 4IKAA 1LOUA 3MUVP 1WORA 2MQOA 2CFXA 4B08A 4CT9A 1UPMB 5D4LA 4MK8A 1F3FA 2A18A 2CQBA 2NCKL 4OX9F 2DIUA 4A46A 1HR0F 1R27B 1LNQA 5ETVA 5KG1A 4ZPAA 5KFPA 2D3O1 2CPYA 4FS2A 2RQMA 3AOCA 4NWBA 3MM6A 4TNOA 1YJNS 2HZAA 2HVEA 3HD2A 1WEYA 1T9VA 4PWWA 2ZE2B 1HNVB 1KTVA 4HR2A 4WJBA 3W5ZA 1KD1T 3JSBA 1R6VA 3KWMA 3BF4A 1SIWB 3NOGA 4K2XA 1DBDA 2HWIA 2C2OB 1Q8BA 4N8NA 5BYSA 3A3PB 1W2BR 4FF2A 4AL5A 5HJYA 2LQ5A 1RT5B 3CF5Q 2FTRA 5HBMA 4KGKA 4H4OB 2VC1A 4DCPB 4ED5A 2HHQA 2DEJA 5BR8J 1GXUA 1RSCA 3CDWA 2KT5A 2NXNA 1BY9A 3J81U 3MOZA 4KR0B 3SDEA 1RWKB 4J9LA 4L76A 5ETKA 1JLGA 3HSGA 1WJ9A 4X4SA 2HRYA 2IJFA 2FVPA 4ZHRA 2ZOMA 2BRKA 1NEEA 1T9WA 3W8GA 2ATCB 4Y2KA 2R7TA 4MYTA 1FKPB 1UVKA 1V5IB 1AROP 4NLTA 2RIJA 7FDRA 1SH3A 3H2UB 4U95A 4Q43A 4GKJF 3D9BA 4ELUA 1SV5A 3DHXA 4HDHA 4Z7CA 2MGZA 2GNKA 2MZRA 1X4EA 2VKZG 2C2EA 3SMZA 3H2LA 4ES2A 2RRBA 2LMIA 3ILJA 3IWLA 1IWGA 4YMEA 3NMRA 3CJ2A 2J5AA 3DLLQ 1QVGR 3B4DA 1LW2B 1P9QC 2HFNA 3LO3A 4K2JA 2VHGA 4X2BA 1Z2ZA 2DXDA 2QLJB 3ETOA 5JVGQ 3UD3P 2F4FA 1JLCB 1QUPA 2V9KA 1GAOA 3GG1A 3FDSA 3OL8A 3NNAA 1NKBA 4LF4F 4QPXA 2ZC4A 3VVTA 4PKDB 4ALZA 4GKKF 2UVUA 2GJ2A 2CQ2A 4IG0B 3C19A 2NXUA 5CD4A 2PMWA 3FZBA 3PRVA 1SI9A 1WHWA 2IVMA 4M8LA 3JAMU 1LV5A 4FXWA 4CWBA 1HBOB 3CMES 2VDIA 3HKZD 3OVSA 2ZITA 2OSQA 3FSYA 4O0IA 3QSIA 1RGVA 2VKRA 3BKFA 3GCWP 1JJ2R 1GQEA 3PKMA 2I8EA 1S76D 4ZCLA 1UWBA 1HA1A 3TX8A 4QQBA 5F8HA 4LRCA 1FJGJ 5E33A 2VG5A 3ISZA 2E5JA 1K9MT 3BJYA 2MKSA 2XSJA 2LEPA 3CJ0A 3LW5C 3OFEA 4C8NA 2UU9J 3G87A 3BQ0A 2F8HA 4LRFA 4MH8A 1RK8A 2BJDA 3NNCA 2XY6A 5CHCB 3H90A 4DQQA 5KFMA 3QGPA 4X65J 4PYAA 3TVZA 2XULA 2DNLA 2DNGA 3A8JA 3KLIB 3WHIA 1RCXB 4LIWA 4CO3A 2QA4S 4OYBA 4TYBA 4F67A 2DNHA 3HVRA 2W9BA 4KPYA 1NXIA 5ETLA 1BQXA 4M5GA 4FYWB 3R5CA 3ET6A 3BR8A 4LF7J 2XS2A 1FRLA 3L7OA 2V94A 3M4XA 5F9NA 5HSPA 2VIHA 2D3OR 4C11B 4EBCA 2CDRB 4OJ3A 3GIRA 3MUTP 1JB0C 5ETQA 2J8SA 5THWA 3H59A 1MMDA 4AXIA 2V0NA 3VHQA 3EVMA 3NAIA 3DRSA 3BYPA 1S97A 3ITHB 5BJRA 1OS5A 4FZVA 1N52B 1KVJA 3OSNA 5K8NA 3QT8A 4ZIWA 1TELA 5KFTA 1ZBTA 4OZNA 5D0RA 2QZ8A 3JYTA 4DPYA 5CCLA 3IR7B 3O8WA 1OY6A 1NKEA 1LW0A 2QLBB 2JSXA 5KG4A 3JSMB 1M1HA 1NU4A 3UWTA 4F3QA 3MGJA 3GYXB 1TKXA 3KUGA 5KG5A 2HNYB 2GV1A 1VGYA 2PT0A 2CPFA 2QMUB 3RAXA 2GZOA 1SH0A 2OD6A 1PJ6A 4ECRA 2GA7A 2CNNB 4K4YA 3KXDA 5DLFA 3IRXB 1G3OA 8AT1B 4KHRA 3V6DB 2XQCA 4ID5B 4DR3F 2ZUAA 4WFZA 4NYZA 3ZZOA 1IXKA 3LGHA 1UFKA 4DX6A 2LXFA 2W7PA 2QLWA 2V4QA 1SJQA 1X8DA 1SH2A 2JH3A 3DOMA 4MYUA 3FJ2A 4ZJQA 3UD4P 4JI1F 2NREA 1D09B 1EP4B 2MJNA 2QG9B 3GP9A 4RUHA 2P9CA 4YHHJ 2P5VA 3OW2R 1X4GA 3IN5A 4S0MA 2VQEJ 2DH9A 4B3SF 1JLBA 2HVZA 2PN6A 1LWXA 3CDUA 4A8MP 1D0EA 3AOBA 5GAHI 4IUFA 3N9UC 1QE1B 1R6YA 1MN9A 2W7OA 3BGFA 4YR2A 2RVJA 2ZEJA 4MKVA 2F9JA 3ITHA 5U47A 4FDFA 3RYLA 5JVHQ 2ZZNA 4QIEA 1EZZB 4MK7A 2DPJA 4DV3J 1Q81T 2MPUA 4HT7A 2VODA 5I3UA 3HHKA 1RUSA 3C6TA 5DG7A 3QT5A 4R8UB 4KH1B 2F3JA 4DL2A 3G82A 4KFBA 2CADA 2DR7A 2XLIA 4Z7YA 2PIIA 2PEHA 4RNNA 2K1RA 3KHRA 2ALZA 3EGVA 1GTHA 2FLLA 2LLZA 1NMEB 1XMQF 2J0XA 4Y2CA 3SSRA 2DR5A 5ETSA 4ED1A 4AFFA 3I82A 3IAS9 2LU2A 2XHWA 2VQFJ 5J2QB 4RW9B 2FB0A 2FHOB 3TO8A 3HP6A 2HHVA 1GEHA 4JI8F 3IAM9 3KUHA 3G8QA 5C25B 3TUZC 3NBPB 3LA0A 2FLOA 1FE0A 1BWVA 3HX9A 3MD1A 4RBTA 1UA0A 3JTOA 2DIVA 4F4AA 2VFTA 3PYDA 5D0EA 3TZWA 2W1BA 4CNZA 4B3TJ 3VAFA 3JSYA 4AYBD 3W9IA 2F8EX 4G1QB 4DJBA 3IC1A 5CABA 1DTTA 3I5BA 4C8MA 5A8RB 4OI1A 2OPQB 2Z2MA 2YWFA 3LWLA 3GCXP 3E8OA 2EKYA 3PXGa 4DUZF 3MECB 2FVCA 2LEBA 3BGUA 4MAKA 3CXCR 3B78A 2R7RA 5AXNA 3H40A 2MLXA 1VQLS 2UVRA 1IKXB 1VQOS 1SJ3P 4LQ9A 4ZVTB 1FWLA 1FHTA 4B3MJ 1S6QA 4USKA 3CCMS 5J2MB 1CJVB 1UJ4A 2ZWOA 4PG5A 2GVZA 3AA8A 1T7PA 1K73T 3Q83A 1YJ7A 4I68A 1U1QA 1S6PA 5KT5A 4ZCKA 1N5YB 3RW7A 1TL5A 5ETPA 1URNA 3THTA 5K8OA 1TR0A 2DNQA 3IG1B 3N6LA 3FZ2A 3D1QA 2GFFA 4NXMJ 4QYZK 1NB2A 3SSQA 3KG4A 1OY9A 2BQUA 1TKZB 4NI2B 4OYXA 2UUWA 5GVQA 2IAJA 3FCVA 4USWA 3KLFB 2HAFA 4ECXA 2IM0A 1XNQJ 1U1MA 1HYSA 2CJAA 1WEXA 1X4BA 2AJ0A 2YWWA 3ENVA 4KH0B 4KGMA 3S01A 1S0OA 1RT6A 1FRMA 2DNPA 4JI0J 2OPPA 5EDWA 4WP9A 3PW4A 2FJVA 2R8IA 2X51A 1WKJA 3MEEB 3JQMA 4F25A 1JIHA 1Z2LA 3R8YA 3E51A 2APOA 1XIQA 2JFKA 2M5YA 2QLXA 4N47A 3NP5A 4F2SA 1VQ6S 1TMJA 1F3VA 2BKOA 3WX4A 4DV0J 1N36J 2IC3B 1TMMA 1S6OA 3EM1A 5HP1B 1FJGF 4C3MA 4ANDA 1E6VA 5HMZA 3Q8QB 3KK3A 4ZVEA 2AEJA 2QMWA 4ECSA 4DPWA 1IKYA 1RADB 3NGRA 2BYCA 4HACB 4J9KA 3K5PA 3J80Y 4QR1A 1WDDA 3DRPB 3HHLA 4F26A 2HHXA 4DOZA 2ACMA 2IM3A 3D6FB 3F73A 3VQSA 3W2VB 2UV8G 2FJBB 3NMAA 2G0CA 3M6UA 1VYAA 1N5YA 1H38A 1FEEA 3OVBA 2LQ9A 2R2RA 3EVWA 2K2PA 2KRRA 3T9NA 4DN0A 3U1LA 5IWAJ 4DR1J 2AKWB 3W9HA 4FPRA 3PX6A 1S12A 5KFYA 3GIKA 1QTMA 4O4GA 2V2KA 3CE8A 1G2EA 2ABYA 2XYPB 3GWCA 3HJVA 2DITA 3HSJA 1DRZA 4LFCJ 2B8QA 5C2CA 3M1VA 4RW6A 5A8KB 1RE1B 4J9RA 1YDLA 2IPOB 4MKYA 1LK7A 2MHEA 4DV7F 4FP9A 2CVIA 5HBMB 1TL3A 3MMJA 2OPSB 2PDAA 5KFSA 1Y10A 2W4PA 2JX2A 5B08A 4AUKA 1GX6A 2GC8A 2NXCA 1I3OB 2DHGA 4ENOA 2N3OA 3IBCB 2MXYA 2OTLS 2A2DA 3QRPA 4F0HA 4P2SA 1EQMA 1JLGB 2R7UA 1HIYA 1SKUB 2ZDPA 2XTJP 3KK3B 1X7VA 3J80U 3MTKA 1S9EB 1RT1B 4DPTA 2BV3A 3DLGA 4OX7A 2R3VA 2ZBRA 3QGGA 1KBRA 2C1EB 4KO0A 1NJXA 2XY7A 3LANA 4WYWA 4LF5J 4J9OA 1K0VA 4C8KA 5J1EB 2ZZTA 2OHDA 2ROPA 1Q1KA 4JYAJ 2HWTA 2YH0A 2Q79A 1FXDA 3DDKA 3US5A 5CXTA 2VFUA 3FBBA 4MIWA 1X4HA 2YQ3A 3TQEA 3N5BA 1REVA 2IIHA 1HHQA 4YY3J 4WFBQ 3OUYB 1MROB 3DMJA 2EFQA 4IOBA 1J5EF 1WNEA 1JLCA 1TUGB 4O23A 3MCNA 3D28A 2MLYA 2OMLA 3HHLC 3PDNA 3MEDA 1ICEB 3HLUA 4NLVA 5HQLA 1TK8A 4Y28C 1ROFA 2ASDA 3VCDA 2DH7A 5F8IA 1UL3A 4M63A 5B0EA 3ZZZA 1BGXT 3T1HF 4F4YA 4EFAC 2MZ1A 4DV2F 1D9FA 2PE8A 4EZ9A 1MWYA 2AJQA 2H48B 4QBUA 4GC7A 4WFNQ 2DGWA 3DYAB 2AGPA 4KGZB 3GYGA 3P5BP 1C2PA 1SJ1A 2P6TA 2HLTA 3JQKA 4C6AA 2MQLA 4Q5VA 4DR6F 3O44A 2CPDA 3WBZA 2ADCA 3PV8A 3H8YA 1AW0A 4I64A 1Q7LB 3SV3A 1H0HB 2VG5B 3HXMA 2KYZA 3W2WA 4R5PA 1AYEA 2VU5A 2WRMA 3N6NA 1VHIA 2PEBA 3LUYA 3QQCD 2MKYA 2EXUA 4QW8A 3R97A 4DN9A 2KU7A 4ER8A 3RR8A 1R8HA 1OY8A 4PG7A 1GFWB 4X66F 3D68A 3P8BB 4RUAA 2ZKUA 4MTPA 3KLIA 3OTOF 3MOJB 2QL7B 2QGFB 4ECYA 1GXTA 1X60A 3QGIA 5G0RB 3M8PA 3C14B 3EZ5A 1N6QB 2H4WB 4PUOA 3I9V9 5K8MA 1GX5A 3A8EA 4N8OA 4XO0A 2MMYA 4YB6A 2XS5A 3U1NA 2KTQA 2FHJD 1D1UA 4B3OB 6FD1A 3PNIA 4GKJJ 5I3QA 4ECZA 1NK9A 3EPGA 4KBIA 4RW4B 1VK3A 3MM8A 4C4WA 3N79A 1ZM9A 3DU6A 1R31A 1TL7B 1NSPA 4LF2A 2I2YA 3R6LB 1C4AA 4KY3A 5IV3A 5K14A 2Y8WA 5H9FJ 2E7VA 4F0MA 1A0OB 1VJQA 3G8SA 4K4TA 3ICLA 4GMKA 4R25A 5DDPC 4ZLNA 1V6HA 1QAXA 4RZRA 3FRYA 5D15A 2BR0A 4K4ZA 4EO6A 3MR3A 1IKWB 4G3IA 1U2FA 1VQMS 4H4KC 2V4RA 1RHQB 3DI6A 4V19J 1K1QA 2W9CA 3FGVA 3KNGA 2G4BA 4I56A 3BN4A 4JI0F 1U45A 5J2PB 3UR3C 1CPZA 2HHHJ 2BE2A 3MMCB 3W3SA 4O4RA 3H20A 3W5YA 2VG7A 4OYPA 2CJBA 2D3UA 2EFGA 2GMLA 2NS1B 2ZBCA 3OFFA 4M5LA 5F9LA 1B70B 1JLAA 2UUAF 1T95A 2UUAJ 2XMJA 4D3HA 3CD6S 4K4XA 3RGIA 2J0WA 1N6QA 5DZ7A 3M6XA 2Z57B 3U1MA 1RHMB 3QYYA 4F50A 4ANEA 3G6VA 1J5OA 4HH1A 1JNRB 2NZCA 1NK0A 2NZ4A 3FFIB 4ZIVA 1GXLA 2A1BA 4B3OA 2RU9A 4OHVA 1P6TA 4DG1A 2BOAA 4JI4F 2F1FA 4WP8A 3G4SS 3K58A 2YNIB 2ZM6F 2C3PA 1EQ0A 3IS9A 5A0YA 3W61A 1WUUA 3ZNUA 1S4EA 2HAIA 2B5JA 2JVRA 2ZBIA 4DX5A 2RMLA 2DPIA 4ETXA 2VBXA 3V2UC 1TUWA 4QR2A 1FVSA 4RW8B 2J9EA 2VA2A 1RT5A 2Y0BB 1KDNA 1RACB 3MM7A 4W4MA 3OTOJ 3KLEA 2JFDA 5DZ6A 1RHJB 3ZZ0A 1DAXA 1NJIT 3FEYB 4M1KA 2B4OA 1VK8A 3LP0A 2NYHA 4NLPA 4DF4A 3IP0A 4XTTA 4N77A 5M2UA 2YX1A 1R0BG 1O8BA 2RQ4A 3GIJA 3R1LA 4MK9A 5H9EK 1TL1B 2BXJA 2BQ3A 1PCAA 4FF3A 3AD7C 5ETRA 4I7FB 1Y5NB 4QIFA 4HI1A 3D7SB 4ZVHA 4IH7A 4EGLA 2E5GA 1R0AB 1U48A 4QU6A 2Y0SD 1T03A 1Y7PA 3EUNA 1HNXF 1XN9A 4OI4A 4LVNP 2FJAB 2QIFA 5CZXA 5J1NA 1Q82T 4WK3A 4B3SJ 2KVIA 3KK1B 3CJ3A 2DNYA 1O5JA 4RPFA 3I4HX 4DSIA 2IHR1 1GT8A 1S5ZA 1VRTB 3OTDA 2B5JB 2XMWA 4QIWD 1H2UX 2K8GA 4UTGA 2B9EA 1PG5B 2ZBQA 4CO5A 2WSEC 2ZKTA 4X62F 3MFIA 4DL4A 4JI3F 1BHNA 1FD8A 4EUVA 1KLNA 1NK6A 1YZ7A 1MNEA 2C2ZB 1BUXA 2B7BB 3GYNA 2UUBJ 1I5OB 2I6WA 1GTEA 3M6WA 2LVWA 2H54B 2P9GA 3BGRA 1PJ7A 3OFGA 3PEJA 4CI0B 3BB5A 2XCPA 2K7JA 4E8UA 4DQRA 1SUQA 1IKVA 2EVZA 2J0SD 4J90A 2HNDA 9RUBA 4Q45A 4YHHF 1VQKS 1HQUB 1P27B 4OZ5A 4XDDA 5ETOA 4Q0BB 5FJ4A 4F4KA 1IR2A 2JZ5A 2YKQA 3K8VA 3N6MA 5DLGA 1N34F 1M0SA 2YVSA 1ZH5A 2DGQA 2RQKA 3MPYA 4RWWA 4WPAA 1R0AA 3CJTA 1HYSB 3BO4A 2AJ2A 2B6AB 4PXEA 2DGXA 3GV8B 4DV0F 1NHVA 1MG7A 5DS7A 1HBUA 4EZ6A 2W8KA 5DDRC 1Z1ZA 3CCTA 2UXDJ 1RTJB 4QWCA 5HAOA 1B0PA 3CPWR 4M94A 4C8YA 2RS2A 4ED4A 5F41A 3TUIC 5IC4B 5KFAA 1FDBA 2XWXA 1RWMB 4Z37A 1GMWA 1Y5LB 2J8AA 1NRKA 3PTWA 2VONA 4IR9A 1XC9A 2GO9A 3R2DJ 4PR6A 1KVKA 1WOOA 4IO1A 4QWBA 1EAYC 4CO1A 4IH5A 2HBQB 1WF1A 3W2VA 3CCJS 2UUCF 2KO1A 4M5DA 4K4WA 1HL6A 3NXZA 1WF2A 2DHHA 1C0UA 3RR7A 3GV5B 4ZDNA 3MEGA 1P1LA 2BANA 2QL5B 2MQQA 1HWLA 2K3KA 3Q2SC 1YHQS 2V8HA 1WWHA 1S1WB 2Y1LB 4R0EA 4PG8A 3OHBA 5LMUF 3GLJA 4B3TF 2G0IA 2RKIB 4ZA1A 3CGIA 4DL3A 3U02A 2DK2A 4DF8A 5HANA 3SBMA 3M1VB 5A8KA 3G8TA 2AZ1A 1RI7A 3HVTB 3MEKA 1W2IA 1RWPB 3AD9C 1UPPA 1IBMF 4J9VA 3PRDA 3FRZA 1FE4A 3ENQA 2HMIA 1Y9OA 1PO6A 1FFSB 3DOMB 2DD8S 5IZHA 3PFOA 3NGSA 4Y00A 3W5XA 4C8OA 2R9LA 1T3OA 2IBKA 3D67A 1IBCB 4NE9C 3VALA 2NPFA 4W92B 3AXMA 3OL9A 2AMCB 3C6UA 2CWXA 2WVEA 2FJXA 4PQUB 3S1TA 3GFYA 2ZD1B 5C24B 4C3LA 3C15B 2GQQA 3AQPA 2CQHA 2DY1A 1ZA2B 2HQGA 2QC3A 1KTQA 5KOXA 5L38A 2QA1A 4B9MA 1S1XB 3ZZYA 4YN3B 3MCSA 3WC2A 2WZ1A 4P2MA 2PI4A 4DR4J 2WONB 2LCWA 3I0RB 3MAHA 3R5AA 4OX9J 1UTAA 3MM9A 5AJ3F 3HF5A 1VCTA 1F5BA 1Q8IA 1UZHA 4ZVSB 3BBCA 4AQYF 3A13A 2J6TA 4UOFA 2IDLA 3LP2B 3G6XA 3J81Y 4DUZJ 3JTPA 3HVWA 2UV8A 5GAHU 3OXLA 3UW1A 3T19A 1WC3A 4LBPA 2RSQA 1U6FA 4OJGA 4KSEB 5B0BA 3H5UA 4TVAB 4YB7A 2R7OA 2WCXA 5C42A 4ZJOA 5KT4A 1KKHA 3DYAA 5KG7A 1JWWA 2EBGA 4X4QA 1DURA 4F36A 2OPRA 2Z2ZA 3F41A 4K5SA 3MD3A 2NXJA 4Y2IA 3K59A 2GHPA 3NCQA 2COLA 3W2WB 3UO0A 3I0SB 1RT3B 4WXWA 1UWBB 4JV2A 1KP6A 1D8YA 2UUTA 3H7HB 4ELVA 2DGVA 4B17A 1FI4A 2HWHA 2M3DA 5DDQC 2KJWA 3GILA 2IM1A 3P45B 4CO0A 1RB0A 3SI8A 1XJWB 4WZQA 2OEKA 5LL6d 4ED0A 4LRAA 5GADI 2XBPA 1TU0B 3R3TA 1C4CA 1GMVA 2HVDA 3EMTA 5D4NA 1FXRA 3N4WA 5G0RA 1VBYA 3LP2A 5J2MA 2ILYA 1ZOTA 2IJNA 3DRRA 1KNZA 1NDPA 2N7YA 2GHWA 4U8VA 5F8LA 4GVBA 1RZMA 1R8PA 1HARA 2Z8QA 2ZJPQ 2U2FA 1I6JA 4OYMA 5ETNA 2DRBA 1R7IA 4WTYA 5CZVA 1FK9B 4NASA 2KRBA 5A8WB 1R8CA 3QT7A 2J0QD 4C8ZA 1LWCA 4WZMA 4Q8FA 1I94J 3DRSB 1RU1A 3EDQB 3JQJA 4FKXA 2E9TA 2UU9F 3QWUA 2M2BA 2DRAA 2PGCA 4X4PA 1FRXA 3DLKB 2BA9A 3EWGA 4O44A 4UT4A 5FLXU 4DV6J 2Y9HA 3P6YC 4FVCA 4QYZJ 3VGTA 3EZUA 4LFAF 7AT1B 5LMNF 1HQ2A 5KFOA 4F8RA 3HSDA 3RRHA 2YY3A 3MTJA 3LPYA 3VAKA 4ZLJA 3AT1B 1FNMA 1CJUA 3UDEA 1RT7B 1RTIA 2NXEA 3AB2B 3IFEA 4KV8A 4LR9A 4DPUA 4YUDA 1SL1A 2C2RA 4OHYA 2KT3A 2EK1A 2JLGA 1C1CA 4BCAA 2DNNA 2DVIA 3HZEA 3I5CA 1VOMA 1U1OA 4EYIB 1IQTA 3DRPA 1S7HA 2W9AA 4WBFA 5CCMA 5FDLA 2K06A 1MU2A 4IFVB 3HFZB 3TA1A 3GJRB
chains in the Genus database with same CATH topology
2XZDB 2HBRB 2HBZB 4ZVPB 2C1EB 2Y0BB 3QNWB 2QLJB 4LSZB 3KJNB 2H4YB 1RHJB 1IBCB 3GJSB 2CJYB 1SC4B 2XYGB 1RWXB 2XYHB 3EDRB 4JB8B 3P4UB 1SC1B 3GJTB 1ICEB 1F9EB 4DCJB 4ZVSB 3R7NB 1RHRB 2H48B 2H65B 2H5IB 2CJXB 4DCOB 2CNOB 3R6GB 4ZVTB 1RHUB 4ZVRB 2QL9B 3RJMB 3D6HB 2CNLB 2CNKB 2C2ZB 3D6MB 3KJQB 3R5JB 3KJFB 1PYOB 2H54B 1GFWB 5IC6B 2XZTB 2CDRB 2DKOB 2C2KB 2QL7B 1PAUB 1RWOB 2H4WB 1I51B 1QDUB 3P45B 3NS7B 2C2MB 1RWVB 2QLBB 5K20B 3R6LB 1SC3B 2CNNB 5IC4B 3R7SB 3D6FB 2H51B 2QLFB 1RWMB 2FQQB 3R7BB 1RHQB 2C2OB 2HBYB 3EDQB 1RWWB 4DCPB 1RHKB 2HBQB 2P2CB 4ZVUB 4ZVOB 3SIPB 2XYPB 2H5JB 1RWKB 1RWNB 1RE1B 1RHMB 2QL5B 2Y1LB 4ZVQB 1I3OB 3IBCB 1BMQB 1RWPB 3GJQB 3IBFB 1QTNB 3GJRB 1NMEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZD B;  2HBR B;  2HBZ B;  4ZVP B;  2C1E B;  2Y0B B;  3QNW B;  2QLJ B;  4LSZ B;  3KJN B;  2H4Y B;  1RHJ B;  1IBC B;  3GJS B;  2CJY B;  1SC4 B;  2XYG B;  1RWX B;  2XYH B;  3EDR B;  4JB8 B;  3P4U B;  1SC1 B;  3GJT B;  1ICE B;  1F9E B;  4DCJ B;  4ZVS B;  3R7N B;  1RHR B;  2H48 B;  2H65 B;  2H5I B;  2CJX B;  4DCO B;  2CNO B;  3R6G B;  4ZVT B;  1RHU B;  4ZVR B;  2QL9 B;  3RJM B;  3D6H B;  2CNL B;  2CNK B;  2C2Z B;  3D6M B;  3KJQ B;  3R5J B;  3KJF B;  1PYO B;  2H54 B;  1GFW B;  5IC6 B;  2XZT B;  2CDR B;  2DKO B;  2C2K B;  2QL7 B;  1PAU B;  1RWO B;  2H4W B;  1I51 B;  1QDU B;  3P45 B;  3NS7 B;  2C2M B;  1RWV B;  2QLB B;  5K20 B;  3R6L B;  1SC3 B;  2CNN B;  5IC4 B;  3R7S B;  3D6F B;  2H51 B;  2QLF B;  1RWM B;  2FQQ B;  3R7B B;  1RHQ B;  2C2O B;  2HBY B;  3EDQ B;  1RWW B;  4DCP B;  1RHK B;  2HBQ B;  2P2C B;  4ZVU B;  4ZVO B;  3SIP B;  2XYP B;  2H5J B;  1RWK B;  1RWN B;  1RE1 B;  1RHM B;  2QL5 B;  2Y1L B;  4ZVQ B;  1I3O B;  3IBC B;  1BMQ B;  1RWP B;  3GJQ B;  3IBF B;  1QTN B;  3GJR B;  1NME B; 
#chains in the Genus database with same CATH topology
 1ZAX A;  1KHW A;  3Q86 A;  4CH0 S;  3IWN C;  4LMZ A;  1CQM A;  3FEZ A;  2KG1 A;  2GVD A;  2N3L A;  3T6J A;  1WEL A;  5L8R C;  1C0T A;  4W98 A;  4FKY A;  1IJE B;  1FTR A;  1A7G E;  1RWU A;  3LF0 A;  1U25 A;  4C48 A;  2A6O A;  5F3T A;  1SQG A;  5LSO A;  2XMU A;  5MLC V;  3RAM A;  2LFV A;  3VF0 B;  2CQ1 A;  3CNQ P;  1FFG B;  2M52 A;  2ZVS A;  1S1T B;  4NPO A;  4L74 A;  4NA3 A;  3LAM A;  3DCA A;  3PHE A;  2AYG A;  1BQM A;  2DNZ A;  1PAE X;  2D69 A;  3L95 X;  1AXQ A;  3P4U B;  4R0J A;  2BUN A;  2KH9 A;  1HNI B;  4LF6 J;  4FYD A;  1B0T A;  1X0P A;  1DLO A;  3DU5 A;  4RKU C;  5GAE U;  3PIO Q;  4H4M A;  4DSF A;  8ATC B;  3CUN A;  3HCX A;  2HHW A;  2QA2 A;  3IM8 A;  5GMK a;  1N36 F;  3M8R A;  2YXL A;  2G2Y A;  3K8W A;  1N5Q A;  1M1G A;  2ZUG A;  4NLW A;  4DCO B;  5DJB A;  4ZLP A;  1KSP A;  1S49 A;  2H9Z A;  5B0D A;  3GMG A;  1UEV A;  4L3K A;  4GRS A;  4HL9 A;  2DY9 A;  4URS A;  2JLE A;  2H5E A;  2ZBP A;  3CCZ A;  3HUL A;  2GQC A;  5AT1 B;  3MAQ A;  4OLO A;  1T03 B;  2ZE2 A;  2V6A A;  3KHL A;  5HRO A;  5DQI A;  5B09 A;  3CED A;  1FKA F;  4JBC A;  3IRW P;  4J9S A;  2KFN A;  2DH8 A;  2LQ8 A;  1VQ4 S;  3TUP A;  3DLB A;  5HJX A;  3FEX B;  1G7C B;  2RQC A;  4KHP J;  3M05 A;  3TZY A;  3UVJ B;  1Q8L A;  2HK3 A;  2EC2 A;  4XAK A;  4Z2X A;  2M8D B;  2WBR A;  3TA0 A;  2IMO A;  4IO9 Q;  1FX4 A;  4G1Q A;  2QEX S;  3CC4 S;  4IQX A;  3Q8P B;  3T9Z A;  3MPU B;  2BEF A;  1JJ4 A;  2V2Z A;  3FBF A;  3KNA A;  3IGV A;  1YJV A;  3F0N A;  4ZCM A;  4PPZ A;  3ZTR A;  2N4D A;  3PW2 A;  2GS8 A;  2RUS A;  4IQM A;  3J7A 1;  3M8S A;  1U26 A;  2DNK A;  2E5I A;  2VJU A;  3PAC A;  4M5H A;  2J9D E;  2F8M A;  3ILI A;  4RBU A;  1FKP A;  1UET A;  1SUQ B;  4HHJ A;  1IKV B;  3SFG A;  1M90 T;  2UXB J;  5D4P A;  5F8G A;  2DCL A;  2AYM A;  3GPA A;  3CD5 A;  4L73 A;  2J6U A;  4RUC A;  2GIR A;  4DFJ A;  5DQH A;  3HJF A;  2WW8 A;  1S6P B;  3A1Y G;  4YP3 A;  1QM9 A;  1FDD A;  1HNZ F;  3CJ5 A;  2OKQ A;  5KFW A;  3CC7 S;  1VDH A;  2HFZ A;  2MGZ B;  2MKH A;  2HLU A;  2V68 A;  2R42 A;  3AJ2 A;  4B02 A;  4WYL A;  2YX4 A;  4DI6 A;  4OZ1 A;  2F65 A;  2AP6 A;  3DRY A;  1IUJ A;  1TUV A;  1XR5 A;  1OIA A;  1ZA1 B;  3HHD A;  3KG1 A;  2ROE A;  3W9J A;  3MMB B;  4ES1 A;  1TKD A;  3CT9 A;  3SQG B;  1N56 A;  1B4S A;  1R8A A;  2DEI A;  5L46 A;  1X9M A;  2GGP B;  1EAR A;  1RWW B;  4PEO A;  4USV A;  3C14 A;  5KFC A;  3KKF A;  2EKN A;  2XCA A;  2G1H A;  4ILM A;  5KFL A;  1TP7 A;  2ZH4 A;  5D78 A;  1M5S A;  2F40 A;  2OEL A;  4KB7 A;  3SYZ A;  2H3E B;  2RRA A;  5E3Q A;  2E66 A;  1RAO A;  1NB7 A;  2XNQ A;  4OYW A;  2CPJ A;  2EC0 A;  1AFJ A;  4ILR A;  4DL5 A;  1WG1 A;  2WHO A;  1U7L A;  2L41 A;  3ZNJ 1;  1ZTW A;  3C16 B;  3F56 A;  3H5Y A;  3KTQ A;  2AU0 A;  3R5D A;  1YGY A;  1VJW A;  2R2U A;  2MZT A;  2ZNZ A;  3G96 A;  4OX6 A;  3GJQ B;  1LEO A;  1Y11 A;  2ACY A;  3UDV A;  3VR1 A;  4F3O A;  1RJJ A;  2BAC A;  1TFY A;  4NZ0 A;  4WFA Q;  4KHP F;  1S77 D;  3O2I A;  3I55 S;  2OI2 A;  4LBH A;  2WVC A;  3U7J A;  2HNZ A;  2R4F A;  3J7Y I;  2WB4 A;  3MAA A;  1DZ5 A;  2HBZ B;  2M7S A;  2VZ9 A;  4G1P A;  3WQP A;  1HHS A;  2CZ4 A;  2R7Q A;  4KC5 A;  1NCL A;  2PFD A;  3LWM A;  1X4A A;  2AX0 A;  2HEK A;  1N5T A;  3DKD A;  1RT2 B;  3LP1 B;  4O4G B;  2FHJ A;  2G2Z A;  3ET6 B;  4USI A;  5T7L A;  4CLW A;  3GJS B;  5LSR A;  4OIX A;  2Q3P A;  5HO4 A;  2HS3 A;  3G6E S;  1BQN B;  3KLV A;  3B4M A;  4C11 A;  1HQE B;  2CG8 A;  3SQG A;  3UR0 A;  1VQ8 S;  1CS4 A;  2DBB A;  2MEW A;  3M32 B;  4Q2L A;  4RNF A;  3THV A;  1U1P A;  1RYS A;  1QAJ A;  1KLM B;  1RAE B;  2E7X A;  4X4R A;  3MZI A;  2NQP A;  1V3S A;  3GR1 A;  3J7A N;  1UJ6 A;  1YK9 A;  1H3D A;  1MMN A;  2QT7 A;  3LAL A;  3MCO A;  4EO8 A;  3J7Z T;  2ZZM A;  3EYZ A;  4J9U E;  4DL0 C;  2HFS A;  2HHS A;  2IM2 A;  1RXO B;  5CQG A;  4PQU A;  2BW7 A;  1LW0 B;  1CJT A;  2DR9 A;  2F63 A;  2EWH A;  2HRU A;  3BZQ A;  3EE3 A;  2XEX A;  1DHM A;  4KPC A;  4X66 J;  2KG0 A;  3IWX A;  4CIO A;  3DLG B;  2BVZ A;  2H5I B;  3SCL E;  4ZPB A;  1HLW A;  1NM2 A;  2VUG A;  8RUC A;  3D6T B;  1NK4 A;  4OJH A;  3V6J A;  2ZM6 J;  3MM7 B;  1OMS A;  4J91 A;  3VAH A;  1ZM4 A;  3V6D A;  1H74 A;  1IN0 A;  1Y3J A;  2EEY A;  2RD5 C;  4FYX B;  3L9Z A;  2HQD A;  4WWS A;  2W8L A;  1APS A;  1R8B A;  2OEJ A;  1VR6 A;  2CNL B;  2V2V A;  3DOK B;  3LTO A;  3ZO7 A;  2Z2L A;  3VWS A;  1EP4 A;  3QWP A;  3IRX A;  4FYV B;  3UCU P;  4K8R A;  3UQS A;  3HT3 A;  3T1A A;  2VQF F;  3TJ8 A;  3GG0 A;  4DLE A;  1N8R T;  4OI0 A;  4IOA Q;  3UPF A;  1N32 F;  2W25 A;  2RAQ A;  3SCJ E;  2XG8 A;  1KLM A;  2MKC A;  4LUB A;  2KM8 B;  2FY1 A;  4TU9 A;  3DLE B;  4H4O A;  3D0H E;  1UW4 A;  1I51 B;  3A4T A;  5IQ6 A;  1N48 A;  1B0V A;  3F44 A;  5CYQ B;  3ILL A;  4HHU A;  3OD2 A;  3T1Y F;  1FTC A;  2CZ9 A;  4ID8 A;  3L4B C;  1DTQ B;  2V34 A;  3M8Q A;  5EUH A;  3TA2 A;  2K3I A;  1VIX A;  2L08 A;  3T6B A;  1FDN A;  5ADZ A;  1WAC A;  3G82 B;  1HW8 A;  2VAS A;  3SV4 A;  2C3Y A;  1X4F A;  2LKZ A;  3A3N B;  4IR1 A;  3RBZ A;  3N5F A;  3K7R A;  5T14 A;  2B9Y A;  4MFB A;  4PWD A;  1JLF A;  1S10 A;  2LXI A;  3FK4 A;  4JI6 F;  2E29 A;  2YPZ A;  1W7W A;  2CQP A;  3POT A;  1KON A;  3AOD A;  3QAT A;  2B4U A;  2ASJ A;  3WZ0 A;  1XNR J;  5JUM A;  1Q0N A;  2BQR A;  3HO1 A;  3ISN D;  3VZH A;  4ECQ A;  4CLL A;  1WHX A;  2R2T A;  4IRD A;  2M9K A;  4OYI A;  1FF2 A;  1QJH A;  2WOM B;  4QWD A;  4DZ6 A;  5EHH A;  4JV1 A;  4LQ3 A;  1IM6 A;  2W24 A;  4MJK A;  4TY8 A;  3TW0 A;  1VQ9 S;  2QE5 A;  5E3R A;  1JQG A;  5F8J A;  4RNO A;  1RHK B;  5DGA A;  4DR2 F;  2BJ1 A;  2QX0 A;  1PYS B;  4OZ0 A;  1UW9 A;  2GCF A;  2LQB A;  3CJQ A;  4QW9 A;  4JI7 J;  2DIS A;  4C3K A;  1XNR F;  1FK9 A;  3P49 B;  1FER A;  2G13 A;  5H9F K;  4E2F B;  1VQ5 S;  5DQG A;  2VA3 A;  4LSL A;  2YWK A;  2IYI A;  2MDA A;  4AT1 B;  5IFM A;  3BDE A;  3R5B A;  2C3O A;  4Y6I A;  4F4Z A;  1N34 J;  2O67 A;  4CH7 A;  4QIG A;  3QZ8 A;  1JLQ A;  1F0X A;  3K5M A;  2BX6 A;  2C42 A;  2IA6 A;  3KOA A;  3GSI A;  3CJS A;  1LWF B;  2WVB A;  4I2Q A;  5J1P A;  2AGQ A;  4WII A;  3T5K A;  4JI1 J;  4LF8 J;  4PWD B;  1H2T Z;  3GQC A;  4I0W A;  4DV2 J;  3KDO A;  4G1I A;  5M2R A;  3QJL A;  2QO3 A;  5J2P A;  1BE4 A;  4CLS A;  4ZIT A;  2CQI A;  1N32 J;  1M1K T;  1T05 A;  2OH2 A;  4FF1 A;  3E01 A;  1ITP A;  1KHV A;  1OPI A;  4TQS A;  4DQS A;  5A2Q Y;  3QID A;  2VG7 B;  4J9P A;  4FBT A;  4IFV A;  2OJ3 A;  4X4T A;  1MW7 A;  1YSJ A;  1YZ6 A;  2IRY A;  2MQ8 A;  2OTJ S;  4NLX A;  4LF1 A;  3FSX A;  2JWN A;  3T1Y J;  2EW9 A;  5IT4 A;  4IRC A;  5KFN A;  1S57 A;  2MQM A;  2FC9 A;  3Q8R B;  4HVZ A;  4DX8 H;  4A8S A;  1NDC A;  4KGV B;  3RBE A;  1S59 A;  1PYT A;  1RKI A;  2PA8 D;  2MY8 A;  3H2V E;  3MEE A;  3OTE A;  3TWZ A;  3PW0 A;  3UDL A;  4BS2 A;  3QMQ A;  1DQ9 A;  5BXI A;  4IDK A;  3PX4 A;  1RAI B;  2I9S A;  1HNX J;  2OFG X;  2Y8Y A;  2FGC A;  1D3W A;  3R7N B;  1YX2 A;  2GIF A;  1HR0 J;  2BZ2 A;  3JYT B;  3NGK A;  1JLQ B;  1UVL A;  5D8H B;  4BC9 A;  4QWE A;  3NG8 A;  4LRE A;  4LSN A;  4U7U K;  1M5O C;  1H72 C;  2HQI A;  3CCV S;  2VFV A;  2UVV A;  1YBA A;  1DLO B;  2AF6 A;  2RT3 A;  4QU7 A;  4ZMM A;  4I2Q B;  1S0V A;  4OMF G;  1EX8 A;  5B7W A;  5DG9 A;  4G65 A;  2QYC A;  1SCJ B;  1UA1 A;  3AH6 A;  3TAR A;  4NA2 A;  2A0F B;  2CNK B;  1K47 A;  3ULH A;  3QO9 B;  3D6M B;  5LT5 A;  3UDC A;  5J2N A;  1RYR A;  1HD0 A;  2ZC3 A;  5AE1 A;  3MF5 A;  2KFY A;  2W7A A;  3M9O B;  3D66 A;  4UZC A;  4JV5 F;  2QSW A;  2XZT B;  3C66 A;  3T41 A;  3G6Y A;  4I7F A;  4P74 A;  5L9X A;  1S0M A;  1U4B A;  3MPV A;  3TAQ A;  3MMA B;  2DO0 A;  2A6M A;  4NLD A;  1RTH B;  1AUS L;  5HK4 A;  5LXY A;  4UOG A;  3UN3 A;  1I94 F;  2Q6C A;  2JDJ A;  2DR8 A;  3DFE A;  3RB0 A;  4MIB A;  1R89 A;  2EI5 A;  4ZPD A;  1QE1 A;  2JJ4 D;  1S1U A;  2CPZ A;  3VAM A;  1L3T A;  4IDK B;  3KK2 B;  2ZH8 A;  1UCN A;  2I0X A;  4E98 A;  4O3Q A;  1HNV A;  1T9U A;  1T9T A;  1WOS A;  2CDQ A;  3QLH B;  1TL3 B;  4OLP A;  2XI3 A;  4WK1 A;  2ZH6 A;  1Q8K A;  3THP A;  4UQG A;  3M2U A;  4HHH A;  1LKZ A;  2VG6 A;  3M7V A;  4CYU B;  3TAN A;  3C6T B;  2VFS A;  5C42 B;  2XGQ A;  1KRP A;  4WCE Q;  3BH6 B;  2DHS A;  5HAT A;  3BM7 A;  5KFR A;  1L5U A;  3AA9 A;  1H7X A;  3E2E A;  2V9W A;  1XBW A;  2NYI A;  3BGR B;  1FRJ A;  1KS2 A;  1UVI A;  4A8O A;  1VBX A;  4UST A;  3SDE B;  1P1T A;  1RT1 A;  3KLG B;  2MZQ A;  3S6E A;  2L3M A;  2DT9 A;  3GE9 A;  3PJX A;  1U0H A;  3ILO A;  2IA0 A;  3CMQ A;  2WK4 A;  2RE1 A;  5KFU A;  3H4D A;  1XTZ A;  2ZFH A;  3K17 A;  4ZCI A;  1PBA A;  4JYA F;  4OHZ A;  2GMJ A;  4ZN1 A;  3OUY A;  4LR8 A;  1CEZ A;  1SKS A;  2E5L F;  2E1R A;  3KDN A;  2B56 A;  1N0V C;  1TFW A;  1CG2 A;  1X5S A;  2B43 A;  2H5J B;  4IG3 A;  1YG0 A;  3NGT A;  1Q16 B;  3P96 A;  4O0N A;  2JC1 A;  1UEU A;  2XMV A;  3ELH A;  3HDS A;  1RKJ A;  1WC1 A;  2F4V J;  3BKU A;  4DX7 A;  4P10 A;  4DR5 J;  3PO5 A;  1FVQ A;  4XK8 C;  1SC6 A;  3JTN A;  5JMN A;  5KT3 A;  3PO4 A;  1YIJ S;  2UXB F;  1F6T A;  1WHY A;  4U8Y A;  1T8E A;  1Q86 T;  4Q7A A;  4WFY A;  1FXL A;  1VS3 A;  3FNN A;  4GVB B;  4UOH A;  4PUO B;  3EJM A;  3GR0 A;  4P71 A;  3UD5 A;  3V4M A;  2RUG A;  2OD4 A;  4GKK J;  2W01 A;  1AFI A;  1M5H A;  1X31 C;  1XR7 A;  3M2U B;  4YEA A;  5IQQ A;  4ZHR B;  1KQS R;  2R8K A;  1U8W A;  1WC4 A;  5DDO C;  4RUB A;  1K8A T;  2AQ4 A;  4CM0 A;  1FJ7 A;  4M5N A;  4FVM A;  4ZVP B;  1U1K A;  2VL1 A;  3CC2 S;  3IR5 B;  4H4K A;  1BD6 A;  1TTH B;  4JI7 F;  3IM9 A;  2KHC A;  1UVM A;  2R7V A;  3G86 A;  2J6S A;  1U49 A;  4ANC A;  4A4J A;  1U0H B;  2XNR A;  4EEY A;  5IWA F;  2DGO A;  2XYH B;  3MM5 B;  5HVG A;  3Q8Y A;  4JB8 B;  3HVA A;  2J7K A;  4CM2 A;  1FWP A;  3KLH B;  3FMW A;  3M9M B;  2MHN A;  1QSL A;  1FX2 A;  1RT2 A;  1S1W A;  2YKN A;  3LP1 A;  2FVR A;  1HI0 P;  4KJI A;  3VV2 B;  2VBZ A;  2ZVI A;  1HPZ B;  1LQ9 A;  4QZV B;  3GJT B;  4CQ1 A;  2BJ3 A;  1NDL A;  2EBE A;  4PCQ A;  3CO9 A;  4DHV A;  2G0J A;  2ZH9 A;  1HWK A;  1SXL A;  3KHH A;  3T1H J;  2LEA A;  3NWR A;  4OZJ A;  3RG6 A;  3MDF A;  1FRI A;  2DO4 A;  2PA3 A;  4KE5 A;  1RA6 A;  2MKJ A;  4PZV A;  4DEZ A;  4PG4 A;  1HBN B;  5JJB A;  1ZYQ A;  1J5E J;  4DSL A;  1N5V A;  3HSZ A;  5D0H A;  4KGX B;  2MB0 B;  2KB2 A;  2A2C A;  3RW6 A;  1T0T V;  4DPO A;  3KFW X;  6FDR A;  2PFF B;  3D54 A;  3X3U A;  2UVW A;  3L7P A;  3ZZU A;  3QZ7 A;  2RIL A;  4WE1 B;  1TZ0 A;  1Y4Z B;  5DET A;  3I87 A;  3PZP A;  2OIH A;  4LR7 A;  3C15 A;  1SL2 A;  3OTB A;  4LF5 F;  2HPU A;  3CMA S;  2LEC A;  4TKT A;  2BBE A;  3V5R A;  3MMC A;  3ZTQ A;  2HZC A;  2BKN A;  4F4X A;  2ZJR Q;  1SJR A;  4A8Y A;  3P3D A;  4PAA A;  4QJV A;  1NO8 A;  1TKT A;  2HIQ A;  2WAQ D;  1ZET A;  2HYI B;  2XC9 A;  2W9C B;  1RAB B;  3DOK A;  3OR2 A;  5HL7 Q;  3PVX A;  5D6G A;  2V8V A;  1RWO B;  3QAU A;  2XMA A;  1WTB A;  4JP8 A;  4J9Q A;  5KG3 A;  3RBD A;  2JEI A;  5IM0 B;  2XGP A;  2MSS A;  4QPT A;  2HIY A;  4CRJ A;  2MKI A;  3KYL A;  2O66 A;  2RRN A;  2I1R A;  2XWY A;  3FFI A;  4QOT A;  1NZA A;  4LF4 J;  2V4J B;  2VDH A;  5EWE A;  1PJ5 A;  2JOQ A;  1OYD A;  2YNH B;  3WX8 A;  3BYR A;  5DGB A;  4CCH A;  4U96 A;  2DYA A;  2F9D A;  2OO4 A;  2L9W A;  3MI7 X;  3H25 A;  3JAM Y;  5DM7 Q;  1T02 A;  3OJU A;  4B9V A;  1M5K C;  2JEF A;  3H42 A;  2CJQ A;  1HKA A;  4U7U D;  1RBO B;  1W26 A;  1X5T A;  4UUW A;  4N7T A;  4DV6 F;  1K0T A;  3JSM A;  1LFP A;  3IBW A;  1G4C A;  1S9E A;  2Y3Y A;  1UFW A;  2EPI A;  5HMY A;  5HLF B;  1VFJ A;  2CQG A;  3OJS A;  1X5P A;  2UXC F;  4KO0 B;  4PXD A;  4WU2 A;  4FXV A;  2XHC A;  2BOP A;  1RAF B;  2LDY A;  2CQ0 A;  4L6V 3;  3PR4 A;  4ID5 A;  2ALY B;  2F4V F;  3UNY A;  1B7F A;  1X4C A;  5ETM A;  1RTD A;  1WDT A;  2FUG 9;  2E9Z A;  2C22 A;  1GNK A;  5SZT A;  1NSQ A;  2MJU A;  3H98 A;  2AX1 A;  4KFB B;  3FBC A;  3VGS A;  5D4O A;  4GVL A;  1WF0 A;  4RU2 A;  4WIQ A;  1FEH A;  3BGL A;  5IT9 Y;  3K89 A;  5G4D A;  3CCW A;  1TL1 A;  4TN2 A;  4A48 A;  2YNG A;  2VFR A;  5C7P A;  3CCU S;  1PGZ A;  3QRQ A;  4JI4 J;  5KAK A;  2G2O A;  2HHP A;  3L3C A;  2J7W A;  2VJV A;  5SUH A;  3CJ8 A;  1Q95 G;  4MMO A;  1QSS A;  3OHA A;  1F2H A;  2F7V A;  5K9F A;  1HBM B;  1BMQ B;  2WVF A;  1B7Y B;  5EWF A;  2HHU A;  4DFM A;  4G6V B;  4DSK A;  1SC4 B;  3VAJ A;  4XIU A;  4NML A;  1FNO A;  2XLK A;  5C5J A;  1Q5Y A;  4LRB A;  4USH A;  4DLG A;  4M5I A;  4RO0 A;  3CDA A;  3UN5 A;  4DFP A;  2HHT A;  4NXM F;  1JXE A;  2H4Y B;  3TNV A;  3U27 A;  1RBL A;  1YJW S;  2HHH F;  1QLN A;  1JXV A;  2JRS A;  5L1I A;  2CJY B;  2CJK A;  1NDK A;  2M4M A;  2XYG B;  3MHY A;  1IR0 A;  1R43 A;  1TV6 B;  1YRX A;  2OAU A;  3NEK A;  1N0U A;  4DS4 A;  1S9F A;  2NUH A;  3MEC A;  3UFC X;  2V8D A;  2EG1 A;  2DHA A;  1N5S A;  1VRU B;  2Y1R I;  3EGW B;  4RBV A;  2XY5 A;  2Z56 B;  4B3M F;  2DNM A;  3DDN A;  4HH0 A;  1OQ3 A;  1VHF A;  2Z58 B;  3C16 A;  1RTZ A;  1FKO B;  1SC1 B;  4DR3 J;  3AB4 B;  1HNZ J;  3PX0 A;  4B9N A;  1NK8 A;  5FDL B;  4M95 A;  1OWX A;  1MU2 B;  1HQU A;  5L1L A;  1IM4 A;  2R7S A;  1DJ0 A;  2YQ0 A;  2OMO A;  4NLR A;  1QAI A;  2D3Z A;  1Y0H A;  2CNO B;  4K0K F;  1FJC A;  5I42 A;  1HNW F;  4ZK7 M;  3TOQ A;  2HSE B;  3DM2 B;  4ZN3 A;  3I9Z A;  3DDI A;  1JXL A;  3CCR S;  1UAW A;  2ZOG A;  4ECV A;  4N56 A;  4NEY A;  4J9M A;  1NHK L;  1IR1 A;  2ILZ A;  1VQS A;  1X9S A;  1X5O A;  2KJV A;  2GHV C;  2VPW B;  3W8P A;  1VBZ A;  2VOO A;  4EBE A;  1S1T A;  4JI6 J;  4LF7 F;  5AE2 A;  2XM3 A;  1WSV A;  3SEO A;  4F02 A;  4JI2 J;  1TV6 A;  2Q1L A;  3Q89 A;  3TUJ C;  3BDP A;  4CTA B;  1TAU A;  2GX8 A;  1FFW B;  3PRB A;  1XMQ J;  2CYY A;  3CD7 A;  1C0U B;  1FA0 A;  2XLJ A;  3RB3 A;  1IBL J;  3LPE A;  4DWI A;  1N88 A;  4RLE A;  2BJ7 A;  4QR0 A;  3A3O B;  1PBU A;  5B0G A;  4YY3 F;  2MQP A;  3JB9 k;  2VH7 A;  2E7W A;  4P73 A;  3L7U A;  3OFH A;  2IAJ B;  1VIS A;  1H2V Z;  3TVK A;  3RAQ A;  3PJW A;  2CZV C;  2D41 A;  2V8G A;  3ADA C;  2R7W A;  5AXL A;  3MEG B;  4RX6 A;  1CC7 A;  5LMU J;  1M5V C;  4HTJ A;  1SPB P;  2YPY A;  4PYD A;  3W1Y C;  3TR5 A;  1JKH B;  1HW9 A;  4YFU A;  2ZH1 A;  2R8G A;  1GMU A;  4OYO A;  1SJ4 P;  2RKI A;  3MCM A;  4USU A;  3ETM A;  1S0N A;  4QYR A;  5F8M A;  1IBM J;  2EG2 A;  2UP1 A;  4CLY A;  2RJZ A;  5HMW A;  1HMV A;  1U1N A;  3K2Y A;  2YKP A;  2I5J A;  2YNF B;  2DR6 A;  2FQQ B;  4GC6 A;  3TQ1 A;  4W90 B;  1NH8 A;  1U0S A;  2HUR A;  1WOP A;  4CO2 A;  3FC9 A;  2E1P A;  4ITS A;  3OSP A;  1RU2 A;  1EIY B;  5KFH A;  3KHG A;  1T3N A;  4DV1 J;  5KFF A;  1KFD A;  1OJ4 A;  1VLO A;  1R0C B;  2BKP A;  4Q2M A;  5CH7 B;  3I6P A;  1HWU A;  5D77 A;  4ZPV R;  3H0P A;  5E5N A;  2W2O P;  4I2P B;  4RW7 B;  2RF2 A;  4ZP6 A;  3DOL A;  3RUB L;  3SSS A;  3KLG A;  4ECW A;  2KFZ A;  1QVF R;  1YJT A;  3AY0 A;  1S1V A;  2FY8 A;  3V6H A;  2C2N A;  5AXK A;  5M2P A;  2DGT A;  3UCZ P;  1O51 A;  2CVE A;  1N33 F;  1X9W A;  2Y1J A;  2BE9 B;  2DGU A;  2KL8 A;  4FNI A;  2LU1 A;  4MFB B;  4CLP A;  2DCU B;  4WFX A;  1SQF A;  3BO3 A;  1KC8 T;  1LFW A;  2NUU G;  5J1E A;  1MLA A;  1RIS A;  1JKH A;  3IBF B;  2YBV A;  2OPS A;  2GMH A;  2BDP A;  1AUD A;  2E1C A;  1NKC A;  2X1A A;  1UVJ A;  3MMB A;  3M9N B;  1REG X;  3MWB A;  5HQ8 A;  1U8S A;  4HYK A;  1J27 A;  5A6P A;  1ULR A;  1P8G A;  3ZC4 A;  2I5J B;  2YNF A;  3KJN B;  2VPX B;  4NL5 A;  4NYO A;  2AV5 A;  1JLB B;  3CTR A;  4WXO A;  5IV4 A;  1S79 A;  4OJ1 A;  3CCL S;  4N5S A;  3PW7 A;  2LYV A;  1RT4 A;  2FLP A;  2AHO B;  3HPO A;  2Q66 A;  2O3D A;  2KN4 A;  2GO8 A;  4ZOS A;  4OX8 A;  1S7I A;  3GTY X;  5EWG A;  3AJ1 A;  1CBK A;  4EWT A;  1YBT A;  3NOC A;  3S8S A;  1D9A A;  2FPH X;  2XZW A;  4I2P A;  2CAJ A;  3MR2 A;  4Q8E A;  5BYQ A;  2W2Q P;  5I3U B;  4YR3 A;  3DRX A;  4UF4 A;  1CJK B;  1YKW A;  5E7O B;  1F9E B;  1WC5 A;  1XNQ F;  1UFL A;  3GU0 A;  5LSL A;  1F9H A;  2DNR A;  3HHE A;  2WSF C;  3K5O A;  2K1R B;  3H5X A;  1H7W A;  3CCS S;  1OPZ A;  1QAY A;  3C8Y A;  4M5M A;  4JI5 F;  3BPD A;  2HNZ B;  2CJX B;  4C0B A;  1LW2 A;  2HK2 A;  3JSR A;  5FD1 A;  4EU0 A;  3MED B;  3PR5 B;  2NSC A;  2W2N P;  2JL9 A;  4OI6 A;  4AE5 A;  1URR A;  2POK A;  2YKA A;  1HBU B;  4LRD A;  2D9O A;  4LVO P;  4MKB A;  1KWM A;  2VC0 A;  1PIE A;  3NBP A;  3D4J A;  1HI1 A;  3RJM B;  3VVU A;  1UP1 A;  3CIM A;  3ZFV A;  5FLX Y;  3BR9 A;  3KJQ B;  3AAW B;  3IO1 A;  4TY9 A;  2GAG C;  3VAI A;  1FES A;  3DGV A;  3KJF B;  3Q8S B;  1WKK A;  3J81 j;  4DS5 A;  3R5G A;  5A76 A;  3AJD A;  4IRK A;  3FCW A;  2YKM B;  3HFK A;  4BLG A;  1X0F A;  4JV5 J;  2CKW A;  1OQ6 A;  2DB1 A;  3QAE A;  3PY8 A;  3G2X A;  2BW2 A;  2YQ1 A;  2OPQ A;  3IXQ A;  4NA1 A;  1KQF B;  5L39 A;  3W62 A;  2N82 B;  2HW3 A;  4DR1 F;  4KKO B;  2X7I A;  2Z4P A;  5HVF A;  2HFO A;  4YR0 A;  1OO0 B;  2HG4 A;  5C2G A;  2XO6 A;  4K0K J;  3HHL D;  3RU0 A;  1RTI B;  1CJK A;  1RT7 A;  4NLG A;  1F2G A;  6AT1 B;  5I4M A;  2GAH C;  3PFE A;  1HI8 A;  1SBR A;  2B4P A;  3BBF A;  5L1K A;  1GH8 A;  1IKW A;  4DZD A;  1HFE L;  1PC5 A;  3DI6 B;  4PG6 A;  1WG4 A;  1SC3 B;  2B0G A;  4C7Q A;  4QWA A;  2W9B B;  1GK8 A;  3QIP A;  3D2W A;  4ED3 A;  4NLQ A;  2C2D A;  1CVJ A;  2GQ2 A;  4OQJ A;  3QO9 A;  1G6B A;  3T3F A;  3WIV A;  3MFH A;  1U02 A;  3BKT A;  2BJ9 A;  3OPK A;  3R7S B;  1U1L A;  4NRT A;  2D7S A;  3V6K A;  1NHU A;  2KYX A;  2QLF B;  5BR8 F;  3NNH A;  1ZM3 A;  4NZ7 A;  5KFJ A;  1F5A A;  2EFP A;  1VQN S;  4PXC A;  3V81 A;  4BWJ A;  1Y00 A;  3MMA A;  1YVF A;  2HBY B;  2IRU A;  1NPK A;  3UE2 A;  4JI8 J;  1RTH A;  1OSC A;  1U09 A;  2RH3 A;  3QRR A;  1RT6 B;  4I6W A;  4PQA A;  5KG2 A;  4DV3 F;  1XMO F;  1C0T B;  4ZVU B;  4OFZ A;  2EFV A;  3CCE S;  1B99 A;  3N01 A;  4QIV A;  4JI2 F;  1HNI A;  2IDE A;  2ZD1 A;  4Y2A A;  3ZZP A;  2YNI A;  4CDI A;  4Q44 A;  4UQT A;  3FCH A;  4OYZ A;  2ZDO A;  4AL7 A;  3QLH A;  4HTI A;  4ERD A;  3W66 A;  1IQZ A;  3PKY A;  2FIU A;  5HP1 A;  2FJD B;  2X3D A;  3BRE A;  4Y65 A;  1L3U A;  4O3R A;  3EXY A;  2WON A;  2CQD A;  3I0R A;  1RP5 A;  3BSA A;  5E41 A;  4UUX A;  3GII A;  4TXS A;  1TKX B;  1L3V A;  4I67 A;  4X64 F;  1EET B;  1FDA A;  1JLE B;  2P8I A;  3M2V B;  2PI5 A;  3FVY A;  3HFV A;  1O0P A;  2GW8 A;  4NZ6 A;  2WOM A;  3Q24 A;  4YQW A;  1U1R A;  2IFX A;  2V69 A;  1ACM B;  1E6Y A;  1V3R A;  2FJE B;  3QT6 A;  1K44 A;  2UUC J;  1HBM A;  2FLN A;  3TZX A;  3C3L A;  1NAQ A;  5F3Z A;  2QMX A;  3FKB A;  5KFZ A;  5HRO B;  1NJY A;  3B82 A;  3RRG A;  2Z0G A;  4B3R J;  1WC0 A;  2AJF E;  2ADB A;  1XQI A;  5CAA A;  5EX3 A;  3MPW A;  4FPI A;  1AZS A;  2J9D A;  3E3X A;  4CLK A;  3H4B A;  2M8H A;  4NLS A;  3BBB A;  1EKR A;  3KMS A;  2Q43 A;  5GAG I;  1VQP S;  2R7X A;  4X4O A;  3EXC X;  4LT6 A;  4K7Q A;  3FMB A;  1G1X A;  4R8U A;  4IFY A;  4AQY J;  3I0S A;  4JUZ A;  1VRT A;  1BLU A;  3GON A;  3V4I B;  4HLB A;  2V50 A;  2JNJ A;  1KOO A;  2WVD A;  4P75 A;  5H1S V;  5KFV A;  3NCR A;  3HMJ G;  1NJZ A;  2XS7 A;  2C3U A;  3LOU A;  4MKA A;  2OP5 A;  3C46 A;  1IJF B;  2YWE A;  3BPS P;  3N0V A;  1EET A;  1RLD A;  5IOL A;  1BC6 A;  2G1D A;  2PD1 A;  5KFX A;  1MN7 A;  3O3L A;  4C0H A;  3I56 S;  4WF9 Q;  3DRR B;  3BH7 B;  4DPX A;  4GO5 X;  5DRK A;  4ZP9 A;  3HI9 A;  2LDI A;  2IVY A;  1F1B B;  4GO7 X;  3VQT A;  4J9N A;  4A8W A;  3BS9 A;  3BEG B;  2GGP A;  2PO4 A;  5MAO A;  3GIM A;  2ZHB A;  5KFE A;  1DFD A;  1KFS A;  3HHN B;  4B9L A;  2XB2 D;  1PAU B;  1MWZ A;  3B6B A;  4NMX A;  2B6A A;  4I69 A;  1FT8 A;  2CJ9 A;  2ZHO A;  3D1H A;  5K5M A;  4DL6 A;  2HRT A;  3R1H A;  2RU3 A;  3EGZ A;  4A8K A;  1DTT B;  3D0G E;  2FHK A;  4O44 B;  1VLY A;  4RL1 A;  3CIZ A;  3KUE A;  4ZS6 A;  1VC5 A;  4X84 A;  2J9C A;  2O01 C;  1V5V A;  2N7C A;  1NH7 A;  5E3P A;  4TU7 A;  2E1M C;  1FWK A;  5KFQ A;  2XSF A;  4B9U A;  1H73 A;  3J7Z 5;  3TEH B;  2B9X A;  3N28 A;  3TEG A;  4ETZ A;  5KFG A;  1KN6 A;  2IBO A;  2JHE A;  3I32 A;  5L1J A;  4C8L A;  2B8P A;  2MY7 A;  3LAK A;  2GVZ B;  5GAG U;  2H51 B;  2Y1I A;  5HLF A;  2ZH7 A;  3BO2 A;  4LF9 F;  1NPP A;  2CPH A;  4M5D B;  3PG9 A;  3CJR A;  3R7B B;  5IXU A;  2KT2 A;  4WP3 A;  1T9X A;  1O6X A;  1RTJ A;  2PC6 A;  1RQ0 A;  3H5S A;  4Y3C A;  4FS1 A;  2ROG A;  3RTV A;  2KDO A;  2E1A A;  1U24 A;  2CG4 A;  4IYQ A;  4P2F A;  2OPP B;  4DR5 F;  1UEK A;  2BRL A;  1MSW D;  2ZH2 A;  1ZZN A;  4I6Y A;  2AW0 A;  2KZM A;  3KJV A;  2D74 B;  2OSR A;  2V67 A;  4LFC F;  1ZAV A;  4ILL A;  1KVI A;  3CWJ A;  1CS4 B;  3M32 A;  2YWH A;  4HDG A;  1TK0 A;  4X4V A;  2O5D A;  4DR4 F;  1BWE A;  2YNH A;  2GIQ A;  3TAM A;  2IC3 A;  4OZ2 A;  1DQ8 A;  3MM8 B;  1BQM B;  1CJT B;  2QSF A;  1V9O A;  4OI2 A;  4ED2 A;  2RHQ B;  2RB7 A;  4YB1 P;  2VG6 B;  1H6K X;  4CYU A;  2VB6 A;  4CLZ A;  2KM8 C;  4KHM A;  4ZVQ B;  1IKY B;  2QA4 G;  3BN7 A;  1ELO A;  3DLJ A;  2AZ3 A;  3AXK A;  2RF2 B;  1MML A;  1DAR A;  2Q6B A;  3DOL B;  4NLO A;  5KFD A;  2RDJ A;  1F60 B;  5H9E J;  2G9O A;  4U7C A;  7FD1 A;  3W64 A;  2R8H A;  3SZ2 A;  1DY3 A;  1UZD A;  3CB4 A;  2IMW P;  2FGO A;  4USJ C;  2YTC A;  2XSJ B;  3CW2 C;  5C24 A;  1QUV A;  2ZOF A;  2CQ4 A;  5GME A;  2B7C B;  2A10 A;  3QNW B;  2E5H A;  3TX0 A;  2B3T B;  4ED8 A;  1JK9 B;  3JS9 A;  2MKK A;  5CYJ A;  1XMO J;  1NK7 A;  3Q2T C;  4OL8 A;  1TL4 A;  4B9S A;  4LIR A;  1A9N B;  3K0J A;  3SCI E;  4X62 J;  4CP5 A;  1Y3K A;  3IMQ J;  4RW6 B;  2KXN B;  4JI3 J;  1ZTT A;  2ZH5 A;  5GAE I;  2JLF A;  4BC7 A;  3GFH A;  2ZJQ Q;  3DLE A;  5LJ5 Y;  1K1S A;  4X4U A;  4ES3 A;  3KJV B;  1Q7Y T;  1B3T A;  2V8P A;  2KVQ E;  4BWM A;  4ATN A;  3QBC A;  2AYB A;  2VOP A;  4HT5 A;  4DG1 B;  3LGN A;  4L72 B;  4V1A k;  5ITH A;  3CCQ S;  2VBW A;  1IWA A;  1DTQ A;  3BSC A;  5B0C A;  2VV5 A;  5A0Y B;  1SJF A;  1RHR B;  5CYQ A;  4DV5 F;  3RB6 A;  2NPI A;  4TLQ A;  1TQL A;  4K50 A;  3A12 A;  1WHV A;  1WTF A;  4USM A;  1Q79 A;  1JLF B;  3M8Z A;  4HEA 9;  4UY8 5;  4F04 B;  3KLE B;  2QL9 B;  4Y0F A;  1YJU A;  4WU3 A;  1HNW J;  3CJ4 A;  3FQK A;  4RR5 A;  1JX4 A;  3D6H B;  2YWG A;  1XK8 A;  2F5G A;  3B8H A;  3CDE A;  2AD9 A;  3S7R A;  2UZA A;  3MM6 B;  1YTY A;  3POT B;  3R5J B;  1SQE A;  3TJA A;  2CUY A;  4DV5 J;  1R3N A;  2ATL A;  1S72 S;  3EIC A;  3RB4 A;  2YKN B;  4OZL A;  2C2K B;  3SFU A;  4RNM A;  4AL6 A;  3PCO B;  2DHX A;  4TY8 B;  1X4D A;  4P7T A;  4ZPW R;  3Q23 A;  4EBD A;  3PW5 A;  2QFI A;  4KYZ A;  4I1T A;  4OZ3 A;  2J7U A;  5T41 A;  1QDU B;  4LSL B;  4ZP7 A;  3HD1 A;  3W63 A;  2E9R X;  5D0G A;  3WC0 A;  2Z2Y B;  4O3S A;  3NL0 A;  5DO2 A;  2CRL A;  2YKM A;  4NCG B;  1RA7 A;  1V3Z A;  2L9N A;  1YRT A;  4FN5 A;  3OL6 A;  3KK1 A;  5I42 B;  1S9G A;  3PYE A;  2X1B A;  4NLU A;  4CLU A;  2MZJ A;  1XR6 A;  4XDC A;  3VGU A;  3PYF A;  1LWF A;  3CUL A;  4ZKA A;  2V63 A;  4R5P B;  2ERR A;  3ZTO A;  2JEG A;  3G9C A;  3KMQ A;  1HD1 A;  1LK5 A;  4AXJ A;  1HWJ A;  1LXN A;  2HQF A;  1FO1 A;  1VIO A;  2FZG B;  4LF6 F;  2AEM A;  1ZPW X;  3CDB A;  3WDO A;  1ZS6 A;  2DXE A;  3DXS X;  3VTI A;  3OLA A;  2MZS A;  3E01 B;  3MUM P;  4DV4 J;  1KOH A;  1TVR B;  1FD2 A;  5KG6 A;  2DRD A;  1TKT B;  1JJH A;  2IRX A;  3OLB A;  3NS5 A;  4O3O A;  5DM6 Q;  4KRW A;  2PMZ D;  5J2Q A;  3M2R B;  3EPI A;  2HND B;  2ASL A;  5T7L B;  1WD6 A;  2HGM A;  2LXU A;  2P2C B;  2XMT A;  3EZO A;  4P52 A;  4C2M A;  5C25 A;  4NOH A;  4JV0 A;  2JEJ A;  1LXJ A;  3BQ1 A;  3LQV A;  1IBK J;  1P9Y A;  4QCL A;  4IG0 A;  4OYA A;  5LXR A;  2XMK A;  4FYY B;  3EX7 B;  4HKQ A;  3EVO A;  5E3C A;  4FBU A;  2AJ4 A;  1HBO A;  1H98 A;  5KFI A;  2UXC J;  4DR2 J;  2I38 A;  5K14 B;  4NCG A;  3K57 A;  4IOC Q;  1ZZF A;  2D1C A;  4KT0 C;  1S9G B;  2RNE A;  3TP2 A;  4ZVF A;  4RW4 A;  2P9E A;  2P6S A;  4AD6 A;  3OQ2 A;  1JNZ B;  4ELT A;  3QJJ A;  1VC0 A;  1ZAW A;  5EGY A;  3DLH A;  1SKR A;  1NND A;  4F0K A;  5L9N A;  1N4L A;  5B0A A;  2OUG A;  1U2C A;  2BM1 A;  2CQ3 A;  2OGU A;  2VF3 A;  3FBE A;  2LP4 A;  4RNH A;  1IKX A;  1B64 A;  3OTC A;  3OXG A;  4LSZ B;  4WKY A;  3IR6 B;  5CD4 H;  1LWE B;  3DNC A;  3RZA A;  1TVR A;  3M2V A;  3A8K A;  3IA0 A;  5HI7 A;  4EYH B;  1RTD B;  1U6B A;  1L3S A;  3O6Q A;  2CPE A;  4DBQ A;  1FJE B;  2E44 A;  1FNX H;  4H4M B;  3GFX A;  4K5R A;  3M2R A;  4RW7 A;  2AIR B;  4X64 J;  3DN9 A;  3R9L A;  2LA6 A;  5GAD U;  3IG1 A;  4F3M A;  3AQO A;  1S1V B;  4U9R A;  2A3J A;  1SIZ A;  1J5O B;  2BAN B;  1EB0 A;  3D1O A;  4P7V A;  2WSC C;  4XPE A;  1JJC B;  1Q53 A;  1S6U A;  1XWL A;  2AT1 B;  2YKO A;  3HZG A;  2FYX A;  9ATC B;  1C1B B;  3MR5 A;  2MST A;  4IH6 A;  1HHT P;  4X4N A;  3NWG A;  4DQP A;  2AJ1 A;  3NAH A;  3OR1 A;  3Q8V A;  1UWA A;  3Q22 A;  3B54 A;  2PSZ A;  4NRU A;  5KOW A;  3FUY A;  2XI2 A;  2WB1 D;  1FCA A;  5HVH A;  2UUB F;  2HMI B;  1I1G A;  1S1U B;  2H65 B;  3M8Q B;  3GV7 B;  3R6G B;  2QRR A;  2KHD A;  3M30 B;  3CJK B;  1CQN A;  4IFY B;  3KK2 A;  3ENW A;  3IS9 B;  2C28 A;  1M5P C;  2CPI A;  2FJW A;  2QTW A;  2RDI A;  4EMD A;  1OYE A;  2HNY A;  2BJE A;  2WTF A;  3V4I A;  2M70 A;  4P6Q A;  3LP0 B;  3PJ9 A;  1BXN A;  3NLC A;  4CZC A;  2H1Y A;  2W4D A;  2QN6 B;  3SXL A;  3C6U B;  4OHW A;  3HK2 A;  1IVZ A;  2EFN A;  1A6L A;  2FDN A;  1AB8 A;  1NJW A;  1LWE A;  5IC6 B;  3UNG C;  2AGO A;  2V2Q A;  4I4B A;  4FF4 A;  2MTL A;  3MR6 A;  4Y34 A;  1S1X A;  3ONQ A;  2L9D A;  4P2X A;  4DFK A;  4BHQ A;  3T5J A;  4KQZ A;  4WKR A;  3K5N A;  3AFG A;  1F5C A;  3DXB A;  3TZZ A;  3VAG A;  1NK5 A;  4NEZ A;  1RAA B;  3G71 S;  4WTO B;  4NCA A;  5D3G A;  1T11 A;  2OFH X;  3MR7 A;  2KI2 A;  3NGD A;  1NSK L;  4I6A A;  3NS7 B;  1EKS A;  4B3R F;  4C98 A;  3SCK E;  5HN0 A;  1N33 J;  2M88 A;  2C2M B;  4K4S A;  1RWV B;  2DJW A;  1FRH A;  2KKH A;  3UCG A;  2FVS A;  2CXE A;  4DMZ A;  1YBU A;  2KXH A;  5LMN J;  3I4P A;  3D0I E;  2CA9 A;  3NRB A;  4LFA J;  3UI3 A;  3PEH A;  3VZI A;  2HFV A;  2XO7 A;  4DU7 A;  3D5M A;  1YI2 S;  2L48 A;  2HS0 A;  1WSR A;  3M8W A;  3JXO A;  5AJ3 J;  2ZHA A;  2UXD F;  4K4U A;  3M30 A;  2VIC A;  2HVI A;  3BSO A;  4E0D A;  5E3A A;  4ED7 A;  3W7B A;  4KIA A;  4DV1 F;  3T5H A;  2OLW A;  3BGO P;  3M8Y A;  3FSI A;  3O5T B;  3BSN A;  4TYA A;  1RAG B;  1UMJ A;  3DHW C;  3NS6 A;  1PSD A;  5FII A;  1NBE B;  5AXM A;  3O1L A;  3UN2 A;  1KQG B;  4UOC A;  4BBY A;  2W4C A;  3DC2 A;  4J37 A;  3GSD A;  3DGP B;  4A8F A;  1T05 B;  1RT3 A;  2FZK B;  4CO4 A;  4RJV A;  2OEM A;  3D3B J;  3W60 A;  3GFZ A;  4CLF A;  1PC4 A;  3OBI A;  5CA5 A;  1XEZ A;  4DV4 F;  4ZVO B;  3SIP B;  3VGV A;  4M5K A;  2Z30 B;  3TJ9 A;  4V19 X;  1RWN B;  1SV5 B;  1XER A;  2HVH A;  1HPZ A;  2AYE A;  1S4F A;  2RS8 A;  5HMX A;  1NUE A;  3NGU A;  5D3G B;  4MIA A;  4P72 A;  1REV B;  4NLY A;  1UKU A;  4B9T A;  1Y5I B;  1N54 B;  4CT8 A;  3DMJ B;  3QPI A;  5A6W A;  3Q0A A;  1NPR A;  4CNY A;  2RHS B;  4A47 A;  4DUY J;  4OI3 A;  3PHT A;  3QIP B;  1U6Z A;  4DUY F;  4ECU A;  5EX0 A;  3K5L A;  4F4W A;  1HBN A;  3PIP Q;  1RDR A;  4L3N A;  4N76 A;  3R2C J;  2YX7 A;  2XZD B;  1Q5V A;  1YQH A;  3KG0 A;  2HGL A;  5HQM A;  3I31 A;  4LSN B;  1YLX A;  3MUR P;  1RLC L;  4WE1 A;  1QD1 A;  2GJF A;  3V81 B;  2HZV A;  2VPZ B;  1LWC B;  4OHX A;  2EK6 A;  1S6Q B;  4Y2M A;  4CH1 A;  4DR7 F;  4F7V A;  4DSJ A;  1VQY A;  1QSY A;  5LOQ A;  2DTJ A;  2WBM A;  3DGP A;  1RWX B;  3NCP A;  1VBK A;  1EHW A;  5J2N B;  1Z4U A;  2MLZ A;  4ED6 A;  1CUL B;  4O3P A;  1D9D A;  1T94 A;  3TI0 A;  1FRK A;  3BV8 A;  3QFH A;  4C97 A;  1TK5 A;  4LF9 J;  1QY7 A;  3AHP A;  1CJU B;  5KFB A;  4TQR A;  1BQN A;  4LFB F;  2MYF A;  3GB0 A;  4DV7 J;  1YJ9 S;  5RUB A;  4DR7 J;  3OR2 B;  4PAB A;  5LM7 E;  5I3P A;  2FC8 A;  3I96 A;  3OT9 A;  1T9Y A;  1ZPV A;  4P9S A;  1JLE A;  5KG0 A;  4DCJ B;  5IT0 A;  1SL0 A;  3QJP A;  2LA4 A;  2RDD A;  1KR4 A;  5IM0 A;  2VPY B;  3OXF A;  2HS4 A;  2ZNY A;  1EJ7 L;  3SQO P;  3OV7 A;  5KTQ A;  3NKY A;  2V4J A;  4TU8 A;  5A2Q U;  2BMB A;  1U47 A;  3HVT A;  4DXL A;  1RHU B;  2NR0 A;  1E6Y B;  3PM9 A;  3Q8U A;  1AA1 B;  3ZZT A;  2GVD B;  4DR6 J;  4FXD A;  1E6V B;  1TL7 A;  1RT4 B;  2CQC A;  4XPC A;  2QFJ A;  4YB5 A;  2B51 A;  4RWX A;  4DU8 A;  2AWZ A;  2QV6 A;  2HQC A;  3HHL B;  2BM0 A;  3L09 A;  5IS2 A;  1NZ8 A;  1PYO B;  3GZ7 A;  4DL7 A;  4LBI A;  4JI5 J;  3J7Y U;  5E2Q A;  3AOA A;  2DKO B;  4DDF A;  2O1P A;  4U67 Q;  3HT0 A;  2MQN A;  1CUL A;  2ZH3 A;  2X1F A;  1RAH B;  1XMB A;  4U6P A;  1RAJ A;  3A8I A;  1KEK A;  2KZZ A;  2X3G A;  2BE2 B;  5F0U A;  2KXF A;  4PRF A;  3TVY A;  4J5O A;  1SKW A;  2FHM A;  3PYG A;  3HM9 A;  1SVD A;  1F9F A;  2K7K A;  1TAQ A;  1D8Z A;  1Q4R A;  2N4C A;  2YNG B;  4IG3 B;  4URQ U;  3MM9 B;  2C3M A;  4D3G A;  4YDD B;  5E0O A;  2R2S A;  3TYT A;  2XMM A;  2CPX A;  3HKW A;  2GJI A;  1YIT S;  4NXN J;  2V5H G;  5K20 B;  1WKL A;  2ZWP A;  4ICL A;  5CYM A;  5F0W A;  4LF8 F;  1AT1 B;  3NY0 A;  3OVA A;  3BQ2 A;  2FZC B;  2LQJ A;  3LH2 S;  4HI2 A;  3TAP A;  1MWQ A;  1RCO B;  3UVJ A;  1YRU A;  5IT9 U;  4OV6 A;  1Q78 A;  4CLT A;  1CSJ A;  4J7C A;  3P5T L;  2HKE A;  2HQ3 A;  4MT1 A;  3M6V A;  4H54 A;  4RW8 A;  3ZXW A;  2CWK A;  4DQI A;  3ENA A;  1VQ7 S;  2B9W A;  4KKO A;  2OPR B;  2B4V A;  1IBL F;  1JMT A;  4M5J A;  1KQK A;  4C9D A;  2DNO A;  1UVN A;  1OSD A;  4ZVG A;  3R27 A;  1WI6 A;  3MM5 A;  4RU9 A;  5ETT A;  4EK2 A;  1PIL A;  4OV1 A;  3OL7 A;  4KTQ A;  3KLH A;  3FQL A;  3CSK A;  3CVK A;  5KFK A;  2NSB A;  1MRO A;  3TRG A;  1VRU A;  2IYG A;  4NCB A;  1PKU A;  3MPD A;  4K4V A;  2NLW A;  1CLF A;  1FKO A;  2W2M P;  4RW9 A;  4L75 A;  4ZLL A;  3I5A A;  2J76 E;  3QSY B;  4ZPT R;  4EI2 A;  3MXH P;  2HFU A;  4JOU A;  5DG8 A;  3DM2 A;  1WG5 A;  1QTN B;  5B0F A;  2X1G A;  4ICL B;  5CYM B;  4ZPC A;  1RBA A;  1IBK F;  2AEF A;  5GMD A;  1WEZ A;  2HGN A;  2HBR B;  2W2P P;  4YDX A;  4NYP A;  2R8J A;  4NX9 A;  2QYG A;  4UW2 A;  3ISN C;  5EN1 A;  2BE7 D;  4FNH A;  2E5L J;  2PMH A;  5A8W A;  5KT7 A;  1WC6 A;  5A8R A;  1DQA A;  1L3K A;  4DUT A;  1VC6 A;  1VRQ C;  2BJ8 A;  3EDR B;  4X65 F;  4PPD A;  4CTA A;  5LJ3 Y;  2CIM A;  3TAM B;  3ZZR A;  1HWI A;  2WW4 A;  4N41 A;  2EFO A;  3DLK A;  4KV8 B;  1SB6 A;  3EGN A;  4O3N A;  5JXS A;  1NSA A;  1CC8 A;  3ZTP A;  4NXN F;  1C1C B;  5F8N A;  2JVO A;  1VMB A;  2VBY A;  3M8P B;  1VI7 A;  2SXL A;  2DGS A;  1CJV A;  3AD8 C;  3LGM A;  3RBX A;  5KT6 A;  4ZJL A;  2FVQ A;  1WI8 A;  2D9P A;  3QFW A;  4TLR A;  4Q0B A;  1YWX A;  4YS2 A;  2VQE F;  4URG A;  4C0O C;  5BYR A;  3MAA B;  2ASY A;  4K59 A;  1C1B A;  4KAI A;  3CD0 A;  4PXB A;  3C2P A;  1TKZ A;  4NI2 A;  4ZVR B;  2FD2 A;  3OR1 B;  3W65 A;  1HMV B;  3KLF A;  4DSE A;  4LJM A;  2VD3 A;  1S99 A;  3T5L A;  1UJ5 A;  1W25 A;  3RRK A;  1HQE A;  5AE3 A;  2QJ3 A;  4BDP A;  4ECT A;  1YJR A;  1AZS B;  2JC0 A;  3CJK A;  2YH1 A;  4F2R A;  3QGH A;  3WIU A;  3IGN A;  4ZP8 A;  3D3C J;  1U2R A;  2IJR A;  4PWU A;  2IVF B;  1GMW D;  3X1L B;  4LFB J;  4A8X A;  1S48 A;  4UY8 T;  2U1A A;  1J2V A;  1ZM2 A;  2M0G B;  3CO0 P;  3ZTS A;  2IY5 B;  4UZB A;  4A8Q A;  4YOE A;  2BAB A;  2DXF A;  4HAC A;  1JLA B;  1NLK L;  5KT2 A;  5K8P A;  4IKA A;  1LOU A;  3MUV P;  1WOR A;  2MQO A;  2CFX A;  4B08 A;  4CT9 A;  1UPM B;  5D4L A;  4MK8 A;  1F3F A;  2A18 A;  2CQB A;  2NCK L;  4OX9 F;  2DIU A;  4A46 A;  1HR0 F;  1R27 B;  1LNQ A;  5ETV A;  5KG1 A;  4ZPA A;  5KFP A;  2D3O 1;  2CPY A;  4FS2 A;  2RQM A;  3AOC A;  4NWB A;  3MM6 A;  4TNO A;  1YJN S;  2HZA A;  2HVE A;  3HD2 A;  1WEY A;  1T9V A;  4PWW A;  2ZE2 B;  1HNV B;  1KTV A;  4HR2 A;  4WJB A;  3W5Z A;  1KD1 T;  3JSB A;  1R6V A;  3KWM A;  3BF4 A;  1SIW B;  3NOG A;  4K2X A;  1DBD A;  2HWI A;  2C2O B;  1Q8B A;  4N8N A;  5BYS A;  3A3P B;  1W2B R;  4FF2 A;  4AL5 A;  5HJY A;  2LQ5 A;  1RT5 B;  3CF5 Q;  2FTR A;  5HBM A;  4KGK A;  4H4O B;  2VC1 A;  4DCP B;  4ED5 A;  2HHQ A;  2DEJ A;  5BR8 J;  1GXU A;  1RSC A;  3CDW A;  2KT5 A;  2NXN A;  1BY9 A;  3J81 U;  3MOZ A;  4KR0 B;  3SDE A;  1RWK B;  4J9L A;  4L76 A;  5ETK A;  1JLG A;  3HSG A;  1WJ9 A;  4X4S A;  2HRY A;  2IJF A;  2FVP A;  4ZHR A;  2ZOM A;  2BRK A;  1NEE A;  1T9W A;  3W8G A;  2ATC B;  4Y2K A;  2R7T A;  4MYT A;  1FKP B;  1UVK A;  1V5I B;  1ARO P;  4NLT A;  2RIJ A;  7FDR A;  1SH3 A;  3H2U B;  4U95 A;  4Q43 A;  4GKJ F;  3D9B A;  4ELU A;  1SV5 A;  3DHX A;  4HDH A;  4Z7C A;  2MGZ A;  2GNK A;  2MZR A;  1X4E A;  2VKZ G;  2C2E A;  3SMZ A;  3H2L A;  4ES2 A;  2RRB A;  2LMI A;  3ILJ A;  3IWL A;  1IWG A;  4YME A;  3NMR A;  3CJ2 A;  2J5A A;  3DLL Q;  1QVG R;  3B4D A;  1LW2 B;  1P9Q C;  2HFN A;  3LO3 A;  4K2J A;  2VHG A;  4X2B A;  1Z2Z A;  2DXD A;  2QLJ B;  3ETO A;  5JVG Q;  3UD3 P;  2F4F A;  1JLC B;  1QUP A;  2V9K A;  1GAO A;  3GG1 A;  3FDS A;  3OL8 A;  3NNA A;  1NKB A;  4LF4 F;  4QPX A;  2ZC4 A;  3VVT A;  4PKD B;  4ALZ A;  4GKK F;  2UVU A;  2GJ2 A;  2CQ2 A;  4IG0 B;  3C19 A;  2NXU A;  5CD4 A;  2PMW A;  3FZB A;  3PRV A;  1SI9 A;  1WHW A;  2IVM A;  4M8L A;  3JAM U;  1LV5 A;  4FXW A;  4CWB A;  1HBO B;  3CME S;  2VDI A;  3HKZ D;  3OVS A;  2ZIT A;  2OSQ A;  3FSY A;  4O0I A;  3QSI A;  1RGV A;  2VKR A;  3BKF A;  3GCW P;  1JJ2 R;  1GQE A;  3PKM A;  2I8E A;  1S76 D;  4ZCL A;  1UWB A;  1HA1 A;  3TX8 A;  4QQB A;  5F8H A;  4LRC A;  1FJG J;  5E33 A;  2VG5 A;  3ISZ A;  2E5J A;  1K9M T;  3BJY A;  2MKS A;  2XSJ A;  2LEP A;  3CJ0 A;  3LW5 C;  3OFE A;  4C8N A;  2UU9 J;  3G87 A;  3BQ0 A;  2F8H A;  4LRF A;  4MH8 A;  1RK8 A;  2BJD A;  3NNC A;  2XY6 A;  5CHC B;  3H90 A;  4DQQ A;  5KFM A;  3QGP A;  4X65 J;  4PYA A;  3TVZ A;  2XUL A;  2DNL A;  2DNG A;  3A8J A;  3KLI B;  3WHI A;  1RCX B;  4LIW A;  4CO3 A;  2QA4 S;  4OYB A;  4TYB A;  4F67 A;  2DNH A;  3HVR A;  2W9B A;  4KPY A;  1NXI A;  5ETL A;  1BQX A;  4M5G A;  4FYW B;  3R5C A;  3ET6 A;  3BR8 A;  4LF7 J;  2XS2 A;  1FRL A;  3L7O A;  2V94 A;  3M4X A;  5F9N A;  5HSP A;  2VIH A;  2D3O R;  4C11 B;  4EBC A;  2CDR B;  4OJ3 A;  3GIR A;  3MUT P;  1JB0 C;  5ETQ A;  2J8S A;  5THW A;  3H59 A;  1MMD A;  4AXI A;  2V0N A;  3VHQ A;  3EVM A;  3NAI A;  3DRS A;  3BYP A;  1S97 A;  3ITH B;  5BJR A;  1OS5 A;  4FZV A;  1N52 B;  1KVJ A;  3OSN A;  5K8N A;  3QT8 A;  4ZIW A;  1TEL A;  5KFT A;  1ZBT A;  4OZN A;  5D0R A;  2QZ8 A;  3JYT A;  4DPY A;  5CCL A;  3IR7 B;  3O8W A;  1OY6 A;  1NKE A;  1LW0 A;  2QLB B;  2JSX A;  5KG4 A;  3JSM B;  1M1H A;  1NU4 A;  3UWT A;  4F3Q A;  3MGJ A;  3GYX B;  1TKX A;  3KUG A;  5KG5 A;  2HNY B;  2GV1 A;  1VGY A;  2PT0 A;  2CPF A;  2QMU B;  3RAX A;  2GZO A;  1SH0 A;  2OD6 A;  1PJ6 A;  4ECR A;  2GA7 A;  2CNN B;  4K4Y A;  3KXD A;  5DLF A;  3IRX B;  1G3O A;  8AT1 B;  4KHR A;  3V6D B;  2XQC A;  4ID5 B;  4DR3 F;  2ZUA A;  4WFZ A;  4NYZ A;  3ZZO A;  1IXK A;  3LGH A;  1UFK A;  4DX6 A;  2LXF A;  2W7P A;  2QLW A;  2V4Q A;  1SJQ A;  1X8D A;  1SH2 A;  2JH3 A;  3DOM A;  4MYU A;  3FJ2 A;  4ZJQ A;  3UD4 P;  4JI1 F;  2NRE A;  1D09 B;  1EP4 B;  2MJN A;  2QG9 B;  3GP9 A;  4RUH A;  2P9C A;  4YHH J;  2P5V A;  3OW2 R;  1X4G A;  3IN5 A;  4S0M A;  2VQE J;  2DH9 A;  4B3S F;  1JLB A;  2HVZ A;  2PN6 A;  1LWX A;  3CDU A;  4A8M P;  1D0E A;  3AOB A;  5GAH I;  4IUF A;  3N9U C;  1QE1 B;  1R6Y A;  1MN9 A;  2W7O A;  3BGF A;  4YR2 A;  2RVJ A;  2ZEJ A;  4MKV A;  2F9J A;  3ITH A;  5U47 A;  4FDF A;  3RYL A;  5JVH Q;  2ZZN A;  4QIE A;  1EZZ B;  4MK7 A;  2DPJ A;  4DV3 J;  1Q81 T;  2MPU A;  4HT7 A;  2VOD A;  5I3U A;  3HHK A;  1RUS A;  3C6T A;  5DG7 A;  3QT5 A;  4R8U B;  4KH1 B;  2F3J A;  4DL2 A;  3G82 A;  4KFB A;  2CAD A;  2DR7 A;  2XLI A;  4Z7Y A;  2PII A;  2PEH A;  4RNN A;  2K1R A;  3KHR A;  2ALZ A;  3EGV A;  1GTH A;  2FLL A;  2LLZ A;  1NME B;  1XMQ F;  2J0X A;  4Y2C A;  3SSR A;  2DR5 A;  5ETS A;  4ED1 A;  4AFF A;  3I82 A;  3IAS 9;  2LU2 A;  2XHW A;  2VQF J;  5J2Q B;  4RW9 B;  2FB0 A;  2FHO B;  3TO8 A;  3HP6 A;  2HHV A;  1GEH A;  4JI8 F;  3IAM 9;  3KUH A;  3G8Q A;  5C25 B;  3TUZ C;  3NBP B;  3LA0 A;  2FLO A;  1FE0 A;  1BWV A;  3HX9 A;  3MD1 A;  4RBT A;  1UA0 A;  3JTO A;  2DIV A;  4F4A A;  2VFT A;  3PYD A;  5D0E A;  3TZW A;  2W1B A;  4CNZ A;  4B3T J;  3VAF A;  3JSY A;  4AYB D;  3W9I A;  2F8E X;  4G1Q B;  4DJB A;  3IC1 A;  5CAB A;  1DTT A;  3I5B A;  4C8M A;  5A8R B;  4OI1 A;  2OPQ B;  2Z2M A;  2YWF A;  3LWL A;  3GCX P;  3E8O A;  2EKY A;  3PXG a;  4DUZ F;  3MEC B;  2FVC A;  2LEB A;  3BGU A;  4MAK A;  3CXC R;  3B78 A;  2R7R A;  5AXN A;  3H40 A;  2MLX A;  1VQL S;  2UVR A;  1IKX B;  1VQO S;  1SJ3 P;  4LQ9 A;  4ZVT B;  1FWL A;  1FHT A;  4B3M J;  1S6Q A;  4USK A;  3CCM S;  5J2M B;  1CJV B;  1UJ4 A;  2ZWO A;  4PG5 A;  2GVZ A;  3AA8 A;  1T7P A;  1K73 T;  3Q83 A;  1YJ7 A;  4I68 A;  1U1Q A;  1S6P A;  5KT5 A;  4ZCK A;  1N5Y B;  3RW7 A;  1TL5 A;  5ETP A;  1URN A;  3THT A;  5K8O A;  1TR0 A;  2DNQ A;  3IG1 B;  3N6L A;  3FZ2 A;  3D1Q A;  2GFF A;  4NXM J;  4QYZ K;  1NB2 A;  3SSQ A;  3KG4 A;  1OY9 A;  2BQU A;  1TKZ B;  4NI2 B;  4OYX A;  2UUW A;  5GVQ A;  2IAJ A;  3FCV A;  4USW A;  3KLF B;  2HAF A;  4ECX A;  2IM0 A;  1XNQ J;  1U1M A;  1HYS A;  2CJA A;  1WEX A;  1X4B A;  2AJ0 A;  2YWW A;  3ENV A;  4KH0 B;  4KGM A;  3S01 A;  1S0O A;  1RT6 A;  1FRM A;  2DNP A;  4JI0 J;  2OPP A;  5EDW A;  4WP9 A;  3PW4 A;  2FJV A;  2R8I A;  2X51 A;  1WKJ A;  3MEE B;  3JQM A;  4F25 A;  1JIH A;  1Z2L A;  3R8Y A;  3E51 A;  2APO A;  1XIQ A;  2JFK A;  2M5Y A;  2QLX A;  4N47 A;  3NP5 A;  4F2S A;  1VQ6 S;  1TMJ A;  1F3V A;  2BKO A;  3WX4 A;  4DV0 J;  1N36 J;  2IC3 B;  1TMM A;  1S6O A;  3EM1 A;  5HP1 B;  1FJG F;  4C3M A;  4AND A;  1E6V A;  5HMZ A;  3Q8Q B;  3KK3 A;  4ZVE A;  2AEJ A;  2QMW A;  4ECS A;  4DPW A;  1IKY A;  1RAD B;  3NGR A;  2BYC A;  4HAC B;  4J9K A;  3K5P A;  3J80 Y;  4QR1 A;  1WDD A;  3DRP B;  3HHL A;  4F26 A;  2HHX A;  4DOZ A;  2ACM A;  2IM3 A;  3D6F B;  3F73 A;  3VQS A;  3W2V B;  2UV8 G;  2FJB B;  3NMA A;  2G0C A;  3M6U A;  1VYA A;  1N5Y A;  1H38 A;  1FEE A;  3OVB A;  2LQ9 A;  2R2R A;  3EVW A;  2K2P A;  2KRR A;  3T9N A;  4DN0 A;  3U1L A;  5IWA J;  4DR1 J;  2AKW B;  3W9H A;  4FPR A;  3PX6 A;  1S12 A;  5KFY A;  3GIK A;  1QTM A;  4O4G A;  2V2K A;  3CE8 A;  1G2E A;  2ABY A;  2XYP B;  3GWC A;  3HJV A;  2DIT A;  3HSJ A;  1DRZ A;  4LFC J;  2B8Q A;  5C2C A;  3M1V A;  4RW6 A;  5A8K B;  1RE1 B;  4J9R A;  1YDL A;  2IPO B;  4MKY A;  1LK7 A;  2MHE A;  4DV7 F;  4FP9 A;  2CVI A;  5HBM B;  1TL3 A;  3MMJ A;  2OPS B;  2PDA A;  5KFS A;  1Y10 A;  2W4P A;  2JX2 A;  5B08 A;  4AUK A;  1GX6 A;  2GC8 A;  2NXC A;  1I3O B;  2DHG A;  4ENO A;  2N3O A;  3IBC B;  2MXY A;  2OTL S;  2A2D A;  3QRP A;  4F0H A;  4P2S A;  1EQM A;  1JLG B;  2R7U A;  1HIY A;  1SKU B;  2ZDP A;  2XTJ P;  3KK3 B;  1X7V A;  3J80 U;  3MTK A;  1S9E B;  1RT1 B;  4DPT A;  2BV3 A;  3DLG A;  4OX7 A;  2R3V A;  2ZBR A;  3QGG A;  1KBR A;  2C1E B;  4KO0 A;  1NJX A;  2XY7 A;  3LAN A;  4WYW A;  4LF5 J;  4J9O A;  1K0V A;  4C8K A;  5J1E B;  2ZZT A;  2OHD A;  2ROP A;  1Q1K A;  4JYA J;  2HWT A;  2YH0 A;  2Q79 A;  1FXD A;  3DDK A;  3US5 A;  5CXT A;  2VFU A;  3FBB A;  4MIW A;  1X4H A;  2YQ3 A;  3TQE A;  3N5B A;  1REV A;  2IIH A;  1HHQ A;  4YY3 J;  4WFB Q;  3OUY B;  1MRO B;  3DMJ A;  2EFQ A;  4IOB A;  1J5E F;  1WNE A;  1JLC A;  1TUG B;  4O23 A;  3MCN A;  3D28 A;  2MLY A;  2OML A;  3HHL C;  3PDN A;  3MED A;  1ICE B;  3HLU A;  4NLV A;  5HQL A;  1TK8 A;  4Y28 C;  1ROF A;  2ASD A;  3VCD A;  2DH7 A;  5F8I A;  1UL3 A;  4M63 A;  5B0E A;  3ZZZ A;  1BGX T;  3T1H F;  4F4Y A;  4EFA C;  2MZ1 A;  4DV2 F;  1D9F A;  2PE8 A;  4EZ9 A;  1MWY A;  2AJQ A;  2H48 B;  4QBU A;  4GC7 A;  4WFN Q;  2DGW A;  3DYA B;  2AGP A;  4KGZ B;  3GYG A;  3P5B P;  1C2P A;  1SJ1 A;  2P6T A;  2HLT A;  3JQK A;  4C6A A;  2MQL A;  4Q5V A;  4DR6 F;  3O44 A;  2CPD A;  3WBZ A;  2ADC A;  3PV8 A;  3H8Y A;  1AW0 A;  4I64 A;  1Q7L B;  3SV3 A;  1H0H B;  2VG5 B;  3HXM A;  2KYZ A;  3W2W A;  4R5P A;  1AYE A;  2VU5 A;  2WRM A;  3N6N A;  1VHI A;  2PEB A;  3LUY A;  3QQC D;  2MKY A;  2EXU A;  4QW8 A;  3R97 A;  4DN9 A;  2KU7 A;  4ER8 A;  3RR8 A;  1R8H A;  1OY8 A;  4PG7 A;  1GFW B;  4X66 F;  3D68 A;  3P8B B;  4RUA A;  2ZKU A;  4MTP A;  3KLI A;  3OTO F;  3MOJ B;  2QL7 B;  2QGF B;  4ECY A;  1GXT A;  1X60 A;  3QGI A;  5G0R B;  3M8P A;  3C14 B;  3EZ5 A;  1N6Q B;  2H4W B;  4PUO A;  3I9V 9;  5K8M A;  1GX5 A;  3A8E A;  4N8O A;  4XO0 A;  2MMY A;  4YB6 A;  2XS5 A;  3U1N A;  2KTQ A;  2FHJ D;  1D1U A;  4B3O B;  6FD1 A;  3PNI A;  4GKJ J;  5I3Q A;  4ECZ A;  1NK9 A;  3EPG A;  4KBI A;  4RW4 B;  1VK3 A;  3MM8 A;  4C4W A;  3N79 A;  1ZM9 A;  3DU6 A;  1R31 A;  1TL7 B;  1NSP A;  4LF2 A;  2I2Y A;  3R6L B;  1C4A A;  4KY3 A;  5IV3 A;  5K14 A;  2Y8W A;  5H9F J;  2E7V A;  4F0M A;  1A0O B;  1VJQ A;  3G8S A;  4K4T A;  3ICL A;  4GMK A;  4R25 A;  5DDP C;  4ZLN A;  1V6H A;  1QAX A;  4RZR A;  3FRY A;  5D15 A;  2BR0 A;  4K4Z A;  4EO6 A;  3MR3 A;  1IKW B;  4G3I A;  1U2F A;  1VQM S;  4H4K C;  2V4R A;  1RHQ B;  3DI6 A;  4V19 J;  1K1Q A;  2W9C A;  3FGV A;  3KNG A;  2G4B A;  4I56 A;  3BN4 A;  4JI0 F;  1U45 A;  5J2P B;  3UR3 C;  1CPZ A;  2HHH J;  2BE2 A;  3MMC B;  3W3S A;  4O4R A;  3H20 A;  3W5Y A;  2VG7 A;  4OYP A;  2CJB A;  2D3U A;  2EFG A;  2GML A;  2NS1 B;  2ZBC A;  3OFF A;  4M5L A;  5F9L A;  1B70 B;  1JLA A;  2UUA F;  1T95 A;  2UUA J;  2XMJ A;  4D3H A;  3CD6 S;  4K4X A;  3RGI A;  2J0W A;  1N6Q A;  5DZ7 A;  3M6X A;  2Z57 B;  3U1M A;  1RHM B;  3QYY A;  4F50 A;  4ANE A;  3G6V A;  1J5O A;  4HH1 A;  1JNR B;  2NZC A;  1NK0 A;  2NZ4 A;  3FFI B;  4ZIV A;  1GXL A;  2A1B A;  4B3O A;  2RU9 A;  4OHV A;  1P6T A;  4DG1 A;  2BOA A;  4JI4 F;  2F1F A;  4WP8 A;  3G4S S;  3K58 A;  2YNI B;  2ZM6 F;  2C3P A;  1EQ0 A;  3IS9 A;  5A0Y A;  3W61 A;  1WUU A;  3ZNU A;  1S4E A;  2HAI A;  2B5J A;  2JVR A;  2ZBI A;  4DX5 A;  2RML A;  2DPI A;  4ETX A;  2VBX A;  3V2U C;  1TUW A;  4QR2 A;  1FVS A;  4RW8 B;  2J9E A;  2VA2 A;  1RT5 A;  2Y0B B;  1KDN A;  1RAC B;  3MM7 A;  4W4M A;  3OTO J;  3KLE A;  2JFD A;  5DZ6 A;  1RHJ B;  3ZZ0 A;  1DAX A;  1NJI T;  3FEY B;  4M1K A;  2B4O A;  1VK8 A;  3LP0 A;  2NYH A;  4NLP A;  4DF4 A;  3IP0 A;  4XTT A;  4N77 A;  5M2U A;  2YX1 A;  1R0B G;  1O8B A;  2RQ4 A;  3GIJ A;  3R1L A;  4MK9 A;  5H9E K;  1TL1 B;  2BXJ A;  2BQ3 A;  1PCA A;  4FF3 A;  3AD7 C;  5ETR A;  4I7F B;  1Y5N B;  4QIF A;  4HI1 A;  3D7S B;  4ZVH A;  4IH7 A;  4EGL A;  2E5G A;  1R0A B;  1U48 A;  4QU6 A;  2Y0S D;  1T03 A;  1Y7P A;  3EUN A;  1HNX F;  1XN9 A;  4OI4 A;  4LVN P;  2FJA B;  2QIF A;  5CZX A;  5J1N A;  1Q82 T;  4WK3 A;  4B3S J;  2KVI A;  3KK1 B;  3CJ3 A;  2DNY A;  1O5J A;  4RPF A;  3I4H X;  4DSI A;  2IHR 1;  1GT8 A;  1S5Z A;  1VRT B;  3OTD A;  2B5J B;  2XMW A;  4QIW D;  1H2U X;  2K8G A;  4UTG A;  2B9E A;  1PG5 B;  2ZBQ A;  4CO5 A;  2WSE C;  2ZKT A;  4X62 F;  3MFI A;  4DL4 A;  4JI3 F;  1BHN A;  1FD8 A;  4EUV A;  1KLN A;  1NK6 A;  1YZ7 A;  1MNE A;  2C2Z B;  1BUX A;  2B7B B;  3GYN A;  2UUB J;  1I5O B;  2I6W A;  1GTE A;  3M6W A;  2LVW A;  2H54 B;  2P9G A;  3BGR A;  1PJ7 A;  3OFG A;  3PEJ A;  4CI0 B;  3BB5 A;  2XCP A;  2K7J A;  4E8U A;  4DQR A;  1SUQ A;  1IKV A;  2EVZ A;  2J0S D;  4J90 A;  2HND A;  9RUB A;  4Q45 A;  4YHH F;  1VQK S;  1HQU B;  1P27 B;  4OZ5 A;  4XDD A;  5ETO A;  4Q0B B;  5FJ4 A;  4F4K A;  1IR2 A;  2JZ5 A;  2YKQ A;  3K8V A;  3N6M A;  5DLG A;  1N34 F;  1M0S A;  2YVS A;  1ZH5 A;  2DGQ A;  2RQK A;  3MPY A;  4RWW A;  4WPA A;  1R0A A;  3CJT A;  1HYS B;  3BO4 A;  2AJ2 A;  2B6A B;  4PXE A;  2DGX A;  3GV8 B;  4DV0 F;  1NHV A;  1MG7 A;  5DS7 A;  1HBU A;  4EZ6 A;  2W8K A;  5DDR C;  1Z1Z A;  3CCT A;  2UXD J;  1RTJ B;  4QWC A;  5HAO A;  1B0P A;  3CPW R;  4M94 A;  4C8Y A;  2RS2 A;  4ED4 A;  5F41 A;  3TUI C;  5IC4 B;  5KFA A;  1FDB A;  2XWX A;  1RWM B;  4Z37 A;  1GMW A;  1Y5L B;  2J8A A;  1NRK A;  3PTW A;  2VON A;  4IR9 A;  1XC9 A;  2GO9 A;  3R2D J;  4PR6 A;  1KVK A;  1WOO A;  4IO1 A;  4QWB A;  1EAY C;  4CO1 A;  4IH5 A;  2HBQ B;  1WF1 A;  3W2V A;  3CCJ S;  2UUC F;  2KO1 A;  4M5D A;  4K4W A;  1HL6 A;  3NXZ A;  1WF2 A;  2DHH A;  1C0U A;  3RR7 A;  3GV5 B;  4ZDN A;  3MEG A;  1P1L A;  2BAN A;  2QL5 B;  2MQQ A;  1HWL A;  2K3K A;  3Q2S C;  1YHQ S;  2V8H A;  1WWH A;  1S1W B;  2Y1L B;  4R0E A;  4PG8 A;  3OHB A;  5LMU F;  3GLJ A;  4B3T F;  2G0I A;  2RKI B;  4ZA1 A;  3CGI A;  4DL3 A;  3U02 A;  2DK2 A;  4DF8 A;  5HAN A;  3SBM A;  3M1V B;  5A8K A;  3G8T A;  2AZ1 A;  1RI7 A;  3HVT B;  3MEK A;  1W2I A;  1RWP B;  3AD9 C;  1UPP A;  1IBM F;  4J9V A;  3PRD A;  3FRZ A;  1FE4 A;  3ENQ A;  2HMI A;  1Y9O A;  1PO6 A;  1FFS B;  3DOM B;  2DD8 S;  5IZH A;  3PFO A;  3NGS A;  4Y00 A;  3W5X A;  4C8O A;  2R9L A;  1T3O A;  2IBK A;  3D67 A;  1IBC B;  4NE9 C;  3VAL A;  2NPF A;  4W92 B;  3AXM A;  3OL9 A;  2AMC B;  3C6U A;  2CWX A;  2WVE A;  2FJX A;  4PQU B;  3S1T A;  3GFY A;  2ZD1 B;  5C24 B;  4C3L A;  3C15 B;  2GQQ A;  3AQP A;  2CQH A;  2DY1 A;  1ZA2 B;  2HQG A;  2QC3 A;  1KTQ A;  5KOX A;  5L38 A;  2QA1 A;  4B9M A;  1S1X B;  3ZZY A;  4YN3 B;  3MCS A;  3WC2 A;  2WZ1 A;  4P2M A;  2PI4 A;  4DR4 J;  2WON B;  2LCW A;  3I0R B;  3MAH A;  3R5A A;  4OX9 J;  1UTA A;  3MM9 A;  5AJ3 F;  3HF5 A;  1VCT A;  1F5B A;  1Q8I A;  1UZH A;  4ZVS B;  3BBC A;  4AQY F;  3A13 A;  2J6T A;  4UOF A;  2IDL A;  3LP2 B;  3G6X A;  3J81 Y;  4DUZ J;  3JTP A;  3HVW A;  2UV8 A;  5GAH U;  3OXL A;  3UW1 A;  3T19 A;  1WC3 A;  4LBP A;  2RSQ A;  1U6F A;  4OJG A;  4KSE B;  5B0B A;  3H5U A;  4TVA B;  4YB7 A;  2R7O A;  2WCX A;  5C42 A;  4ZJO A;  5KT4 A;  1KKH A;  3DYA A;  5KG7 A;  1JWW A;  2EBG A;  4X4Q A;  1DUR A;  4F36 A;  2OPR A;  2Z2Z A;  3F41 A;  4K5S A;  3MD3 A;  2NXJ A;  4Y2I A;  3K59 A;  2GHP A;  3NCQ A;  2COL A;  3W2W B;  3UO0 A;  3I0S B;  1RT3 B;  4WXW A;  1UWB B;  4JV2 A;  1KP6 A;  1D8Y A;  2UUT A;  3H7H B;  4ELV A;  2DGV A;  4B17 A;  1FI4 A;  2HWH A;  2M3D A;  5DDQ C;  2KJW A;  3GIL A;  2IM1 A;  3P45 B;  4CO0 A;  1RB0 A;  3SI8 A;  1XJW B;  4WZQ A;  2OEK A;  5LL6 d;  4ED0 A;  4LRA A;  5GAD I;  2XBP A;  1TU0 B;  3R3T A;  1C4C A;  1GMV A;  2HVD A;  3EMT A;  5D4N A;  1FXR A;  3N4W A;  5G0R A;  1VBY A;  3LP2 A;  5J2M A;  2ILY A;  1ZOT A;  2IJN A;  3DRR A;  1KNZ A;  1NDP A;  2N7Y A;  2GHW A;  4U8V A;  5F8L A;  4GVB A;  1RZM A;  1R8P A;  1HAR A;  2Z8Q A;  2ZJP Q;  2U2F A;  1I6J A;  4OYM A;  5ETN A;  2DRB A;  1R7I A;  4WTY A;  5CZV A;  1FK9 B;  4NAS A;  2KRB A;  5A8W B;  1R8C A;  3QT7 A;  2J0Q D;  4C8Z A;  1LWC A;  4WZM A;  4Q8F A;  1I94 J;  3DRS B;  1RU1 A;  3EDQ B;  3JQJ A;  4FKX A;  2E9T A;  2UU9 F;  3QWU A;  2M2B A;  2DRA A;  2PGC A;  4X4P A;  1FRX A;  3DLK B;  2BA9 A;  3EWG A;  4O44 A;  4UT4 A;  5FLX U;  4DV6 J;  2Y9H A;  3P6Y C;  4FVC A;  4QYZ J;  3VGT A;  3EZU A;  4LFA F;  7AT1 B;  5LMN F;  1HQ2 A;  5KFO A;  4F8R A;  3HSD A;  3RRH A;  2YY3 A;  3MTJ A;  3LPY A;  3VAK A;  4ZLJ A;  3AT1 B;  1FNM A;  1CJU A;  3UDE A;  1RT7 B;  1RTI A;  2NXE A;  3AB2 B;  3IFE A;  4KV8 A;  4LR9 A;  4DPU A;  4YUD A;  1SL1 A;  2C2R A;  4OHY A;  2KT3 A;  2EK1 A;  2JLG A;  1C1C A;  4BCA A;  2DNN A;  2DVI A;  3HZE A;  3I5C A;  1VOM A;  1U1O A;  4EYI B;  1IQT A;  3DRP A;  1S7H A;  2W9A A;  4WBF A;  5CCM A;  5FDL A;  2K06 A;  1MU2 A;  4IFV B;  3HFZ B;  3TA1 A;  3GJR B; 
#chains in the Genus database with same CATH homology
 2XZD B;  2HBR B;  2HBZ B;  4ZVP B;  2C1E B;  2Y0B B;  3QNW B;  2QLJ B;  4LSZ B;  3KJN B;  2H4Y B;  1RHJ B;  1IBC B;  3GJS B;  2CJY B;  1SC4 B;  2XYG B;  1RWX B;  2XYH B;  3EDR B;  4JB8 B;  3P4U B;  1SC1 B;  3GJT B;  1ICE B;  1F9E B;  4DCJ B;  4ZVS B;  3R7N B;  1RHR B;  2H48 B;  2H65 B;  2H5I B;  2CJX B;  4DCO B;  2CNO B;  3R6G B;  4ZVT B;  1RHU B;  4ZVR B;  2QL9 B;  3RJM B;  3D6H B;  2CNL B;  2CNK B;  2C2Z B;  3D6M B;  3KJQ B;  3R5J B;  3KJF B;  1PYO B;  2H54 B;  1GFW B;  5IC6 B;  2XZT B;  2CDR B;  2DKO B;  2C2K B;  2QL7 B;  1PAU B;  1RWO B;  2H4W B;  1I51 B;  1QDU B;  3P45 B;  3NS7 B;  2C2M B;  1RWV B;  2QLB B;  5K20 B;  3R6L B;  1SC3 B;  2CNN B;  5IC4 B;  3R7S B;  3D6F B;  2H51 B;  2QLF B;  1RWM B;  2FQQ B;  3R7B B;  1RHQ B;  2C2O B;  2HBY B;  3EDQ B;  1RWW B;  4DCP B;  1RHK B;  2HBQ B;  2P2C B;  4ZVU B;  4ZVO B;  3SIP B;  2XYP B;  2H5J B;  1RWK B;  1RWN B;  1RE1 B;  1RHM B;  2QL5 B;  2Y1L B;  4ZVQ B;  1I3O B;  3IBC B;  1BMQ B;  1RWP B;  3GJQ B;  3IBF B;  1QTN B;  3GJR B;  1NME B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...