1QTNB

Crystal structure of the complex of caspase-8 with the tetrapeptide inhibitor ace-ietd-aldehyde
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The atomic-resolution structure of human caspase-8, a key activator of apoptosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-8
total genus 20
structure length 90
sequence length 90
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 1999-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1qtnB00
3IBFB 1BMQB 2QL9B 2XYGB 1RWMB 3R6GB 5IC6B 3RJMB 1RWVB 1F9EB 1RHJB 1I51B 2H5JB 3R7BB 2H51B 1RHRB 4ZVSB 3KJNB 2C2OB 3D6HB 4ZVPB 3P4UB 3KJFB 3EDRB 2CNLB 2HBQB 2Y1LB 3IBCB 2H5IB 1RHMB 2H65B 4ZVUB 2XYPB 2CNNB 2XYHB 3GJSB 2H4WB 4DCOB 2QL5B 4ZVRB 4LSZB 2CJXB 1I3OB 3NS7B 1IBCB 3R7SB 1RWPB 1NMEB 2QL7B 1RHKB 3R7NB 2Y0BB 2QLFB 2FQQB 3GJRB 2C2ZB 3EDQB 2XZTB 1GFWB 1RWWB 2HBYB 1QDUB 3R6LB 1ICEB 3GJTB 4ZVTB 1RHUB 1PYOB 1RHQB 1RE1B 2H4YB 3R5JB 1RWNB 2CNKB 2CDRB 2HBZB 2XZDB 3D6MB 2C2MB 5IC4B 3QNWB 1RWOB 1SC1B 2DKOB 4JB8B 1SC3B 3GJQB 1SC4B 1RWKB 2C2KB 3P45B 2QLJB 3SIPB 2QLBB 2HBRB 1QTNB 2P2CB 2H54B 4ZVQB 5K20B 4DCJB 2C1EB 4ZVOB 4DCPB 1RWXB 2CJYB 1PAUB 3KJQB 2H48B 2CNOB 3D6FB
chains in the Genus database with same CATH superfamily
1N5VA 3IC1A 1VC6A 5DZ6A 4DV2F 4Q8FA 3MOJB 3I5CA 4LRFA 4Y2MA 3R5CA 3QO9B 2ZJPQ 3VAFA 2BW2A 3C16B 3MCNA 4QIFA 2FPHX 2LMIA 2MLZA 1SUQB 3DRYA 4N77A 1TL3B 3A3NB 3BR9A 2FUG9 1S1WA 4M5NA 4M95A 4WP8A 2OGUA 3ZZTA 3Q8VA 1LXNA 2VHGA 5J2QB 1WTBA 3BQ1A 3NBPB 1OY9A 5K8NA 2FZKB 2JVOA 5A0YB 1KLMA 4QR2A 3R7BB 5KAKA 9ATCB 3KNAA 4DI6A 1APSA 4DPWA 4YDXA 3CMQA 4CLPA 5J2MB 2GAGC 2CFXA 2LLZA 1RT1A 4O23A 3SV4A 4KV8A 4RW9A 4DF8A 2HQCA 4WK1A 2BJ3A 2HIYA 3GV5B 3OUYB 1X5TA 1UCNA 2HK2A 1ZTTA 1VK3A 3D2WA 3TJ9A 1JXLA 2IY5B 1SV5B 4UT4A 2W24A 1VCTA 4CRJA 1I94J 4LF9F 4DEZA 2R7SA 2WSEC 1MU2B 2J6TA 3CDWA 3IS9B 1J2VA 3MCSA 2VODA 2CQ3A 3NY0A 4HTIA 4I68A 3MGJA 3PHEA 1JLAA 4IQMA 1RHMB 5BXIA 3F73A 1SUQA 2JEIA 2JOQA 1JMTA 4FF2A 1B7FA 4WWSA 4PRFA 5KFSA 4PG7A 4DPYA 2Y1JA 1S9EA 1B0PA 1YLXA 2D9OA 4UOCA 3Q8RB 3BQ2A 4DV7F 4ECSA 1UVJA 3AT1B 4W98A 3EGNA 4ELUA 1D09B 4M5DA 3NS7B 3OVAA 3KLFA 4NLPA 3HO1A 2EC0A 2HURA 3ITHA 5E41A 5E5NA 1GXUA 3FUYA 4WU2A 3SBMA 2OFHX 1HA1A 3G2XA 1VRTB 1D1UA 4J90A 4KR0B 1RJJA 2F7VA 3DYAA 4DV6F 3QT8A 5LMNJ 2IIHA 3R7NB 3FEXB 3A4TA 2OEKA 4JI8F 3M32A 1B0TA 2NXUA 5IM0A 1RT6B 2JSXA 2YPYA 1Q78A 1MN9A 3GSDA 4EI2A 3GJRB 1DAXA 3IBWA 3TP2A 3MM5B 2UVWA 2GIQA 3W5ZA 3S8SA 1RAFB 1R6VA 1UMJA 3GG0A 3MEGB 3GP9A 3NGDA 2LECA 3DDNA 4KC5A 3BGUA 4N7TA 2KH9A 3R6LB 3S01A 2ADBA 5J2QA 4LQ3A 3NLCA 1YSJA 1BWEA 3MEKA 4DL6A 1HNZF 2FHJD 2HZVA 2XS7A 1CBKA 4F02A 3K59A 1RT3A 2FJWA 1IKVA 3LAMA 4HI2A 1VQPS 1FJ7A 1S9GB 1GMUA 3W9IA 4KHPJ 3QGIA 2OEJA 3DMJA 2DHAA 2Q6CA 3HSJA 4J9KA 1GT8A 2CJBA 2X1BA 4M5DB 2WOMA 3PW0A 1KTVA 4GKKF 3BV8A 5H9FK 2GJIA 4HACA 3DFEA 4YUDA 4ED7A 3WX8A 2BEFA 1S6QB 2HFVA 2JC1A 2MZRA 3M4XA 4ZCKA 1KQKA 3EGWB 5E3PA 5IV3A 4F50A 4LSLB 2ATCB 2ZD1A 3TUJC 5A8KB 5DDOC 1M5OC 2AYBA 4KJIA 2Z2YB 4PABA 2OO4A 1RAHB 3Q0AA 3BGOP 1F5BA 3QAUA 2GFFA 4DFJA 1H3DA 2DVIA 4F8RA 1NHKL 1EHWA 2GX8A 2HWTA 1WD6A 3NGSA 3PRVA 2HQGA 3HX9A 4F7VA 2J0SD 3PHTA 1QE1A 1PJ5A 2DH8A 2EFQA 2KJVA 5K5MA 4D3GA 1EKSA 2ZKTA 3EM1A 2BJ7A 1NDPA 4P74A 1YQHA 1UTAA 3TEGA 2YNGB 2LQJA 5HVFA 1FKOA 2VDIA 3I9V9 3RAQA 4J9SA 3LOUA 4URGA 1L5UA 2ALYB 3KHRA 4NLRA 1VBYA 5BR8F 5EX3A 3HHKA 2N3OA 2MHEA 2YKQA 3MMCB 4ID5B 2Y0SD 4ANEA 2W2MP 4IOBA 3CTRA 1BC6A 1UW9A 4JI7F 4LF6F 2CNOB 4KRWA 4IR9A 1KOOA 4DU8A 5KFPA 2XCAA 4CZCA 2VONA 1XIQA 2MZTA 2XSJA 1UA1A 5DGAA 3LA0A 5HVGA 2JEFA 2HK3A 4U8VA 3NXZA 3OR1B 2HQIA 1NH8A 2CYYA 1F0XA 3MMAA 1SH2A 5D3GA 4L74A 2EK1A 2D74B 1WKJA 5C24B 2VFTA 1CQMA 2XSJB 1U0HB 2OUGA 3OR2B 3TUIC 3AHPA 2RE1A 1U8WA 4EK2A 3EZ5A 4A8QA 2ZNZA 4OI2A 1B99A 1V5VA 4UQTA 2NLWA 3PW4A 1RKJA 4DR4F 1X5OA 3OL7A 2L3MA 2B7BB 2VQEJ 4HDHA 2FVSA 5F8HA 3HK2A 3DRRB 2YQ0A 4UOHA 3Q2TC 1J5EF 1HYSA 4YHHF 3I6PA 4JOUA 4OZNA 2C3MA 2CNLB 3LPYA 1RAGB 1DZ5A 1PSDA 2D69A 4MMOA 1FRJA 1PC4A 3OD2A 3HD2A 2B7CB 4DMZA 2F65A 4ZOSA 4P52A 2CNNB 1U1QA 4Z7YA 2MXYA 4FF3A 4JV0A 2FTRA 4I4BA 2UV8G 5MLCV 4OHVA 4PCQA 1D9FA 3CCJS 2VFRA 1TAUA 1RB0A 3IRXB 1HW9A 2L9DA 4KGXB 4I6YA 4U7CA 4EZ6A 1I3OB 3LW5C 4OI3A 1TUVA 2NPFA 2CDQA 3OQ2A 3THTA 3KLHB 4NZ6A 5J1EB 3D6TB 1HQ2A 3VQTA 2C3YA 4MT1A 1EKRA 2V69A 3BBFA 5U47A 1RQ0A 5A8RB 3KHGA 1WI8A 1YJ9S 4RNHA 1NMEB 3IM9A 2N4DA 3H7HB 3M30B 3G8SA 4DR7F 4K4WA 3THPA 2DNYA 2H1YA 3R9LA 4OV1A 2F4VF 1RT4B 4Y2KA 3W2WA 1SJFA 2RQKA 3D0HE 1Z4UA 2VIHA 2H3EB 3VTIA 4JV2A 2CQ1A 1WOPA 2LXUA 3I5BA 3MPYA 2JZ5A 2HQDA 4TU7A 4QWCA 3PW2A 5LSRA 3MEGA 4PQUA 5DQHA 4QIVA 1JB0C 1FA0A 5C2GA 3BO4A 2Q6BA 4JI1F 3FJ2A 4AXIA 3D4JA 2J9DA 2MKCA 4X4TA 3FFIB 2GJFA 3GYXB 3FGVA 2MLXA 2VZ9A 4FVCA 1FD2A 3TOQA 3GMGA 3BO3A 4WFBQ 1VISA 4KY3A 4A4JA 5KFOA 2F3JA 5EDWA 4DL4A 2A6OA 1GX5A 4ZIWA 5HMZA 2R7TA 4P2SA 5KFZA 4U7UK 3KWMA 2FDNA 3AB4B 3JTPA 1M1GA 5KG1A 1FD8A 2ZVIA 3D1QA 1Y3JA 4X4QA 1UWBA 2CRLA 3OFHA 4QR1A 3T6BA 3WHIA 2GMHA 5EWGA 3KK3B 2HIQA 4WCEQ 2EFVA 3CJ4A 3NCRA 3WIVA 1BQXA 3U27A 2ZBQA 3NEKA 1NHUA 2VDHA 3NS6A 4WTOB 2W9AA 2I2YA 1FRHA 2MY8A 4ZPWR 3EXYA 2OJ3A 1AFIA 5B0FA 4R8UA 1U7LA 1B70B 3JSYA 4JI4F 5D0GA 2XBPA 1FKOB 5AE2A 2DO0A 3ZZ0A 2AT1B 2ZKUA 2CXEA 1CPZA 3DKDA 3UCGA 2ZEJA 1NRKA 2QFJA 1TKTB 4P73A 4A8YA 2ZZTA 1VQKS 5IZHA 2JEGA 4YOEA 4E2FB 2ZDOA 3MM5A 4RW9B 1YDLA 3LP2A 3KHHA 2W9CA 4CLYA 2XMWA 4K2XA 2LP4A 4ID8A 2HHUA 2EC2A 1RT4A 1RTZA 1SIWB 2HZCA 3AJDA 3BGRA 3MAAA 3PEJA 1RSCA 1OMSA 5KG3A 2IDLA 4RWWA 2XYGB 3PW7A 4NLUA 1VOMA 3CUNA 1J5OB 1HBMB 3E2EA 2YKNA 5K9FA 3FCWA 4HH0A 1RWMB 1PYSB 1W25A 2QYCA 3KUEA 3R6GB 5IC6B 4DBQA 5BYSA 3GCWP 1U6FA 4DS5A 2KZZA 1VJQA 4GVBB 4PZVA 4DV4F 1X9MA 4JI6F 1FWLA 4LSLA 1UVMA 3KJNB 5DS7A 1N32F 3MPVA 4F26A 2GO8A 1AYEA 4B9SA 2P9GA 1N36J 4MKYA 5KFFA 1CVJA 2ZH6A 3UVJA 1HWLA 4YEAA 2BDPA 3O2IA 3IAS9 3PRDA 3W9JA 3HHDA 2IMOA 4K2JA 3MM6A 3LP2B 4K4TA 1LV5A 3HHLD 4J5OA 2ASJA 4ZVGA 3CJ2A 4YFUA 3B54A 5IQ6A 4ECTA 3AOCA 3KK3A 1R8HA 3IBCB 4E8UA 2OLWA 2OPQA 2JRSA 4LRDA 3TUPA 3M2UA 5KG4A 4DX8H 6FDRA 3OVSA 2G4BA 4C4WA 4TLRA 4C0OC 2KT3A 3EX7B 4EBDA 3AOAA 4KAIA 2BKPA 1LOUA 4U95A 4MH8A 4LSZB 2YNIB 4CLWA 5B7WA 5JVGQ 1L3VA 4I2QA 1QTMA 1TFWA 1F1BB 3KTQA 3KMSA 2VKRA 3AAWB 2IA6A 3FVYA 5KT6A 3H40A 4F25A 5A76A 5A8WA 2KJWA 5E3QA 3LANA 3Q83A 3W3SA 3R7SB 3PIOQ 4LFBJ 3RGIA 4L3KA 5J1NA 4MKBA 3ZTPA 4ECYA 4DV1J 1DTTB 1PYTA 1C1BA 3CCTA 5B0CA 3HT3A 1RU1A 2XMTA 4OYOA 4FXWA 5KFVA 1E6YA 4DS4A 3T1HJ 3TJAA 1TZ0A 5L1KA 3CD6S 2WW8A 3EDQB 3TNVA 3PTWA 4ES3A 1TKZB 2GAHC 2MMYA 2R7WA 1RWWB 4K7QA 1R3NA 3LWLA 4ZPDA 1QDUB 4DF4A 4QCLA 3EE3A 3DNCA 1U1MA 4ECZA 4ZVFA 1E6YB 3VR1A 4WP9A 2NXEA 1HBOA 2R7QA 2XGQA 1N33J 1KWMA 4LBHA 5IQQA 3JB9k 2L9NA 3ADAC 1QSSA 1VLYA 3RB0A 3Q24A 4QYZJ 2HBZB 1B0VA 3BSAA 2NSCA 2PDAA 1RTIB 1FE0A 4U96A 1WACA 4XPEA 3FQKA 3H98A 4ZPBA 2C2DA 4DV2J 4OYPA 3PV8A 4GMKA 2GIRA 2V50A 2MKIA 4DR2F 2CAJA 1IKYB 2CPFA 2CIMA 5IC4B 2LQBA 4CO2A 3SYZA 3V81B 3BBCA 1MLAA 1Q1KA 2A18A 1RTDA 2BV3A 3CC4S 1VFJA 3CO0P 4L73A 4O3RA 1SC4B 2MQLA 1N34F 3M2UB 3OLBA 3P5TL 3H42A 2BQUA 2E44A 3CW2C 2DPJA 4F3MA 4ANCA 2NXNA 2RB7A 5KFYA 1G6BA 5JMNA 2HHHJ 2C2RA 3FZBA 4ATNA 2RKIB 1D9AA 1Q4RA 3GQCA 3KDNA 2NCKL 2IC3A 4Y28C 2IM2A 3N28A 2DIUA 3QLHB 3US5A 2VICA 4B9LA 4Q8EA 2G2ZA 1H72C 5DGBA 5CYMA 2M70A 1MMNA 2JFDA 1CC7A 1QD1A 4BS2A 3FMWA 1K73T 4LF1A 3W63A 4IH7A 1QY7A 3ZO7A 4Q2LA 4DSFA 5KFQA 2POKA 1FNMA 1S48A 1RTIA 4NXNF 1CJVB 3DXBA 2V67A 2IC3B 1T94A 4RLEA 1R43A 1WG1A 2M52A 3CO9A 4DPOA 3G6YA 4NXMF 1Y10A 3TI0A 2JNJA 2XMKA 4OYIA 3HXMA 1H74A 4LF8F 2HHQA 4PG4A 3UD5A 4O3PA 3V2UC 2EG2A 3UQSA 3KK2B 2B8PA 2MJUA 4NLXA 4DZDA 3HZGA 3RJMB 3HP6A 1RWVB 3TAPA 4LF5F 1F9EB 2MQOA 4LBIA 4PYAA 4DSJA 1RT2A 4KKOB 5KFAA 4A8KA 2WAQD 5E3RA 1KSPA 4FDFA 2CZ9A 4KIAA 4LJMA 3OR1A 4ALZA 3VAMA 2P9EA 2CKWA 3ZTSA 3PX4A 5LJ3Y 1AW0A 1UWBB 2ZH5A 2MKJA 2AMCB 4I0WA 5ETVA 3KLGB 2RJZA 2LVWA 3W9HA 3KLVA 2W01A 2BJEA 4F0MA 1S99A 3LH2S 3I82A 1R89A 3AQOA 3AY0A 3VAJA 4OLOA 1P8GA 4UOGA 3AODA 2MDAA 3CJ3A 4P75A 3UW1A 4A47A 2QE5A 1GTEA 2CQCA 1GTHA 2LQ8A 5DO2A 3TX8A 4OX6A 5DQIA 1NK5A 2LCWA 2LEPA 1VHIA 2MEWA 3DN9A 4J9OA 1OPIA 1HQUB 2DHGA 2NXCA 2XYHB 4MK7A 2VKZG 4ZVEA 5AJ3J 4ZVRB 2VJUA 2W9CB 2DR8A 3BJYA 1EQ0A 3VVUA 2VA3A 3MDFA 2OAUA 3JTNA 1FRLA 4Y2CA 2EVZA 2F4FA 3DLLQ 1HQUA 2I38A 1VBZA 2RH3A 2Z56B 4C8KA 2AQ4A 2KB2A 1IBCB 3HFKA 4Y34A 2XI2A 3SXLA 3OXLA 2EKNA 3I4HX 5G0RA 4Y0FA 2QL7B 1HW8A 1C0TB 3GFZA 4GO7X 1MG7A 2YWWA 1RT7B 1UJ4A 2V8GA 2XTJP 1S1TB 1OO0B 3G96A 1N36F 3CJKB 3K17A 1FRMA 1GMWA 4CLLA 3K57A 2PI5A 4DR1F 1YX2A 2E1MC 3AD7C 2G1HA 4DUZJ 2C22A 3R5AA 1KEKA 3DI6A 4DFPA 2WBMA 3E01B 3IRXA 3B8HA 4LREA 2OPSB 4WU3A 1UEVA 4ZLNA 3TUZC 1PBUA 1YJTA 2BE2A 3M8PA 3NAIA 4IH5A 5HBMA 2GO9A 3DXSX 3W2WB 3W66A 4ZCMA 4EYIB 3HZEA 1FX2A 5KFWA 5DG7A 4HDGA 2UVUA 3PEHA 3QIPA 5KTQA 3BYRA 1K44A 3AXMA 3OL8A 3QMQA 4USWA 4I69A 4DV0F 3V4IB 2A0FB 3R5DA 2MZQA 3SSRA 1VQ9S 3ZZYA 4DR6F 2XMUA 4C6AA 1GH8A 4IO9Q 5L39A 4USMA 5HSPA 2DIVA 3ZNUA 3V81A 4XIUA 2QGFB 3ILOA 5B0AA 8ATCB 2GC8A 1O6XA 4LF8J 2V8DA 3RAMA 1LW0B 4LRCA 4FBUA 3POTB 3T41A 2IYGA 4ZLJA 2HMIA 2RS8A 5C7PA 4C8ZA 2NQPA 4J9NA 2YKNB 2R7RA 3DM2B 4NRTA 3NOGA 1QTNB 2K7JA 4IFVA 4NZ0A 3RR7A 3MM9A 3M6XA 4KO0B 1HBUB 1FJEB 2KVIA 4USKA 2MQQA 2BE2B 3DOKA 5C42A 1BQMB 4C97A 2VV5A 5IOLA 4F4WA 2A6MA 4MFBB 5KG0A 3TVYA 1N5YB 1S79A 2AU0A 4LRBA 1YITS 2UXCF 1IR0A 3PX0A 2BW7A 1R6YA 4G1QB 5CXTA 1SB6A 2WRMA 2IAJB 5HMXA 2LA4A 4UZBA 3H59A 2DGUA 2QL9B 2VASA 1Z2ZA 4TYBA 3VVTA 1FRIA 5HJXA 5KOXA 1JJ2R 2ZJRQ 5IS2A 1QSYA 3D5MA 3O8WA 4ZDNA 5DLFA 1C0UA 3CWJA 3ZZPA 4EBCA 3M2RA 2Z2ZA 4WE1B 2AYEA 2LDIA 3VHQA 2MQPA 4R5PA 4LBPA 2L41A 1K0VA 1RP5A 1Q7LB 4H4OA 3KLEA 1NKCA 4OZ2A 2K8GA 2NR0A 3IR6B 3M1VA 2UVRA 2VG5A 1X5PA 1KTQA 2ZDPA 4P9SA 1X9SA 1WOSA 1H2UX 1U47A 3U1NA 5CHCB 4K5RA 3KLGA 1RTJA 4KT0C 5JVHQ 3BEGB 4H4OB 4IRDA 1NJWA 1A7GE 2E7XA 5D4OA 1FRXA 1DURA 3KLIA 4RX6A 5HK4A 2HPUA 3W5YA 2DGQA 4M5HA 1DTTA 3ILIA 2DY9A 4F3OA 2MSTA 6AT1B 2GGPA 2MSSA 1TTHB 1N88A 3KFWX 2DNQA 1HWJA 1M5HA 4ZVUB 4PWUA 4IRKA 4RO0A 4J9LA 1UZDA 1NDKA 4ZN1A 5EWFA 3RB6A 1WKKA 2HHVA 2IMWP 4GC7A 3VQSA 2YKAA 5F9LA 3Q86A 2GJ2A 5GADU 3QGPA 1WHYA 1L3TA 1G3OA 5KFKA 2EPIA 1WC6A 2O3DA 2AX1A 3L7PA 2G0CA 3ENVA 3SCKE 3ZZOA 3UD4P 4PKDB 1F2HA 2XC9A 1U1PA 2AYMA 1BXNA 5H9EK 1HR0F 1XR7A 2KXNB 2R8KA 1SKUB 4Q5VA 3NCPA 4GKKJ 4TY8B 2JL9A 2XY5A 1SXLA 4O0NA 1C2PA 2ZOGA 2ABYA 4Z7CA 3MM9B 1WC1A 2KHDA 2HFUA 2MKHA 3LP0A 4FZVA 3GR0A 3SQGB 4DZ6A 1ZBTA 1XWLA 2QYGA 3FRYA 5J2PA 2KHCA 5AT1B 4QU6A 2HVHA 4JV1A 1ZPWX 2ROGA 5KFUA 4HKQA 3GCXP 2GVZA 3KXDA 3PACA 2IM1A 1OQ3A 5CD4A 1V3RA 2HWIA 1TAQA 4B3RJ 4NX9A 3I0SA 1S9EB 2ROEA 3BDEA 3MPUB 1NK0A 1FDBA 1XTZA 1QM9A 3G8QA 2E5JA 1VC5A 2HHPA 2OD4A 1S6QA 4NYZA 1JLEB 1E6VB 2FGCA 3OR2A 4WYLA 4H4KA 1RAIB 2FJAB 5JUMA 5FLXY 3CJ0A 3NAHA 4YB5A 1OYEA 3C14B 4F0HA 3A3PB 1JKHB 2DHSA 1WC5A 4LF2A 5KFDA 1SJ1A 2J8SA 1QVFR 1ROFA 4F04B 2CPEA 3RZAA 2W25A 4R25A 1XMBA 3EUNA 4KHRA 4ZP6A 2BA9A 1Q7YT 1K47A 1SJRA 1SQFA 4AFFA 4KV8B 4RW8A 5BYRA 5E0OA 1EARA 7AT1B 3VALA 1QAXA 3OTEA 2VQFJ 2M2BA 4JB8B 3BN7A 3GJQB 2JVRA 3IAM9 2F8EX 1P1TA 3AQPA 4LR8A 2NREA 2HBRB 2K7KA 5KG2A 4CO1A 3EVOA 4N76A 2UXDF 3NCQA 3F56A 5G0RB 1URNA 4F67A 2EK6A 5AXMA 3KYLA 2VFSA 2OSQA 5F3TA 2DGWA 3U1MA 3OSPA 2C2EA 4P2XA 3M2VA 2JLGA 4B3OA 2DNOA 4OYZA 4WK3A 1WHWA 1N5TA 3UI3A 1N52B 3MI7X 1RA6A 2JFKA 1HNWJ 2E1CA 2CQGA 3MUTP 2H5JB 2X7IA 4CT9A 4FBTA 1KKHA 2CQ0A 2IJFA 2CPZA 2EXUA 2OFGX 5CYMB 3CCSS 4QWBA 2B6AB 2W2PP 1S0MA 4M5KA 5F0UA 1YTYA 1SQGA 1U2RA 3TR5A 3PM9A 4FS2A 1H2TZ 2RMLA 2LXFA 4U9RA 5HL7Q 1DHMA 1F9HA 1Q5VA 1TV6A 4K8RA 5LMNF 1UVIA 3TVKA 3PKYA 2A10A 1PILA 2QMUB 4M5GA 5FIIA 2HHXA 2VJVA 1KC8T 3NRBA 1RT1B 2HFOA 1HI1A 3LF0A 5CCMA 1S6PB 3MR6A 4YR3A 4WJBA 2AV5A 3GYGA 4USUA 5CAAA 2BQRA 1TL1A 4X4NA 1HL6A 5IWAF 1RLCL 3CCUS 1O0PA 3DM2A 3VAKA 1S9GA 3J7AN 2XWYA 3TAMA 4FF4A 4M94A 2VBWA 4HT5A 4W4MA 1HNZJ 1VQ6S 3M8RA 4GO5X 1WC0A 1JIHA 2CPJA 2V9KA 2Z4PA 4LR9A 2V34A 4PXBA 2H5IB 5J1PA 3T5JA 3TANA 5DM7Q 3FC9A 3PFOA 5E3CA 5KFHA 5EWEA 4AQYJ 1IBMJ 1X4EA 2UU9J 3RRHA 2XNRA 4DV0J 1I1GA 1LFWA 3HD1A 5HVHA 2KKHA 3MM6B 1T9YA 4X4VA 1U25A 2PA3A 3Q8YA 4TN2A 1H0HB 5KT3A 3TZWA 4NCAA 4NE9C 2MPUA 2O01C 1F5CA 3GFXA 4B9UA 1LW2A 5FLXU 2Z2MA 1FO1A 4RU9A 2AEMA 4TLQA 5ETTA 1VR6A 4P6QA 3C8YA 3OHBA 4U7UD 2ZM6J 3H2VE 4WIQA 2FYXA 4RW4A 3K5LA 1N32J 2W2OP 3RBEA 2HVDA 1FEEA 5A6PA 2DK2A 3QJLA 2EG1A 4Z2XA 2EBEA 1XMQF 5J2MA 3K5NA 5GAGI 2YKMA 2NUUG 4U6PA 2Z30B 4A8FA 3GV8B 5FDLA 2VB6A 1PAEX 2FY8A 4AUKA 2HNDB 3FRZA 1RHUB 4B9NA 3R2CJ 3NMAA 3IS9A 1B64A 2G1DA 5HANA 2X3GA 1QAYA 1X31C 2ZC3A 4J9PA 3QATA 1WC3A 2W8KA 1RWNB 4V1Ak 2HAIA 2CNKB 5T7LB 3T9ZA 5I3UB 1JLBA 3DDIA 4YDDB 2HNDA 3I4PA 2VC1A 3V4MA 1ZA2B 2NXJA 5IV4A 4DV7J 4ECRA 3HJFA 5KFEA 3HPOA 1NAQA 2D1CA 3D3CJ 2B9EA 2C2MB 3I0RA 2CJKA 3OJSA 1YKWA 2XI3A 3M6VA 3JSMB 1S4EA 4J9VA 1SC1B 1RAAB 2ZWPA 3FSXA 4OJ3A 3T1HF 4PXEA 4TQSA 2IM3A 3HSGA 1NZ8A 3K89A 1XMOF 1CS4A 3DGPA 2BE9B 5AE3A 3SIPB 2HHSA 3BZQA 3NGKA 5H9EJ 3EWGA 3TQ1A 1IWGA 3QT5A 4Y2AA 3J81j 2YNGA 3JSBA 3AOBA 2OTLS 3OSNA 4MK8A 3MR2A 1L3UA 1AZSB 2CQ2A 2DBBA 3G6ES 1JXEA 3TARA 1RTDB 3MAAB 4DCPB 2EEYA 1HI0P 4KBIA 1W26A 3TJ8A 3E3XA 5KG6A 3WQPA 3CIZA 3IWLA 3KJQB 3SEOA 3Q2SC 1P27B 1WNEA 4QWEA 2ZNYA 2DD8S 3D6FB 1B7YB 3MMBA 4QIWD 1FWPA 1Q95G 5AXKA 2HS0A 3Q8PB 3N5FA 2V4QA 3M6UA 3IG1B 2ADCA 2Y9HA 4USJC 1BMQB 2ZH1A 5LMUF 1I6JA 4O44B 2VFUA 2VA2A 4EU0A 4B3SJ 4DL2A 3UN5A 3HHLA 2DNHA 3C14A 5B08A 4IQXA 2YVSA 1FJGJ 2R7UA 3WBZA 3KOAA 2H9ZA 3QRQA 3ZC4A 3P6YC 1N6QB 1BQNA 1IBLF 4I2PB 3J81Y 4C48A 3T19A 2O67A 3EICA 3HSZA 2HZAA 3F44A 5K14A 2R2RA 1Y4ZB 3MFIA 2VG6A 1F9FA 4I7FB 3G8TA 4ETXA 3C15A 3KDOA 3KJFB 3NS5A 3UO0A 2D41A 3GG1A 4LMZA 1S9FA 1FE4A 3EDRB 4C11A 4IOAQ 3QWPA 4PUOB 1FI4A 3GU0A 3RRKA 5BJRA 4X65F 1HBMA 1NDLA 3WZ0A 2W7PA 3BKTA 2UUCJ 1FDDA 2C3UA 3K8WA 2ZH3A 1YJNS 3J7A1 3N4WA 2AJQA 1VQ7S 1NZAA 4H4KC 1S7HA 5DG8A 3L9ZA 5G4DA 1HHQA 1WELA 4CLKA 4WPAA 3AA9A 1KRPA 3RB3A 2B9YA 3TA0A 4IOCQ 1RDRA 4LFCF 2PSZA 2QL5B 4Q2MA 1N33F 2FB0A 1CJUA 4J9RA 3PX6A 5E3AA 3H4BA 3U7JA 4K4YA 1Y5LB 3O44A 5KT2A 4FYXB 1BY9A 1N0VC 3H5SA 3FMBA 4OJHA 2PEBA 3MMAB 2RQCA 3MMCA 4ID5A 4KB7A 4X64F 2RS2A 1KVIA 1ZM9A 2BJDA 4LQ9A 5C24A 3TA2A 3ZXWA 1GQEA 2OP5A 5KFNA 1I5OB 5E7OB 3DRSA 3MM7A 1RAEB 5ADZA 1BUXA 1U1KA 4F0KA 1X4AA 2BJ1A 2GS8A 2YBVA 3BKUA 1YJ7A 1ZM3A 3JYTB 4ERDA 2J7KA 5C2CA 1Q81T 8AT1B 1GFWB 2DH7A 4MYTA 1TELA 4NLOA 1F5AA 2M9KA 4BHQA 3MEDB 1HBNA 3VAHA 2Y3YA 4DR3F 4MKAA 3Q8QB 3P5BP 5F8JA 2DR5A 3MTJA 3D67A 1C4CA 1HPZA 3EYZA 2FVCA 4OHWA 2GCFA 4DN0A 5A0YA 3I55S 3C6TB 1U02A 4HHUA 4CYUB 1VQOS 1ZZNA 1RE1B 1J5OA 3CDUA 2QEXS 2HRTA 2IHR1 1YWXA 2L9WA 1LNQA 2G2YA 2CUYA 1U45A 2FC8A 3IO1A 5HAOA 4O3QA 4X4OA 1YK9A 5A2QY 3KMQA 1C1BB 1AUDA 2YKPA 2HFSA 2HQFA 7FDRA 4FNHA 5E2QA 2ACMA 2RDDA 3UN2A 3KLHA 1TQLA 1R0BG 3R97A 4DSLA 1RBLA 4JI6J 5F9NA 4DHVA 3OXFA 1RADB 5KFIA 2AX0A 3EJMA 2QLBB 1RT2B 1EAYC 1R8PA 2G13A 2ZD1B 4C8NA 3U1LA 1YHQS 5I42B 2QSFA 5F0WA 1IBLJ 1CJKA 2IAJA 1MMDA 4ZHRB 3KK1A 4RBUA 3LPEA 4FYWB 1O5JA 1WHVA 5H1SV 2DNZA 4DV5F 3NG8A 2FZCB 3AJ2A 1S59A 1R31A 3BH7B 5L1LA 1PAUB 1U49A 4C8MA 4CLUA 2DNMA 2H5EA 4C2MA 4PXDA 1NK8A 2IPOB 1S0NA 1IBMF 4F4AA 3EZUA 3QRRA 4DPTA 4WFZA 4LF9J 2L08A 3UDLA 1RKIA 5KFGA 3OL9A 1X7VA 3MR7A 1RT7A 4EO8A 1ZM2A 2YQ1A 2DB1A 4KKOA 4RL1A 4NMLA 2R2UA 3SV3A 2KDOA 1U4BA 3DGVA 4IYQA 1K9MT 1M5VC 2J9CA 3OV7A 4NLWA 1JLCA 4C0HA 3NMRA 1ZPVA 1LWFB 5KT5A 1XNQJ 2DH9A 3FKBA 1EQMA 5EN1A 1I51B 3THVA 2E5IA 2BJ9A 5L1JA 2DNPA 2M3DA 3K2YA 4DSKA 3B4MA 3PYGA 1RHRB 2ZJQQ 4CP5A 1OPZA 3B82A 5CYQB 5HN0A 4DV5J 4ED0A 2V9WA 3JSMA 3N5BA 4KHMA 3JAMU 3V4IA 2IVFB 1IBKJ 1OQ6A 2DCUB 4AYBD 4ILLA 1RT5A 1R8AA 3HJVA 3H5UA 5HI7A 1D0EA 1RU2A 1RLDA 1SI9A 1NPPA 3G4SS 2LU1A 2XB2D 1KFDA 2MHNA 3OTBA 2HW3A 3KUHA 2CPDA 5B0DA 4OX9F 2V0NA 3L7OA 3IN5A 4Q7AA 2QZ8A 4QQBA 2HMIB 3GJSB 2MZ1A 2QA4S 3SSQA 4D3HA 2JC0A 4BBYA 4CQ1A 1B3TA 2ZH8A 3MMBB 3PDNA 1TUWA 4USTA 1YJVA 4C8LA 2XS2A 1F2GA 1ZAVA 2YNIA 3CC7S 2GHWA 1Y3KA 4DQRA 1FHTA 2RDIA 3NWRA 1XN9A 3Q8UA 1S1WB 4UOFA 3GIJA 3PKMA 1YZ7A 2XO7A 3P8BB 4TKTA 1KHWA 1ZOTA 2MQ8A 1WSVA 1XQIA 3LQVA 2KXFA 4ZPVR 2FJEB 2A1BA 4OX8A 4USIA 4YHHJ 1QUPA 1IKVB 3L3CA 2RKIA 2IBKA 1RT5B 5D4LA 1NJZA 4JBCA 2BYCA 2DXEA 2UP1A 2Y8YA 4JYAJ 2R7XA 4CLTA 2XZTB 1GNKA 2CJAA 1TKZA 4YB7A 3BSCA 3O1LA 2VPYB 1S4FA 3N6NA 1ICEB 2OPRB 1S1UB 3LP0B 3SQGA 2IRXA 2G9OA 2SXLA 2QN6B 5GAHU 4YP3A 4FS1A 3DLGA 1DRZA 2Y1RI 1BQMA 2DPIA 4PUOA 1DFDA 4NYPA 1RT6A 3TEHB 3OJUA 1HNVB 3VCDA 3A13A 3R5JB 5THWA 5BR8J 1VGYA 2GVZB 2RUGA 3BPSP 3SDEA 3ZNJ1 3HMJG 2ZBCA 3QFHA 1T05A 1NKEA 4PWDB 2Z8QA 3CJ8A 3ZTQA 3HKZD 1FFSB 1KR4A 5D77A 2V2VA 4B3SF 2MQNA 3POTA 1TK8A 4OI0A 2X1FA 2F9DA 1U24A 4KGZB 4PQAA 1F3VA 1WG4A 3BGRB 3D28A 1YRTA 1SKWA 1OY6A 1T9UA 2APOA 5M2UA 3BSOA 4A8OA 5DDPC 1FJGF 1UFLA 3DRPA 3RAXA 2K2PA 1RABB 1TL7A 1WHXA 2HSEB 3FCVA 3F41A 2DNRA 3JQKA 4GVBA 4KE5A 4KQZA 1NB7A 1WWHA 4DV4J 2H54B 3PCOB 2YWKA 1KONA 1O51A 2J0WA 1Q8LA 1V6HA 1UVKA 3QIPB 2QIFA 2R8JA 4AL5A 4OYAA 2V4JA 4ZVQB 2YWGA 3DDKA 1Q53A 5ITHA 1G4CA 1WSRA 2DR6A 3L09A 4X65J 4ECXA 4DSIA 1YG0A 2AP6A 2GQ2A 3UDCA 1HBNB 3CXCR 2WB1D 1R0CB 4FPIA 2RQ4A 2W9BB 3CE8A 3TVZA 3K8VA 2VUGA 2U1AA 2XULA 1S1VA 1AZSA 1XERA 3ZTRA 2WONA 4OYBA 4CO3A 1PKUA 1SH3A 1X9WA 2HRUA 2CPHA 2B51A 3GE9A 3PXGa 4IFYB 3LAKA 2XLIA 4Y65A 3OL6A 1W7WA 2IRUA 4IDKA 5F8NA 2VG5B 3V5RA 1NU4A 1EZZB 4RKUC 3TZYA 3PYEA 4QZVB 4DL3A 4QJVA 4NEYA 4G3IA 2PC6A 2CPXA 2FJBB 1S76D 2KZMA 4LFBF 4LFAF 1MWZA 1VMBA 1ZS6A 1AB8A 2HFNA 3CJQA 4NMXA 2JHEA 5A2QU 4DV6J 2FY1A 4BDPA 1NO8A 2O66A 3T3FA 2KL8A 2ZHOA 3DOMB 4LIWA 4RJVA 2A3JA 1JLQA 1TKDA 2CPYA 3NWGA 3MPWA 1NJIT 3DLKA 5GMEA 3DOLB 5KFMA 3C3LA 1VQ4S 2IYIA 3IM8A 3GIIA 1QAIA 1TKTA 2JH3A 2OSRA 1BD6A 4NEZA 4N8NA 4CH7A 4ZJQA 1T0TV 3H5XA 4OZLA 1IKWA 4RUAA 3KKFA 1R0AB 3CEDA 3CCES 2IM0A 3SDEB 3HULA 1T05B 4RZRA 4KYZA 2AGQA 4K5SA 1IN0A 5HROB 5B09A 2V63A 2G0JA 2DGXA 4IFYA 1LFPA 4MYUA 2B8QA 4WFYA 1UKUA 5A8RA 1T7PA 4NLGA 3Q22A 4NXNJ 1QJHA 2EW9A 1AROP 3W60A 1N5SA 2YNHB 4RNFA 3MZIA 3B4DA 2UUAJ 3OHAA 2BJ8A 1WF2A 4OHYA 1FFGB 3CDEA 5HROA 1U1LA 2J7WA 3H0PA 2RD5C 1F60B 1M1HA 2J9EA 3D3BJ 3QQCD 2V68A 3TQEA 1SL0A 1FTCA 2V8HA 4A46A 1WG5A 1SC6A 3QGHA 1KVKA 2RHSB 2OHDA 4N41A 2RRNA 4W90B 1WF0A 3NGRA 3M30A 5HO4A 4AT1B 4I2QB 2FLLA 2MZJA 2LQ5A 2AF6A 2QLFB 2FQQB 2YQ3A 3L4BC 1ZTWA 1UVNA 2GW8A 3M8SA 3QPIA 2KFYA 4IUFA 1S97A 1RAJA 3CJKA 1T03B 1ACMB 3GIRA 5C25A 3FK4A 3VGVA 4DQPA 5D6GA 1JXVA 1PBAA 2C3PA 3UCUP 2ZOMA 2AW0A 3BR8A 1P9YA 4IG0B 4K4ZA 2OPSA 4FYVB 4OQJA 4JV5J 1U26A 1JNRB 4X66F 3M05A 4HI1A 3LGHA 1BWVA 5I42A 1RGVA 1J27A 2B4OA 4IDKB 4YN3B 1MNEA 3GTYX 4PWDA 5IT4A 3FBBA 2CDRB 3UVJB 2ZUGA 2QMXA 3ILLA 4DL0C 5IM0B 2R8HA 2ERRA 3EVMA 4P10A 2YH1A 4K4SA 1V9OA 3D6MB 3SMZA 2B6AA 2JWNA 3X1LB 1LK5A 2CWXA 2DISA 2WSCC 2IFXA 4L6V3 2DEIA 4R0JA 2J0XA 3BS9A 2C2NA 3HT0A 3ISND 3JXOA 2X1GA 1T02A 1H2VZ 2ILZA 1LW0A 1D8ZA 4I64A 2HG4A 2KXHA 3BSNA 2FLPA 5KT7A 1TVRA 5I3UA 1GXLA 1REVA 1X0PA 3QJPA 4OV6A 2FJDB 5LSOA 4DV3F 2RUSA 3ZZZA 2UXCJ 2F1FA 2M4MA 4LT6A 1ZYQA 4ECQA 4JYAF 2HFZA 2DRDA 2XHCA 1M5PC 2C1EB 1TVRB 5KFRA 2K3IA 2J6UA 4CH1A 1IM4A 2H48B 4A48A 1OSCA 2LU2A 1UVLA 4FYYB 4NI2A 4DN9A 1IR2A 3CNQP 4RW8B 5IFMA 5GMKa 1RA7A 2EKYA 5AJ3F 3R1HA 1VQ8S 3PR5B 2XO6A 1KDNA 4C8YA 2HHTA 1TL3A 3MCOA 5DQGA 1HNVA 2AGOA 2N7YA 3J81U 5K8MA 1X5SA 1FKPB 2OI2A 2VC0A 2VU5A 4I6AA 3M2RB 3I56S 1YIJS 4LFCJ 1Q8KA 2I5JB 3AD9C 1R8CA 4B02A 2ZZMA 5DDQC 1AXQA 1Z2LA 1JLGA 3V6HA 1T9VA 4OZ5A 4WIIA 3CJ5A 1K0TA 1K1SA 4AE5A 2Y1IA 3O5TB 2FGOA 2E9TA 1GX6A 3T1YF 1SJQA 3D0GE 5M2PA 5EHHA 2BRKA 3I32A 3EVWA 4AL6A 3OVBA 1WORA 3LUYA 2J0QD 3I0SB 2UXDJ 1UEUA 4TVAB 1TP7A 2NS1B 3I31A 1GMWD 3T5HA 2E5GA 1JLFB 4HVZA 1ZA1B 1RCXB 2HVEA 4MK9A 1V5IB 1IUJA 2YKOA 4KO0A 1UPPA 4HHHA 1JLCB 4UW2A 4NXMJ 2UUWA 1RBAA 3DMJB 1NSKL 3HVTB 4N56A 1WTFA 2H65B 5ETRA 3UR0A 3GILA 2VG6B 1KQGB 1RK8A 4GKJJ 1NK9A 2H4WB 3M8PB 1EETB 2IVMA 1VQYA 4G1QA 2AKWB 4X66J 5AXNA 1T95A 1KNZA 3HM9A 1Q86T 2HS4A 1MWYA 3GONA 3QBCA 5C5JA 2FD2A 3MF5A 4M5JA 3BKFA 2E5HA 4ES1A 1CG2A 2WVBA 5CZVA 3QGGA 2R2TA 3CMES 4JI2J 4M5IA 4CM2A 3PIPQ 5EX0A 4CT8A 4TQRA 3B6BA 4OFZA 4RW6A 1TKXB 3W65A 1LWXA 4A8XA 1G1XA 2Y0BB 4FN5A 2ZBRA 4CYUA 1KQFB 5JJBA 4DL5A 3LWMA 1SJ3P 1FVSA 1WEXA 5HATA 2QC3A 1TMMA 1N34J 3NNCA 1UWAA 2BBEA 2J9DE 1RTJB 2EI5A 3DOLA 5H9FJ 3FSIA 2ZHAA 3BO2A 5HLFB 1J5EJ 4DV3J 1T3NA 4ZN3A 1NK7A 2DR7A 4O4RA 2JLEA 2GNKA 1H7XA 1U8SA 3HVAA 4ZPAA 4NPOA 1JJCB 3CCRS 1SJ4P 2B5JB 3CVKA 3KLIB 4CIOA 4R8UB 3RTVA 4LF4F 4JI5F 1DTQB 4K0KJ 2MKYA 2ZH2A 3EGZA 3BGLA 4ITSA 4NASA 2AHOB 3K5OA 2B9XA 2UUAF 5HBMB 1U6ZA 3PY8A 4DFKA 1HPZB 1F6TA 1C4AA 2PEHA 1SH0A 2HNYB 2MJNA 3C16A 3DRXA 3TW0A 4ED2A 3EPIA 1RT3B 1PO6A 4UY8T 2CWKA 3I5AA 1AFJA 5KFJA 4F4YA 2ZE2A 1FX4A 3JAMY 1OIAA 2F40A 3BH6B 4M8LA 1HNIA 2BOAA 3LTOA 3NKYA 4EMDA 3WX4A 3MEEB 3QT6A 1JJHA 5B0BA 4O0IA 4L75A 2WZ1A 4NLTA 3GIMA 3G86A 1XMQJ 4ELVA 4ZP7A 3CD7A 3EZOA 4OIXA 2CQIA 1F3FA 4GC6A 5L38A 5AE1A 2CQDA 1IXKA 3N01A 2WCXA 4QU7A 2KG1A 3R5BA 3RUBL 2HHHF 2GZOA 2GVDA 3M9MB 4OZ1A 4KH0B 4DR5J 2PA8D 4ED8A 4BLGA 2ZH7A 3M32B 2K06A 2HGMA 4OJGA 2V6AA 3M8ZA 2RILA 4BC9A 4ETZA 2E1AA 3E51A 3K7RA 4BCAA 3QLHA 4DX5A 5CYQA 4FKXA 4ZJLA 2UUCF 4EO6A 4XPCA 3OW2R 4IKAA 5HJYA 1S0OA 4YMEA 3T6JA 2N7CA 1MW7A 2V2KA 2DITA 3TZZA 2JEJA 3JSRA 1OWXA 1BE4A 2HLTA 3KJVB 2DHXA 4ER8A 3C46A 1NPRA 2YNHA 3C2PA 3CCZA 4NCGB 1KVJA 1H7WA 5L1IA 3KNGA 4NWBA 2HNZA 3BF4A 3HFVA 3TWZA 5IXUA 4JI2F 2HYIB 1WOOA 2ZWOA 2B4PA 2BKNA 1VC0A 3MUVP 4CCHA 4IR1A 4JI0J 1NUEA 4LUBA 4FKYA 1NPKA 2WVCA 4G65A 4KTQA 2OD6A 3DCAA 3IP0A 3J80U 3TAMB 2R3VA 1VQSA 2HBQB 4HTJA 1ZH5A 1L3KA 2Y1LB 1UJ6A 2MYFA 5D0RA 4ZPCA 1WC4A 3UN3A 3CCLS 1XJWB 1WEYA 2GV1A 3Q89A 2N4CA 5LOQA 2FJXA 2BVZA 4F2RA 4KGKA 1MROA 2OMOA 4DR3J 2KM8C 2RT3A 3UDVA 2VL1A 4G1IA 3SQOP 3DOMA 2ASDA 1PJ6A 2XSFA 2RQMA 2D7SA 2COLA 2NYIA 3NBPA 1RYRA 4JI5J 4PWWA 4ZS6A 3UFCX 4ZJOA 5L9XA 2J76E 1RACB 1UFWA 1TFYA 2HHWA 5DG9A 2OPPB 2ZH9A 2I5JA 3TX0A 3H20A 1X4DA 3RBDA 4YB6A 4NA3A 1TV6B 2BRLA 4ECWA 1G2EA 3NGTA 3AJ1A 1I94F 2DGTA 4ED6A 3V6JA 4MTPA 4N5SA 2ZC4A 2VOPA 4CM0A 5D0EA 3TA1A 2M8DB 1MU2A 5D78A 1VIOA 1HWUA 3D54A 2FHKA 2XEXA 3J7Z5 1Y00A 2WVEA 3BPDA 2HBYB 5GAEU 3G9CA 1FT8A 4N8OA 2LEAA 4Y00A 1LKZA 1PYOB 3TO8A 3B78A 4ZMMA 3CJSA 5ETMA 1Q0NA 4J37A 2H4YB 3H8YA 4O44A 4WFNQ 4ENOA 1FK9A 1HHSA 3IWXA 2WW4A 2MQMA 5D15A 1TL7B 2W2NP 1Q79A 2VPWB 1UW4A 3AH6A 1DJ0A 2VBXA 4OI6A 5LSLA 1MWQA 1X4GA 4HT7A 3T5KA 1TK0A 3MXHP 4DR5F 1TL1B 3DHXA 3EXCX 3G87A 1HQEA 3ET6B 4ZK7M 4C3KA 3T9NA 1KLMB 2ASYA 2HS3A 4JP8A 1U48A 3VGUA 3GYNA 5IT0A 5DM6Q 4I1TA 4YR2A 3WC2A 2CG8A 3R5GA 5ETKA 4YR0A 2DRAA 5IT9Y 1JKHA 1KBRA 1YVFA 1DQ8A 2DGOA 2E1RA 2YPZA 3DLBA 2CPIA 2XMAA 5CD4H 3KK2A 3ENQA 4C11B 5F8MA 2V5HG 1HARA 2F63A 2P2CB 2AYGA 5J2NA 2DXDA 4RW4B 4LVOP 1UL3A 3H25A 2QJ3A 2ZH4A 4DR1J 2B9WA 1DARA 1LW2B 5K8PA 1A0OB 1NM2A 4EZ9A 1Q82T 3FBEA 3DI6B 2K3KA 4JI3J 3HFZB 4HR2A 2DO4A 3QSIA 3KG0A 3SCLE 4URQU 2RNEA 4B08A 5KFBA 4K50A 2BM1A 2E7WA 4RBVA 3PR4A 4H4MA 1Y0HA 4RU2A 2YH0A 2DCLA 2YTCA 4E98A 4I56A 4OYMA 3RBZA 1M5KC 1LWCB 4HL9A 1R8BA 1XEZA 2FIUA 3K5PA 4X62J 2XHWA 1VK8A 5GADI 1VRTA 1WF1A 5I3PA 3MTKA 2DY1A 5CZXA 3CJTA 1RHJB 2DGVA 4ZCLA 5L8RC 1KQSR 1CJTB 1YRUA 2KYXA 3MAHA 2K1RA 5ETNA 2WONB 4DFMA 3V6KA 4ZVSB 4CLZA 2ACYA 1HR0J 3IR5B 2ZE2B 4G6VB 4O3SA 3NL0A 1KP6A 2HNZB 3MEDA 3UE2A 2AJ1A 2ZM6F 1WDTA 1M1KT 3J7ZT 3VGTA 4ICLA 3V6DB 1N4LA 2XCPA 2AWZA 4URSA 4ZIVA 3IWNC 1S0VA 4DR7J 5MAOA 3L7UA 3OXGA 1PJ7A 3A8JA 3D0IE 5AXLA 1HBOB 3MR5A 1C0TA 4X4UA 1VRUA 1DLOA 3MECB 1VBXA 1SPBP 3E8OA 3N0VA 1QAJA 2E9ZA 3VAGA 3FEZA 2WB4A 4KHPF 4LF4J 1CULA 5ETLA 2Q66A 4HYKA 2R7VA 1P6TA 2UV8A 4DX7A 4K4UA 2PI4A 1TK5A 1LEOA 5T14A 3PZPA 4P2FA 2WHOA 1O8BA 4LFAJ 5HLFA 4DR6J 1U1NA 1H38A 1N5QA 3KG1A 1VIXA 2ZZNA 2I9SA 3H2UB 1A9NB 3CB4A 4WXOA 3OBIA 2PMHA 2YX7A 4QPTA 3R27A 3W64A 5CYJA 2OPPA 2MKSA 2X51A 4OX7A 3LP1B 2WVDA 2DNKA 3I0RB 1NK4A 1CQNA 1RHKB 3JS9A 4ELTA 1HD1A 1X4BA 4B9MA 2DTJA 1Y9OA 1E6VA 3KK1B 3A1YG 4WZMA 2DJWA 3DLGB 3IA0A 1GK8A 4UUXA 2VQFF 1UA0A 1IQTA 2C2ZB 4NCGA 2I6WA 4U67Q 1K8AT 2E9RX 1XMOJ 2VF3A 1U0SA 3QT7A 3QSYB 4QIGA 5KG5A 2BE7D 4F36A 3GIKA 1XNRF 3AD8C 3NP5A 3ONQA 3S6EA 5HP1B 5CA5A 1RHQB 2AEFA 1YZ6A 4J9QA 8RUCA 2RDJA 3RR8A 2EFGA 1SL1A 4DUYJ 4EBEA 2D3OR 1V3SA 3CCVS 1SIZA 3OFGA 4ZLPA 2QA4G 1FKAF 4K4VA 4Q43A 2XZDB 1IWAA 5SUHA 2CADA 4OHZA 3R1LA 1FERA 2XGPA 5ETSA 4XDDA 2BR0A 1D9DA 1RZMA 3DRRA 2GVDB 2ZFHA 2DT9A 3PG9A 2CG4A 4BWJA 1ULRA 3UNGC 1CJUB 1CSJA 4WXWA 4J9MA 4DSEA 1HD0A 3IXQA 2BABA 4KH1B 3S7RA 2W8LA 2F4VJ 4Q45A 4KPYA 1SC3B 4WFAQ 3E01A 1SVDA 1YRXA 1LXJA 4WP3A 2B3TB 3RB4A 5EUHA 4Y3CA 2F5GA 4YY3F 1WJ9A 4MIWA 4NLYA 2Z0GA 2AIRB 1UP1A 2B4VA 1VI7A 4FNIA 2FC9A 3ILJA 3DRSB 3MM7B 4ANDA 2MY7A 1FXLA 1EP4A 1LQ9A 3F0NA 3CMAS 4FXVA 1TL4A 3VF0B 4HLBA 4K59A 1VYAA 4QYZK 3JQMA 1UETA 1NXIA 4F4XA 4RUCA 2U2FA 4DCOB 4QWAA 7FD1A 1T3OA 2HEKA 1WEZA 5F3ZA 1BLUA 5HMWA 1A6LA 4DR2J 1ZM4A 3IGVA 1HMVB 1VLOA 4P72A 4RPFA 4ZITA 1T03A 1JLQB 4TY9A 4WBFA 2GGPB 5GAGU 2C28A 5D3GB 1LWFA 3BM7A 1FK9B 4ED4A 3H2LA 3EGVA 3RG6A 3JQJA 3SZ2A 3VV2B 5KOWA 4LF7F 2ZITA 2BANB 1JLFA 1Y5IB 2HAFA 1N8RT 3D1HA 2BMBA 4LIRA 4RNMA 3CCMS 1S72S 4LR7A 3A8EA 2H51B 1TU0B 3FFIA 2GQQA 5B0EA 1ELOA 2IDEA 5RUBA 3D6HB 3FEYB 2Z58B 1RI7A 2KI2A 1HNXF 2VD3A 1G7CB 4L3NA 3NNHA 4PQUB 2D3O1 1S1VB 1ZAWA 2E7VA 2Z57B 4RNOA 3HHLC 2R2SA 3CCQS 2P6TA 1FDNA 3ELHA 4XTTA 4EUVA 4JI1J 3A8IA 2LYVA 1C0UB 2ROPA 1S12A 3M2VB 4B3OB 1CEZA 2BM0A 2RIJA 1C1CA 1WUUA 2PFDA 1HMVA 3A8KA 2B0GA 3M7VA 4QW8A 2ATLA 1CC8A 3GZ7A 1WDDA 3D68A 2YNFB 5KFCA 1S77D 3HVWA 4JV5F 2DXFA 4ZKAA 2O1PA 5IT9U 3R2DJ 1T8EA 4TYAA 2PMZD 2Z2LA 3MFHA 2XM3A 1CLFA 1HIYA 1Y11A 5LL6d 1PGZA 4QWDA 4K0KF 3QWUA 1U1OA 3BYPA 2W4PA 2VFVA 1NBEB 4Z37A 4TU9A 5ETOA 3WC0A 2CQ4A 2MGZB 1HHTP 5LM7E 4E0DA 2XMMA 1LWEA 3M8QB 5KG7A 3CD0A 1S6OA 1IVZA 2MLYA 3BB5A 5DZ7A 1XR6A 4PG6A 4DR4J 1FDAA 2M8HA 2DNLA 1RTHB 2VOOA 2ZVSA 3FBCA 2VPXB 3IFEA 4V19J 3Q8SB 4DQSA 5IWAJ 1LWEB 3M8QA 4HHJA 4YY3J 1S1UA 1M0SA 4X84A 2KFNA 4FYDA 4JI7J 2WVFA 4LF6J 4DL7A 4P2MA 3X3UA 4I2PA 5J2NB 4DX6A 4B3TF 2BXJA 4ZP9A 1RTHA 1ZAXA 3RRGA 1V3ZA 1NCLA 1VRUB 4PXCA 1M90T 2X3DA 4NRUA 1QUVA 2GA7A 5T7LA 3ZFVA 4OJ1A 4USHA 4DQIA 1H73A 2RF2B 2KO1A 4NYOA 1HKAA 5DLGA 2RU9A 1YBUA 5CQGA 3MUMP 4DLEA 2XLJA 3CC2S 5K8OA 3C6UB 4EEYA 2BACA 4F3QA 3BQ0A 2RVJA 3A12A 3DLKB 5A6WA 4DG1B 5DETA 3NOCA 3OTOF 4MIAA 3CDBA 1SL2A 4O3OA 5GVQA 1VJWA 4EFAC 2VPZB 2GQCA 2QSWA 2AEJA 2V8VA 4RUHA 2QLJB 3W7BA 1XK8A 4F4ZA 1BGXT 2ZUAA 3CGIA 4GRSA 4UUWA 2VBYA 2RRAA 1IBKF 2GMLA 2OKQA 3IGNA 2UUBJ 4TU8A 1VQNS 5F8LA 2WBRA 1S7IA 4OMFG 1FF2A 4OYXA 1VS3A 2RRBA 3RBXA 4NI2B 3AA8A 5HQ8A 1C1CB 5K20B 3DHWC 1FEHA 4UZCA 3ITHB 4EYHB 4B3RF 2VG7A 2W2QP 3TRGA 5LJ5Y 4C3LA 4N47A 2WSFC 4LRAA 2C3OA 1CS4B 3DGPB 2IA0A 3CSKA 3K5MA 1NSAA 4CWBA 2W9BA 1X0FA 3HHNB 4C9DA 4XAKA 3FBFA 3VAIA 4OI1A 2IJNA 1N0UA 2GIFA 3M6WA 5ETPA 4GVLA 3G6VA 1BQNB 1VRQC 3ENAA 5KFXA 1HLWA 5A8KA 1YJWS 1HWKA 1T11A 3IR7B 1DLOB 3FSYA 1REVB 2G2OA 3MECA 2DGSA 5A8WB 1JLBB 4ED3A 2KFZA 1OSDA 1S49A 2J7UA 2XWXA 4BC7A 1IM6A 2ZOFA 1OJ4A 3MAQA 3J7YI 3ZZRA 1L3SA 1JWWA 3QO9A 3IG1A 4FF1A 2KTQA 4NLQA 2LDYA 2NZCA 3HCXA 5HQLA 1S10A 2YX1A 1XC9A 1KFSA 4F4KA 5FJ4A 2GMJA 2VBZA 3EMTA 2LKZA 3PO5A 1FESA 3MMJA 4NL5A 1IJEB 1KLNA 4IG0A 3QIDA 3WDOA 2DHHA 4ES2A 2AJ2A 2EFOA 2XZWA 1N54B 3HLUA 3SFGA 3UR3C 1NJXA 4W92B 3P49B 3U02A 2CVEA 1RBOB 3LP1A 2BOPA 2QX0A 1URRA 4ILMA 3C66A 3I87A 2KM8B 2V8PA 2X1AA 1UPMB 4ZP8A 1LWCA 3HKWA 4F2SA 4G1PA 3KLFB 1YGYA 3KUGA 2AD9A 4CDIA 1VQ5S 1FRKA 3MOZA 1S1XB 2CQBA 2QA1A 1S57A 3PJXA 4PG8A 2E29A 4I7FA 2EWHA 3BGFA 2FHOB 2R4FA 3MPDA 4LVNP 4Y2IA 1TUGB 5L46A 3PW5A 1JX4A 2FJVA 4IFVB 1REGX 2DNGA 2R8IA 4ZCIA 1QSLA 1U2CA 1DQAA 1EJ7L 3LALA 1IJFB 4PPZA 4ZVHA 1MSWD 4CTAA 3UD3P 4A8MP 2PO4A 1NB2A 4NA2A 4YQWA 1PIEA 1GEHA 3MCMA 4QR0A 3HHLB 2D9PA 2EFPA 1VQLS 2IJRA 1NKBA 3O3LA 3UNYA 2LA6A 1JLEA 3W2VB 5CCLA 2YX4A 3G71S 4JI4J 1MMLA 1YBAA 4RUBA 3OTDA 2UXBJ 3GFYA 3FQLA 1HNIB 1K1QA 1XBWA 3VGSA 4PG5A 2O5DA 2N3LA 2QTWA 2WK4A 1S1XA 2LQ9A 3DLEB 3HHEA 4MAKA 4ECVA 2UUBF 5KFLA 1HNWF 4FP9A 1EB0A 4ZVTB 3OLAA 9RUBA 3EPGA 3A3OB 3KLEB 1FTRA 1M5SA 4J7CA 1NDCA 5J2PB 4A8WA 1R0AA 3HI9A 4IRCA 2HNYA 2LFVA 3M8WA 5SZTA 3VZIA 4NCBA 1KN6A 3C19A 3OFFA 1HNXJ 3GR1A 3SCJE 2HWHA 1FKPA 4Y6IA 2HQ3A 5D8HB 1HI8A 1ZZFA 2PFFB 1X60A 4Q0BB 5LXRA 2M7SA 3OT9A 4ZA1A 1Y5NB 4OHXA 1T9XA 3CPWR 2HGNA 2AJ4A 3LGMA 4NLSA 2W7OA 2Q79A 4J91A 3MD3A 4WF9Q 4TXSA 2PMWA 3T5LA 2UXBF 1Q8BA 4X64J 4Q0BA 3BN4A 2R42A 1MROB 3P45B 4DUZF 4HACB 3UDEA 1X4FA 5I3QA 4DV1F 3ETMA 4HH1A 2QT7A 2M88A 3W8GA 2XMVA 2JJ4D 3ZTOA 2CVIA 1OS5A 2P9CA 2E5LJ 2XG8A 3MHYA 1U1RA 6FD1A 1GMVA 4TY8A 3CIMA 3QJJA 1WKLA 3ETOA 1AA1B 5BYQA 2I0XA 1TMJA 4LSNB 3PJ9A 1YI2S 3C15B 2V4JB 3ISNC 4WKRA 3IBFB 4O4GA 3HSDA 3W2VA 2BUNA 2KG0A 4JI8J 4UTGA 1T9TA 2AZ1A 2KRRA 2BX6A 2QG9B 2VH7A 3VWSA 1DY3A 1Z1ZA 3D1OA 4DOZA 3TZXA 4WZQA 3R8YA 1SCJB 4KFBA 4CO0A 4ZLLA 3KHLA 2ZHBA 3DRPB 4AL7A 3FZ2A 3GPAA 1QVGR 2OPRA 1D3WA 3N6MA 4DJBA 2ASLA 4ILRA 1U09A 2V4RA 4KSEB 4OL8A 2W7AA 1JNZB 2ILYA 2PE8A 4WYWA 4X4RA 4QYRA 1P1LA 1RWUA 2FZGB 2KU7A 2B43A 3C6UA 2DEJA 2GHPA 3ENWA 3GSIA 3KG4A 3BREA 1NH7A 3GWCA 3W1YC 2C2OB 5DJBA 3W5XA 4DPUA 3D7SB 1HFEL 1W2BR 4ZVPB 2UUTA 4PR6A 2DNNA 2W1BA 4OLPA 3P4UB 3CDAA 2W4DA 4USVA 1YBTA 2YWHA 3QAEA 2MZSA 2BQ3A 3P3DA 3H4DA 1PG5B 1UEKA 1NHVA 1R7IA 1UAWA 2PIIA 3OTCA 4PYDA 4DLGA 4DXLA 2XLKA 2XY7A 2NZ4A 2XYPB 2CJ9A 4X62F 2KVQE 3FCHA 5DRKA 4DU7A 1W2IA 1N48A 3CF5Q 3WIUA 3UPFA 4WTYA 5M2RA 4P7VA 3GLJA 1T9WA 1R27B 4MJKA 3VZHA 5KT4A 2DRBA 3J80Y 5F8GA 3I9ZA 3QRPA 2V2QA 4DUYF 2GHVC 3OTOJ 2I1RA 2OMLA 1NSPA 3GB0A 2I8EA 1CULB 3QZ7A 1N5YA 2OELA 2YWEA 2CQHA 4KGVB 1UJ5A 4L76A 3AXKA 1NJYA 1HQEB 2KN4A 3ET6A 5T41A 5EGYA 5FDLB 4YB1P 2VQEF 2WTFA 3LGNA 1XR5A 4PPDA 5C42B 2FVPA 4B3MF 4B9TA 4P7TA 2E66A 4DDFA 3PNIA 4CNYA 3IRWP 4C8OA 1NEEA 2AJ0A 4CLSA 3Q23A 5J1EA 2XY6A 3DU6A 1YJUA 4M5MA 1BHNA 4JI0F 4DG1A 4MFBA 4NZ7A 4S0MA 4RW7A 2QRRA 1FFWB 1UZHA 1KHVA 1X8DA 1YJRA 2QV6A 3P96A 1H6KX 1GXTA 2KT2A 3MR3A 1NSQA 3M1VB 3L95X 3G82A 4RWXA 4ED1A 1MN7A 2JLFA 1DTQA 2YKMB 3ZZUA 5LT5A 1TR0A 5LMUJ 2FHMA 2RSQA 5GMDA 4K4XA 3TAQA 1RYSA 1DQ9A 4GKJF 4OZJA 1VDHA 2QA2A 5KFTA 4JI3F 1Q8IA 4QBUA 4OZ3A 1S5ZA 4B17A 4NLVA 3UWTA 3K58A 1FXDA 1RUSA 1PCAA 1QE1B 4V19X 1SBRA 2D3UA 4DPXA 1DBDA 2HRYA 3I96A 2RU3A 1CJVA 1B4SA 2PD1A 4A8SA 3CJRA 1RWOB 2IBOA 2NYHA 5K14B 2DKOB 2J8AA 4CTAB 2AGPA 2IVYA 2JX2A 2RF2A 4WFXA 2C2KB 3S1TA 4RBTA 3ISZA 5C25B 1CJTA 4IG3A 5B0GA 4RW6B 2OIHA 1XNRJ 1QLNA 2CZ4A 1N56A 1IKXB 1NNDA 4C3MA 4J9UE 3DOKB 3MD1A 4QW9A 2NSBA 3W62A 4C98A 3JTOA 3HDSA 2WOMB 3QZ8A 2DYAA 2L48A 3PRBA 2XMJA 4H4MB 4ICLB 3V6DA 4IG3B 3CULA 1U6BA 2ZBIA 3HF5A 3PVXA 2MB0B 4I67A 3CT9A 1RISA 2CJYB 3SCIE 4UY85 4IH6A 1JJ4A 4XO0A 1VQMS 2Y8WA 1N6QA 2PN6A 5L9NA 1FJCA 1U0HA 3HVTA 4ZPTR 4R0EA 3HVRA 1TL5A 2B5JA 1SQEA 4PAAA 1WI6A 2KT5A 3AB2B 2R9LA 2HKEA 4AQYF 2UU9F 3BBBA 4M5LA 4KFBB 2A2DA 4WE1A 1IR1A 1FNOA 3PYFA 2V94A 4XDCA 5F41A 5GAHI 2XQCA 1FCAA 3M9OB 3PO4A 3RW6A 4FXDA 4X4SA 4M63A 4C0BA 2NPIA 4RNNA 1LK7A 4CO4A 5D4NA 3MM8A 2QO3A 2R7OA 3D66A 3G82B 3MWBA 1U2FA 2D3ZA 2VG7B 2BKOA 4JUZA 1D8YA 3BDPA 3JYTA 4X2BA 1UFKA 3T1AA 4Q44A 3QFWA 4RW7B 5FD1A 1Q5YA 2YNFA 2E1PA 4AD6A 1TKXA 4CH0S 2LXIA 1KS2A 4AXJA 1JQGA 2BANA 4EWTA 4X4PA 4TNOA 2N82B 1IKWB 4FVMA 3C6TA 2G0IA 3SFUA 3ULHA 1HBUA 4HEA9 3RU0A 4PEOA 4NOHA 2ZBPA 1JLAB 4RR5A 2A2CA 5HQMA 3PFEA 2BZ2A 3N6LA 4KGMA 5CH7B 3OPKA 3J7YU 3H90A 2LEBA 1JK9B 2EBGA 2QLWA 3OFEA 3LO3A 3FNNA 2JDJA 3ICLA 3NGUA 4XK8C 3SI8A 3MEEA 4LSNA 3DLEA 1PC5A 4CO5A 1ITPA 2HGLA 4B9VA 4P71A 2CJXB 3SSSA 3N79A 4FPRA 5I4MA 4CNZA 1X4CA 4M1KA 1GAOA 4EGLA 2C42A 3QYYA 4DUTA 5DDRC 3T1YJ 1SKSA 5JXSA 2M0GB 1XNQF 2AZ3A 2OPQB 1VBKA 2J6SA 2RHQB 4OI4A 4R5PB 3TYTA 2F9JA 2V2ZA 1RWPB 4OZ0A 1RCOB 3DLHA 5ETQA 2YY3A 4CI0B 2HVZA 4QIEA 1SKRA 3DLJA 3AFGA 4QPXA 2CZVC 1FXRA 4ECUA 2FLNA 5D4PA 2OH2A 5HP1A 1H98A 2FHJA 2RAQA 4I6WA 4L72B 2HLUA 2XNQA 4IO1A 2Q3PA 4O3NA 1OYDA 4YS2A 1NK6A 2CJQA 4U8YA 3W61A 3IMQJ 1AT1B 1EX8A 3PYDA 5LXYA 2EFNA 2B56A 1RXOB 3H5YA 3N9UC 2UVVA 4CLFA 4QOTA 1JLGB 2KRBA 2J5AA 3GJTB 4KPCA 2MGZA 1IQZA 2OEMA 2PGCA 1EP4B 3MM8B 1IKYA 1Y7PA 2UZAA 4OX9J 1NLKL 4BWMA 1FVQA 3G6XA 2QFIA 3O6QA 2P5VA 3M8YA 2F8MA 4NA1A 1P9QC 2NUHA 1KOHA 2YWFA 3D9BA 2FLOA 2F8HA 5F8IA 2PT0A 1HWIA 2P8IA 1AUSL 1SV5A 4WKYA 3RW7A 4DWIA 3R3TA 4MIBA 2AJFE 4NLDA 2ALZA 2Q1LA 2W4CA 2K1RB 4OYWA 3W8PA 3RYLA 5HMYA 2DR9A 3QNWB 1S6PA 2CA9A 4O4GB 3DC2A 1ZETA 2XS5A 3K0JA 4ED5A 1VHFA 4UQGA 1OY8A 1S1TA 1X4HA 1KD1T 2M5YA 3NNAA 2HVIA 1Q16B 2IRYA 1RWKB 3CCWA 2Q43A 5CABA 1FNXH 2FVQA 2QLXA 4LF5J 3PJWA 4LF7J 1HYSB 3KJVA 5D0HA 2P6SA 1EETA 4H54A 4B3MJ 3DYAB 3OUYA 3MURP 3UCZP 1CJKB 5GAEI 1IKXA 4ZHRA 2YXLA 2MTLA 3CD5A 2OTJS 4DQQA 3GFHA 4MKVA 2MKKA 1EIYB 4B3TJ 1S6UA 5E33A 4DCJB 2E5LF 2CQPA 4ZVOB 2KYZA 2QMWA 3M9NB 2R8GA 1RWXB 3FDSA 3GV7B 1FWKA 4C7QA 4UF4A 2FVRA 3DU5A 1RAOA 2B4UA
chains in the Genus database with same CATH topology
3IBFB 1BMQB 2QL9B 2XYGB 1RWMB 3R6GB 5IC6B 3RJMB 1RWVB 1F9EB 1RHJB 1I51B 2H5JB 3R7BB 2H51B 1RHRB 4ZVSB 3KJNB 2C2OB 3D6HB 4ZVPB 3P4UB 3KJFB 3EDRB 2CNLB 2HBQB 2Y1LB 3IBCB 2H5IB 1RHMB 2H65B 4ZVUB 2XYPB 2CNNB 2XYHB 3GJSB 2H4WB 4DCOB 2QL5B 4ZVRB 4LSZB 2CJXB 1I3OB 3NS7B 1IBCB 3R7SB 1RWPB 1NMEB 2QL7B 1RHKB 3R7NB 2Y0BB 2QLFB 2FQQB 3GJRB 2C2ZB 3EDQB 2XZTB 1GFWB 1RWWB 2HBYB 1QDUB 3R6LB 1ICEB 3GJTB 4ZVTB 1RHUB 1PYOB 1RHQB 1RE1B 2H4YB 3R5JB 1RWNB 2CNKB 2CDRB 2HBZB 2XZDB 3D6MB 2C2MB 5IC4B 3QNWB 1RWOB 1SC1B 2DKOB 4JB8B 1SC3B 3GJQB 1SC4B 1RWKB 2C2KB 3P45B 2QLJB 3SIPB 2QLBB 2HBRB 1QTNB 2P2CB 2H54B 4ZVQB 5K20B 4DCJB 2C1EB 4ZVOB 4DCPB 1RWXB 2CJYB 1PAUB 3KJQB 2H48B 2CNOB 3D6FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IBF B;  1BMQ B;  2QL9 B;  2XYG B;  1RWM B;  3R6G B;  5IC6 B;  3RJM B;  1RWV B;  1F9E B;  1RHJ B;  1I51 B;  2H5J B;  3R7B B;  2H51 B;  1RHR B;  4ZVS B;  3KJN B;  2C2O B;  3D6H B;  4ZVP B;  3P4U B;  3KJF B;  3EDR B;  2CNL B;  2HBQ B;  2Y1L B;  3IBC B;  2H5I B;  1RHM B;  2H65 B;  4ZVU B;  2XYP B;  2CNN B;  2XYH B;  3GJS B;  2H4W B;  4DCO B;  2QL5 B;  4ZVR B;  4LSZ B;  2CJX B;  1I3O B;  3NS7 B;  1IBC B;  3R7S B;  1RWP B;  1NME B;  2QL7 B;  1RHK B;  3R7N B;  2Y0B B;  2QLF B;  2FQQ B;  3GJR B;  2C2Z B;  3EDQ B;  2XZT B;  1GFW B;  1RWW B;  2HBY B;  1QDU B;  3R6L B;  1ICE B;  3GJT B;  4ZVT B;  1RHU B;  1PYO B;  1RHQ B;  1RE1 B;  2H4Y B;  3R5J B;  1RWN B;  2CNK B;  2CDR B;  2HBZ B;  2XZD B;  3D6M B;  2C2M B;  5IC4 B;  3QNW B;  1RWO B;  1SC1 B;  2DKO B;  4JB8 B;  1SC3 B;  3GJQ B;  1SC4 B;  1RWK B;  2C2K B;  3P45 B;  2QLJ B;  3SIP B;  2QLB B;  2HBR B;  1QTN B;  2P2C B;  2H54 B;  4ZVQ B;  5K20 B;  4DCJ B;  2C1E B;  4ZVO B;  4DCP B;  1RWX B;  2CJY B;  1PAU B;  3KJQ B;  2H48 B;  2CNO B;  3D6F B; 
#chains in the Genus database with same CATH topology
 1N5V A;  3IC1 A;  1VC6 A;  5DZ6 A;  4DV2 F;  4Q8F A;  3MOJ B;  3I5C A;  4LRF A;  4Y2M A;  3R5C A;  3QO9 B;  2ZJP Q;  3VAF A;  2BW2 A;  3C16 B;  3MCN A;  4QIF A;  2FPH X;  2LMI A;  2MLZ A;  1SUQ B;  3DRY A;  4N77 A;  1TL3 B;  3A3N B;  3BR9 A;  2FUG 9;  1S1W A;  4M5N A;  4M95 A;  4WP8 A;  2OGU A;  3ZZT A;  3Q8V A;  1LXN A;  2VHG A;  5J2Q B;  1WTB A;  3BQ1 A;  3NBP B;  1OY9 A;  5K8N A;  2FZK B;  2JVO A;  5A0Y B;  1KLM A;  4QR2 A;  3R7B B;  5KAK A;  9ATC B;  3KNA A;  4DI6 A;  1APS A;  4DPW A;  4YDX A;  3CMQ A;  4CLP A;  5J2M B;  2GAG C;  2CFX A;  2LLZ A;  1RT1 A;  4O23 A;  3SV4 A;  4KV8 A;  4RW9 A;  4DF8 A;  2HQC A;  4WK1 A;  2BJ3 A;  2HIY A;  3GV5 B;  3OUY B;  1X5T A;  1UCN A;  2HK2 A;  1ZTT A;  1VK3 A;  3D2W A;  3TJ9 A;  1JXL A;  2IY5 B;  1SV5 B;  4UT4 A;  2W24 A;  1VCT A;  4CRJ A;  1I94 J;  4LF9 F;  4DEZ A;  2R7S A;  2WSE C;  1MU2 B;  2J6T A;  3CDW A;  3IS9 B;  1J2V A;  3MCS A;  2VOD A;  2CQ3 A;  3NY0 A;  4HTI A;  4I68 A;  3MGJ A;  3PHE A;  1JLA A;  4IQM A;  1RHM B;  5BXI A;  3F73 A;  1SUQ A;  2JEI A;  2JOQ A;  1JMT A;  4FF2 A;  1B7F A;  4WWS A;  4PRF A;  5KFS A;  4PG7 A;  4DPY A;  2Y1J A;  1S9E A;  1B0P A;  1YLX A;  2D9O A;  4UOC A;  3Q8R B;  3BQ2 A;  4DV7 F;  4ECS A;  1UVJ A;  3AT1 B;  4W98 A;  3EGN A;  4ELU A;  1D09 B;  4M5D A;  3NS7 B;  3OVA A;  3KLF A;  4NLP A;  3HO1 A;  2EC0 A;  2HUR A;  3ITH A;  5E41 A;  5E5N A;  1GXU A;  3FUY A;  4WU2 A;  3SBM A;  2OFH X;  1HA1 A;  3G2X A;  1VRT B;  1D1U A;  4J90 A;  4KR0 B;  1RJJ A;  2F7V A;  3DYA A;  4DV6 F;  3QT8 A;  5LMN J;  2IIH A;  3R7N B;  3FEX B;  3A4T A;  2OEK A;  4JI8 F;  3M32 A;  1B0T A;  2NXU A;  5IM0 A;  1RT6 B;  2JSX A;  2YPY A;  1Q78 A;  1MN9 A;  3GSD A;  4EI2 A;  3GJR B;  1DAX A;  3IBW A;  3TP2 A;  3MM5 B;  2UVW A;  2GIQ A;  3W5Z A;  3S8S A;  1RAF B;  1R6V A;  1UMJ A;  3GG0 A;  3MEG B;  3GP9 A;  3NGD A;  2LEC A;  3DDN A;  4KC5 A;  3BGU A;  4N7T A;  2KH9 A;  3R6L B;  3S01 A;  2ADB A;  5J2Q A;  4LQ3 A;  3NLC A;  1YSJ A;  1BWE A;  3MEK A;  4DL6 A;  1HNZ F;  2FHJ D;  2HZV A;  2XS7 A;  1CBK A;  4F02 A;  3K59 A;  1RT3 A;  2FJW A;  1IKV A;  3LAM A;  4HI2 A;  1VQP S;  1FJ7 A;  1S9G B;  1GMU A;  3W9I A;  4KHP J;  3QGI A;  2OEJ A;  3DMJ A;  2DHA A;  2Q6C A;  3HSJ A;  4J9K A;  1GT8 A;  2CJB A;  2X1B A;  4M5D B;  2WOM A;  3PW0 A;  1KTV A;  4GKK F;  3BV8 A;  5H9F K;  2GJI A;  4HAC A;  3DFE A;  4YUD A;  4ED7 A;  3WX8 A;  2BEF A;  1S6Q B;  2HFV A;  2JC1 A;  2MZR A;  3M4X A;  4ZCK A;  1KQK A;  3EGW B;  5E3P A;  5IV3 A;  4F50 A;  4LSL B;  2ATC B;  2ZD1 A;  3TUJ C;  5A8K B;  5DDO C;  1M5O C;  2AYB A;  4KJI A;  2Z2Y B;  4PAB A;  2OO4 A;  1RAH B;  3Q0A A;  3BGO P;  1F5B A;  3QAU A;  2GFF A;  4DFJ A;  1H3D A;  2DVI A;  4F8R A;  1NHK L;  1EHW A;  2GX8 A;  2HWT A;  1WD6 A;  3NGS A;  3PRV A;  2HQG A;  3HX9 A;  4F7V A;  2J0S D;  3PHT A;  1QE1 A;  1PJ5 A;  2DH8 A;  2EFQ A;  2KJV A;  5K5M A;  4D3G A;  1EKS A;  2ZKT A;  3EM1 A;  2BJ7 A;  1NDP A;  4P74 A;  1YQH A;  1UTA A;  3TEG A;  2YNG B;  2LQJ A;  5HVF A;  1FKO A;  2VDI A;  3I9V 9;  3RAQ A;  4J9S A;  3LOU A;  4URG A;  1L5U A;  2ALY B;  3KHR A;  4NLR A;  1VBY A;  5BR8 F;  5EX3 A;  3HHK A;  2N3O A;  2MHE A;  2YKQ A;  3MMC B;  4ID5 B;  2Y0S D;  4ANE A;  2W2M P;  4IOB A;  3CTR A;  1BC6 A;  1UW9 A;  4JI7 F;  4LF6 F;  2CNO B;  4KRW A;  4IR9 A;  1KOO A;  4DU8 A;  5KFP A;  2XCA A;  4CZC A;  2VON A;  1XIQ A;  2MZT A;  2XSJ A;  1UA1 A;  5DGA A;  3LA0 A;  5HVG A;  2JEF A;  2HK3 A;  4U8V A;  3NXZ A;  3OR1 B;  2HQI A;  1NH8 A;  2CYY A;  1F0X A;  3MMA A;  1SH2 A;  5D3G A;  4L74 A;  2EK1 A;  2D74 B;  1WKJ A;  5C24 B;  2VFT A;  1CQM A;  2XSJ B;  1U0H B;  2OUG A;  3OR2 B;  3TUI C;  3AHP A;  2RE1 A;  1U8W A;  4EK2 A;  3EZ5 A;  4A8Q A;  2ZNZ A;  4OI2 A;  1B99 A;  1V5V A;  4UQT A;  2NLW A;  3PW4 A;  1RKJ A;  4DR4 F;  1X5O A;  3OL7 A;  2L3M A;  2B7B B;  2VQE J;  4HDH A;  2FVS A;  5F8H A;  3HK2 A;  3DRR B;  2YQ0 A;  4UOH A;  3Q2T C;  1J5E F;  1HYS A;  4YHH F;  3I6P A;  4JOU A;  4OZN A;  2C3M A;  2CNL B;  3LPY A;  1RAG B;  1DZ5 A;  1PSD A;  2D69 A;  4MMO A;  1FRJ A;  1PC4 A;  3OD2 A;  3HD2 A;  2B7C B;  4DMZ A;  2F65 A;  4ZOS A;  4P52 A;  2CNN B;  1U1Q A;  4Z7Y A;  2MXY A;  4FF3 A;  4JV0 A;  2FTR A;  4I4B A;  2UV8 G;  5MLC V;  4OHV A;  4PCQ A;  1D9F A;  3CCJ S;  2VFR A;  1TAU A;  1RB0 A;  3IRX B;  1HW9 A;  2L9D A;  4KGX B;  4I6Y A;  4U7C A;  4EZ6 A;  1I3O B;  3LW5 C;  4OI3 A;  1TUV A;  2NPF A;  2CDQ A;  3OQ2 A;  3THT A;  3KLH B;  4NZ6 A;  5J1E B;  3D6T B;  1HQ2 A;  3VQT A;  2C3Y A;  4MT1 A;  1EKR A;  2V69 A;  3BBF A;  5U47 A;  1RQ0 A;  5A8R B;  3KHG A;  1WI8 A;  1YJ9 S;  4RNH A;  1NME B;  3IM9 A;  2N4D A;  3H7H B;  3M30 B;  3G8S A;  4DR7 F;  4K4W A;  3THP A;  2DNY A;  2H1Y A;  3R9L A;  4OV1 A;  2F4V F;  1RT4 B;  4Y2K A;  3W2W A;  1SJF A;  2RQK A;  3D0H E;  1Z4U A;  2VIH A;  2H3E B;  3VTI A;  4JV2 A;  2CQ1 A;  1WOP A;  2LXU A;  3I5B A;  3MPY A;  2JZ5 A;  2HQD A;  4TU7 A;  4QWC A;  3PW2 A;  5LSR A;  3MEG A;  4PQU A;  5DQH A;  4QIV A;  1JB0 C;  1FA0 A;  5C2G A;  3BO4 A;  2Q6B A;  4JI1 F;  3FJ2 A;  4AXI A;  3D4J A;  2J9D A;  2MKC A;  4X4T A;  3FFI B;  2GJF A;  3GYX B;  3FGV A;  2MLX A;  2VZ9 A;  4FVC A;  1FD2 A;  3TOQ A;  3GMG A;  3BO3 A;  4WFB Q;  1VIS A;  4KY3 A;  4A4J A;  5KFO A;  2F3J A;  5EDW A;  4DL4 A;  2A6O A;  1GX5 A;  4ZIW A;  5HMZ A;  2R7T A;  4P2S A;  5KFZ A;  4U7U K;  3KWM A;  2FDN A;  3AB4 B;  3JTP A;  1M1G A;  5KG1 A;  1FD8 A;  2ZVI A;  3D1Q A;  1Y3J A;  4X4Q A;  1UWB A;  2CRL A;  3OFH A;  4QR1 A;  3T6B A;  3WHI A;  2GMH A;  5EWG A;  3KK3 B;  2HIQ A;  4WCE Q;  2EFV A;  3CJ4 A;  3NCR A;  3WIV A;  1BQX A;  3U27 A;  2ZBQ A;  3NEK A;  1NHU A;  2VDH A;  3NS6 A;  4WTO B;  2W9A A;  2I2Y A;  1FRH A;  2MY8 A;  4ZPW R;  3EXY A;  2OJ3 A;  1AFI A;  5B0F A;  4R8U A;  1U7L A;  1B70 B;  3JSY A;  4JI4 F;  5D0G A;  2XBP A;  1FKO B;  5AE2 A;  2DO0 A;  3ZZ0 A;  2AT1 B;  2ZKU A;  2CXE A;  1CPZ A;  3DKD A;  3UCG A;  2ZEJ A;  1NRK A;  2QFJ A;  1TKT B;  4P73 A;  4A8Y A;  2ZZT A;  1VQK S;  5IZH A;  2JEG A;  4YOE A;  4E2F B;  2ZDO A;  3MM5 A;  4RW9 B;  1YDL A;  3LP2 A;  3KHH A;  2W9C A;  4CLY A;  2XMW A;  4K2X A;  2LP4 A;  4ID8 A;  2HHU A;  2EC2 A;  1RT4 A;  1RTZ A;  1SIW B;  2HZC A;  3AJD A;  3BGR A;  3MAA A;  3PEJ A;  1RSC A;  1OMS A;  5KG3 A;  2IDL A;  4RWW A;  2XYG B;  3PW7 A;  4NLU A;  1VOM A;  3CUN A;  1J5O B;  1HBM B;  3E2E A;  2YKN A;  5K9F A;  3FCW A;  4HH0 A;  1RWM B;  1PYS B;  1W25 A;  2QYC A;  3KUE A;  3R6G B;  5IC6 B;  4DBQ A;  5BYS A;  3GCW P;  1U6F A;  4DS5 A;  2KZZ A;  1VJQ A;  4GVB B;  4PZV A;  4DV4 F;  1X9M A;  4JI6 F;  1FWL A;  4LSL A;  1UVM A;  3KJN B;  5DS7 A;  1N32 F;  3MPV A;  4F26 A;  2GO8 A;  1AYE A;  4B9S A;  2P9G A;  1N36 J;  4MKY A;  5KFF A;  1CVJ A;  2ZH6 A;  3UVJ A;  1HWL A;  4YEA A;  2BDP A;  3O2I A;  3IAS 9;  3PRD A;  3W9J A;  3HHD A;  2IMO A;  4K2J A;  3MM6 A;  3LP2 B;  4K4T A;  1LV5 A;  3HHL D;  4J5O A;  2ASJ A;  4ZVG A;  3CJ2 A;  4YFU A;  3B54 A;  5IQ6 A;  4ECT A;  3AOC A;  3KK3 A;  1R8H A;  3IBC B;  4E8U A;  2OLW A;  2OPQ A;  2JRS A;  4LRD A;  3TUP A;  3M2U A;  5KG4 A;  4DX8 H;  6FDR A;  3OVS A;  2G4B A;  4C4W A;  4TLR A;  4C0O C;  2KT3 A;  3EX7 B;  4EBD A;  3AOA A;  4KAI A;  2BKP A;  1LOU A;  4U95 A;  4MH8 A;  4LSZ B;  2YNI B;  4CLW A;  5B7W A;  5JVG Q;  1L3V A;  4I2Q A;  1QTM A;  1TFW A;  1F1B B;  3KTQ A;  3KMS A;  2VKR A;  3AAW B;  2IA6 A;  3FVY A;  5KT6 A;  3H40 A;  4F25 A;  5A76 A;  5A8W A;  2KJW A;  5E3Q A;  3LAN A;  3Q83 A;  3W3S A;  3R7S B;  3PIO Q;  4LFB J;  3RGI A;  4L3K A;  5J1N A;  4MKB A;  3ZTP A;  4ECY A;  4DV1 J;  1DTT B;  1PYT A;  1C1B A;  3CCT A;  5B0C A;  3HT3 A;  1RU1 A;  2XMT A;  4OYO A;  4FXW A;  5KFV A;  1E6Y A;  4DS4 A;  3T1H J;  3TJA A;  1TZ0 A;  5L1K A;  3CD6 S;  2WW8 A;  3EDQ B;  3TNV A;  3PTW A;  4ES3 A;  1TKZ B;  2GAH C;  2MMY A;  2R7W A;  1RWW B;  4K7Q A;  1R3N A;  3LWL A;  4ZPD A;  1QDU B;  4DF4 A;  4QCL A;  3EE3 A;  3DNC A;  1U1M A;  4ECZ A;  4ZVF A;  1E6Y B;  3VR1 A;  4WP9 A;  2NXE A;  1HBO A;  2R7Q A;  2XGQ A;  1N33 J;  1KWM A;  4LBH A;  5IQQ A;  3JB9 k;  2L9N A;  3ADA C;  1QSS A;  1VLY A;  3RB0 A;  3Q24 A;  4QYZ J;  2HBZ B;  1B0V A;  3BSA A;  2NSC A;  2PDA A;  1RTI B;  1FE0 A;  4U96 A;  1WAC A;  4XPE A;  3FQK A;  3H98 A;  4ZPB A;  2C2D A;  4DV2 J;  4OYP A;  3PV8 A;  4GMK A;  2GIR A;  2V50 A;  2MKI A;  4DR2 F;  2CAJ A;  1IKY B;  2CPF A;  2CIM A;  5IC4 B;  2LQB A;  4CO2 A;  3SYZ A;  3V81 B;  3BBC A;  1MLA A;  1Q1K A;  2A18 A;  1RTD A;  2BV3 A;  3CC4 S;  1VFJ A;  3CO0 P;  4L73 A;  4O3R A;  1SC4 B;  2MQL A;  1N34 F;  3M2U B;  3OLB A;  3P5T L;  3H42 A;  2BQU A;  2E44 A;  3CW2 C;  2DPJ A;  4F3M A;  4ANC A;  2NXN A;  2RB7 A;  5KFY A;  1G6B A;  5JMN A;  2HHH J;  2C2R A;  3FZB A;  4ATN A;  2RKI B;  1D9A A;  1Q4R A;  3GQC A;  3KDN A;  2NCK L;  2IC3 A;  4Y28 C;  2IM2 A;  3N28 A;  2DIU A;  3QLH B;  3US5 A;  2VIC A;  4B9L A;  4Q8E A;  2G2Z A;  1H72 C;  5DGB A;  5CYM A;  2M70 A;  1MMN A;  2JFD A;  1CC7 A;  1QD1 A;  4BS2 A;  3FMW A;  1K73 T;  4LF1 A;  3W63 A;  4IH7 A;  1QY7 A;  3ZO7 A;  4Q2L A;  4DSF A;  5KFQ A;  2POK A;  1FNM A;  1S48 A;  1RTI A;  4NXN F;  1CJV B;  3DXB A;  2V67 A;  2IC3 B;  1T94 A;  4RLE A;  1R43 A;  1WG1 A;  2M52 A;  3CO9 A;  4DPO A;  3G6Y A;  4NXM F;  1Y10 A;  3TI0 A;  2JNJ A;  2XMK A;  4OYI A;  3HXM A;  1H74 A;  4LF8 F;  2HHQ A;  4PG4 A;  3UD5 A;  4O3P A;  3V2U C;  2EG2 A;  3UQS A;  3KK2 B;  2B8P A;  2MJU A;  4NLX A;  4DZD A;  3HZG A;  3RJM B;  3HP6 A;  1RWV B;  3TAP A;  4LF5 F;  1F9E B;  2MQO A;  4LBI A;  4PYA A;  4DSJ A;  1RT2 A;  4KKO B;  5KFA A;  4A8K A;  2WAQ D;  5E3R A;  1KSP A;  4FDF A;  2CZ9 A;  4KIA A;  4LJM A;  3OR1 A;  4ALZ A;  3VAM A;  2P9E A;  2CKW A;  3ZTS A;  3PX4 A;  5LJ3 Y;  1AW0 A;  1UWB B;  2ZH5 A;  2MKJ A;  2AMC B;  4I0W A;  5ETV A;  3KLG B;  2RJZ A;  2LVW A;  3W9H A;  3KLV A;  2W01 A;  2BJE A;  4F0M A;  1S99 A;  3LH2 S;  3I82 A;  1R89 A;  3AQO A;  3AY0 A;  3VAJ A;  4OLO A;  1P8G A;  4UOG A;  3AOD A;  2MDA A;  3CJ3 A;  4P75 A;  3UW1 A;  4A47 A;  2QE5 A;  1GTE A;  2CQC A;  1GTH A;  2LQ8 A;  5DO2 A;  3TX8 A;  4OX6 A;  5DQI A;  1NK5 A;  2LCW A;  2LEP A;  1VHI A;  2MEW A;  3DN9 A;  4J9O A;  1OPI A;  1HQU B;  2DHG A;  2NXC A;  2XYH B;  4MK7 A;  2VKZ G;  4ZVE A;  5AJ3 J;  4ZVR B;  2VJU A;  2W9C B;  2DR8 A;  3BJY A;  1EQ0 A;  3VVU A;  2VA3 A;  3MDF A;  2OAU A;  3JTN A;  1FRL A;  4Y2C A;  2EVZ A;  2F4F A;  3DLL Q;  1HQU A;  2I38 A;  1VBZ A;  2RH3 A;  2Z56 B;  4C8K A;  2AQ4 A;  2KB2 A;  1IBC B;  3HFK A;  4Y34 A;  2XI2 A;  3SXL A;  3OXL A;  2EKN A;  3I4H X;  5G0R A;  4Y0F A;  2QL7 B;  1HW8 A;  1C0T B;  3GFZ A;  4GO7 X;  1MG7 A;  2YWW A;  1RT7 B;  1UJ4 A;  2V8G A;  2XTJ P;  1S1T B;  1OO0 B;  3G96 A;  1N36 F;  3CJK B;  3K17 A;  1FRM A;  1GMW A;  4CLL A;  3K57 A;  2PI5 A;  4DR1 F;  1YX2 A;  2E1M C;  3AD7 C;  2G1H A;  4DUZ J;  2C22 A;  3R5A A;  1KEK A;  3DI6 A;  4DFP A;  2WBM A;  3E01 B;  3IRX A;  3B8H A;  4LRE A;  2OPS B;  4WU3 A;  1UEV A;  4ZLN A;  3TUZ C;  1PBU A;  1YJT A;  2BE2 A;  3M8P A;  3NAI A;  4IH5 A;  5HBM A;  2GO9 A;  3DXS X;  3W2W B;  3W66 A;  4ZCM A;  4EYI B;  3HZE A;  1FX2 A;  5KFW A;  5DG7 A;  4HDG A;  2UVU A;  3PEH A;  3QIP A;  5KTQ A;  3BYR A;  1K44 A;  3AXM A;  3OL8 A;  3QMQ A;  4USW A;  4I69 A;  4DV0 F;  3V4I B;  2A0F B;  3R5D A;  2MZQ A;  3SSR A;  1VQ9 S;  3ZZY A;  4DR6 F;  2XMU A;  4C6A A;  1GH8 A;  4IO9 Q;  5L39 A;  4USM A;  5HSP A;  2DIV A;  3ZNU A;  3V81 A;  4XIU A;  2QGF B;  3ILO A;  5B0A A;  8ATC B;  2GC8 A;  1O6X A;  4LF8 J;  2V8D A;  3RAM A;  1LW0 B;  4LRC A;  4FBU A;  3POT B;  3T41 A;  2IYG A;  4ZLJ A;  2HMI A;  2RS8 A;  5C7P A;  4C8Z A;  2NQP A;  4J9N A;  2YKN B;  2R7R A;  3DM2 B;  4NRT A;  3NOG A;  1QTN B;  2K7J A;  4IFV A;  4NZ0 A;  3RR7 A;  3MM9 A;  3M6X A;  4KO0 B;  1HBU B;  1FJE B;  2KVI A;  4USK A;  2MQQ A;  2BE2 B;  3DOK A;  5C42 A;  1BQM B;  4C97 A;  2VV5 A;  5IOL A;  4F4W A;  2A6M A;  4MFB B;  5KG0 A;  3TVY A;  1N5Y B;  1S79 A;  2AU0 A;  4LRB A;  1YIT S;  2UXC F;  1IR0 A;  3PX0 A;  2BW7 A;  1R6Y A;  4G1Q B;  5CXT A;  1SB6 A;  2WRM A;  2IAJ B;  5HMX A;  2LA4 A;  4UZB A;  3H59 A;  2DGU A;  2QL9 B;  2VAS A;  1Z2Z A;  4TYB A;  3VVT A;  1FRI A;  5HJX A;  5KOX A;  1JJ2 R;  2ZJR Q;  5IS2 A;  1QSY A;  3D5M A;  3O8W A;  4ZDN A;  5DLF A;  1C0U A;  3CWJ A;  3ZZP A;  4EBC A;  3M2R A;  2Z2Z A;  4WE1 B;  2AYE A;  2LDI A;  3VHQ A;  2MQP A;  4R5P A;  4LBP A;  2L41 A;  1K0V A;  1RP5 A;  1Q7L B;  4H4O A;  3KLE A;  1NKC A;  4OZ2 A;  2K8G A;  2NR0 A;  3IR6 B;  3M1V A;  2UVR A;  2VG5 A;  1X5P A;  1KTQ A;  2ZDP A;  4P9S A;  1X9S A;  1WOS A;  1H2U X;  1U47 A;  3U1N A;  5CHC B;  4K5R A;  3KLG A;  1RTJ A;  4KT0 C;  5JVH Q;  3BEG B;  4H4O B;  4IRD A;  1NJW A;  1A7G E;  2E7X A;  5D4O A;  1FRX A;  1DUR A;  3KLI A;  4RX6 A;  5HK4 A;  2HPU A;  3W5Y A;  2DGQ A;  4M5H A;  1DTT A;  3ILI A;  2DY9 A;  4F3O A;  2MST A;  6AT1 B;  2GGP A;  2MSS A;  1TTH B;  1N88 A;  3KFW X;  2DNQ A;  1HWJ A;  1M5H A;  4ZVU B;  4PWU A;  4IRK A;  4RO0 A;  4J9L A;  1UZD A;  1NDK A;  4ZN1 A;  5EWF A;  3RB6 A;  1WKK A;  2HHV A;  2IMW P;  4GC7 A;  3VQS A;  2YKA A;  5F9L A;  3Q86 A;  2GJ2 A;  5GAD U;  3QGP A;  1WHY A;  1L3T A;  1G3O A;  5KFK A;  2EPI A;  1WC6 A;  2O3D A;  2AX1 A;  3L7P A;  2G0C A;  3ENV A;  3SCK E;  3ZZO A;  3UD4 P;  4PKD B;  1F2H A;  2XC9 A;  1U1P A;  2AYM A;  1BXN A;  5H9E K;  1HR0 F;  1XR7 A;  2KXN B;  2R8K A;  1SKU B;  4Q5V A;  3NCP A;  4GKK J;  4TY8 B;  2JL9 A;  2XY5 A;  1SXL A;  4O0N A;  1C2P A;  2ZOG A;  2ABY A;  4Z7C A;  3MM9 B;  1WC1 A;  2KHD A;  2HFU A;  2MKH A;  3LP0 A;  4FZV A;  3GR0 A;  3SQG B;  4DZ6 A;  1ZBT A;  1XWL A;  2QYG A;  3FRY A;  5J2P A;  2KHC A;  5AT1 B;  4QU6 A;  2HVH A;  4JV1 A;  1ZPW X;  2ROG A;  5KFU A;  4HKQ A;  3GCX P;  2GVZ A;  3KXD A;  3PAC A;  2IM1 A;  1OQ3 A;  5CD4 A;  1V3R A;  2HWI A;  1TAQ A;  4B3R J;  4NX9 A;  3I0S A;  1S9E B;  2ROE A;  3BDE A;  3MPU B;  1NK0 A;  1FDB A;  1XTZ A;  1QM9 A;  3G8Q A;  2E5J A;  1VC5 A;  2HHP A;  2OD4 A;  1S6Q A;  4NYZ A;  1JLE B;  1E6V B;  2FGC A;  3OR2 A;  4WYL A;  4H4K A;  1RAI B;  2FJA B;  5JUM A;  5FLX Y;  3CJ0 A;  3NAH A;  4YB5 A;  1OYE A;  3C14 B;  4F0H A;  3A3P B;  1JKH B;  2DHS A;  1WC5 A;  4LF2 A;  5KFD A;  1SJ1 A;  2J8S A;  1QVF R;  1ROF A;  4F04 B;  2CPE A;  3RZA A;  2W25 A;  4R25 A;  1XMB A;  3EUN A;  4KHR A;  4ZP6 A;  2BA9 A;  1Q7Y T;  1K47 A;  1SJR A;  1SQF A;  4AFF A;  4KV8 B;  4RW8 A;  5BYR A;  5E0O A;  1EAR A;  7AT1 B;  3VAL A;  1QAX A;  3OTE A;  2VQF J;  2M2B A;  4JB8 B;  3BN7 A;  3GJQ B;  2JVR A;  3IAM 9;  2F8E X;  1P1T A;  3AQP A;  4LR8 A;  2NRE A;  2HBR B;  2K7K A;  5KG2 A;  4CO1 A;  3EVO A;  4N76 A;  2UXD F;  3NCQ A;  3F56 A;  5G0R B;  1URN A;  4F67 A;  2EK6 A;  5AXM A;  3KYL A;  2VFS A;  2OSQ A;  5F3T A;  2DGW A;  3U1M A;  3OSP A;  2C2E A;  4P2X A;  3M2V A;  2JLG A;  4B3O A;  2DNO A;  4OYZ A;  4WK3 A;  1WHW A;  1N5T A;  3UI3 A;  1N52 B;  3MI7 X;  1RA6 A;  2JFK A;  1HNW J;  2E1C A;  2CQG A;  3MUT P;  2H5J B;  2X7I A;  4CT9 A;  4FBT A;  1KKH A;  2CQ0 A;  2IJF A;  2CPZ A;  2EXU A;  2OFG X;  5CYM B;  3CCS S;  4QWB A;  2B6A B;  2W2P P;  1S0M A;  4M5K A;  5F0U A;  1YTY A;  1SQG A;  1U2R A;  3TR5 A;  3PM9 A;  4FS2 A;  1H2T Z;  2RML A;  2LXF A;  4U9R A;  5HL7 Q;  1DHM A;  1F9H A;  1Q5V A;  1TV6 A;  4K8R A;  5LMN F;  1UVI A;  3TVK A;  3PKY A;  2A10 A;  1PIL A;  2QMU B;  4M5G A;  5FII A;  2HHX A;  2VJV A;  1KC8 T;  3NRB A;  1RT1 B;  2HFO A;  1HI1 A;  3LF0 A;  5CCM A;  1S6P B;  3MR6 A;  4YR3 A;  4WJB A;  2AV5 A;  3GYG A;  4USU A;  5CAA A;  2BQR A;  1TL1 A;  4X4N A;  1HL6 A;  5IWA F;  1RLC L;  3CCU S;  1O0P A;  3DM2 A;  3VAK A;  1S9G A;  3J7A N;  2XWY A;  3TAM A;  4FF4 A;  4M94 A;  2VBW A;  4HT5 A;  4W4M A;  1HNZ J;  1VQ6 S;  3M8R A;  4GO5 X;  1WC0 A;  1JIH A;  2CPJ A;  2V9K A;  2Z4P A;  4LR9 A;  2V34 A;  4PXB A;  2H5I B;  5J1P A;  3T5J A;  3TAN A;  5DM7 Q;  3FC9 A;  3PFO A;  5E3C A;  5KFH A;  5EWE A;  4AQY J;  1IBM J;  1X4E A;  2UU9 J;  3RRH A;  2XNR A;  4DV0 J;  1I1G A;  1LFW A;  3HD1 A;  5HVH A;  2KKH A;  3MM6 B;  1T9Y A;  4X4V A;  1U25 A;  2PA3 A;  3Q8Y A;  4TN2 A;  1H0H B;  5KT3 A;  3TZW A;  4NCA A;  4NE9 C;  2MPU A;  2O01 C;  1F5C A;  3GFX A;  4B9U A;  1LW2 A;  5FLX U;  2Z2M A;  1FO1 A;  4RU9 A;  2AEM A;  4TLQ A;  5ETT A;  1VR6 A;  4P6Q A;  3C8Y A;  3OHB A;  4U7U D;  2ZM6 J;  3H2V E;  4WIQ A;  2FYX A;  4RW4 A;  3K5L A;  1N32 J;  2W2O P;  3RBE A;  2HVD A;  1FEE A;  5A6P A;  2DK2 A;  3QJL A;  2EG1 A;  4Z2X A;  2EBE A;  1XMQ F;  5J2M A;  3K5N A;  5GAG I;  2YKM A;  2NUU G;  4U6P A;  2Z30 B;  4A8F A;  3GV8 B;  5FDL A;  2VB6 A;  1PAE X;  2FY8 A;  4AUK A;  2HND B;  3FRZ A;  1RHU B;  4B9N A;  3R2C J;  3NMA A;  3IS9 A;  1B64 A;  2G1D A;  5HAN A;  2X3G A;  1QAY A;  1X31 C;  2ZC3 A;  4J9P A;  3QAT A;  1WC3 A;  2W8K A;  1RWN B;  4V1A k;  2HAI A;  2CNK B;  5T7L B;  3T9Z A;  5I3U B;  1JLB A;  3DDI A;  4YDD B;  2HND A;  3I4P A;  2VC1 A;  3V4M A;  1ZA2 B;  2NXJ A;  5IV4 A;  4DV7 J;  4ECR A;  3HJF A;  5KFE A;  3HPO A;  1NAQ A;  2D1C A;  3D3C J;  2B9E A;  2C2M B;  3I0R A;  2CJK A;  3OJS A;  1YKW A;  2XI3 A;  3M6V A;  3JSM B;  1S4E A;  4J9V A;  1SC1 B;  1RAA B;  2ZWP A;  3FSX A;  4OJ3 A;  3T1H F;  4PXE A;  4TQS A;  2IM3 A;  3HSG A;  1NZ8 A;  3K89 A;  1XMO F;  1CS4 A;  3DGP A;  2BE9 B;  5AE3 A;  3SIP B;  2HHS A;  3BZQ A;  3NGK A;  5H9E J;  3EWG A;  3TQ1 A;  1IWG A;  3QT5 A;  4Y2A A;  3J81 j;  2YNG A;  3JSB A;  3AOB A;  2OTL S;  3OSN A;  4MK8 A;  3MR2 A;  1L3U A;  1AZS B;  2CQ2 A;  2DBB A;  3G6E S;  1JXE A;  3TAR A;  1RTD B;  3MAA B;  4DCP B;  2EEY A;  1HI0 P;  4KBI A;  1W26 A;  3TJ8 A;  3E3X A;  5KG6 A;  3WQP A;  3CIZ A;  3IWL A;  3KJQ B;  3SEO A;  3Q2S C;  1P27 B;  1WNE A;  4QWE A;  2ZNY A;  2DD8 S;  3D6F B;  1B7Y B;  3MMB A;  4QIW D;  1FWP A;  1Q95 G;  5AXK A;  2HS0 A;  3Q8P B;  3N5F A;  2V4Q A;  3M6U A;  3IG1 B;  2ADC A;  2Y9H A;  4USJ C;  1BMQ B;  2ZH1 A;  5LMU F;  1I6J A;  4O44 B;  2VFU A;  2VA2 A;  4EU0 A;  4B3S J;  4DL2 A;  3UN5 A;  3HHL A;  2DNH A;  3C14 A;  5B08 A;  4IQX A;  2YVS A;  1FJG J;  2R7U A;  3WBZ A;  3KOA A;  2H9Z A;  3QRQ A;  3ZC4 A;  3P6Y C;  1N6Q B;  1BQN A;  1IBL F;  4I2P B;  3J81 Y;  4C48 A;  3T19 A;  2O67 A;  3EIC A;  3HSZ A;  2HZA A;  3F44 A;  5K14 A;  2R2R A;  1Y4Z B;  3MFI A;  2VG6 A;  1F9F A;  4I7F B;  3G8T A;  4ETX A;  3C15 A;  3KDO A;  3KJF B;  3NS5 A;  3UO0 A;  2D41 A;  3GG1 A;  4LMZ A;  1S9F A;  1FE4 A;  3EDR B;  4C11 A;  4IOA Q;  3QWP A;  4PUO B;  1FI4 A;  3GU0 A;  3RRK A;  5BJR A;  4X65 F;  1HBM A;  1NDL A;  3WZ0 A;  2W7P A;  3BKT A;  2UUC J;  1FDD A;  2C3U A;  3K8W A;  2ZH3 A;  1YJN S;  3J7A 1;  3N4W A;  2AJQ A;  1VQ7 S;  1NZA A;  4H4K C;  1S7H A;  5DG8 A;  3L9Z A;  5G4D A;  1HHQ A;  1WEL A;  4CLK A;  4WPA A;  3AA9 A;  1KRP A;  3RB3 A;  2B9Y A;  3TA0 A;  4IOC Q;  1RDR A;  4LFC F;  2PSZ A;  2QL5 B;  4Q2M A;  1N33 F;  2FB0 A;  1CJU A;  4J9R A;  3PX6 A;  5E3A A;  3H4B A;  3U7J A;  4K4Y A;  1Y5L B;  3O44 A;  5KT2 A;  4FYX B;  1BY9 A;  1N0V C;  3H5S A;  3FMB A;  4OJH A;  2PEB A;  3MMA B;  2RQC A;  3MMC A;  4ID5 A;  4KB7 A;  4X64 F;  2RS2 A;  1KVI A;  1ZM9 A;  2BJD A;  4LQ9 A;  5C24 A;  3TA2 A;  3ZXW A;  1GQE A;  2OP5 A;  5KFN A;  1I5O B;  5E7O B;  3DRS A;  3MM7 A;  1RAE B;  5ADZ A;  1BUX A;  1U1K A;  4F0K A;  1X4A A;  2BJ1 A;  2GS8 A;  2YBV A;  3BKU A;  1YJ7 A;  1ZM3 A;  3JYT B;  4ERD A;  2J7K A;  5C2C A;  1Q81 T;  8AT1 B;  1GFW B;  2DH7 A;  4MYT A;  1TEL A;  4NLO A;  1F5A A;  2M9K A;  4BHQ A;  3MED B;  1HBN A;  3VAH A;  2Y3Y A;  4DR3 F;  4MKA A;  3Q8Q B;  3P5B P;  5F8J A;  2DR5 A;  3MTJ A;  3D67 A;  1C4C A;  1HPZ A;  3EYZ A;  2FVC A;  4OHW A;  2GCF A;  4DN0 A;  5A0Y A;  3I55 S;  3C6T B;  1U02 A;  4HHU A;  4CYU B;  1VQO S;  1ZZN A;  1RE1 B;  1J5O A;  3CDU A;  2QEX S;  2HRT A;  2IHR 1;  1YWX A;  2L9W A;  1LNQ A;  2G2Y A;  2CUY A;  1U45 A;  2FC8 A;  3IO1 A;  5HAO A;  4O3Q A;  4X4O A;  1YK9 A;  5A2Q Y;  3KMQ A;  1C1B B;  1AUD A;  2YKP A;  2HFS A;  2HQF A;  7FDR A;  4FNH A;  5E2Q A;  2ACM A;  2RDD A;  3UN2 A;  3KLH A;  1TQL A;  1R0B G;  3R97 A;  4DSL A;  1RBL A;  4JI6 J;  5F9N A;  4DHV A;  3OXF A;  1RAD B;  5KFI A;  2AX0 A;  3EJM A;  2QLB B;  1RT2 B;  1EAY C;  1R8P A;  2G13 A;  2ZD1 B;  4C8N A;  3U1L A;  1YHQ S;  5I42 B;  2QSF A;  5F0W A;  1IBL J;  1CJK A;  2IAJ A;  1MMD A;  4ZHR B;  3KK1 A;  4RBU A;  3LPE A;  4FYW B;  1O5J A;  1WHV A;  5H1S V;  2DNZ A;  4DV5 F;  3NG8 A;  2FZC B;  3AJ2 A;  1S59 A;  1R31 A;  3BH7 B;  5L1L A;  1PAU B;  1U49 A;  4C8M A;  4CLU A;  2DNM A;  2H5E A;  4C2M A;  4PXD A;  1NK8 A;  2IPO B;  1S0N A;  1IBM F;  4F4A A;  3EZU A;  3QRR A;  4DPT A;  4WFZ A;  4LF9 J;  2L08 A;  3UDL A;  1RKI A;  5KFG A;  3OL9 A;  1X7V A;  3MR7 A;  1RT7 A;  4EO8 A;  1ZM2 A;  2YQ1 A;  2DB1 A;  4KKO A;  4RL1 A;  4NML A;  2R2U A;  3SV3 A;  2KDO A;  1U4B A;  3DGV A;  4IYQ A;  1K9M T;  1M5V C;  2J9C A;  3OV7 A;  4NLW A;  1JLC A;  4C0H A;  3NMR A;  1ZPV A;  1LWF B;  5KT5 A;  1XNQ J;  2DH9 A;  3FKB A;  1EQM A;  5EN1 A;  1I51 B;  3THV A;  2E5I A;  2BJ9 A;  5L1J A;  2DNP A;  2M3D A;  3K2Y A;  4DSK A;  3B4M A;  3PYG A;  1RHR B;  2ZJQ Q;  4CP5 A;  1OPZ A;  3B82 A;  5CYQ B;  5HN0 A;  4DV5 J;  4ED0 A;  2V9W A;  3JSM A;  3N5B A;  4KHM A;  3JAM U;  3V4I A;  2IVF B;  1IBK J;  1OQ6 A;  2DCU B;  4AYB D;  4ILL A;  1RT5 A;  1R8A A;  3HJV A;  3H5U A;  5HI7 A;  1D0E A;  1RU2 A;  1RLD A;  1SI9 A;  1NPP A;  3G4S S;  2LU1 A;  2XB2 D;  1KFD A;  2MHN A;  3OTB A;  2HW3 A;  3KUH A;  2CPD A;  5B0D A;  4OX9 F;  2V0N A;  3L7O A;  3IN5 A;  4Q7A A;  2QZ8 A;  4QQB A;  2HMI B;  3GJS B;  2MZ1 A;  2QA4 S;  3SSQ A;  4D3H A;  2JC0 A;  4BBY A;  4CQ1 A;  1B3T A;  2ZH8 A;  3MMB B;  3PDN A;  1TUW A;  4UST A;  1YJV A;  4C8L A;  2XS2 A;  1F2G A;  1ZAV A;  2YNI A;  3CC7 S;  2GHW A;  1Y3K A;  4DQR A;  1FHT A;  2RDI A;  3NWR A;  1XN9 A;  3Q8U A;  1S1W B;  4UOF A;  3GIJ A;  3PKM A;  1YZ7 A;  2XO7 A;  3P8B B;  4TKT A;  1KHW A;  1ZOT A;  2MQ8 A;  1WSV A;  1XQI A;  3LQV A;  2KXF A;  4ZPV R;  2FJE B;  2A1B A;  4OX8 A;  4USI A;  4YHH J;  1QUP A;  1IKV B;  3L3C A;  2RKI A;  2IBK A;  1RT5 B;  5D4L A;  1NJZ A;  4JBC A;  2BYC A;  2DXE A;  2UP1 A;  2Y8Y A;  4JYA J;  2R7X A;  4CLT A;  2XZT B;  1GNK A;  2CJA A;  1TKZ A;  4YB7 A;  3BSC A;  3O1L A;  2VPY B;  1S4F A;  3N6N A;  1ICE B;  2OPR B;  1S1U B;  3LP0 B;  3SQG A;  2IRX A;  2G9O A;  2SXL A;  2QN6 B;  5GAH U;  4YP3 A;  4FS1 A;  3DLG A;  1DRZ A;  2Y1R I;  1BQM A;  2DPI A;  4PUO A;  1DFD A;  4NYP A;  1RT6 A;  3TEH B;  3OJU A;  1HNV B;  3VCD A;  3A13 A;  3R5J B;  5THW A;  5BR8 J;  1VGY A;  2GVZ B;  2RUG A;  3BPS P;  3SDE A;  3ZNJ 1;  3HMJ G;  2ZBC A;  3QFH A;  1T05 A;  1NKE A;  4PWD B;  2Z8Q A;  3CJ8 A;  3ZTQ A;  3HKZ D;  1FFS B;  1KR4 A;  5D77 A;  2V2V A;  4B3S F;  2MQN A;  3POT A;  1TK8 A;  4OI0 A;  2X1F A;  2F9D A;  1U24 A;  4KGZ B;  4PQA A;  1F3V A;  1WG4 A;  3BGR B;  3D28 A;  1YRT A;  1SKW A;  1OY6 A;  1T9U A;  2APO A;  5M2U A;  3BSO A;  4A8O A;  5DDP C;  1FJG F;  1UFL A;  3DRP A;  3RAX A;  2K2P A;  1RAB B;  1TL7 A;  1WHX A;  2HSE B;  3FCV A;  3F41 A;  2DNR A;  3JQK A;  4GVB A;  4KE5 A;  4KQZ A;  1NB7 A;  1WWH A;  4DV4 J;  2H54 B;  3PCO B;  2YWK A;  1KON A;  1O51 A;  2J0W A;  1Q8L A;  1V6H A;  1UVK A;  3QIP B;  2QIF A;  2R8J A;  4AL5 A;  4OYA A;  2V4J A;  4ZVQ B;  2YWG A;  3DDK A;  1Q53 A;  5ITH A;  1G4C A;  1WSR A;  2DR6 A;  3L09 A;  4X65 J;  4ECX A;  4DSI A;  1YG0 A;  2AP6 A;  2GQ2 A;  3UDC A;  1HBN B;  3CXC R;  2WB1 D;  1R0C B;  4FPI A;  2RQ4 A;  2W9B B;  3CE8 A;  3TVZ A;  3K8V A;  2VUG A;  2U1A A;  2XUL A;  1S1V A;  1AZS A;  1XER A;  3ZTR A;  2WON A;  4OYB A;  4CO3 A;  1PKU A;  1SH3 A;  1X9W A;  2HRU A;  2CPH A;  2B51 A;  3GE9 A;  3PXG a;  4IFY B;  3LAK A;  2XLI A;  4Y65 A;  3OL6 A;  1W7W A;  2IRU A;  4IDK A;  5F8N A;  2VG5 B;  3V5R A;  1NU4 A;  1EZZ B;  4RKU C;  3TZY A;  3PYE A;  4QZV B;  4DL3 A;  4QJV A;  4NEY A;  4G3I A;  2PC6 A;  2CPX A;  2FJB B;  1S76 D;  2KZM A;  4LFB F;  4LFA F;  1MWZ A;  1VMB A;  1ZS6 A;  1AB8 A;  2HFN A;  3CJQ A;  4NMX A;  2JHE A;  5A2Q U;  4DV6 J;  2FY1 A;  4BDP A;  1NO8 A;  2O66 A;  3T3F A;  2KL8 A;  2ZHO A;  3DOM B;  4LIW A;  4RJV A;  2A3J A;  1JLQ A;  1TKD A;  2CPY A;  3NWG A;  3MPW A;  1NJI T;  3DLK A;  5GME A;  3DOL B;  5KFM A;  3C3L A;  1VQ4 S;  2IYI A;  3IM8 A;  3GII A;  1QAI A;  1TKT A;  2JH3 A;  2OSR A;  1BD6 A;  4NEZ A;  4N8N A;  4CH7 A;  4ZJQ A;  1T0T V;  3H5X A;  4OZL A;  1IKW A;  4RUA A;  3KKF A;  1R0A B;  3CED A;  3CCE S;  2IM0 A;  3SDE B;  3HUL A;  1T05 B;  4RZR A;  4KYZ A;  2AGQ A;  4K5S A;  1IN0 A;  5HRO B;  5B09 A;  2V63 A;  2G0J A;  2DGX A;  4IFY A;  1LFP A;  4MYU A;  2B8Q A;  4WFY A;  1UKU A;  5A8R A;  1T7P A;  4NLG A;  3Q22 A;  4NXN J;  1QJH A;  2EW9 A;  1ARO P;  3W60 A;  1N5S A;  2YNH B;  4RNF A;  3MZI A;  3B4D A;  2UUA J;  3OHA A;  2BJ8 A;  1WF2 A;  4OHY A;  1FFG B;  3CDE A;  5HRO A;  1U1L A;  2J7W A;  3H0P A;  2RD5 C;  1F60 B;  1M1H A;  2J9E A;  3D3B J;  3QQC D;  2V68 A;  3TQE A;  1SL0 A;  1FTC A;  2V8H A;  4A46 A;  1WG5 A;  1SC6 A;  3QGH A;  1KVK A;  2RHS B;  2OHD A;  4N41 A;  2RRN A;  4W90 B;  1WF0 A;  3NGR A;  3M30 A;  5HO4 A;  4AT1 B;  4I2Q B;  2FLL A;  2MZJ A;  2LQ5 A;  2AF6 A;  2QLF B;  2FQQ B;  2YQ3 A;  3L4B C;  1ZTW A;  1UVN A;  2GW8 A;  3M8S A;  3QPI A;  2KFY A;  4IUF A;  1S97 A;  1RAJ A;  3CJK A;  1T03 B;  1ACM B;  3GIR A;  5C25 A;  3FK4 A;  3VGV A;  4DQP A;  5D6G A;  1JXV A;  1PBA A;  2C3P A;  3UCU P;  2ZOM A;  2AW0 A;  3BR8 A;  1P9Y A;  4IG0 B;  4K4Z A;  2OPS A;  4FYV B;  4OQJ A;  4JV5 J;  1U26 A;  1JNR B;  4X66 F;  3M05 A;  4HI1 A;  3LGH A;  1BWV A;  5I42 A;  1RGV A;  1J27 A;  2B4O A;  4IDK B;  4YN3 B;  1MNE A;  3GTY X;  4PWD A;  5IT4 A;  3FBB A;  2CDR B;  3UVJ B;  2ZUG A;  2QMX A;  3ILL A;  4DL0 C;  5IM0 B;  2R8H A;  2ERR A;  3EVM A;  4P10 A;  2YH1 A;  4K4S A;  1V9O A;  3D6M B;  3SMZ A;  2B6A A;  2JWN A;  3X1L B;  1LK5 A;  2CWX A;  2DIS A;  2WSC C;  2IFX A;  4L6V 3;  2DEI A;  4R0J A;  2J0X A;  3BS9 A;  2C2N A;  3HT0 A;  3ISN D;  3JXO A;  2X1G A;  1T02 A;  1H2V Z;  2ILZ A;  1LW0 A;  1D8Z A;  4I64 A;  2HG4 A;  2KXH A;  3BSN A;  2FLP A;  5KT7 A;  1TVR A;  5I3U A;  1GXL A;  1REV A;  1X0P A;  3QJP A;  4OV6 A;  2FJD B;  5LSO A;  4DV3 F;  2RUS A;  3ZZZ A;  2UXC J;  2F1F A;  2M4M A;  4LT6 A;  1ZYQ A;  4ECQ A;  4JYA F;  2HFZ A;  2DRD A;  2XHC A;  1M5P C;  2C1E B;  1TVR B;  5KFR A;  2K3I A;  2J6U A;  4CH1 A;  1IM4 A;  2H48 B;  4A48 A;  1OSC A;  2LU2 A;  1UVL A;  4FYY B;  4NI2 A;  4DN9 A;  1IR2 A;  3CNQ P;  4RW8 B;  5IFM A;  5GMK a;  1RA7 A;  2EKY A;  5AJ3 F;  3R1H A;  1VQ8 S;  3PR5 B;  2XO6 A;  1KDN A;  4C8Y A;  2HHT A;  1TL3 A;  3MCO A;  5DQG A;  1HNV A;  2AGO A;  2N7Y A;  3J81 U;  5K8M A;  1X5S A;  1FKP B;  2OI2 A;  2VC0 A;  2VU5 A;  4I6A A;  3M2R B;  3I56 S;  1YIJ S;  4LFC J;  1Q8K A;  2I5J B;  3AD9 C;  1R8C A;  4B02 A;  2ZZM A;  5DDQ C;  1AXQ A;  1Z2L A;  1JLG A;  3V6H A;  1T9V A;  4OZ5 A;  4WII A;  3CJ5 A;  1K0T A;  1K1S A;  4AE5 A;  2Y1I A;  3O5T B;  2FGO A;  2E9T A;  1GX6 A;  3T1Y F;  1SJQ A;  3D0G E;  5M2P A;  5EHH A;  2BRK A;  3I32 A;  3EVW A;  4AL6 A;  3OVB A;  1WOR A;  3LUY A;  2J0Q D;  3I0S B;  2UXD J;  1UEU A;  4TVA B;  1TP7 A;  2NS1 B;  3I31 A;  1GMW D;  3T5H A;  2E5G A;  1JLF B;  4HVZ A;  1ZA1 B;  1RCX B;  2HVE A;  4MK9 A;  1V5I B;  1IUJ A;  2YKO A;  4KO0 A;  1UPP A;  4HHH A;  1JLC B;  4UW2 A;  4NXM J;  2UUW A;  1RBA A;  3DMJ B;  1NSK L;  3HVT B;  4N56 A;  1WTF A;  2H65 B;  5ETR A;  3UR0 A;  3GIL A;  2VG6 B;  1KQG B;  1RK8 A;  4GKJ J;  1NK9 A;  2H4W B;  3M8P B;  1EET B;  2IVM A;  1VQY A;  4G1Q A;  2AKW B;  4X66 J;  5AXN A;  1T95 A;  1KNZ A;  3HM9 A;  1Q86 T;  2HS4 A;  1MWY A;  3GON A;  3QBC A;  5C5J A;  2FD2 A;  3MF5 A;  4M5J A;  3BKF A;  2E5H A;  4ES1 A;  1CG2 A;  2WVB A;  5CZV A;  3QGG A;  2R2T A;  3CME S;  4JI2 J;  4M5I A;  4CM2 A;  3PIP Q;  5EX0 A;  4CT8 A;  4TQR A;  3B6B A;  4OFZ A;  4RW6 A;  1TKX B;  3W65 A;  1LWX A;  4A8X A;  1G1X A;  2Y0B B;  4FN5 A;  2ZBR A;  4CYU A;  1KQF B;  5JJB A;  4DL5 A;  3LWM A;  1SJ3 P;  1FVS A;  1WEX A;  5HAT A;  2QC3 A;  1TMM A;  1N34 J;  3NNC A;  1UWA A;  2BBE A;  2J9D E;  1RTJ B;  2EI5 A;  3DOL A;  5H9F J;  3FSI A;  2ZHA A;  3BO2 A;  5HLF B;  1J5E J;  4DV3 J;  1T3N A;  4ZN3 A;  1NK7 A;  2DR7 A;  4O4R A;  2JLE A;  2GNK A;  1H7X A;  1U8S A;  3HVA A;  4ZPA A;  4NPO A;  1JJC B;  3CCR S;  1SJ4 P;  2B5J B;  3CVK A;  3KLI B;  4CIO A;  4R8U B;  3RTV A;  4LF4 F;  4JI5 F;  1DTQ B;  4K0K J;  2MKY A;  2ZH2 A;  3EGZ A;  3BGL A;  4ITS A;  4NAS A;  2AHO B;  3K5O A;  2B9X A;  2UUA F;  5HBM B;  1U6Z A;  3PY8 A;  4DFK A;  1HPZ B;  1F6T A;  1C4A A;  2PEH A;  1SH0 A;  2HNY B;  2MJN A;  3C16 A;  3DRX A;  3TW0 A;  4ED2 A;  3EPI A;  1RT3 B;  1PO6 A;  4UY8 T;  2CWK A;  3I5A A;  1AFJ A;  5KFJ A;  4F4Y A;  2ZE2 A;  1FX4 A;  3JAM Y;  1OIA A;  2F40 A;  3BH6 B;  4M8L A;  1HNI A;  2BOA A;  3LTO A;  3NKY A;  4EMD A;  3WX4 A;  3MEE B;  3QT6 A;  1JJH A;  5B0B A;  4O0I A;  4L75 A;  2WZ1 A;  4NLT A;  3GIM A;  3G86 A;  1XMQ J;  4ELV A;  4ZP7 A;  3CD7 A;  3EZO A;  4OIX A;  2CQI A;  1F3F A;  4GC6 A;  5L38 A;  5AE1 A;  2CQD A;  1IXK A;  3N01 A;  2WCX A;  4QU7 A;  2KG1 A;  3R5B A;  3RUB L;  2HHH F;  2GZO A;  2GVD A;  3M9M B;  4OZ1 A;  4KH0 B;  4DR5 J;  2PA8 D;  4ED8 A;  4BLG A;  2ZH7 A;  3M32 B;  2K06 A;  2HGM A;  4OJG A;  2V6A A;  3M8Z A;  2RIL A;  4BC9 A;  4ETZ A;  2E1A A;  3E51 A;  3K7R A;  4BCA A;  3QLH A;  4DX5 A;  5CYQ A;  4FKX A;  4ZJL A;  2UUC F;  4EO6 A;  4XPC A;  3OW2 R;  4IKA A;  5HJY A;  1S0O A;  4YME A;  3T6J A;  2N7C A;  1MW7 A;  2V2K A;  2DIT A;  3TZZ A;  2JEJ A;  3JSR A;  1OWX A;  1BE4 A;  2HLT A;  3KJV B;  2DHX A;  4ER8 A;  3C46 A;  1NPR A;  2YNH A;  3C2P A;  3CCZ A;  4NCG B;  1KVJ A;  1H7W A;  5L1I A;  3KNG A;  4NWB A;  2HNZ A;  3BF4 A;  3HFV A;  3TWZ A;  5IXU A;  4JI2 F;  2HYI B;  1WOO A;  2ZWO A;  2B4P A;  2BKN A;  1VC0 A;  3MUV P;  4CCH A;  4IR1 A;  4JI0 J;  1NUE A;  4LUB A;  4FKY A;  1NPK A;  2WVC A;  4G65 A;  4KTQ A;  2OD6 A;  3DCA A;  3IP0 A;  3J80 U;  3TAM B;  2R3V A;  1VQS A;  2HBQ B;  4HTJ A;  1ZH5 A;  1L3K A;  2Y1L B;  1UJ6 A;  2MYF A;  5D0R A;  4ZPC A;  1WC4 A;  3UN3 A;  3CCL S;  1XJW B;  1WEY A;  2GV1 A;  3Q89 A;  2N4C A;  5LOQ A;  2FJX A;  2BVZ A;  4F2R A;  4KGK A;  1MRO A;  2OMO A;  4DR3 J;  2KM8 C;  2RT3 A;  3UDV A;  2VL1 A;  4G1I A;  3SQO P;  3DOM A;  2ASD A;  1PJ6 A;  2XSF A;  2RQM A;  2D7S A;  2COL A;  2NYI A;  3NBP A;  1RYR A;  4JI5 J;  4PWW A;  4ZS6 A;  3UFC X;  4ZJO A;  5L9X A;  2J76 E;  1RAC B;  1UFW A;  1TFY A;  2HHW A;  5DG9 A;  2OPP B;  2ZH9 A;  2I5J A;  3TX0 A;  3H20 A;  1X4D A;  3RBD A;  4YB6 A;  4NA3 A;  1TV6 B;  2BRL A;  4ECW A;  1G2E A;  3NGT A;  3AJ1 A;  1I94 F;  2DGT A;  4ED6 A;  3V6J A;  4MTP A;  4N5S A;  2ZC4 A;  2VOP A;  4CM0 A;  5D0E A;  3TA1 A;  2M8D B;  1MU2 A;  5D78 A;  1VIO A;  1HWU A;  3D54 A;  2FHK A;  2XEX A;  3J7Z 5;  1Y00 A;  2WVE A;  3BPD A;  2HBY B;  5GAE U;  3G9C A;  1FT8 A;  4N8O A;  2LEA A;  4Y00 A;  1LKZ A;  1PYO B;  3TO8 A;  3B78 A;  4ZMM A;  3CJS A;  5ETM A;  1Q0N A;  4J37 A;  2H4Y B;  3H8Y A;  4O44 A;  4WFN Q;  4ENO A;  1FK9 A;  1HHS A;  3IWX A;  2WW4 A;  2MQM A;  5D15 A;  1TL7 B;  2W2N P;  1Q79 A;  2VPW B;  1UW4 A;  3AH6 A;  1DJ0 A;  2VBX A;  4OI6 A;  5LSL A;  1MWQ A;  1X4G A;  4HT7 A;  3T5K A;  1TK0 A;  3MXH P;  4DR5 F;  1TL1 B;  3DHX A;  3EXC X;  3G87 A;  1HQE A;  3ET6 B;  4ZK7 M;  4C3K A;  3T9N A;  1KLM B;  2ASY A;  2HS3 A;  4JP8 A;  1U48 A;  3VGU A;  3GYN A;  5IT0 A;  5DM6 Q;  4I1T A;  4YR2 A;  3WC2 A;  2CG8 A;  3R5G A;  5ETK A;  4YR0 A;  2DRA A;  5IT9 Y;  1JKH A;  1KBR A;  1YVF A;  1DQ8 A;  2DGO A;  2E1R A;  2YPZ A;  3DLB A;  2CPI A;  2XMA A;  5CD4 H;  3KK2 A;  3ENQ A;  4C11 B;  5F8M A;  2V5H G;  1HAR A;  2F63 A;  2P2C B;  2AYG A;  5J2N A;  2DXD A;  4RW4 B;  4LVO P;  1UL3 A;  3H25 A;  2QJ3 A;  2ZH4 A;  4DR1 J;  2B9W A;  1DAR A;  1LW2 B;  5K8P A;  1A0O B;  1NM2 A;  4EZ9 A;  1Q82 T;  3FBE A;  3DI6 B;  2K3K A;  4JI3 J;  3HFZ B;  4HR2 A;  2DO4 A;  3QSI A;  3KG0 A;  3SCL E;  4URQ U;  2RNE A;  4B08 A;  5KFB A;  4K50 A;  2BM1 A;  2E7W A;  4RBV A;  3PR4 A;  4H4M A;  1Y0H A;  4RU2 A;  2YH0 A;  2DCL A;  2YTC A;  4E98 A;  4I56 A;  4OYM A;  3RBZ A;  1M5K C;  1LWC B;  4HL9 A;  1R8B A;  1XEZ A;  2FIU A;  3K5P A;  4X62 J;  2XHW A;  1VK8 A;  5GAD I;  1VRT A;  1WF1 A;  5I3P A;  3MTK A;  2DY1 A;  5CZX A;  3CJT A;  1RHJ B;  2DGV A;  4ZCL A;  5L8R C;  1KQS R;  1CJT B;  1YRU A;  2KYX A;  3MAH A;  2K1R A;  5ETN A;  2WON B;  4DFM A;  3V6K A;  4ZVS B;  4CLZ A;  2ACY A;  1HR0 J;  3IR5 B;  2ZE2 B;  4G6V B;  4O3S A;  3NL0 A;  1KP6 A;  2HNZ B;  3MED A;  3UE2 A;  2AJ1 A;  2ZM6 F;  1WDT A;  1M1K T;  3J7Z T;  3VGT A;  4ICL A;  3V6D B;  1N4L A;  2XCP A;  2AWZ A;  4URS A;  4ZIV A;  3IWN C;  1S0V A;  4DR7 J;  5MAO A;  3L7U A;  3OXG A;  1PJ7 A;  3A8J A;  3D0I E;  5AXL A;  1HBO B;  3MR5 A;  1C0T A;  4X4U A;  1VRU A;  1DLO A;  3MEC B;  1VBX A;  1SPB P;  3E8O A;  3N0V A;  1QAJ A;  2E9Z A;  3VAG A;  3FEZ A;  2WB4 A;  4KHP F;  4LF4 J;  1CUL A;  5ETL A;  2Q66 A;  4HYK A;  2R7V A;  1P6T A;  2UV8 A;  4DX7 A;  4K4U A;  2PI4 A;  1TK5 A;  1LEO A;  5T14 A;  3PZP A;  4P2F A;  2WHO A;  1O8B A;  4LFA J;  5HLF A;  4DR6 J;  1U1N A;  1H38 A;  1N5Q A;  3KG1 A;  1VIX A;  2ZZN A;  2I9S A;  3H2U B;  1A9N B;  3CB4 A;  4WXO A;  3OBI A;  2PMH A;  2YX7 A;  4QPT A;  3R27 A;  3W64 A;  5CYJ A;  2OPP A;  2MKS A;  2X51 A;  4OX7 A;  3LP1 B;  2WVD A;  2DNK A;  3I0R B;  1NK4 A;  1CQN A;  1RHK B;  3JS9 A;  4ELT A;  1HD1 A;  1X4B A;  4B9M A;  2DTJ A;  1Y9O A;  1E6V A;  3KK1 B;  3A1Y G;  4WZM A;  2DJW A;  3DLG B;  3IA0 A;  1GK8 A;  4UUX A;  2VQF F;  1UA0 A;  1IQT A;  2C2Z B;  4NCG A;  2I6W A;  4U67 Q;  1K8A T;  2E9R X;  1XMO J;  2VF3 A;  1U0S A;  3QT7 A;  3QSY B;  4QIG A;  5KG5 A;  2BE7 D;  4F36 A;  3GIK A;  1XNR F;  3AD8 C;  3NP5 A;  3ONQ A;  3S6E A;  5HP1 B;  5CA5 A;  1RHQ B;  2AEF A;  1YZ6 A;  4J9Q A;  8RUC A;  2RDJ A;  3RR8 A;  2EFG A;  1SL1 A;  4DUY J;  4EBE A;  2D3O R;  1V3S A;  3CCV S;  1SIZ A;  3OFG A;  4ZLP A;  2QA4 G;  1FKA F;  4K4V A;  4Q43 A;  2XZD B;  1IWA A;  5SUH A;  2CAD A;  4OHZ A;  3R1L A;  1FER A;  2XGP A;  5ETS A;  4XDD A;  2BR0 A;  1D9D A;  1RZM A;  3DRR A;  2GVD B;  2ZFH A;  2DT9 A;  3PG9 A;  2CG4 A;  4BWJ A;  1ULR A;  3UNG C;  1CJU B;  1CSJ A;  4WXW A;  4J9M A;  4DSE A;  1HD0 A;  3IXQ A;  2BAB A;  4KH1 B;  3S7R A;  2W8L A;  2F4V J;  4Q45 A;  4KPY A;  1SC3 B;  4WFA Q;  3E01 A;  1SVD A;  1YRX A;  1LXJ A;  4WP3 A;  2B3T B;  3RB4 A;  5EUH A;  4Y3C A;  2F5G A;  4YY3 F;  1WJ9 A;  4MIW A;  4NLY A;  2Z0G A;  2AIR B;  1UP1 A;  2B4V A;  1VI7 A;  4FNI A;  2FC9 A;  3ILJ A;  3DRS B;  3MM7 B;  4AND A;  2MY7 A;  1FXL A;  1EP4 A;  1LQ9 A;  3F0N A;  3CMA S;  4FXV A;  1TL4 A;  3VF0 B;  4HLB A;  4K59 A;  1VYA A;  4QYZ K;  3JQM A;  1UET A;  1NXI A;  4F4X A;  4RUC A;  2U2F A;  4DCO B;  4QWA A;  7FD1 A;  1T3O A;  2HEK A;  1WEZ A;  5F3Z A;  1BLU A;  5HMW A;  1A6L A;  4DR2 J;  1ZM4 A;  3IGV A;  1HMV B;  1VLO A;  4P72 A;  4RPF A;  4ZIT A;  1T03 A;  1JLQ B;  4TY9 A;  4WBF A;  2GGP B;  5GAG U;  2C28 A;  5D3G B;  1LWF A;  3BM7 A;  1FK9 B;  4ED4 A;  3H2L A;  3EGV A;  3RG6 A;  3JQJ A;  3SZ2 A;  3VV2 B;  5KOW A;  4LF7 F;  2ZIT A;  2BAN B;  1JLF A;  1Y5I B;  2HAF A;  1N8R T;  3D1H A;  2BMB A;  4LIR A;  4RNM A;  3CCM S;  1S72 S;  4LR7 A;  3A8E A;  2H51 B;  1TU0 B;  3FFI A;  2GQQ A;  5B0E A;  1ELO A;  2IDE A;  5RUB A;  3D6H B;  3FEY B;  2Z58 B;  1RI7 A;  2KI2 A;  1HNX F;  2VD3 A;  1G7C B;  4L3N A;  3NNH A;  4PQU B;  2D3O 1;  1S1V B;  1ZAW A;  2E7V A;  2Z57 B;  4RNO A;  3HHL C;  2R2S A;  3CCQ S;  2P6T A;  1FDN A;  3ELH A;  4XTT A;  4EUV A;  4JI1 J;  3A8I A;  2LYV A;  1C0U B;  2ROP A;  1S12 A;  3M2V B;  4B3O B;  1CEZ A;  2BM0 A;  2RIJ A;  1C1C A;  1WUU A;  2PFD A;  1HMV A;  3A8K A;  2B0G A;  3M7V A;  4QW8 A;  2ATL A;  1CC8 A;  3GZ7 A;  1WDD A;  3D68 A;  2YNF B;  5KFC A;  1S77 D;  3HVW A;  4JV5 F;  2DXF A;  4ZKA A;  2O1P A;  5IT9 U;  3R2D J;  1T8E A;  4TYA A;  2PMZ D;  2Z2L A;  3MFH A;  2XM3 A;  1CLF A;  1HIY A;  1Y11 A;  5LL6 d;  1PGZ A;  4QWD A;  4K0K F;  3QWU A;  1U1O A;  3BYP A;  2W4P A;  2VFV A;  1NBE B;  4Z37 A;  4TU9 A;  5ETO A;  3WC0 A;  2CQ4 A;  2MGZ B;  1HHT P;  5LM7 E;  4E0D A;  2XMM A;  1LWE A;  3M8Q B;  5KG7 A;  3CD0 A;  1S6O A;  1IVZ A;  2MLY A;  3BB5 A;  5DZ7 A;  1XR6 A;  4PG6 A;  4DR4 J;  1FDA A;  2M8H A;  2DNL A;  1RTH B;  2VOO A;  2ZVS A;  3FBC A;  2VPX B;  3IFE A;  4V19 J;  3Q8S B;  4DQS A;  5IWA J;  1LWE B;  3M8Q A;  4HHJ A;  4YY3 J;  1S1U A;  1M0S A;  4X84 A;  2KFN A;  4FYD A;  4JI7 J;  2WVF A;  4LF6 J;  4DL7 A;  4P2M A;  3X3U A;  4I2P A;  5J2N B;  4DX6 A;  4B3T F;  2BXJ A;  4ZP9 A;  1RTH A;  1ZAX A;  3RRG A;  1V3Z A;  1NCL A;  1VRU B;  4PXC A;  1M90 T;  2X3D A;  4NRU A;  1QUV A;  2GA7 A;  5T7L A;  3ZFV A;  4OJ1 A;  4USH A;  4DQI A;  1H73 A;  2RF2 B;  2KO1 A;  4NYO A;  1HKA A;  5DLG A;  2RU9 A;  1YBU A;  5CQG A;  3MUM P;  4DLE A;  2XLJ A;  3CC2 S;  5K8O A;  3C6U B;  4EEY A;  2BAC A;  4F3Q A;  3BQ0 A;  2RVJ A;  3A12 A;  3DLK B;  5A6W A;  4DG1 B;  5DET A;  3NOC A;  3OTO F;  4MIA A;  3CDB A;  1SL2 A;  4O3O A;  5GVQ A;  1VJW A;  4EFA C;  2VPZ B;  2GQC A;  2QSW A;  2AEJ A;  2V8V A;  4RUH A;  2QLJ B;  3W7B A;  1XK8 A;  4F4Z A;  1BGX T;  2ZUA A;  3CGI A;  4GRS A;  4UUW A;  2VBY A;  2RRA A;  1IBK F;  2GML A;  2OKQ A;  3IGN A;  2UUB J;  4TU8 A;  1VQN S;  5F8L A;  2WBR A;  1S7I A;  4OMF G;  1FF2 A;  4OYX A;  1VS3 A;  2RRB A;  3RBX A;  4NI2 B;  3AA8 A;  5HQ8 A;  1C1C B;  5K20 B;  3DHW C;  1FEH A;  4UZC A;  3ITH B;  4EYH B;  4B3R F;  2VG7 A;  2W2Q P;  3TRG A;  5LJ5 Y;  4C3L A;  4N47 A;  2WSF C;  4LRA A;  2C3O A;  1CS4 B;  3DGP B;  2IA0 A;  3CSK A;  3K5M A;  1NSA A;  4CWB A;  2W9B A;  1X0F A;  3HHN B;  4C9D A;  4XAK A;  3FBF A;  3VAI A;  4OI1 A;  2IJN A;  1N0U A;  2GIF A;  3M6W A;  5ETP A;  4GVL A;  3G6V A;  1BQN B;  1VRQ C;  3ENA A;  5KFX A;  1HLW A;  5A8K A;  1YJW S;  1HWK A;  1T11 A;  3IR7 B;  1DLO B;  3FSY A;  1REV B;  2G2O A;  3MEC A;  2DGS A;  5A8W B;  1JLB B;  4ED3 A;  2KFZ A;  1OSD A;  1S49 A;  2J7U A;  2XWX A;  4BC7 A;  1IM6 A;  2ZOF A;  1OJ4 A;  3MAQ A;  3J7Y I;  3ZZR A;  1L3S A;  1JWW A;  3QO9 A;  3IG1 A;  4FF1 A;  2KTQ A;  4NLQ A;  2LDY A;  2NZC A;  3HCX A;  5HQL A;  1S10 A;  2YX1 A;  1XC9 A;  1KFS A;  4F4K A;  5FJ4 A;  2GMJ A;  2VBZ A;  3EMT A;  2LKZ A;  3PO5 A;  1FES A;  3MMJ A;  4NL5 A;  1IJE B;  1KLN A;  4IG0 A;  3QID A;  3WDO A;  2DHH A;  4ES2 A;  2AJ2 A;  2EFO A;  2XZW A;  1N54 B;  3HLU A;  3SFG A;  3UR3 C;  1NJX A;  4W92 B;  3P49 B;  3U02 A;  2CVE A;  1RBO B;  3LP1 A;  2BOP A;  2QX0 A;  1URR A;  4ILM A;  3C66 A;  3I87 A;  2KM8 B;  2V8P A;  2X1A A;  1UPM B;  4ZP8 A;  1LWC A;  3HKW A;  4F2S A;  4G1P A;  3KLF B;  1YGY A;  3KUG A;  2AD9 A;  4CDI A;  1VQ5 S;  1FRK A;  3MOZ A;  1S1X B;  2CQB A;  2QA1 A;  1S57 A;  3PJX A;  4PG8 A;  2E29 A;  4I7F A;  2EWH A;  3BGF A;  2FHO B;  2R4F A;  3MPD A;  4LVN P;  4Y2I A;  1TUG B;  5L46 A;  3PW5 A;  1JX4 A;  2FJV A;  4IFV B;  1REG X;  2DNG A;  2R8I A;  4ZCI A;  1QSL A;  1U2C A;  1DQA A;  1EJ7 L;  3LAL A;  1IJF B;  4PPZ A;  4ZVH A;  1MSW D;  4CTA A;  3UD3 P;  4A8M P;  2PO4 A;  1NB2 A;  4NA2 A;  4YQW A;  1PIE A;  1GEH A;  3MCM A;  4QR0 A;  3HHL B;  2D9P A;  2EFP A;  1VQL S;  2IJR A;  1NKB A;  3O3L A;  3UNY A;  2LA6 A;  1JLE A;  3W2V B;  5CCL A;  2YX4 A;  3G71 S;  4JI4 J;  1MML A;  1YBA A;  4RUB A;  3OTD A;  2UXB J;  3GFY A;  3FQL A;  1HNI B;  1K1Q A;  1XBW A;  3VGS A;  4PG5 A;  2O5D A;  2N3L A;  2QTW A;  2WK4 A;  1S1X A;  2LQ9 A;  3DLE B;  3HHE A;  4MAK A;  4ECV A;  2UUB F;  5KFL A;  1HNW F;  4FP9 A;  1EB0 A;  4ZVT B;  3OLA A;  9RUB A;  3EPG A;  3A3O B;  3KLE B;  1FTR A;  1M5S A;  4J7C A;  1NDC A;  5J2P B;  4A8W A;  1R0A A;  3HI9 A;  4IRC A;  2HNY A;  2LFV A;  3M8W A;  5SZT A;  3VZI A;  4NCB A;  1KN6 A;  3C19 A;  3OFF A;  1HNX J;  3GR1 A;  3SCJ E;  2HWH A;  1FKP A;  4Y6I A;  2HQ3 A;  5D8H B;  1HI8 A;  1ZZF A;  2PFF B;  1X60 A;  4Q0B B;  5LXR A;  2M7S A;  3OT9 A;  4ZA1 A;  1Y5N B;  4OHX A;  1T9X A;  3CPW R;  2HGN A;  2AJ4 A;  3LGM A;  4NLS A;  2W7O A;  2Q79 A;  4J91 A;  3MD3 A;  4WF9 Q;  4TXS A;  2PMW A;  3T5L A;  2UXB F;  1Q8B A;  4X64 J;  4Q0B A;  3BN4 A;  2R42 A;  1MRO B;  3P45 B;  4DUZ F;  4HAC B;  3UDE A;  1X4F A;  5I3Q A;  4DV1 F;  3ETM A;  4HH1 A;  2QT7 A;  2M88 A;  3W8G A;  2XMV A;  2JJ4 D;  3ZTO A;  2CVI A;  1OS5 A;  2P9C A;  2E5L J;  2XG8 A;  3MHY A;  1U1R A;  6FD1 A;  1GMV A;  4TY8 A;  3CIM A;  3QJJ A;  1WKL A;  3ETO A;  1AA1 B;  5BYQ A;  2I0X A;  1TMJ A;  4LSN B;  3PJ9 A;  1YI2 S;  3C15 B;  2V4J B;  3ISN C;  4WKR A;  3IBF B;  4O4G A;  3HSD A;  3W2V A;  2BUN A;  2KG0 A;  4JI8 J;  4UTG A;  1T9T A;  2AZ1 A;  2KRR A;  2BX6 A;  2QG9 B;  2VH7 A;  3VWS A;  1DY3 A;  1Z1Z A;  3D1O A;  4DOZ A;  3TZX A;  4WZQ A;  3R8Y A;  1SCJ B;  4KFB A;  4CO0 A;  4ZLL A;  3KHL A;  2ZHB A;  3DRP B;  4AL7 A;  3FZ2 A;  3GPA A;  1QVG R;  2OPR A;  1D3W A;  3N6M A;  4DJB A;  2ASL A;  4ILR A;  1U09 A;  2V4R A;  4KSE B;  4OL8 A;  2W7A A;  1JNZ B;  2ILY A;  2PE8 A;  4WYW A;  4X4R A;  4QYR A;  1P1L A;  1RWU A;  2FZG B;  2KU7 A;  2B43 A;  3C6U A;  2DEJ A;  2GHP A;  3ENW A;  3GSI A;  3KG4 A;  3BRE A;  1NH7 A;  3GWC A;  3W1Y C;  2C2O B;  5DJB A;  3W5X A;  4DPU A;  3D7S B;  1HFE L;  1W2B R;  4ZVP B;  2UUT A;  4PR6 A;  2DNN A;  2W1B A;  4OLP A;  3P4U B;  3CDA A;  2W4D A;  4USV A;  1YBT A;  2YWH A;  3QAE A;  2MZS A;  2BQ3 A;  3P3D A;  3H4D A;  1PG5 B;  1UEK A;  1NHV A;  1R7I A;  1UAW A;  2PII A;  3OTC A;  4PYD A;  4DLG A;  4DXL A;  2XLK A;  2XY7 A;  2NZ4 A;  2XYP B;  2CJ9 A;  4X62 F;  2KVQ E;  3FCH A;  5DRK A;  4DU7 A;  1W2I A;  1N48 A;  3CF5 Q;  3WIU A;  3UPF A;  4WTY A;  5M2R A;  4P7V A;  3GLJ A;  1T9W A;  1R27 B;  4MJK A;  3VZH A;  5KT4 A;  2DRB A;  3J80 Y;  5F8G A;  3I9Z A;  3QRP A;  2V2Q A;  4DUY F;  2GHV C;  3OTO J;  2I1R A;  2OML A;  1NSP A;  3GB0 A;  2I8E A;  1CUL B;  3QZ7 A;  1N5Y A;  2OEL A;  2YWE A;  2CQH A;  4KGV B;  1UJ5 A;  4L76 A;  3AXK A;  1NJY A;  1HQE B;  2KN4 A;  3ET6 A;  5T41 A;  5EGY A;  5FDL B;  4YB1 P;  2VQE F;  2WTF A;  3LGN A;  1XR5 A;  4PPD A;  5C42 B;  2FVP A;  4B3M F;  4B9T A;  4P7T A;  2E66 A;  4DDF A;  3PNI A;  4CNY A;  3IRW P;  4C8O A;  1NEE A;  2AJ0 A;  4CLS A;  3Q23 A;  5J1E A;  2XY6 A;  3DU6 A;  1YJU A;  4M5M A;  1BHN A;  4JI0 F;  4DG1 A;  4MFB A;  4NZ7 A;  4S0M A;  4RW7 A;  2QRR A;  1FFW B;  1UZH A;  1KHV A;  1X8D A;  1YJR A;  2QV6 A;  3P96 A;  1H6K X;  1GXT A;  2KT2 A;  3MR3 A;  1NSQ A;  3M1V B;  3L95 X;  3G82 A;  4RWX A;  4ED1 A;  1MN7 A;  2JLF A;  1DTQ A;  2YKM B;  3ZZU A;  5LT5 A;  1TR0 A;  5LMU J;  2FHM A;  2RSQ A;  5GMD A;  4K4X A;  3TAQ A;  1RYS A;  1DQ9 A;  4GKJ F;  4OZJ A;  1VDH A;  2QA2 A;  5KFT A;  4JI3 F;  1Q8I A;  4QBU A;  4OZ3 A;  1S5Z A;  4B17 A;  4NLV A;  3UWT A;  3K58 A;  1FXD A;  1RUS A;  1PCA A;  1QE1 B;  4V19 X;  1SBR A;  2D3U A;  4DPX A;  1DBD A;  2HRY A;  3I96 A;  2RU3 A;  1CJV A;  1B4S A;  2PD1 A;  4A8S A;  3CJR A;  1RWO B;  2IBO A;  2NYH A;  5K14 B;  2DKO B;  2J8A A;  4CTA B;  2AGP A;  2IVY A;  2JX2 A;  2RF2 A;  4WFX A;  2C2K B;  3S1T A;  4RBT A;  3ISZ A;  5C25 B;  1CJT A;  4IG3 A;  5B0G A;  4RW6 B;  2OIH A;  1XNR J;  1QLN A;  2CZ4 A;  1N56 A;  1IKX B;  1NND A;  4C3M A;  4J9U E;  3DOK B;  3MD1 A;  4QW9 A;  2NSB A;  3W62 A;  4C98 A;  3JTO A;  3HDS A;  2WOM B;  3QZ8 A;  2DYA A;  2L48 A;  3PRB A;  2XMJ A;  4H4M B;  4ICL B;  3V6D A;  4IG3 B;  3CUL A;  1U6B A;  2ZBI A;  3HF5 A;  3PVX A;  2MB0 B;  4I67 A;  3CT9 A;  1RIS A;  2CJY B;  3SCI E;  4UY8 5;  4IH6 A;  1JJ4 A;  4XO0 A;  1VQM S;  2Y8W A;  1N6Q A;  2PN6 A;  5L9N A;  1FJC A;  1U0H A;  3HVT A;  4ZPT R;  4R0E A;  3HVR A;  1TL5 A;  2B5J A;  1SQE A;  4PAA A;  1WI6 A;  2KT5 A;  3AB2 B;  2R9L A;  2HKE A;  4AQY F;  2UU9 F;  3BBB A;  4M5L A;  4KFB B;  2A2D A;  4WE1 A;  1IR1 A;  1FNO A;  3PYF A;  2V94 A;  4XDC A;  5F41 A;  5GAH I;  2XQC A;  1FCA A;  3M9O B;  3PO4 A;  3RW6 A;  4FXD A;  4X4S A;  4M63 A;  4C0B A;  2NPI A;  4RNN A;  1LK7 A;  4CO4 A;  5D4N A;  3MM8 A;  2QO3 A;  2R7O A;  3D66 A;  3G82 B;  3MWB A;  1U2F A;  2D3Z A;  2VG7 B;  2BKO A;  4JUZ A;  1D8Y A;  3BDP A;  3JYT A;  4X2B A;  1UFK A;  3T1A A;  4Q44 A;  3QFW A;  4RW7 B;  5FD1 A;  1Q5Y A;  2YNF A;  2E1P A;  4AD6 A;  1TKX A;  4CH0 S;  2LXI A;  1KS2 A;  4AXJ A;  1JQG A;  2BAN A;  4EWT A;  4X4P A;  4TNO A;  2N82 B;  1IKW B;  4FVM A;  3C6T A;  2G0I A;  3SFU A;  3ULH A;  1HBU A;  4HEA 9;  3RU0 A;  4PEO A;  4NOH A;  2ZBP A;  1JLA B;  4RR5 A;  2A2C A;  5HQM A;  3PFE A;  2BZ2 A;  3N6L A;  4KGM A;  5CH7 B;  3OPK A;  3J7Y U;  3H90 A;  2LEB A;  1JK9 B;  2EBG A;  2QLW A;  3OFE A;  3LO3 A;  3FNN A;  2JDJ A;  3ICL A;  3NGU A;  4XK8 C;  3SI8 A;  3MEE A;  4LSN A;  3DLE A;  1PC5 A;  4CO5 A;  1ITP A;  2HGL A;  4B9V A;  4P71 A;  2CJX B;  3SSS A;  3N79 A;  4FPR A;  5I4M A;  4CNZ A;  1X4C A;  4M1K A;  1GAO A;  4EGL A;  2C42 A;  3QYY A;  4DUT A;  5DDR C;  3T1Y J;  1SKS A;  5JXS A;  2M0G B;  1XNQ F;  2AZ3 A;  2OPQ B;  1VBK A;  2J6S A;  2RHQ B;  4OI4 A;  4R5P B;  3TYT A;  2F9J A;  2V2Z A;  1RWP B;  4OZ0 A;  1RCO B;  3DLH A;  5ETQ A;  2YY3 A;  4CI0 B;  2HVZ A;  4QIE A;  1SKR A;  3DLJ A;  3AFG A;  4QPX A;  2CZV C;  1FXR A;  4ECU A;  2FLN A;  5D4P A;  2OH2 A;  5HP1 A;  1H98 A;  2FHJ A;  2RAQ A;  4I6W A;  4L72 B;  2HLU A;  2XNQ A;  4IO1 A;  2Q3P A;  4O3N A;  1OYD A;  4YS2 A;  1NK6 A;  2CJQ A;  4U8Y A;  3W61 A;  3IMQ J;  1AT1 B;  1EX8 A;  3PYD A;  5LXY A;  2EFN A;  2B56 A;  1RXO B;  3H5Y A;  3N9U C;  2UVV A;  4CLF A;  4QOT A;  1JLG B;  2KRB A;  2J5A A;  3GJT B;  4KPC A;  2MGZ A;  1IQZ A;  2OEM A;  2PGC A;  1EP4 B;  3MM8 B;  1IKY A;  1Y7P A;  2UZA A;  4OX9 J;  1NLK L;  4BWM A;  1FVQ A;  3G6X A;  2QFI A;  3O6Q A;  2P5V A;  3M8Y A;  2F8M A;  4NA1 A;  1P9Q C;  2NUH A;  1KOH A;  2YWF A;  3D9B A;  2FLO A;  2F8H A;  5F8I A;  2PT0 A;  1HWI A;  2P8I A;  1AUS L;  1SV5 A;  4WKY A;  3RW7 A;  4DWI A;  3R3T A;  4MIB A;  2AJF E;  4NLD A;  2ALZ A;  2Q1L A;  2W4C A;  2K1R B;  4OYW A;  3W8P A;  3RYL A;  5HMY A;  2DR9 A;  3QNW B;  1S6P A;  2CA9 A;  4O4G B;  3DC2 A;  1ZET A;  2XS5 A;  3K0J A;  4ED5 A;  1VHF A;  4UQG A;  1OY8 A;  1S1T A;  1X4H A;  1KD1 T;  2M5Y A;  3NNA A;  2HVI A;  1Q16 B;  2IRY A;  1RWK B;  3CCW A;  2Q43 A;  5CAB A;  1FNX H;  2FVQ A;  2QLX A;  4LF5 J;  3PJW A;  4LF7 J;  1HYS B;  3KJV A;  5D0H A;  2P6S A;  1EET A;  4H54 A;  4B3M J;  3DYA B;  3OUY A;  3MUR P;  3UCZ P;  1CJK B;  5GAE I;  1IKX A;  4ZHR A;  2YXL A;  2MTL A;  3CD5 A;  2OTJ S;  4DQQ A;  3GFH A;  4MKV A;  2MKK A;  1EIY B;  4B3T J;  1S6U A;  5E33 A;  4DCJ B;  2E5L F;  2CQP A;  4ZVO B;  2KYZ A;  2QMW A;  3M9N B;  2R8G A;  1RWX B;  3FDS A;  3GV7 B;  1FWK A;  4C7Q A;  4UF4 A;  2FVR A;  3DU5 A;  1RAO A;  2B4U A; 
#chains in the Genus database with same CATH homology
 3IBF B;  1BMQ B;  2QL9 B;  2XYG B;  1RWM B;  3R6G B;  5IC6 B;  3RJM B;  1RWV B;  1F9E B;  1RHJ B;  1I51 B;  2H5J B;  3R7B B;  2H51 B;  1RHR B;  4ZVS B;  3KJN B;  2C2O B;  3D6H B;  4ZVP B;  3P4U B;  3KJF B;  3EDR B;  2CNL B;  2HBQ B;  2Y1L B;  3IBC B;  2H5I B;  1RHM B;  2H65 B;  4ZVU B;  2XYP B;  2CNN B;  2XYH B;  3GJS B;  2H4W B;  4DCO B;  2QL5 B;  4ZVR B;  4LSZ B;  2CJX B;  1I3O B;  3NS7 B;  1IBC B;  3R7S B;  1RWP B;  1NME B;  2QL7 B;  1RHK B;  3R7N B;  2Y0B B;  2QLF B;  2FQQ B;  3GJR B;  2C2Z B;  3EDQ B;  2XZT B;  1GFW B;  1RWW B;  2HBY B;  1QDU B;  3R6L B;  1ICE B;  3GJT B;  4ZVT B;  1RHU B;  1PYO B;  1RHQ B;  1RE1 B;  2H4Y B;  3R5J B;  1RWN B;  2CNK B;  2CDR B;  2HBZ B;  2XZD B;  3D6M B;  2C2M B;  5IC4 B;  3QNW B;  1RWO B;  1SC1 B;  2DKO B;  4JB8 B;  1SC3 B;  3GJQ B;  1SC4 B;  1RWK B;  2C2K B;  3P45 B;  2QLJ B;  3SIP B;  2QLB B;  2HBR B;  1QTN B;  2P2C B;  2H54 B;  4ZVQ B;  5K20 B;  4DCJ B;  2C1E B;  4ZVO B;  4DCP B;  1RWX B;  2CJY B;  1PAU B;  3KJQ B;  2H48 B;  2CNO B;  3D6F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...