1QTNB

Crystal structure of the complex of caspase-8 with the tetrapeptide inhibitor ace-ietd-aldehyde
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-8
publication title The atomic-resolution structure of human caspase-8, a key activator of apoptosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 20
structure length 90
sequence length 90
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 1999-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1qtnB00
2H65B 1PYOB 3IBCB 1RHJB 3EDQB 1RE1B 1RWVB 3RJMB 2CNOB 2C2MB 2H51B 2C2ZB 1RHQB 2QL5B 2HBRB 1RWWB 1RHRB 3P45B 4DCOB 1BMQB 2HBQB 4ZVPB 2H5JB 2CNLB 4LSZB 2DKOB 2QL7B 2CJXB 2QLJB 3GJSB 1SC3B 1QDUB 3P4UB 4DCPB 4ZVUB 4ZVTB 3D6HB 3GJRB 1RWNB 1I51B 2XYGB 3IBFB 2XYHB 4ZVOB 1RWOB 3SIPB 2HBYB 4ZVQB 3R7NB 3D6FB 1RHUB 1IBCB 5IC6B 2H54B 2Y0BB 2Y1LB 3KJFB 2XZTB 3KJQB 3R7BB 2XZDB 4JB8B 1I3OB 2CNNB 2P2CB 4DCJB 1RWMB 1QTNB 1GFWB 3NS7B 2H4WB 2H4YB 1RHMB 2H5IB 3GJTB 1SC4B 1NMEB 2QLFB 2C2OB 3GJQB 2QLBB 2HBZB 5K20B 2FQQB 2CNKB 1RHKB 1F9EB 3D6MB 1ICEB 5IC4B 3EDRB 4ZVSB 1RWPB 2QL9B 1PAUB 3QNWB 3R6LB 2C1EB 1RWXB 2C2KB 4ZVRB 3R6GB 3R7SB 1RWKB 2XYPB 2CDRB 2CJYB 1SC1B 3R5JB 3KJNB 2H48B
chains in the Genus database with same CATH superfamily
2GJFA 3CJ8A 2IC3B 3ZZTA 5D15A 1CS4A 1IXKA 3M6WA 5HLFA 1B99A 1TMJA 4NLPA 3MWBA 2QLWA 2RDIA 1DQAA 4LSZB 4EZ9A 4A8YA 2QJ3A 1ACMB 3QGIA 2N7YA 3PG9A 1HNZJ 2DGTA 2MZTA 3DOKB 3Q2SC 1E6YB 3ZTOA 2I9SA 5DDOC 2VDIA 2A2CA 3EGVA 1URRA 1NJZA 1B3TA 1HMVB 2H4WB 4AD6A 2GZOA 1C4AA 2DR8A 4P6QA 4OI1A 4DLGA 1TL1B 4RWXA 1A7GE 1U26A 1VQKS 5J2QA 2FY8A 2WAQD 2YWGA 2XMUA 4C8LA 2KTQA 1LNQA 2V2VA 3DLJA 3H5YA 4F2RA 4Q5VA 3S7RA 1KVIA 4NLRA 5KFMA 4MKAA 2EXUA 3O5TB 5B7WA 4QPXA 2UXDJ 5F8HA 1X4EA 4FKYA 2C3PA 2GO8A 3EJMA 5E2QA 3IWLA 3TNVA 4RW4B 1U6BA 2VU5A 2CRLA 2A2DA 2C22A 1C4CA 3OVBA 4DR7J 4I64A 2YQ1A 3NL0A 5BR8F 2UVWA 1FEEA 4DCOB 2PT0A 4PQUB 1REVB 1M90T 2E44A 3OFHA 4I68A 4BWMA 2QL7B 3CCWA 1OQ6A 3BQ0A 3W8PA 1KTQA 4OYWA 4IDKB 2HIQA 1RWNB 2Z30B 3ET6B 4YUDA 2YKAA 3TZZA 4CH0S 3KJFB 4LSLB 1H2UX 1SIZA 2HVIA 2F63A 2ZNYA 1RT7A 5D4LA 2KVQE 4DV1J 4G1IA 2EBGA 2GIRA 3V6DA 3M1VA 5J1EB 4ECVA 2V2KA 2R8JA 4ED5A 1F3FA 4RL1A 1KRPA 3S01A 4JI2F 4LF7F 3PJXA 1T8EA 1CVJA 3PV8A 4CNYA 2HHWA 1QAIA 5IT9U 3M30A 1NJWA 1CPZA 2BRKA 1FRLA 3R3TA 1WI6A 1YKWA 1YLXA 1JLCA 4ECSA 2UV8A 3KK1A 1QSLA 1JLBB 1K9MT 1S9FA 1RHQB 2GGPB 3RB4A 1URNA 1NH7A 1V3SA 2KB2A 3JQMA 3TEGA 2RU3A 3DRPA 4K4ZA 3SV4A 1Q8LA 4DQIA 3B4MA 1IJFB 2KZZA 3MMBA 2J0XA 4RW7B 4ZVQB 1IBCB 3RZAA 2KFYA 1YITS 2P5VA 1U0SA 1R6VA 4E2FB 4NCBA 3OVAA 1R0BG 4L76A 2QC3A 5KFHA 1SCJB 2HBZB 1S4EA 4USTA 1LK5A 5F0UA 3MI7X 4F67A 1LOUA 4I0WA 3N6LA 3RR7A 2QL9B 2J0SD 4I67A 1WHXA 2HFNA 1HW8A 3UD5A 5KG0A 1PC4A 2CDRB 1H72C 6FD1A 5ETKA 4XPCA 1XK8A 3MAAA 3HSJA 1AA1B 2EFPA 2AD9A 2MKYA 5C7PA 3AY0A 2VG6B 4F04B 2IJRA 4M95A 2Z58B 2Q43A 1RUSA 3JSMB 1FD2A 3BB5A 3HD1A 3RB6A 5A8RB 4TY8B 1SKWA 5HO4A 1WC4A 4YY3J 2FTRA 3LP0A 4JI8F 4YHHJ 2EWHA 2IBOA 1MU2B 2B9WA 3TWZA 1YI2S 1XMOF 1WELA 1S6PB 2XHCA 2YWHA 4IFYA 1RBLA 5GADU 2ZHBA 3TVYA 4GMKA 1SI9A 3SCIE 4NLUA 1SL2A 1GH8A 4BLGA 1VR6A 3T1HJ 4ZVEA 3BS9A 2QTWA 4PXEA 4DV5F 4QU6A 3SMZA 4CLKA 1SKUB 1ROFA 2ZZMA 4KO0A 3J7AN 1S1VB 5KT4A 1RYRA 1Q95G 1FE0A 1QUVA 3BGLA 5CD4H 1SXLA 4UOHA 2W7OA 2JSXA 4ED2A 1PC5A 4Y2CA 4JV5F 5J2PB 3NRBA 3PTWA 2FJBB 2NCKL 2HHTA 4O3RA 1N6QA 1EETB 1ZAWA 4KAIA 4Y00A 1UETA 3OTDA 3VF0B 1NU4A 4JI1F 3DN9A 1BWEA 3Q8RB 3L7UA 1GTHA 1RXOB 1EQ0A 1JWWA 2UVUA 3MEGA 4YQWA 3FC9A 2LLZA 2VBWA 1N33F 4OJ1A 2BABA 4OV6A 2DNZA 1SQEA 2B4VA 1VQNS 2G4BA 4ZHRA 3CCLS 1OSDA 2HG4A 1WHWA 4AL6A 3CDAA 2HRUA 3I87A 2UU9F 3R9LA 3A12A 1RT6B 1TK0A 2RSQA 1HNZF 1DZ5A 4L72B 3C14B 3R7SB 3L9ZA 4V19J 2Y1IA 2GQ2A 2V2ZA 2EKNA 2VQFJ 1HYSB 5B0FA 4CQ1A 1ZETA 1EJ7L 2GVZA 1VC0A 1RTDB 1AZSA 1Q7YT 4LRBA 4W98A 2DGQA 3CJ3A 3FUYA 5LXRA 2DNKA 1U1MA 4EYHB 4N8OA 1EX8A 1Q8KA 1XJWB 1LWFB 1N88A 1T02A 3QIPA 1J5OB 2F5GA 2V34A 4OMFG 5KFGA 2EVZA 5DDPC 1LWEA 5IQ6A 3BBFA 5F8MA 3MURP 3TYTA 3V4MA 2G2OA 4NX9A 1OY9A 1TL5A 4LFBF 4FXWA 1P6TA 1UFKA 4DSEA 1R43A 4OFZA 2EC0A 1WOSA 3W61A 2HQDA 2B51A 2W4PA 5E7OB 1A0OB 3D1QA 2AGOA 3OD2A 2ZBRA 4A8WA 3OW2R 1TKTA 4PXDA 4U8YA 1ITPA 1RKIA 1F5CA 3UR0A 2RF2B 2OSRA 3OHBA 2GMJA 1G6BA 1E6VA 4EMDA 1HQUA 2QL5B 3W2VB 4PABA 4F25A 4PG8A 1HHSA 3MR2A 3IRXB 2BE9B 4ITSA 3MFHA 3V4IB 3O1LA 3W8GA 2LVWA 4Z37A 2DNPA 4CLFA 5CYMA 1X4CA 3HF5A 5LMUJ 5HQLA 4QYRA 3KLHB 3KUGA 1BC6A 1TKZA 2HNDA 3BDEA 2LFVA 1Y11A 2ABYA 3M9OB 1OWXA 4HH1A 1ZM4A 3MM6A 3O3LA 2ROEA 3UD3P 3UVJA 2R7SA 2G0IA 1WI8A 4AL7A 3H20A 2NPFA 1RHMB 2QA4G 4K50A 5IWAF 1JMTA 2LQ5A 2VG5B 3HFKA 2VV5A 2R8IA 2XMAA 5IT9Y 4F02A 3RBEA 5B0DA 4CO0A 4FYWB 4UT4A 3UDEA 3OR1B 4RW9B 2KHDA 3VAJA 5JUMA 2MLYA 5LXYA 2ROPA 4Q0BB 1N5SA 4K0KJ 4RU9A 3PR5B 4B9LA 4O4GB 4MKBA 1NK7A 3JSRA 3SQOP 2EG2A 4E0DA 3MM5B 4DR6J 4ECZA 2RU9A 4EBDA 2BOAA 3GV5B 3QO9A 4PR6A 1HBOA 4K4TA 5AXLA 2CDQA 4NLOA 3V81A 2X3GA 2LEBA 4X4QA 1H2VZ 3LP1B 3SBMA 1WKJA 5KTQA 4F4XA 5E3PA 4H4OB 4QOTA 3D4JA 2XZDB 2IHR1 3DM2A 4J9RA 3MPYA 4DN9A 1NSAA 1FTRA 4KHPF 1T03B 2EK1A 4YFUA 4MK7A 2CG8A 4TQSA 3GIJA 4ZPCA 2V9KA 3DOLA 1C1BA 1NHUA 4BCAA 2DH7A 4AQYF 1QLNA 4MYTA 4QJVA 1HBUA 3R5CA 3N4WA 1NSQA 1CULA 4DUZF 4TN2A 1HNWJ 3T6BA 3I96A 3T19A 1RYSA 4EU0A 3CJ5A 1N52B 1Y9OA 4ECQA 5KFVA 4MKYA 3OL9A 4DF8A 2JLEA 2I38A 4YS2A 4C48A 3IBWA 4JI5J 1EB0A 4OHZA 3IBFB 3K5NA 4WYWA 2O3DA 3LAKA 1J5EF 3HHKA 4RNNA 1VQMS 4DPYA 2JEFA 1KONA 1HNIB 4DCJB 3NNCA 1U0HB 2JH3A 4DFKA 2YH0A 3WQPA 1F3VA 2NSBA 1K73T 5G4DA 4NLQA 1FX2A 5DQIA 1LXNA 2N4CA 2DR6A 4DV4J 5JMNA 5HP1A 2N3OA 4ID5A 4MH8A 2N3LA 3T5LA 5T7LA 1VS3A 1UVIA 1FXRA 1Y7PA 5KFAA 2AYBA 1AROP 1N0VC 1P9YA 3JSYA 3B8HA 1IQTA 5KOWA 5HANA 2R8KA 1QE1B 3OPKA 1WJ9A 3RU0A 4JI7J 2DHXA 2W8LA 3OJSA 4ES3A 4DUTA 2DIVA 2UUWA 5M2UA 2DYAA 1IKXA 5F0WA 3VQSA 4A48A 3BN4A 2AX0A 4WXWA 1TFWA 2H1YA 4BDPA 2MQMA 3KXDA 4RR5A 1RSCA 4I2QB 2W2MP 3G2XA 4Y65A 3M2RA 4NLYA 2C2DA 3U27A 2ADBA 1N32J 4HT7A 1RP5A 1Y10A 3MMAA 2IIHA 3OTOF 1BD6A 1RAHB 4DR2F 1SH3A 4NCGB 2IRUA 3L4BC 4X4SA 2EFVA 3ENAA 2HS0A 4ZOSA 3LAMA 5B0GA 2V4RA 4OI2A 1NRKA 4NASA 3BO3A 2BQRA 4LF6F 1N54B 2XCPA 3RRHA 3JQKA 1CJVA 1WSVA 3NOGA 4WYLA 3GV7B 3KJNB 3C6UA 4LQ9A 2QMWA 1FKPA 4C3KA 4DSKA 1YRTA 3D0HE 3EYZA 2YKPA 4RW8B 5IV4A 2ZWPA 3DRRB 1HI0P 1SKRA 3LALA 1RA6A 1FVSA 1SH0A 2W9BB 5D77A 4P2SA 2XC9A 4LRAA 3TA1A 4Q43A 3OUYB 3DYAA 1VFJA 1WKKA 2GCFA 2HMIB 4KGZB 2D1CA 5IZHA 1WOPA 2AZ3A 5KFXA 2R7RA 3AXKA 4WIIA 4RO0A 2UXCF 2QG9B 1KEKA 1DQ9A 3KK2A 1T9UA 3BSCA 2VKZG 3G96A 4FYXB 4QIEA 1UJ6A 3BF4A 1NK0A 1RAFB 2FVSA 2DR5A 1LK7A 2PC6A 4M5DA 5C2GA 3LW5C 3BGOP 3D1OA 2MKJA 4B3RF 2H48B 3M2VB 2BJDA 1NHKL 1JLFB 4YN3B 1T0TV 2FHKA 2K3KA 3I0SB 4RW6B 4EYIB 1AUDA 5EUHA 4YDXA 1RI7A 4UW2A 4ZP8A 4ZVHA 4X62F 3HHLD 4HACA 4ZCMA 2HBQB 5IM0A 4X4PA 2ZHOA 3G9CA 2HK2A 3GJSB 4WP8A 2FGCA 3QSIA 3DFEA 5EWEA 2DNQA 4LSNA 2ASLA 2ZDPA 1R0CB 3Q89A 7FDRA 3GQCA 3KLGB 1VRUA 4K0KF 2JEJA 2JFKA 3AA9A 2HNZA 5I4MA 2O66A 3H7HB 2WSEC 4DR6F 3HJFA 3VAKA 3UDLA 2IJNA 4Y2AA 1GXTA 1VQ9S 3R6GB 4F4KA 2AX1A 3CB4A 4ETXA 4C0HA 1T3NA 8AT1B 2FLNA 2UZAA 1XC9A 1RTJB 1MWQA 3KYLA 3SXLA 4M5IA 2BKNA 2FLPA 3D1HA 4ANEA 3BZQA 4IR9A 3IM9A 3RR8A 3GLJA 2HRTA 3L7OA 1S1XA 2RS2A 1BXNA 4LF5F 1SJFA 2A10A 3QATA 2NPIA 3ITHB 4ALZA 4Q45A 4XDDA 1VK3A 3ZZUA 1TZ0A 2OPQB 1KLNA 1IBKF 2VJVA 4Q2MA 4LJMA 4WFNQ 4YEAA 2CJKA 3GCXP 4DV7J 2IPOB 2GVDA 1S76D 4YB7A 2OJ3A 2EBEA 3C66A 2NYHA 1VI7A 3DRYA 2E9ZA 5SUHA 1JQGA 5CYJA 1N5QA 1PYSB 5HMXA 4YP3A 4FF2A 3B78A 1C0UA 3ZXWA 3GFXA 1FI4A 3HZEA 2B3TB 2YNHB 1RA7A 2IA0A 2VPYB 3CO0P 2XY6A 3THPA 3UN2A 3KLFB 2DBBA 4R0JA 1O0PA 5ITHA 1B7FA 2DHSA 1IN0A 4DV6J 2IMWP 4C8NA 4G65A 5A6PA 3W5XA 3PW7A 4KC5A 2HZCA 1IR2A 4DV4F 4P2FA 3FZBA 2YKNA 4OHYA 5GAGU 4U6PA 2Y0SD 3HHLB 1PIEA 4DCPB 4DR1J 4OX9J 4C8KA 4DU8A 3D5MA 2XS5A 2HFUA 3KLIB 3SIPB 1U4BA 2OPRA 2E1CA 3KLEA 1DJ0A 5DG9A 2XI2A 4PXCA 5T41A 3DLKB 4JB8B 5HVGA 3RB3A 2QGFB 4CYUA 2RKIA 3W2WB 1ZA1B 4J9QA 1N5YA 1NMEB 2YPYA 4CNZA 4J9PA 2CNKB 1NO8A 3RYLA 4LFAF 1KQFB 1TVRA 3R2CJ 3DLLQ 4U67Q 2UXBF 3ZC4A 3D3CJ 1KDNA 4LMZA 1Q5VA 4DMZA 2YTCA 1FFWB 2ZBCA 4OYOA 4M5LA 1NPKA 2BACA 4OJ3A 3G6VA 3M8WA 1L3VA 1PKUA 2CNOB 3MM7B 3QLHB 4Y2KA 2B8PA 3A8EA 4FYVB 5GMKa 1PJ7A 5D78A 4ZN3A 1FKOA 2U2FA 3PO5A 4N41A 2H5JB 5GAGI 1UPMB 1RB0A 3KJVA 3J7YU 2CJXB 2L48A 4LREA 4NYOA 1HPZB 4O0IA 1ZTWA 1WUUA 3ENVA 3GTYX 2N7CA 3LF0A 2WONB 2X51A 3E8OA 4NLTA 4ES1A 2HVEA 1FWKA 1F5BA 1S9EA 1T9TA 3PEHA 3E01A 1TKXB 4C0OC 1NPPA 1GX6A 2RVJA 3MF5A 3EUNA 4WZQA 1RT1B 1VLOA 5KFZA 1U7LA 3MD1A 2CQBA 2LXIA 1PYTA 4CT8A 3MR3A 3I9ZA 4U9RA 1NKEA 2NREA 2HS3A 4ZVRB 1SJ4P 4P74A 4HHJA 1O51A 3V6KA 1K44A 2KI2A 1M5KC 1R0AA 1JJHA 2A0FB 3M8QB 4EBEA 3WDOA 1FDBA 1YWXA 2BXJA 2ZWOA 3B4DA 1XNQJ 4LBHA 2KRRA 2OTLS 4F0KA 2BQUA 3BGUA 4YB1P 1O6XA 3MGJA 3J7YI 4DR3J 2MKKA 1AXQA 2IM3A 3RTVA 2OI2A 1DFDA 2Q1LA 5G0RB 1PG5B 3PX6A 1OO0B 5C42B 1I94F 1OIAA 2C3UA 1RWOB 1AUSL 2HHPA 4IG0B 3UQSA 3BPDA 3FSIA 2GS8A 1YGYA 2ZD1B 2CJBA 2KM8B 4NOHA 1E6YA 2YKQA 1S7IA 1Q0NA 3VAMA 5H1SV 3THVA 7AT1B 3G71S 2WHOA 3GILA 3K89A 3RRKA 3MECA 2W25A 4KKOB 4R8UB 1C0TA 4NXMJ 2B5JA 2UUCF 2PEBA 1VQ7S 1VC6A 2BJ7A 1TL1A 1ZH5A 1YDLA 2V2QA 2YNFB 2YX7A 2M5YA 3BH7B 2A3JA 1QAXA 1FRXA 1V3RA 3OQ2A 2XCAA 1FJCA 3CDEA 2R7TA 4QBUA 3DU6A 3UCUP 3MEDA 2D3OR 2AU0A 4CT9A 2VFUA 3BN7A 3D6TB 2FHOB 1H6KX 1U8WA 2DB1A 3FCWA 1ZA2B 2OGUA 4HHUA 2D74B 2FC9A 1NAQA 2HFOA 1YRXA 4PQUA 1HQEB 4TNOA 5KFSA 1SJ3P 3K5PA 2OELA 3AH6A 3FKBA 1S6UA 1IWAA 1MN7A 4UOGA 2F9JA 4PG7A 3N79A 3CC7S 2QE5A 2XGQA 3GPAA 2XLKA 2VB6A 4F0MA 5KG4A 3N6NA 5CZXA 4C8MA 3TVKA 3J7Z5 2J6UA 5KOXA 4LFCF 5BYSA 4CLZA 3IFEA 3IWXA 3MZIA 4WWSA 1TFYA 2IM2A 4WFYA 4I1TA 1VQ6S 2HGMA 2CPJA 2M52A 1RHRB 1ZPVA 4ETZA 2D9PA 3LWMA 2CFXA 3MM9B 3AA8A 1U09A 3KHGA 2PGCA 1D3WA 3ZTSA 2HVHA 4CLLA 2GGPA 3D6HB 5DM7Q 4F2SA 4M5HA 1U2CA 3D6FB 1N36F 3MR7A 2YWKA 3W65A 1ZAXA 5GMEA 4UY85 4ZIWA 4FN5A 3GIMA 1XERA 3CXCR 4AXJA 1HBNA 1FEHA 1L3SA 2FUG9 3TA0A 2EC2A 4DV6F 2AYEA 3M4XA 2VH7A 1KHVA 2V4JB 4KR0B 2JEGA 2XWYA 2C3OA 3IR6B 3QPIA 4B3OB 2B0GA 4OX9F 5F8NA 2LEPA 5EX3A 4N7TA 1RWKB 2HGNA 2B9YA 3HPOA 5HMZA 3OL8A 3BGFA 3JQJA 2A18A 1FRKA 5H9EJ 1IJEB 3TANA 1P8GA 3TOQA 1MMDA 2O1PA 3IBCB 2R3VA 3DLBA 3SEOA 3SSRA 3PJWA 1PBUA 1YBTA 2YPZA 2CPHA 2M2BA 4G1QB 4ZVPB 2ZC3A 3T1AA 2N82B 2VG6A 3GYGA 2ZC4A 2JEIA 4WK3A 3SCLE 3EZ5A 1JK9B 2J9DE 5RUBA 1NK9A 4IOBA 1DHMA 5LMNF 2DGVA 2Z2ZA 3FMBA 5A8KB 4FS2A 2NR0A 4J91A 2VQEF 2MQQA 1T3OA 5D4PA 5IC6B 5BXIA 3GIIA 4TY8A 2O67A 4YB5A 4I7FB 1B4SA 4DFPA 3OFFA 3ILOA 1MU2A 3F41A 1S6PA 5JXSA 3PDNA 4ECXA 1IKVA 5A8WB 4FPRA 4DV2J 3ILIA 1JKHB 4OLPA 3CJKA 1RWXB 3QWPA 3NGUA 4I4BA 3OR2A 2R8GA 1S79A 2VIHA 2PEHA 1FRIA 3A13A 3AFGA 3QGGA 2CPXA 1S12A 3DLGB 3D0GE 1H74A 3KNAA 4PYDA 3K8VA 2ALYB 3QAEA 1S1VA 3AOBA 2D69A 2C2ZB 1M0SA 4RX6A 2KN4A 3BSOA 2WCXA 4KV8A 3UI3A 3PW0A 5DQHA 3LGMA 3K5OA 3CCVS 4LRCA 2AYGA 2RRAA 2CVIA 4ED4A 4K4UA 1KHWA 4GC6A 3CMQA 4NCAA 5SZTA 8ATCB 2B7BB 3O2IA 1EETA 3MR5A 1FRMA 2NS1B 3LWLA 1MNEA 5J2NA 3W60A 4PUOB 2B4UA 1RABB 4HEA9 5H9FJ 3U1NA 2CPEA 3IN5A 3BGRB 4ZP6A 3KDOA 4M5NA 2JVRA 3MAQA 1F9EB 4OV1A 1LWCA 2CQ1A 4P10A 4UTGA 1RT3A 1XMQJ 3Q8UA 5J2MB 1UW9A 1VOMA 3QMQA 4PKDB 5KFLA 1Y5IB 2MZQA 1YJ9S 1I1GA 2QFIA 2VC0A 1RE1B 4C8OA 2C2MB 4QCLA 2E66A 1VCTA 4JI0J 2AYMA 1RBAA 2DGUA 3DGPB 4DV3J 4FVCA 2DHHA 2ZJPQ 1VBXA 5KFJA 3FFIB 3TUPA 1HNXF 4OX6A 3PCOB 3I6PA 3PX4A 4PEOA 2WRMA 5HROA 4X64J 2V0NA 5F9NA 4DR4F 4USIA 2CQPA 2RS8A 4H4KA 2WVCA 4DUYJ 4NXNJ 5ETPA 2MTLA 1GXLA 1LWFA 2DY9A 3NS5A 2B7CB 2DRBA 5F8GA 5CYQA 3EZUA 1HR0J 1S5ZA 2E5LF 1KD1T 2G1HA 4X4OA 4MFBB 1ZM9A 2I6WA 2AEJA 3HXMA 1DTQB 4O3QA 2UUBF 2AWZA 2BEFA 4OJHA 1LFWA 1CSJA 2CQCA 5DLGA 1LW2A 1FESA 3TR5A 1WG5A 2I0XA 4CLWA 1JLGA 4ILRA 5DGAA 2JWNA 4USMA 1TL4A 1D8ZA 2BKOA 2W9CA 4M1KA 3TUZC 1FXLA 2XMKA 2VKRA 2RF2A 4WBFA 1YJ7A 3OXGA 3TO8A 3QRRA 3GJRB 3EGNA 1FWPA 3UO0A 1RT2A 5HI7A 4DG1A 2WBMA 2HHHF 4IOCQ 3PXGa 2SXLA 4JYAF 3PJ9A 1M5VC 2DH8A 3H4DA 1WF2A 1YZ7A 3IS9B 4IO9Q 3QJPA 2QX0A 2BANB 1YJVA 1DARA 1V9OA 3W5YA 2IVMA 3CCMS 3A4TA 5LJ3Y 4RJVA 4KRWA 2UP1A 5DDRC 2R4FA 4I2PB 3CCSS 2ZH6A 3ZZPA 3BSAA 3DCAA 3JYTB 2B9EA 3G8SA 1UKUA 3F73A 4MIBA 4C8YA 2MLZA 4L74A 5B0CA 1MROB 2ZZNA 4AE5A 2HKEA 5C25A 2FJEB 5DQGA 2G9OA 1AB8A 2BQ3A 3H5SA 2DGOA 2ZE2A 5IS2A 3MUTP 3W66A 1KOHA 5HLFB 4WTYA 1XN9A 3L09A 4NZ6A 4RW9A 4UF4A 2XI3A 4Q8EA 3KLVA 2P8IA 2ZKTA 3ILJA 3TRGA 1YJRA 2R7WA 2IY5B 2PFDA 2YQ3A 3MM5A 5KFTA 2KM8C 4ZIVA 2BBEA 4ED3A 3QJJA 2I2YA 1F1BB 3ISNC 5DETA 1S1UA 2YKOA 1M1KT 3GONA 1WNEA 2MGZA 3UCGA 4ELUA 3TAMB 4HTJA 1NDLA 2CKWA 4H4OA 4IYQA 2QT7A 2ZUGA 4ZPVR 2ZBIA 2DHGA 1T03A 1FFSB 1W25A 3TEHB 1RZMA 3DLEB 2HHSA 4FZVA 3CULA 4KT0C 4CO4A 3GIKA 1R8CA 5EGYA 4ID8A 1Z4UA 1NKCA 4P52A 4NI2A 2F4VJ 1AYEA 1FJ7A 2FJWA 3DDIA 3UNGC 1V3ZA 4KFBA 3TAPA 2OD4A 4WIQA 4O44A 4JI4J 4PWWA 1Q8IA 2WSCC 3T9ZA 2KU7A 3VCDA 3W64A 4FPIA 5KT3A 4ZN1A 1F2HA 2DVIA 2WVEA 2UUAF 2G2YA 4OI3A 2ZZTA 2W24A 1KS2A 4GKJJ 3PW5A 1RT7B 2M8DB 4QIGA 2BE2A 4FF1A 2F65A 3UW1A 1VDHA 3V6DB 3M1VB 2XMTA 3ISZA 1MWYA 1UVKA 1ICEB 1S99A 2HWHA 3G86A 4DQQA 2HQGA 4JI3J 4K59A 1KVKA 2GV1A 2FHJD 2F9DA 3I55S 3AJ2A 2DD8S 1NK6A 3M30B 3MMCB 3KMQA 3R8YA 1GTEA 2EK6A 1FCAA 3H4BA 3M7VA 1JLCB 2VG7A 1LEOA 5DLFA 2KXHA 2XBPA 1IBMF 2J5AA 1XNRF 4OHXA 2HYIB 1FERA 2VOOA 1HW9A 3DRPB 3HVAA 4GKKJ 2QEXS 1TL3B 2HBYB 1MWZA 1B0PA 2K1RB 2MSSA 4F4WA 4H54A 3ENWA 3HX9A 1YIJS 2HURA 4BC9A 5KT7A 4JI0F 3C3LA 4DV3F 2HZAA 2LXUA 2RIJA 2D3UA 3PNIA 1RHKB 1VQOS 2RHSB 1DY3A 4MAKA 2FZCB 1Q79A 1S1WA 4X64F 1KN6A 2L9DA 3V2UC 2GW8A 5ETLA 4TY9A 2KDOA 2DCLA 2YH1A 3IWNC 2BRLA 4NLGA 3MPVA 1KOOA 3HMJG 2C3YA 3MAAB 2YWEA 4WCEQ 1FFGB 4LBIA 3UE2A 4ER8A 3E51A 3CDUA 3ZTPA 1XBWA 1CJKB 2VFVA 2LA4A 4DR5F 1WDDA 3W7BA 1DURA 2BJEA 3PX0A 1B64A 5M2PA 4RW8A 3R1LA 5HN0A 3LP0B 4DL4A 3VAFA 4W92B 1JXEA 2FY1A 3QZ8A 5AJ3J 2XZTB 2FLOA 2W9BA 4PQAA 3BEGB 1SBRA 2C42A 4P71A 3OUYA 4ANDA 2MJUA 2QO3A 4NMXA 4FYYB 2GJ2A 4B3SJ 3GR1A 2NZ4A 4DQRA 4GVBA 2F8HA 1HQ2A 5F8JA 1KWMA 1U24A 4CP5A 4KO0B 2QZ8A 1IVZA 3C16A 2CPIA 4OYBA 2J6TA 3ICLA 3Q23A 5ETRA 1UPPA 2QIFA 3HHNB 4A47A 2OLWA 3CCQS 3BJYA 1RTIA 4DL2A 2R42A 3B54A 3P45B 3OL7A 4L3KA 1N6QB 3QT6A 2GAGC 1JLFA 4KGKA 4RW6A 3WZ0A 5D0HA 2JNJA 4DPWA 1RK8A 2YNIA 3DC2A 2OMLA 2MZSA 4ICLA 3NY0A 3KMSA 3HVWA 3MOZA 5A2QU 1R8PA 2CQIA 2ZUAA 2B9XA 2IYIA 2AHOB 1NSKL 2ZHAA 3EZOA 2PMHA 4IR1A 5CCMA 4XTTA 4OYZA 2FVPA 4ZHRB 4YR3A 2XS2A 3EX7B 1JJ2R 2F8EX 3G82B 2BJ8A 3UD4P 4TLQA 2KFZA 1I6JA 4A4JA 2DITA 1Y5NB 1IBLJ 5GAEU 4RPFA 4GC7A 5DG7A 2EG1A 3M8PB 1UWBA 4USHA 3G87A 2GVZB 3F56A 4QW9A 4HLBA 5KG3A 4A8MP 1AZSB 3KHLA 2B4OA 1MSWD 2QV6A 3GZ7A 1KNZA 2CNLB 1QJHA 3GR0A 2W8KA 2DKOB 4WE1A 1R7IA 2KJVA 2MY8A 3AHPA 1GT8A 5GAHU 4OX8A 5A0YA 1R89A 2E7WA 3QIPB 1LKZA 4ANCA 1LWEB 4X65F 2HEKA 4TU8A 3J81j 3W9HA 1RTHB 2X3DA 1SC4B 5KG6A 1PCAA 4Z2XA 2XNQA 3LPYA 1XR7A 1WTBA 1QAJA 3TUJC 3MUMP 3LTOA 3D6MB 4ENOA 1H73A 1S0OA 2VASA 3R6LB 3KK3A 4JV2A 4FBTA 4CWBA 4RUAA 4CM0A 4TVAB 4J9NA 4LF4J 2KT3A 4R5PA 3AB2B 3C15A 3NMRA 3EMTA 5CAAA 1MLAA 5L9XA 3CE8A 1X9WA 4P7TA 1K0VA 3P8BB 3KLFA 3SV3A 2Q3PA 4BBYA 3AD7C 1SKSA 2W4CA 2VPXB 5LJ5Y 2B6AA 4I6WA 1LW0B 5CYMB 3U1MA 3BPSP 4FS1A 1FJGJ 2DH9A 1X4DA 3IC1A 1PJ5A 1TKZB 2HNDB 2OIHA 1S49A 4OHVA 4JOUA 4OI6A 1X60A 1YBUA 3HHLA 2IRYA 5KFOA 4Q8FA 4UZCA 1ZZNA 3DRXA 2ZNZA 3Q0AA 4USVA 5KFFA 3G4SS 2E29A 3FK4A 4HHHA 4FDFA 4CZCA 1Q8BA 1U6FA 2VBYA 2LQ9A 3SFGA 3BQ2A 4DV0F 1GXUA 2ZKUA 1KFSA 3W2WA 2F3JA 1EIYB 3MR6A 1Y3KA 2KL8A 2FVCA 2GHWA 1S6QB 4MYUA 4DBQA 1IKWB 4NYPA 4OZ5A 6AT1B 2Y8WA 3CJSA 1U02A 1ZBTA 1VJQA 2ROGA 2G0CA 1MG7A 1C2PA 4CIOA 4ZP7A 2AMCB 5M2RA 2ZJQQ 1BMQB 2VF3A 3Q8VA 3P96A 4M63A 3RW7A 3QLHA 4TU7A 3G6ES 3KHHA 4A8FA 3C46A 3QO9B 2ZM6F 2GIQA 1H0HB 3O44A 3V81B 4HKQA 1RGVA 4ZJLA 2H54B 3TX0A 3FJ2A 2Q79A 3LUYA 3MAHA 1RCXB 4QPTA 3CSKA 2BVZA 4U95A 3DM2B 4KY3A 2WOMA 4J5OA 4X66J 4GRSA 1BWVA 3NGTA 1S0VA 1TL7A 1S0NA 2CQGA 2MZ1A 1VQ5S 4N76A 5FJ4A 3DOLB 2FJDB 4ED1A 5DZ6A 1HA1A 1IKYA 3HSGA 1M1HA 2OP5A 1SJQA 2EPIA 2XEXA 1HBUB 3NCQA 3AXMA 3PRVA 3M6VA 4E98A 1N34J 1M5HA 1GK8A 2MYFA 1IUJA 1MMNA 1BQNA 3N01A 5IT0A 1HFEL 1TV6B 5DO2A 3WX8A 3UNYA 4K7QA 1SL1A 1XR5A 4N47A 1KQGB 4URGA 4UQGA 4OZ0A 4C2MA 1H7XA 2BJ3A 3D9BA 2LP4A 1FK9A 2GIFA 1OYEA 1RISA 1UTAA 3CJRA 5AXKA 4LUBA 1TUVA 1F5AA 1UVNA 3NP5A 4QYZJ 2KG0A 3UCZP 5C5JA 1R6YA 5K20B 3PHEA 2R2RA 5EN1A 1SUQA 5K8OA 3AQOA 1U47A 3VWSA 4DWIA 2DIUA 4ID5B 1DLOA 5T7LB 3LP2A 3LPEA 1XEZA 1L3UA 4USJC 3T1YF 5CZVA 3BR9A 3K5MA 2F40A 3KG0A 1NM2A 3FMWA 4XAKA 4DPOA 3PKMA 3E2EA 1UVLA 5GADI 4CTAB 2YNFA 2AEMA 1ELOA 1NDKA 1IKXB 1ZM3A 2XSJA 2G2ZA 5FIIA 5A2QY 4LR8A 3B82A 2PN6A 3QQCD 2K06A 3S6EA 3GSDA 2DO4A 1QSYA 1Z2LA 2OEKA 5L1IA 4FNIA 2ASYA 2DNOA 2HS4A 1G7CB 4LVNP 2PE8A 1KQKA 4B3TJ 1NZ8A 4RNFA 1SB6A 2RJZA 1K8AT 2JC1A 1IM4A 4ATNA 1YK9A 2ZOGA 3K59A 3MPWA 1X0FA 5KAKA 5K8NA 1U45A 5HMWA 1BLUA 4Y3CA 4LF8J 3IR7B 3C6UB 4ECRA 2Y9HA 2QYCA 2BKPA 1IR0A 1JLQA 7FD1A 3TZWA 4MKVA 3VAHA 3QBCA 5A6WA 2UXDF 4PPDA 2PDAA 2MKSA 3VALA 3SYZA 3KG1A 1WHYA 5LSRA 4GO5X 1BQMA 3FRZA 2IRXA 2HQIA 3EGWB 2CJQA 4KGMA 5HQMA 4DR7F 1NDCA 4B3MJ 3BYPA 2KFNA 2V63A 2HW3A 3D67A 3DYAB 3OVSA 1JIHA 5F3TA 4LF4F 1GMWD 3CJ4A 3NKYA 2J7KA 1T05B 4UUWA 4X2BA 4NE9C 2IAJA 2X1AA 3R1HA 5B0AA 4H4MB 1TTHB 1RU1A 3Q2TC 5H9EK 1X5PA 1X4FA 1FX4A 1S1TA 5IC4B 5C24A 3EDRB 4QIWD 5HAOA 1JNZB 4DV1F 3N5FA 4U7CA 4YR0A 1WKLA 1T9WA 2KHCA 2CJYB 3CCTA 2V4JA 4Q2LA 1FHTA 5L8RC 3TQ1A 2AGQA 1A6LA 2POKA 2HFZA 5DDQC 4OHWA 1X4HA 3KFWX 2CJ9A 2CWKA 1FRJA 3LO3A 2LQJA 3IGNA 2C2NA 2ASDA 3OHAA 1D9AA 4HACB 3NGSA 2OPSA 4IQMA 5IM0B 4AL5A 4P75A 1T9YA 1N48A 1ZAVA 2F8MA 3CO9A 1V5VA 4ZVOB 2M0GB 2UUTA 2Z2YB 1SQFA 2V6AA 5T14A 3GYNA 2J0WA 4IG3B 1MW7A 4ED0A 1CC7A 4HVZA 1VRUB 2Z2MA 3DMJB 3FNNA 5F3ZA 1GMUA 4XK8C 4TYAA 3KNGA 2R2TA 5D3GA 2R2SA 1VQ4S 1WC6A 3C6TB 5KFBA 5K14A 1JXVA 3Q83A 5BR8J 4QWDA 4I6AA 1JLEA 4DFMA 4EGLA 4CH1A 2AJFE 1YJWS 5A8WA 1M1GA 2XO6A 4J9LA 1WD6A 1JLAB 4OJGA 3R5BA 2FYXA 4ZPAA 2X1GA 1S1XB 2FB0A 4PAAA 3K58A 3NEKA 3G6XA 3WBZA 3CPWR 1HD0A 2RDJA 3UDVA 5H9FK 4IFVA 3CCZA 1NK8A 1Q53A 4USUA 1RHUB 2MXYA 4YY3F 1VC5A 2LDIA 2CADA 4JI2J 1D8YA 4LF7J 3I0RA 2IMOA 4YHHF 3AD9C 4C3LA 2QLBB 3GIRA 3J80U 1S57A 4IQXA 2KRBA 2NYIA 3C19A 4Y2IA 3DI6A 2RT3A 3T1HF 5GVQA 4TLRA 1C0UB 1T7PA 1FVQA 1WC5A 4P9SA 1YBAA 4ZA1A 3TX8A 3BGRA 1DBDA 3GV8B 2XMWA 1Z2ZA 3TZXA 4JV0A 5L39A 2KVIA 3RRGA 4UOCA 3V6JA 3B6BA 1NJXA 3KHRA 2OO4A 4NWBA 1X31C 1XWLA 4WP9A 4KB7A 1S97A 5CXTA 3K8WA 2Q6BA 2VPZB 2QSFA 2XQCA 1NZAA 3W9IA 4PWDA 5GMDA 3BKUA 3I82A 3NAIA 1S9GA 2OPRB 2H9ZA 3SFUA 2DGXA 4NEZA 4KH0B 2DPJA 3P49B 3FEZA 4CYUB 2RKIB 4AUKA 4KH1B 1LFPA 3Q8SB 4OI0A 1AT1B 2FHMA 2KZMA 1KLMA 1VBKA 2CWXA 4DSIA 4I6YA 3TA2A 2XULA 5CCLA 4CLYA 1SJ1A 3PW4A 1FDAA 4ED6A 3R27A 1KFDA 3EM1A 2ZDOA 2XTJP 4JP8A 2E7VA 4J9OA 3GMGA 4X4TA 1HWJA 3PRDA 2M3DA 5AE1A 4JI8J 5I42B 4C97A 2HBRB 4OIXA 4BWJA 1IQZA 1XMOJ 1FWLA 2M88A 1FKOB 4QR2A 2VQFF 1RAAB 4KPCA 1RDRA 2IDEA 4DHVA 1OY6A 3ZTRA 2R9LA 2FC8A 3MMJA 1AFJA 3MM8A 3W63A 1VRTA 1HWLA 4IRCA 3HM9A 4DV5J 3D3BJ 3NBPA 4RBVA 1X9MA 3IG1A 3E01B 2OAUA 2VONA 1X5OA 4J37A 3R5DA 5AE2A 2QSWA 1B70B 4NYZA 3WHIA 3DXSX 2LU1A 1X4AA 2K2PA 2NUUG 3A1YG 3W5ZA 1H38A 4JV5J 5KG2A 1S72S 2FLLA 3H5UA 1LWXA 4J9KA 1FTCA 4ZPBA 3R5JB 2RD5C 4JI1J 3JYTA 3Q86A 1FD8A 4QIFA 5FDLA 2MQPA 1P9QC 1R0AB 2ZVIA 1WC3A 4D3HA 3NCRA 2EI5A 1S4FA 1FNMA 1F9FA 1PSDA 4RZRA 4B9NA 1OY8A 4AT1B 4F0HA 1N33J 2CQDA 4RWWA 1PGZA 2CQHA 2V50A 5D0EA 1X7VA 3SDEA 4V19X 2XYGB 2DNLA 5ETVA 3CCUS 4LRFA 3VGUA 3T41A 4DF4A 2MB0B 2RUGA 4C3MA 2UU9J 2DCUB 5LMUF 4IRDA 1APSA 2HAFA 4IUFA 3I5CA 4L75A 4B02A 2J0QD 2MJNA 2E9RX 3MECB 3I5AA 2XMJA 1R8HA 3MTJA 3TQEA 3LOUA 1C0TB 2B5JB 4MIWA 3NS6A 3CNQP 3TAMA 3P6YC 2YX4A 1NSPA 2PA8D 4ZKAA 1YHQS 2J8AA 4K5RA 4AYBD 3N0VA 3O8WA 2XHWA 1ULRA 3M9MB 5ETOA 1VHIA 3C8YA 1SV5A 1EHWA 2ADCA 1FDNA 1TELA 3AQPA 3DLEA 2MQOA 3OSNA 1EARA 2DHAA 2VL1A 2AW0A 3MEDB 1Y3JA 5AXNA 4LF9J 4C11A 5IXUA 3BH6B 2HHUA 1XTZA 4LFBJ 3PZPA 4M5GA 1FDDA 2BZ2A 3A3OB 2APOA 5J1NA 2RHQB 4CM2A 4ED7A 2VJUA 1NEEA 2RRBA 2IVYA 2VD3A 3CIZA 1KC8T 2J7WA 3PIOQ 2XMVA 3BKTA 1OPIA 3OFEA 1CG2A 5HSPA 2KT2A 1NHVA 1RT5A 3RBZA 1N0UA 1TAQA 2E5JA 2RRNA 5KFPA 3FBBA 2CPDA 2RDDA 3QAUA 5B08A 8RUCA 5HATA 1TU0B 2HPUA 2ZITA 3UN5A 3IAS9 4J90A 5D4OA 2R2UA 5BYQA 1DTTB 4DXLA 3CT9A 5C2CA 3UWTA 2DPIA 1ZZFA 1VJWA 4QWCA 4MIAA 1CEZA 2V8DA 3D2WA 3MMCA 5D8HB 1HNWF 4DFJA 3K57A 2JRSA 1UJ5A 2FJAB 1FNOA 2AJ1A 1I51B 1UEKA 1D09B 5ADZA 3HLUA 4ELVA 5IWAJ 3FSYA 1TP7A 1HIYA 3FBCA 4RLEA 4HL9A 2F4FA 4UZBA 2ZH1A 4DJBA 2V68A 2NQPA 3MCNA 4JI5F 3J80Y 1C1CA 2WW8A 4LF2A 4M5MA 4C98A 1UAWA 1U49A 5HQ8A 1TL3A 1HBNB 3I32A 1KP6A 2FPHX 2RQ4A 1R8BA 1O8BA 4NLWA 1WORA 2K1RA 3TW0A 3CD0A 1PBAA 2FZGB 1F60B 2R7UA 4QWAA 3R5GA 3TARA 1RAIB 4J9SA 1PILA 3HVTB 5K9FA 4OX7A 1I5OB 1RLDA 2FVRA 2BJ9A 1RBOB 4GVLA 4QWEA 4V1Ak 1S7HA 5D4NA 1JJ4A 2HLUA 2C28A 2R7OA 4RNMA 1CJTB 3X3UA 3QGPA 3ISND 4LR9A 2DGSA 1QM9A 2RQMA 3DKDA 4EUVA 2GQQA 4DX7A 2Q6CA 4O23A 4JI7F 3PY8A 4K4VA 3T6JA 3OLBA 1VRQC 1CJKA 2OPPB 4KHPJ 3CDBA 2YKMA 5I3UA 4RU2A 2E5GA 2HGLA 4P2XA 4ZITA 3KDNA 4OZNA 3QRPA 3SQGB 1OQ3A 1XMBA 4KSEB 4EO6A 2K7JA 1UWAA 1ZOTA 4AQYJ 2L9NA 4ZPWR 5LL6d 3ONQA 1J2VA 4OL8A 4OYMA 3FGVA 2DO0A 4DUZJ 1N32F 1IKVB 3HO1A 1K1SA 2D3O1 3CJKB 1H3DA 1NLKL 3DNCA 3OR2B 2CPFA 2VUGA 4CO5A 2HNYA 3SZ2A 2W1BA 4FP9A 2RH3A 4FNHA 3IRWP 2E9TA 3HVRA 2FVQA 2YNGA 4ZJQA 1J5EJ 4KV8B 3UN3A 4ZVGA 1YQHA 4NL5A 2PI4A 2KG1A 1B0VA 2FHJA 1BUXA 1RAEB 4KHRA 5IV3A 3NCPA 2LDYA 1HWKA 1U1NA 4K4XA 4PG6A 3CJQA 3LGHA 1REGX 4ECUA 1QTMA 1L3KA 4X84A 2HK3A 3TAQA 5ETTA 2J6SA 4KGVB 3M2UA 2JVOA 4RKUC 1VHFA 1YJNS 5J2NB 3TUIC 4MK9A 4P2MA 4IH5A 1LQ9A 1XIQA 2OKQA 4MMOA 5DRKA 4KQZA 5E41A 5LOQA 3VVTA 2V69A 4N5SA 5LM7E 4KYZA 4KGXB 2ASJA 2IM1A 1PAUB 2IM0A 2XNRA 1LWCB 1RT3B 4X4NA 4QR0A 3GU0A 2ZOFA 5KT6A 5IOLA 4E8UA 4N77A 2E1RA 2IC3A 4LVOP 1P27B 3G82A 4CDIA 3H42A 3P3DA 3K17A 2DR9A 4O3PA 4U7UK 5E5NA 2MKCA 3OTEA 2HHVA 2H5EA 1QD1A 2EEYA 4WJBA 2AJ4A 5E3RA 3VZHA 4OI4A 5CHCB 1JB0C 1HLWA 3M8PA 2WBRA 5JVHQ 3DOKA 3OTOJ 4F3OA 3AAWB 4DR2J 1QAYA 5HROB 5F9LA 2HQFA 3DRSB 3Q8QB 1FT8A 2W9AA 5HBMB 4LQ3A 3WX4A 1HMVA 3V5RA 2V9WA 5KFYA 3NWGA 3UR3C 4LF6J 2UV8G 5KFRA 3NS7B 1HNVB 1EP4B 3RAMA 3F44A 3JAMU 4R25A 3PVXA 3DLHA 5CYQB 2H3EB 1F6TA 2CVEA 4DQPA 4LF9F 2M8HA 1MN9A 3W3SA 4OQJA 2B8QA 1NJIT 1RTHA 1SVDA 3LA0A 2XLJA 3AD8C 3K7RA 2ZH2A 4YDDB 4CH7A 5IT4A 4RW4A 1R3NA 2WSFC 1LW2B 2H51B 2RUSA 1JLGB 2ERRA 3J81U 1YTYA 1REVA 4ZCKA 2P6TA 2E5HA 2W9CB 2YBVA 4HYKA 4ZLNA 4IDKA 2M4MA 2RE1A 4U96A 2UXCJ 3IGVA 1FKAF 2HWIA 4DZDA 3ET6A 3JTPA 1F0XA 2DXDA 3FQKA 3GYXB 1X9SA 1RT2B 4QQBA 4DG1B 4B08A 4K4YA 4J9MA 4LSLA 1WDTA 3CTRA 1G2EA 2OEJA 1LW0A 1YJUA 3EE3A 2H5IB 2KO1A 5J1EA 3O6QA 5A76A 9ATCB 3WIUA 2CQ2A 4FBUA 1NDPA 4B3RJ 1H2TZ 5ETQA 4DV7F 3HFZB 3T3FA 1G1XA 2ZH9A 2P9GA 4F4YA 1WG4A 1QSSA 1VQSA 4J9VA 5L1JA 2DNGA 1OS5A 4X62J 1WEXA 1TK8A 4CO3A 4F36A 4WKRA 1YVFA 3MEEB 2L41A 5C25B 1JLBA 1U2RA 2X1FA 3H40A 5EDWA 3W1YC 4L73A 2ZE2B 2R7XA 3R97A 1RACB 4DOZA 3L3CA 4QU7A 2O5DA 4DI6A 3HDSA 2WZ1A 4F8RA 2LECA 1S6QA 1IKWA 3CMES 1U1LA 2YX1A 4C0BA 3AB4B 3P4UB 2QFJA 1WF0A 3ENQA 3MXHP 4RW7A 2KH9A 4LIWA 2IVFB 2RNEA 5CQGA 2XM3A 3MCSA 4CO1A 1S6OA 1W7WA 2KYXA 4DR1F 1QVFR 1S1UB 1RLCL 2EFGA 5FD1A 2DK2A 2MGZB 4ZVFA 3QFHA 2Z2LA 4FKXA 2Z8QA 4NLXA 3POTB 4WFAQ 3VVUA 5DM6Q 1WC0A 1LV5A 4URSA 3ETOA 4UQTA 3BR8A 4O3SA 4S0MA 4FF4A 4B9TA 4O3NA 4PZVA 4LF5J 1ZPWX 1F9HA 1FA0A 3HI9A 2EFNA 4K5SA 3GFHA 4MJKA 2QYGA 4NI2B 3JSMA 2GQCA 1CBKA 4I69A 1DAXA 1JJCB 2R8HA 2HVDA 1IBKJ 4C6AA 2DNHA 4KFBB 3MD3A 5A8RA 3PO4A 3H98A 3SSSA 3BBCA 4TU9A 4O44B 2YWFA 5KFWA 1TV6A 1UFLA 3IA0A 3T5KA 4DX8H 4G1PA 4I56A 3DU5A 3HFVA 5E33A 4NRUA 3R7NB 4QYZK 1FF2A 2XGPA 2HQCA 2QRRA 1RT4B 2A6MA 1GQEA 2PO4A 1NK5A 1JXLA 5IFMA 3CGIA 3D66A 3M8RA 5HK4A 4QWBA 4NRTA 2BE2B 3JS9A 2MY7A 2OTJS 1R31A 5D6GA 4P72A 2VDHA 4OYXA 2ZBQA 2DJWA 2OMOA 3H2UB 4F7VA 3ZFVA 4RUCA 1KBRA 1Q82T 2ZOMA 2WTFA 2IDLA 1Q7LB 2FGOA 3W9JA 1NNDA 1RHJB 1Z1ZA 1TMMA 2RILA 3AODA 4EK2A 5J2PA 3HP6A 2VG7B 3DHWC 3D0IE 2L9WA 1T9VA 4BC7A 2AF6A 1U2FA 1EAYC 3VAGA 4CLUA 3LANA 5F8LA 1S77D 2XLIA 1XNQF 3H5XA 4URQU 1VQYA 3KTQA 4CTAA 4ERDA 5KT5A 2NZCA 2PIIA 2I5JB 2WK4A 1YG0A 3NAHA 4DR3F 3IM8A 1HBMB 4PG4A 4LFAJ 2VPWB 3DHXA 1HI1A 4EWTA 2UXBJ 3OXFA 3EPIA 2OEMA 2NLWA 3NWRA 1TAUA 4IH7A 3GJQB 4X4UA 1HKAA 2CZ4A 4WFZA 1RT6A 2W2OP 3OL6A 3C14A 1MMLA 1S1WB 5L9NA 2XG8A 2V8GA 3GSIA 1TUWA 4FYDA 2VBZA 2BJ1A 1HYSA 4M5JA 4NLDA 2JOQA 4NXMF 3PYDA 4RBUA 3VQTA 1RTDA 5HVHA 2CQ3A 3N28A 5E0OA 1CJUB 1UJ4A 2W4DA 4F3MA 4F4AA 1OMSA 4NA2A 2IYGA 2FZKB 1J5OA 2FDNA 3H59A 3MCOA 1G3OA 1UA1A 3PFEA 2Y0BB 3LGNA 2MKHA 4EEYA 3HCXA 3JAMY 2P2CB 1S59A 5D0GA 5HJYA 2V94A 2YQ0A 2E1AA 3M05A 5BYRA 4ZPTR 1T11A 3VR1A 1X5SA 2CA9A 4WTOB 3CWJA 4GVBB 1T05A 4ZVSB 2PMZD 4Y28C 4H4MA 4UUXA 3C16B 2XS7A 2AP6A 3Q8YA 1SL0A 1RKJA 3J81Y 3Q22A 4WF9Q 4K2JA 1RTZA 3W2VA 1I94J 5EHHA 1RTIB 5F41A 1U1OA 2LQBA 3DGVA 3IRXA 3C2PA 4ZP9A 5K8MA 2RQCA 1QUPA 1O5JA 2YXLA 2GA7A 4WZMA 4A8OA 3V4IA 4PRFA 1OPZA 4CRJA 3RAQA 3DOMB 2B43A 1KR4A 3KLHA 4UOFA 1X4BA 2YNIB 3VGTA 4ICLB 5K8PA 4QIVA 4DL3A 2JX2A 1PJ6A 1SC6A 4DSJA 2VICA 4DL5A 2VODA 2HWTA 2EFQA 1M5PC 2HZVA 1EZZB 3NGRA 2UUCJ 4WU3A 1WG1A 3GWCA 4DDFA 4ZCIA 3M32B 2VG5A 4NA1A 3I4HX 1IM6A 1RCOB 2BE7D 2G0JA 2ATLA 4XDCA 1CQNA 4IG3A 5CD4A 3DMJA 1CS4B 3RBXA 2GMHA 3FEXB 3OR1A 4ES2A 2QA1A 1W2BR 5DZ7A 4ZMMA 3A8IA 2CUYA 4Q0BA 1F2GA 3WIVA 4WXOA 4QZVB 3C6TA 3JSBA 1RU2A 5L38A 1UWBB 3AOAA 4O4GA 4C4WA 1TUGB 1N5VA 1GMVA 2HQ3A 2LA6A 3H8YA 4B9VA 1HWIA 4DSFA 4LT6A 1Y4ZB 4WE1B 1SC3B 1Y0HA 1JLAA 2YY3A 4LBPA 5LSLA 5KFNA 2V8PA 5KFEA 3LP1A 4KIAA 5A0YB 4H4KC 4G3IA 1Q1KA 2K7KA 5B0EA 1NH8A 5J2QB 2GMLA 1YZ6A 1V6HA 3SCJE 5D0RA 3FQLA 2LEAA 2VFTA 2P9CA 4LFCJ 5ETSA 4RBTA 1HHTP 2QLFB 2K3IA 4K4WA 2CZ9A 2AKWB 3H90A 5KFCA 2DXFA 3I4PA 2VHGA 3FBEA 1GMWA 3FRYA 3GE9A 4K4SA 2L3MA 2XYPB 3KK3B 3CUNA 3CIMA 4DV2F 3D54A 4R5PB 1UEVA 2Z57B 1HI8A 4OZLA 3C15B 4Y2MA 3I31A 4NPOA 2CYYA 4RUHA 1BHNA 2ILYA 4ZJOA 4FVMA 1N36J 4OYPA 3AOCA 3J7ZT 3RAXA 4AFFA 3HD2A 3ZZYA 5AE3A 4KBIA 3SCKE 1U48A 4ZVUB 4Y34A 4Z7CA 2B6AB 1N8RT 2NUHA 3TJAA 4PPZA 4ZPDA 1JX4A 4BHQA 4Q44A 3BO4A 1ZM2A 1HNIA 3M8YA 1U0HA 2CNNB 3RB0A 2GHVC 2DISA 2MEWA 5I3PA 4JUZA 3VGSA 4YOEA 3RUBL 3PYEA 2RAQA 4HDHA 2MSTA 5JVGQ 3L7PA 3CEDA 2Z0GA 3CCJS 4OZ3A 2DT9A 1GNKA 2C1EB 3KK1B 3IMQJ 2OUGA 1VIXA 3QFWA 2XY5A 3OSPA 4UY8T 1KVJA 5AXMA 1QE1A 3CJTA 2AIRB 1X5TA 2Q66A 2LMIA 2QLXA 3EXYA 3NLCA 4M94A 2AJQA 2JL9A 3U1LA 3QT8A 1FJEB 4N8NA 1XMQF 2Z56B 5LMNJ 3MUVP 3MMBB 5KFQA 1NBEB 2CG4A 2VQEJ 3K2YA 5LSOA 2RMLA 1FO1A 2P6SA 1SQGA 3MHYA 4OYAA 1NCLA 4LIRA 5I42A 2J7UA 4I2QA 3W62A 3MCMA 1QY7A 4WFBQ 2HHXA 3ZZOA 3TI0A 2C2EA 4K2XA 5HVFA 3PRBA 2KJWA 2OD6A 2Y1JA 5CH7B 4NCGA 1P1TA 2WOMB 1KSPA 3BO2A 2ALZA 3PFOA 4EZ6A 4USKA 5L46A 5E3AA 4DUYF 4NXNF 4ZS6A 1TL7B 2QA2A 2ZH5A 1RAGB 3OLAA 2VC1A 1U1QA 2LKZA 1IKYB 2NXUA 2MQNA 4LR7A 1HR0F 2ZH7A 1RWVB 4HT5A 3KOAA 1OJ4A 1BQNB 2NXNA 3H2LA 1CLFA 2Y1RI 3QIDA 4DS4A 3DRRA 2ZH8A 2JFDA 2MHEA 4EBCA 4IFYB 2FJVA 2HFVA 3I5BA 3ELHA 2X7IA 2J9CA 2GO9A 2HMIA 4W4MA 5AT1B 1FK9B 3MOJB 1XR6A 3KJQB 1N5TA 3R2DJ 5DS7A 1SJRA 1QTNB 2HVZA 1J27A 3US5A 4WP3A 1VQ8S 1S0MA 4FXVA 3VV2B 2DR7A 1H98A 1SUQB 1FRHA 4NEYA 4OZJA 1DLOB 5KFUA 1RJJA 1FE4A 3M2VA 3EVWA 1BQXA 3LP2B 2BMBA 1OYDA 1PYOB 3I0SA 2IJFA 1HNXJ 2QMXA 5EWGA 5ETMA 5L1KA 1W2IA 1BY9A 1BGXT 1Q78A 3CD5A 4DR4J 3MEGB 1S48A 1VLYA 3ETMA 1KTVA 3PYFA 1RAOA 2XSJB 1WWHA 4GO7X 3NG8A 2HHQA 3PHTA 1VMBA 2DNRA 3KLGA 1A9NB 4DN0A 4NMLA 2E5IA 3M8SA 2OH2A 2E5LJ 3CCRS 3THTA 2LU2A 5KT2A 4NLVA 2WVDA 3T5JA 5FLXU 5CA5A 4N56A 3QZ7A 3OBIA 2UUBJ 3I56S 4YMEA 3CJ0A 3CCES 2W7PA 2IBKA 3EXCX 2GFFA 3D7SB 1WHVA 2AJ2A 3M8ZA 3BREA 2D9OA 3RW6A 1RTJA 2GAHC 2H65B 3JXOA 1TK5A 2OFHX 4O4RA 3GG0A 3DDKA 1R27B 1JLQB 2HHHJ 3QYYA 1XQIA 4JYAJ 3ITHA 2ZH4A 1DTTA 2BA9A 1NB2A 2F4VF 1BQMB 1QDUB 1NUEA 2OPQA 3A8KA 3H25A 2EKYA 5HL7Q 3PYGA 3EGZA 4DZ6A 2R7VA 5HJXA 3A8JA 4ED8A 3OTCA 4JI4F 5B09A 4Q7AA 3FBFA 3PACA 3GP9A 3EVMA 5GAEI 4RUBA 2IAJB 3FEYB 3SI8A 4NA3A 2V8HA 4M8LA 3QSYB 2C3MA 1TKTB 2FIUA 3VGVA 4GKJF 3NOCA 3N6MA 2Y8YA 1L5UA 1S1TB 5C24B 1WEYA 3UFCX 1YRUA 1E6VB 2V4QA 1HQUB 2KT5A 3N5BA 3DXBA 3IP0A 2YNHA 4PCQA 2HSEB 4A8XA 1JNRB 3PKYA 2WVFA 2AV5A 4MK8A 1U8SA 1Q4RA 5GAHI 3GFZA 4DL6A 2E1MC 2PD1A 1Q5YA 4JI3F 3HVTA 1D9FA 3QT5A 4ZLLA 5ETNA 3NXZA 1VYAA 3HKWA 4OLOA 4M5KA 2EW9A 4DS5A 2PMWA 2K8GA 2OPSB 2QLJB 1VQPS 3NNHA 2IA6A 1HHQA 3MM6B 2VFRA 3KLIA 2BV3A 2AJ0A 3UVJB 4DU7A 1CJTA 4DPTA 2JLGA 3TJ9A 5CABA 3DLKA 4C8ZA 3H2VE 3BV8A 2FJXA 1RAJA 3IR5B 3KKFA 2RB7A 2YVSA 3AJDA 4BS2A 4GKKF 2HAIA 2OPPA 1GFWB 5KG5A 1R8AA 3HT3A 4R0EA 2MHNA 3VZIA 3SQGA 4WU2A 4TXSA 2NXJA 5D3GB 2W01A 2J9DA 4Z7YA 2L08A 2BM0A 2DNNA 3DDNA 2M9KA 4EI2A 2A6OA 3FZ2A 4CCHA 2OFGX 5K14B 1JLEB 3MM7A 2PI5A 3ADAC 2ILZA 2PSZA 4B9UA 1EKSA 1HBOB 2FD2A 1FXDA 4DQSA 4F4ZA 1U1RA 1UP1A 2CPYA 2MZRA 3Q8PB 2J8SA 5J1PA 4P73A 4PWUA 4PYAA 2UUAJ 4J7CA 4KJIA 1HPZA 3FSXA 1G4CA 1WSRA 4DL0C 2XWXA 2BW2A 2CXEA 3CD7A 1U1KA 3OJUA 2WONA 2WB4A 2ZVSA 3HSDA 3K0JA 4IFVB 1GX5A 1NJYA 3EVOA 3A3PB 1NKBA 1C1BB 1RQ0A 1SH2A 1TKXA 2NXCA 4TQRA 5EX0A 2F7VA 1K47A 4C7QA 5KFKA 2LYVA 3QGHA 3I0RB 3HHEA 2XB2D 1RT1A 1WTFA 5AJ3F 1CULB 1NXIA 1VISA 3RG6A 3DI6B 4Y0FA 3A3NB 1UZDA 1ZS6A 2KXFA 2Y3YA 4B3SF 1IBMJ 2JC0A 3MFIA 1XNRJ 5MAOA 3SSQA 3M8QA 1UL3A 2YWWA 3LQVA 3CDWA 2UVRA 4F50A 3OXLA 6FDRA 5MLCV 3TZYA 2N4DA 2BOPA 2GC8A 3N9UC 1DRZA 1FNXH 2ZFHA 2XZWA 3T9NA 3TP2A 2W2NP 5G0RA 2BW7A 5C42A 3ZZ0A 4XPEA 2MZJA 2IFXA 1K0TA 3NGKA 3PR4A 3MTKA 4CLPA 4IG0A 4J9UE 4PWDB 5LT5A 2D7SA 2ZD1A 1UA0A 4KPYA 1S9GB 2HRYA 3TVZA 3R7BB 4O3OA 4O0NA 3HHLC 5HP1B 1DQ8A 2ZBPA 3G8QA 1UMJA 3ILLA 4HI2A 3HULA 3CC2S 3IAM9 3M9NB 1SIWB 3DRSA 4MTPA 4B9MA 1HL6A 5HBMA 3RGIA 4KKOA 4R8UA 1KLMB 4MT1A 2M70A 3TJ8A 4G6VB 3EICA 2J9EA 1Y5LB 1HNVA 3WC0A 1EP4A 1T94A 3HZGA 3ZO7A 2UVVA 3QJLA 4JI6J 3IXQA 1AFIA 4DR5J 4CO2A 4DX6A 2JZ5A 2QMUB 1VGYA 2MQ8A 2ZH3A 4B9SA 3GG1A 5I3QA 2X1BA 3P5BP 1IBLF 2VA2A 4DX5A 2JDJA 3PW2A 2MKIA 4A8SA 4IOAQ 3MPDA 2J76E 3FCHA 3M2RB 3MPUB 3D68A 4WPAA 2ATCB 4A46A 1UVMA 1HD1A 2GJIA 4ECYA 4ZVTB 4KHMA 3MMAB 4B17A 3JTOA 1HQEA 3MM8B 2G13A 1VRTB 1KKHA 3GFYA 2BR0A 1N4LA 2BDPA 1RWUA 2XY7A 4QR1A 2Y1LB 5FLXY 3NBPB 4A8KA 3M6UA 3IG1B 2CPZA 3KWMA 1CJVB 1SPBP 5KG1A 3E3XA 3BDPA 1FKPB 3HJVA 3ZNUA 1RWPB 3CF5Q 3QWUA 1IWGA 2AGPA 5KFDA 2DNMA 1CC8A 3OV7A 5HMYA 1PO6A 3X1LB 1B7YB 4ZK7M 3VHQA 2CIMA 5DJBA 4U8VA 2PA3A 3RJMB 4EFAC 3OT9A 5FDLB 5E3CA 1RWWB 2JLFA 1L3TA 3CVKA 4ZDNA 2Z4PA 3MEEA 4LRDA 4ZLJA 3MM9A 1UZHA 2WVBA 1WEZA 5EWFA 1LXJA 2MPUA 3CC4S 2WB1D 2VZ9A 4F26A 3SDEB 3KK2B 2CZVC 1T9XA 3U02A 5U47A 4ILMA 4P7VA 4HI1A 2CQ4A 3ZTQA 5DGBA 1FJGF 4M5DB 2DRAA 4DLEA 2R7QA 1WC1A 2C2OB 2I8EA 1M5OC 3ZZRA 3ULHA 4B3OA 1ZYQA 2GX8A 2CJAA 4RNHA 2XSFA 2HIYA 1X0PA 2A1BA 1B0TA 3HSZA 1D9DA 2MDAA 1T95A 3HHDA 4DL7A 3I9V9 3FDSA 1RADB 1NPRA 3POTA 2V5HG 4FXDA 1YSJA 1BE4A 3PM9A 4RNOA 4G1QA 3T5HA 1UVJA 2AT1B 4LSNB 1SV5B 5BJRA 3FVYA 4A8QA 1YJTA 4ILLA 2KXNB 3LH2S 4C11B 4NZ7A 4X65J 3GB0A 5A8KA 4HH0A 2MMYA 2HNZB 2O01C 3BBBA 3BM7A 3S1TA 1U25A 3K5LA 4I7FA 5E3QA 3WC2A 2M7SA 3PEJA 3OTBA 4NZ0A 4CI0B 3VAIA 1RWMB 4X4VA 4XO0A 1TQLA 2DTJA 3JTNA 2HLTA 4L3NA 4L6V3 3CMAS 4HTIA 1UW4A 1RT4A 3MEKA 3S8SA 1UCNA 1JKHA 3V6HA 1RT5B 2E1PA 4LF1A 5F8IA 4ZCLA 4HDGA 3CJ2A 4X66F 3BYRA 3DLGA 2VA3A 3OFGA 2LQ8A 3HT0A 2COLA 2D3ZA 2ZEJA 2GNKA 3EDQB 4W90B 3KG4A 1TKDA 4WK1A 2W2QP 5B0BA 3M6XA 2G1DA 2NXEA 4HR2A 1KQSR 1N34F 1D1UA 2F1FA 3G6YA 3AT1B 4IO1A 1AW0A 2JJ4D 1OSCA 2GVDB 3J7A1 1WACA 4F3QA 2DEJA 2JHEA 3UDCA 1YX2A 2C2RA 1V5IB 1NB7A 4PUOA 4DV0J 1I3OB 1TR0A 3NMAA 2LXFA 1EKRA 1C1CB 3F0NA 2I5JA 5KG7A 2B56A 4KE5A 3EWGA 2V67A 4X4RA 1VQLS 3CD6S 2I1RA 2EFOA 2BM1A 1HBMA 4DPXA 2BUNA 1Q86T 1M5SA 3JB9k 3D28A 3QNWB 2HFSA 2DY1A 2E7XA 2W7AA 2VFSA 4K8RA 5J2MA 1U1PA 4IH6A 2U1AA 3QRQA 1SC1B 4KTQA 2MLXA 4DPUA 1QVGR 2VBXA 4IRKA 4FF3A 2AZ1A 3HK2A 2QN6B 4QW8A 2YKNB 4D3GA 1EQMA 2MQLA 2ZM6J 1WF1A 9RUBA 3FCVA 3MDFA 3DGPA 2WW4A 2DXEA 4NLSA 3FFIA 2XO7A 4IKAA 1K1QA 3KLEB 5L1LA 3RBDA 4Y6IA 4USWA 1CJUA 4OZ2A 4ELTA 1GAOA 2KYZA 2KKHA 2XYHB 4JI6F 3UPFA 1N5YB 4XIUA 3IO1A 2YKMB 4TKTA 3AJ1A 5I3UB 5DG8A 2PFFB 3HKZD 2W2PP 2V8VA 4PXBA 1N56A 3CW2C 2ACYA 1Q81T 1TVRB 1VIOA 1UEUA 3GJTB 4CLTA 2VOPA 2OHDA 4ECTA 1VBYA 3NGDA 5IQQA 4MFBA 1CQMA 3H0PA 2ZJRQ 2B4PA 1Q16B 1DTQA 2C2KB 4B3TF 1UFWA 4YR2A 2RQKA 1HARA 4PG5A 1ZTTA 2BYCA 4DSLA 1NK4A 3NNAA 3KJVB 2CQ0A 4AXIA 4CLSA 3Q24A 2AQ4A 1P1LA 2GHPA 2DNYA 1VK8A 2HNYB 1H7WA 2YNGB 4DEZA 3PIPQ 2D41A 3BQ1A 4LF8F 1VBZA 2QA4S 1Y00A 1S9EB 4WFXA 1U6ZA 1X8DA 4OYIA 4ZLPA 3EPGA 2DGWA 2ACMA 4C9DA 3KUHA 4JV1A 1D0EA 4TYBA 2AEFA 1GEHA 1PAEX 1X4GA 3VTIA 2DEIA 3IS9A 3GCWP 5KFIA 2BANA 3DOMA 3M2UB 4B3MF 1IR1A 3R5AA 3L95X 1S10A 2H4YB 3BSNA 2BX6A 3ZZZA 4JBCA 2NSCA 4I2PA 2CAJA 2FQQB 3G8TA 4WKYA 4U7UD 4YB6A 1W26A 5K5MA 3U7JA 3QT7A 2P9EA 5THWA 4OZ1A 3T1YJ 2LCWA 5JJBA 3ZNJ1 2OSQA 3M32A 1WOOA 3P5TL 2DRDA 1MROA 2XMMA 3BKFA 4EO8A 1HWUA 4ECWA 3KUEA
chains in the Genus database with same CATH topology
2H65B 1PYOB 3IBCB 1RHJB 3EDQB 1RE1B 1RWVB 3RJMB 2CNOB 2C2MB 2H51B 2C2ZB 1RHQB 2QL5B 2HBRB 1RWWB 1RHRB 3P45B 4DCOB 1BMQB 2HBQB 4ZVPB 2H5JB 2CNLB 4LSZB 2DKOB 2QL7B 2CJXB 2QLJB 3GJSB 1SC3B 1QDUB 3P4UB 4DCPB 4ZVUB 4ZVTB 3D6HB 3GJRB 1RWNB 1I51B 2XYGB 3IBFB 2XYHB 4ZVOB 1RWOB 3SIPB 2HBYB 4ZVQB 3R7NB 3D6FB 1RHUB 1IBCB 5IC6B 2H54B 2Y0BB 2Y1LB 3KJFB 2XZTB 3KJQB 3R7BB 2XZDB 4JB8B 1I3OB 2CNNB 2P2CB 4DCJB 1RWMB 1QTNB 1GFWB 3NS7B 2H4WB 2H4YB 1RHMB 2H5IB 3GJTB 1SC4B 1NMEB 2QLFB 2C2OB 3GJQB 2QLBB 2HBZB 5K20B 2FQQB 2CNKB 1RHKB 1F9EB 3D6MB 1ICEB 5IC4B 3EDRB 4ZVSB 1RWPB 2QL9B 1PAUB 3QNWB 3R6LB 2C1EB 1RWXB 2C2KB 4ZVRB 3R6GB 3R7SB 1RWKB 2XYPB 2CDRB 2CJYB 1SC1B 3R5JB 3KJNB 2H48B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H65 B;  1PYO B;  3IBC B;  1RHJ B;  3EDQ B;  1RE1 B;  1RWV B;  3RJM B;  2CNO B;  2C2M B;  2H51 B;  2C2Z B;  1RHQ B;  2QL5 B;  2HBR B;  1RWW B;  1RHR B;  3P45 B;  4DCO B;  1BMQ B;  2HBQ B;  4ZVP B;  2H5J B;  2CNL B;  4LSZ B;  2DKO B;  2QL7 B;  2CJX B;  2QLJ B;  3GJS B;  1SC3 B;  1QDU B;  3P4U B;  4DCP B;  4ZVU B;  4ZVT B;  3D6H B;  3GJR B;  1RWN B;  1I51 B;  2XYG B;  3IBF B;  2XYH B;  4ZVO B;  1RWO B;  3SIP B;  2HBY B;  4ZVQ B;  3R7N B;  3D6F B;  1RHU B;  1IBC B;  5IC6 B;  2H54 B;  2Y0B B;  2Y1L B;  3KJF B;  2XZT B;  3KJQ B;  3R7B B;  2XZD B;  4JB8 B;  1I3O B;  2CNN B;  2P2C B;  4DCJ B;  1RWM B;  1QTN B;  1GFW B;  3NS7 B;  2H4W B;  2H4Y B;  1RHM B;  2H5I B;  3GJT B;  1SC4 B;  1NME B;  2QLF B;  2C2O B;  3GJQ B;  2QLB B;  2HBZ B;  5K20 B;  2FQQ B;  2CNK B;  1RHK B;  1F9E B;  3D6M B;  1ICE B;  5IC4 B;  3EDR B;  4ZVS B;  1RWP B;  2QL9 B;  1PAU B;  3QNW B;  3R6L B;  2C1E B;  1RWX B;  2C2K B;  4ZVR B;  3R6G B;  3R7S B;  1RWK B;  2XYP B;  2CDR B;  2CJY B;  1SC1 B;  3R5J B;  3KJN B;  2H48 B; 
#chains in the Genus database with same CATH topology
 2GJF A;  3CJ8 A;  2IC3 B;  3ZZT A;  5D15 A;  1CS4 A;  1IXK A;  3M6W A;  5HLF A;  1B99 A;  1TMJ A;  4NLP A;  3MWB A;  2QLW A;  2RDI A;  1DQA A;  4LSZ B;  4EZ9 A;  4A8Y A;  2QJ3 A;  1ACM B;  3QGI A;  2N7Y A;  3PG9 A;  1HNZ J;  2DGT A;  2MZT A;  3DOK B;  3Q2S C;  1E6Y B;  3ZTO A;  2I9S A;  5DDO C;  2VDI A;  2A2C A;  3EGV A;  1URR A;  1NJZ A;  1B3T A;  1HMV B;  2H4W B;  4AD6 A;  2GZO A;  1C4A A;  2DR8 A;  4P6Q A;  4OI1 A;  4DLG A;  1TL1 B;  4RWX A;  1A7G E;  1U26 A;  1VQK S;  5J2Q A;  2FY8 A;  2WAQ D;  2YWG A;  2XMU A;  4C8L A;  2KTQ A;  1LNQ A;  2V2V A;  3DLJ A;  3H5Y A;  4F2R A;  4Q5V A;  3S7R A;  1KVI A;  4NLR A;  5KFM A;  4MKA A;  2EXU A;  3O5T B;  5B7W A;  4QPX A;  2UXD J;  5F8H A;  1X4E A;  4FKY A;  2C3P A;  2GO8 A;  3EJM A;  5E2Q A;  3IWL A;  3TNV A;  4RW4 B;  1U6B A;  2VU5 A;  2CRL A;  2A2D A;  2C22 A;  1C4C A;  3OVB A;  4DR7 J;  4I64 A;  2YQ1 A;  3NL0 A;  5BR8 F;  2UVW A;  1FEE A;  4DCO B;  2PT0 A;  4PQU B;  1REV B;  1M90 T;  2E44 A;  3OFH A;  4I68 A;  4BWM A;  2QL7 B;  3CCW A;  1OQ6 A;  3BQ0 A;  3W8P A;  1KTQ A;  4OYW A;  4IDK B;  2HIQ A;  1RWN B;  2Z30 B;  3ET6 B;  4YUD A;  2YKA A;  3TZZ A;  4CH0 S;  3KJF B;  4LSL B;  1H2U X;  1SIZ A;  2HVI A;  2F63 A;  2ZNY A;  1RT7 A;  5D4L A;  2KVQ E;  4DV1 J;  4G1I A;  2EBG A;  2GIR A;  3V6D A;  3M1V A;  5J1E B;  4ECV A;  2V2K A;  2R8J A;  4ED5 A;  1F3F A;  4RL1 A;  1KRP A;  3S01 A;  4JI2 F;  4LF7 F;  3PJX A;  1T8E A;  1CVJ A;  3PV8 A;  4CNY A;  2HHW A;  1QAI A;  5IT9 U;  3M30 A;  1NJW A;  1CPZ A;  2BRK A;  1FRL A;  3R3T A;  1WI6 A;  1YKW A;  1YLX A;  1JLC A;  4ECS A;  2UV8 A;  3KK1 A;  1QSL A;  1JLB B;  1K9M T;  1S9F A;  1RHQ B;  2GGP B;  3RB4 A;  1URN A;  1NH7 A;  1V3S A;  2KB2 A;  3JQM A;  3TEG A;  2RU3 A;  3DRP A;  4K4Z A;  3SV4 A;  1Q8L A;  4DQI A;  3B4M A;  1IJF B;  2KZZ A;  3MMB A;  2J0X A;  4RW7 B;  4ZVQ B;  1IBC B;  3RZA A;  2KFY A;  1YIT S;  2P5V A;  1U0S A;  1R6V A;  4E2F B;  4NCB A;  3OVA A;  1R0B G;  4L76 A;  2QC3 A;  5KFH A;  1SCJ B;  2HBZ B;  1S4E A;  4UST A;  1LK5 A;  5F0U A;  3MI7 X;  4F67 A;  1LOU A;  4I0W A;  3N6L A;  3RR7 A;  2QL9 B;  2J0S D;  4I67 A;  1WHX A;  2HFN A;  1HW8 A;  3UD5 A;  5KG0 A;  1PC4 A;  2CDR B;  1H72 C;  6FD1 A;  5ETK A;  4XPC A;  1XK8 A;  3MAA A;  3HSJ A;  1AA1 B;  2EFP A;  2AD9 A;  2MKY A;  5C7P A;  3AY0 A;  2VG6 B;  4F04 B;  2IJR A;  4M95 A;  2Z58 B;  2Q43 A;  1RUS A;  3JSM B;  1FD2 A;  3BB5 A;  3HD1 A;  3RB6 A;  5A8R B;  4TY8 B;  1SKW A;  5HO4 A;  1WC4 A;  4YY3 J;  2FTR A;  3LP0 A;  4JI8 F;  4YHH J;  2EWH A;  2IBO A;  1MU2 B;  2B9W A;  3TWZ A;  1YI2 S;  1XMO F;  1WEL A;  1S6P B;  2XHC A;  2YWH A;  4IFY A;  1RBL A;  5GAD U;  2ZHB A;  3TVY A;  4GMK A;  1SI9 A;  3SCI E;  4NLU A;  1SL2 A;  1GH8 A;  4BLG A;  1VR6 A;  3T1H J;  4ZVE A;  3BS9 A;  2QTW A;  4PXE A;  4DV5 F;  4QU6 A;  3SMZ A;  4CLK A;  1SKU B;  1ROF A;  2ZZM A;  4KO0 A;  3J7A N;  1S1V B;  5KT4 A;  1RYR A;  1Q95 G;  1FE0 A;  1QUV A;  3BGL A;  5CD4 H;  1SXL A;  4UOH A;  2W7O A;  2JSX A;  4ED2 A;  1PC5 A;  4Y2C A;  4JV5 F;  5J2P B;  3NRB A;  3PTW A;  2FJB B;  2NCK L;  2HHT A;  4O3R A;  1N6Q A;  1EET B;  1ZAW A;  4KAI A;  4Y00 A;  1UET A;  3OTD A;  3VF0 B;  1NU4 A;  4JI1 F;  3DN9 A;  1BWE A;  3Q8R B;  3L7U A;  1GTH A;  1RXO B;  1EQ0 A;  1JWW A;  2UVU A;  3MEG A;  4YQW A;  3FC9 A;  2LLZ A;  2VBW A;  1N33 F;  4OJ1 A;  2BAB A;  4OV6 A;  2DNZ A;  1SQE A;  2B4V A;  1VQN S;  2G4B A;  4ZHR A;  3CCL S;  1OSD A;  2HG4 A;  1WHW A;  4AL6 A;  3CDA A;  2HRU A;  3I87 A;  2UU9 F;  3R9L A;  3A12 A;  1RT6 B;  1TK0 A;  2RSQ A;  1HNZ F;  1DZ5 A;  4L72 B;  3C14 B;  3R7S B;  3L9Z A;  4V19 J;  2Y1I A;  2GQ2 A;  2V2Z A;  2EKN A;  2VQF J;  1HYS B;  5B0F A;  4CQ1 A;  1ZET A;  1EJ7 L;  2GVZ A;  1VC0 A;  1RTD B;  1AZS A;  1Q7Y T;  4LRB A;  4W98 A;  2DGQ A;  3CJ3 A;  3FUY A;  5LXR A;  2DNK A;  1U1M A;  4EYH B;  4N8O A;  1EX8 A;  1Q8K A;  1XJW B;  1LWF B;  1N88 A;  1T02 A;  3QIP A;  1J5O B;  2F5G A;  2V34 A;  4OMF G;  5KFG A;  2EVZ A;  5DDP C;  1LWE A;  5IQ6 A;  3BBF A;  5F8M A;  3MUR P;  3TYT A;  3V4M A;  2G2O A;  4NX9 A;  1OY9 A;  1TL5 A;  4LFB F;  4FXW A;  1P6T A;  1UFK A;  4DSE A;  1R43 A;  4OFZ A;  2EC0 A;  1WOS A;  3W61 A;  2HQD A;  2B51 A;  2W4P A;  5E7O B;  1A0O B;  3D1Q A;  2AGO A;  3OD2 A;  2ZBR A;  4A8W A;  3OW2 R;  1TKT A;  4PXD A;  4U8Y A;  1ITP A;  1RKI A;  1F5C A;  3UR0 A;  2RF2 B;  2OSR A;  3OHB A;  2GMJ A;  1G6B A;  1E6V A;  4EMD A;  1HQU A;  2QL5 B;  3W2V B;  4PAB A;  4F25 A;  4PG8 A;  1HHS A;  3MR2 A;  3IRX B;  2BE9 B;  4ITS A;  3MFH A;  3V4I B;  3O1L A;  3W8G A;  2LVW A;  4Z37 A;  2DNP A;  4CLF A;  5CYM A;  1X4C A;  3HF5 A;  5LMU J;  5HQL A;  4QYR A;  3KLH B;  3KUG A;  1BC6 A;  1TKZ A;  2HND A;  3BDE A;  2LFV A;  1Y11 A;  2ABY A;  3M9O B;  1OWX A;  4HH1 A;  1ZM4 A;  3MM6 A;  3O3L A;  2ROE A;  3UD3 P;  3UVJ A;  2R7S A;  2G0I A;  1WI8 A;  4AL7 A;  3H20 A;  2NPF A;  1RHM B;  2QA4 G;  4K50 A;  5IWA F;  1JMT A;  2LQ5 A;  2VG5 B;  3HFK A;  2VV5 A;  2R8I A;  2XMA A;  5IT9 Y;  4F02 A;  3RBE A;  5B0D A;  4CO0 A;  4FYW B;  4UT4 A;  3UDE A;  3OR1 B;  4RW9 B;  2KHD A;  3VAJ A;  5JUM A;  2MLY A;  5LXY A;  2ROP A;  4Q0B B;  1N5S A;  4K0K J;  4RU9 A;  3PR5 B;  4B9L A;  4O4G B;  4MKB A;  1NK7 A;  3JSR A;  3SQO P;  2EG2 A;  4E0D A;  3MM5 B;  4DR6 J;  4ECZ A;  2RU9 A;  4EBD A;  2BOA A;  3GV5 B;  3QO9 A;  4PR6 A;  1HBO A;  4K4T A;  5AXL A;  2CDQ A;  4NLO A;  3V81 A;  2X3G A;  2LEB A;  4X4Q A;  1H2V Z;  3LP1 B;  3SBM A;  1WKJ A;  5KTQ A;  4F4X A;  5E3P A;  4H4O B;  4QOT A;  3D4J A;  2XZD B;  2IHR 1;  3DM2 A;  4J9R A;  3MPY A;  4DN9 A;  1NSA A;  1FTR A;  4KHP F;  1T03 B;  2EK1 A;  4YFU A;  4MK7 A;  2CG8 A;  4TQS A;  3GIJ A;  4ZPC A;  2V9K A;  3DOL A;  1C1B A;  1NHU A;  4BCA A;  2DH7 A;  4AQY F;  1QLN A;  4MYT A;  4QJV A;  1HBU A;  3R5C A;  3N4W A;  1NSQ A;  1CUL A;  4DUZ F;  4TN2 A;  1HNW J;  3T6B A;  3I96 A;  3T19 A;  1RYS A;  4EU0 A;  3CJ5 A;  1N52 B;  1Y9O A;  4ECQ A;  5KFV A;  4MKY A;  3OL9 A;  4DF8 A;  2JLE A;  2I38 A;  4YS2 A;  4C48 A;  3IBW A;  4JI5 J;  1EB0 A;  4OHZ A;  3IBF B;  3K5N A;  4WYW A;  2O3D A;  3LAK A;  1J5E F;  3HHK A;  4RNN A;  1VQM S;  4DPY A;  2JEF A;  1KON A;  1HNI B;  4DCJ B;  3NNC A;  1U0H B;  2JH3 A;  4DFK A;  2YH0 A;  3WQP A;  1F3V A;  2NSB A;  1K73 T;  5G4D A;  4NLQ A;  1FX2 A;  5DQI A;  1LXN A;  2N4C A;  2DR6 A;  4DV4 J;  5JMN A;  5HP1 A;  2N3O A;  4ID5 A;  4MH8 A;  2N3L A;  3T5L A;  5T7L A;  1VS3 A;  1UVI A;  1FXR A;  1Y7P A;  5KFA A;  2AYB A;  1ARO P;  1N0V C;  1P9Y A;  3JSY A;  3B8H A;  1IQT A;  5KOW A;  5HAN A;  2R8K A;  1QE1 B;  3OPK A;  1WJ9 A;  3RU0 A;  4JI7 J;  2DHX A;  2W8L A;  3OJS A;  4ES3 A;  4DUT A;  2DIV A;  2UUW A;  5M2U A;  2DYA A;  1IKX A;  5F0W A;  3VQS A;  4A48 A;  3BN4 A;  2AX0 A;  4WXW A;  1TFW A;  2H1Y A;  4BDP A;  2MQM A;  3KXD A;  4RR5 A;  1RSC A;  4I2Q B;  2W2M P;  3G2X A;  4Y65 A;  3M2R A;  4NLY A;  2C2D A;  3U27 A;  2ADB A;  1N32 J;  4HT7 A;  1RP5 A;  1Y10 A;  3MMA A;  2IIH A;  3OTO F;  1BD6 A;  1RAH B;  4DR2 F;  1SH3 A;  4NCG B;  2IRU A;  3L4B C;  4X4S A;  2EFV A;  3ENA A;  2HS0 A;  4ZOS A;  3LAM A;  5B0G A;  2V4R A;  4OI2 A;  1NRK A;  4NAS A;  3BO3 A;  2BQR A;  4LF6 F;  1N54 B;  2XCP A;  3RRH A;  3JQK A;  1CJV A;  1WSV A;  3NOG A;  4WYL A;  3GV7 B;  3KJN B;  3C6U A;  4LQ9 A;  2QMW A;  1FKP A;  4C3K A;  4DSK A;  1YRT A;  3D0H E;  3EYZ A;  2YKP A;  4RW8 B;  5IV4 A;  2ZWP A;  3DRR B;  1HI0 P;  1SKR A;  3LAL A;  1RA6 A;  1FVS A;  1SH0 A;  2W9B B;  5D77 A;  4P2S A;  2XC9 A;  4LRA A;  3TA1 A;  4Q43 A;  3OUY B;  3DYA A;  1VFJ A;  1WKK A;  2GCF A;  2HMI B;  4KGZ B;  2D1C A;  5IZH A;  1WOP A;  2AZ3 A;  5KFX A;  2R7R A;  3AXK A;  4WII A;  4RO0 A;  2UXC F;  2QG9 B;  1KEK A;  1DQ9 A;  3KK2 A;  1T9U A;  3BSC A;  2VKZ G;  3G96 A;  4FYX B;  4QIE A;  1UJ6 A;  3BF4 A;  1NK0 A;  1RAF B;  2FVS A;  2DR5 A;  1LK7 A;  2PC6 A;  4M5D A;  5C2G A;  3LW5 C;  3BGO P;  3D1O A;  2MKJ A;  4B3R F;  2H48 B;  3M2V B;  2BJD A;  1NHK L;  1JLF B;  4YN3 B;  1T0T V;  2FHK A;  2K3K A;  3I0S B;  4RW6 B;  4EYI B;  1AUD A;  5EUH A;  4YDX A;  1RI7 A;  4UW2 A;  4ZP8 A;  4ZVH A;  4X62 F;  3HHL D;  4HAC A;  4ZCM A;  2HBQ B;  5IM0 A;  4X4P A;  2ZHO A;  3G9C A;  2HK2 A;  3GJS B;  4WP8 A;  2FGC A;  3QSI A;  3DFE A;  5EWE A;  2DNQ A;  4LSN A;  2ASL A;  2ZDP A;  1R0C B;  3Q89 A;  7FDR A;  3GQC A;  3KLG B;  1VRU A;  4K0K F;  2JEJ A;  2JFK A;  3AA9 A;  2HNZ A;  5I4M A;  2O66 A;  3H7H B;  2WSE C;  4DR6 F;  3HJF A;  3VAK A;  3UDL A;  2IJN A;  4Y2A A;  1GXT A;  1VQ9 S;  3R6G B;  4F4K A;  2AX1 A;  3CB4 A;  4ETX A;  4C0H A;  1T3N A;  8AT1 B;  2FLN A;  2UZA A;  1XC9 A;  1RTJ B;  1MWQ A;  3KYL A;  3SXL A;  4M5I A;  2BKN A;  2FLP A;  3D1H A;  4ANE A;  3BZQ A;  4IR9 A;  3IM9 A;  3RR8 A;  3GLJ A;  2HRT A;  3L7O A;  1S1X A;  2RS2 A;  1BXN A;  4LF5 F;  1SJF A;  2A10 A;  3QAT A;  2NPI A;  3ITH B;  4ALZ A;  4Q45 A;  4XDD A;  1VK3 A;  3ZZU A;  1TZ0 A;  2OPQ B;  1KLN A;  1IBK F;  2VJV A;  4Q2M A;  4LJM A;  4WFN Q;  4YEA A;  2CJK A;  3GCX P;  4DV7 J;  2IPO B;  2GVD A;  1S76 D;  4YB7 A;  2OJ3 A;  2EBE A;  3C66 A;  2NYH A;  1VI7 A;  3DRY A;  2E9Z A;  5SUH A;  1JQG A;  5CYJ A;  1N5Q A;  1PYS B;  5HMX A;  4YP3 A;  4FF2 A;  3B78 A;  1C0U A;  3ZXW A;  3GFX A;  1FI4 A;  3HZE A;  2B3T B;  2YNH B;  1RA7 A;  2IA0 A;  2VPY B;  3CO0 P;  2XY6 A;  3THP A;  3UN2 A;  3KLF B;  2DBB A;  4R0J A;  1O0P A;  5ITH A;  1B7F A;  2DHS A;  1IN0 A;  4DV6 J;  2IMW P;  4C8N A;  4G65 A;  5A6P A;  3W5X A;  3PW7 A;  4KC5 A;  2HZC A;  1IR2 A;  4DV4 F;  4P2F A;  3FZB A;  2YKN A;  4OHY A;  5GAG U;  4U6P A;  2Y0S D;  3HHL B;  1PIE A;  4DCP B;  4DR1 J;  4OX9 J;  4C8K A;  4DU8 A;  3D5M A;  2XS5 A;  2HFU A;  3KLI B;  3SIP B;  1U4B A;  2OPR A;  2E1C A;  3KLE A;  1DJ0 A;  5DG9 A;  2XI2 A;  4PXC A;  5T41 A;  3DLK B;  4JB8 B;  5HVG A;  3RB3 A;  2QGF B;  4CYU A;  2RKI A;  3W2W B;  1ZA1 B;  4J9Q A;  1N5Y A;  1NME B;  2YPY A;  4CNZ A;  4J9P A;  2CNK B;  1NO8 A;  3RYL A;  4LFA F;  1KQF B;  1TVR A;  3R2C J;  3DLL Q;  4U67 Q;  2UXB F;  3ZC4 A;  3D3C J;  1KDN A;  4LMZ A;  1Q5V A;  4DMZ A;  2YTC A;  1FFW B;  2ZBC A;  4OYO A;  4M5L A;  1NPK A;  2BAC A;  4OJ3 A;  3G6V A;  3M8W A;  1L3V A;  1PKU A;  2CNO B;  3MM7 B;  3QLH B;  4Y2K A;  2B8P A;  3A8E A;  4FYV B;  5GMK a;  1PJ7 A;  5D78 A;  4ZN3 A;  1FKO A;  2U2F A;  3PO5 A;  4N41 A;  2H5J B;  5GAG I;  1UPM B;  1RB0 A;  3KJV A;  3J7Y U;  2CJX B;  2L48 A;  4LRE A;  4NYO A;  1HPZ B;  4O0I A;  1ZTW A;  1WUU A;  3ENV A;  3GTY X;  2N7C A;  3LF0 A;  2WON B;  2X51 A;  3E8O A;  4NLT A;  4ES1 A;  2HVE A;  1FWK A;  1F5B A;  1S9E A;  1T9T A;  3PEH A;  3E01 A;  1TKX B;  4C0O C;  1NPP A;  1GX6 A;  2RVJ A;  3MF5 A;  3EUN A;  4WZQ A;  1RT1 B;  1VLO A;  5KFZ A;  1U7L A;  3MD1 A;  2CQB A;  2LXI A;  1PYT A;  4CT8 A;  3MR3 A;  3I9Z A;  4U9R A;  1NKE A;  2NRE A;  2HS3 A;  4ZVR B;  1SJ4 P;  4P74 A;  4HHJ A;  1O51 A;  3V6K A;  1K44 A;  2KI2 A;  1M5K C;  1R0A A;  1JJH A;  2A0F B;  3M8Q B;  4EBE A;  3WDO A;  1FDB A;  1YWX A;  2BXJ A;  2ZWO A;  3B4D A;  1XNQ J;  4LBH A;  2KRR A;  2OTL S;  4F0K A;  2BQU A;  3BGU A;  4YB1 P;  1O6X A;  3MGJ A;  3J7Y I;  4DR3 J;  2MKK A;  1AXQ A;  2IM3 A;  3RTV A;  2OI2 A;  1DFD A;  2Q1L A;  5G0R B;  1PG5 B;  3PX6 A;  1OO0 B;  5C42 B;  1I94 F;  1OIA A;  2C3U A;  1RWO B;  1AUS L;  2HHP A;  4IG0 B;  3UQS A;  3BPD A;  3FSI A;  2GS8 A;  1YGY A;  2ZD1 B;  2CJB A;  2KM8 B;  4NOH A;  1E6Y A;  2YKQ A;  1S7I A;  1Q0N A;  3VAM A;  5H1S V;  3THV A;  7AT1 B;  3G71 S;  2WHO A;  3GIL A;  3K89 A;  3RRK A;  3MEC A;  2W25 A;  4KKO B;  4R8U B;  1C0T A;  4NXM J;  2B5J A;  2UUC F;  2PEB A;  1VQ7 S;  1VC6 A;  2BJ7 A;  1TL1 A;  1ZH5 A;  1YDL A;  2V2Q A;  2YNF B;  2YX7 A;  2M5Y A;  3BH7 B;  2A3J A;  1QAX A;  1FRX A;  1V3R A;  3OQ2 A;  2XCA A;  1FJC A;  3CDE A;  2R7T A;  4QBU A;  3DU6 A;  3UCU P;  3MED A;  2D3O R;  2AU0 A;  4CT9 A;  2VFU A;  3BN7 A;  3D6T B;  2FHO B;  1H6K X;  1U8W A;  2DB1 A;  3FCW A;  1ZA2 B;  2OGU A;  4HHU A;  2D74 B;  2FC9 A;  1NAQ A;  2HFO A;  1YRX A;  4PQU A;  1HQE B;  4TNO A;  5KFS A;  1SJ3 P;  3K5P A;  2OEL A;  3AH6 A;  3FKB A;  1S6U A;  1IWA A;  1MN7 A;  4UOG A;  2F9J A;  4PG7 A;  3N79 A;  3CC7 S;  2QE5 A;  2XGQ A;  3GPA A;  2XLK A;  2VB6 A;  4F0M A;  5KG4 A;  3N6N A;  5CZX A;  4C8M A;  3TVK A;  3J7Z 5;  2J6U A;  5KOX A;  4LFC F;  5BYS A;  4CLZ A;  3IFE A;  3IWX A;  3MZI A;  4WWS A;  1TFY A;  2IM2 A;  4WFY A;  4I1T A;  1VQ6 S;  2HGM A;  2CPJ A;  2M52 A;  1RHR B;  1ZPV A;  4ETZ A;  2D9P A;  3LWM A;  2CFX A;  3MM9 B;  3AA8 A;  1U09 A;  3KHG A;  2PGC A;  1D3W A;  3ZTS A;  2HVH A;  4CLL A;  2GGP A;  3D6H B;  5DM7 Q;  4F2S A;  4M5H A;  1U2C A;  3D6F B;  1N36 F;  3MR7 A;  2YWK A;  3W65 A;  1ZAX A;  5GME A;  4UY8 5;  4ZIW A;  4FN5 A;  3GIM A;  1XER A;  3CXC R;  4AXJ A;  1HBN A;  1FEH A;  1L3S A;  2FUG 9;  3TA0 A;  2EC2 A;  4DV6 F;  2AYE A;  3M4X A;  2VH7 A;  1KHV A;  2V4J B;  4KR0 B;  2JEG A;  2XWY A;  2C3O A;  3IR6 B;  3QPI A;  4B3O B;  2B0G A;  4OX9 F;  5F8N A;  2LEP A;  5EX3 A;  4N7T A;  1RWK B;  2HGN A;  2B9Y A;  3HPO A;  5HMZ A;  3OL8 A;  3BGF A;  3JQJ A;  2A18 A;  1FRK A;  5H9E J;  1IJE B;  3TAN A;  1P8G A;  3TOQ A;  1MMD A;  2O1P A;  3IBC B;  2R3V A;  3DLB A;  3SEO A;  3SSR A;  3PJW A;  1PBU A;  1YBT A;  2YPZ A;  2CPH A;  2M2B A;  4G1Q B;  4ZVP B;  2ZC3 A;  3T1A A;  2N82 B;  2VG6 A;  3GYG A;  2ZC4 A;  2JEI A;  4WK3 A;  3SCL E;  3EZ5 A;  1JK9 B;  2J9D E;  5RUB A;  1NK9 A;  4IOB A;  1DHM A;  5LMN F;  2DGV A;  2Z2Z A;  3FMB A;  5A8K B;  4FS2 A;  2NR0 A;  4J91 A;  2VQE F;  2MQQ A;  1T3O A;  5D4P A;  5IC6 B;  5BXI A;  3GII A;  4TY8 A;  2O67 A;  4YB5 A;  4I7F B;  1B4S A;  4DFP A;  3OFF A;  3ILO A;  1MU2 A;  3F41 A;  1S6P A;  5JXS A;  3PDN A;  4ECX A;  1IKV A;  5A8W B;  4FPR A;  4DV2 J;  3ILI A;  1JKH B;  4OLP A;  3CJK A;  1RWX B;  3QWP A;  3NGU A;  4I4B A;  3OR2 A;  2R8G A;  1S79 A;  2VIH A;  2PEH A;  1FRI A;  3A13 A;  3AFG A;  3QGG A;  2CPX A;  1S12 A;  3DLG B;  3D0G E;  1H74 A;  3KNA A;  4PYD A;  3K8V A;  2ALY B;  3QAE A;  1S1V A;  3AOB A;  2D69 A;  2C2Z B;  1M0S A;  4RX6 A;  2KN4 A;  3BSO A;  2WCX A;  4KV8 A;  3UI3 A;  3PW0 A;  5DQH A;  3LGM A;  3K5O A;  3CCV S;  4LRC A;  2AYG A;  2RRA A;  2CVI A;  4ED4 A;  4K4U A;  1KHW A;  4GC6 A;  3CMQ A;  4NCA A;  5SZT A;  8ATC B;  2B7B B;  3O2I A;  1EET A;  3MR5 A;  1FRM A;  2NS1 B;  3LWL A;  1MNE A;  5J2N A;  3W60 A;  4PUO B;  2B4U A;  1RAB B;  4HEA 9;  5H9F J;  3U1N A;  2CPE A;  3IN5 A;  3BGR B;  4ZP6 A;  3KDO A;  4M5N A;  2JVR A;  3MAQ A;  1F9E B;  4OV1 A;  1LWC A;  2CQ1 A;  4P10 A;  4UTG A;  1RT3 A;  1XMQ J;  3Q8U A;  5J2M B;  1UW9 A;  1VOM A;  3QMQ A;  4PKD B;  5KFL A;  1Y5I B;  2MZQ A;  1YJ9 S;  1I1G A;  2QFI A;  2VC0 A;  1RE1 B;  4C8O A;  2C2M B;  4QCL A;  2E66 A;  1VCT A;  4JI0 J;  2AYM A;  1RBA A;  2DGU A;  3DGP B;  4DV3 J;  4FVC A;  2DHH A;  2ZJP Q;  1VBX A;  5KFJ A;  3FFI B;  3TUP A;  1HNX F;  4OX6 A;  3PCO B;  3I6P A;  3PX4 A;  4PEO A;  2WRM A;  5HRO A;  4X64 J;  2V0N A;  5F9N A;  4DR4 F;  4USI A;  2CQP A;  2RS8 A;  4H4K A;  2WVC A;  4DUY J;  4NXN J;  5ETP A;  2MTL A;  1GXL A;  1LWF A;  2DY9 A;  3NS5 A;  2B7C B;  2DRB A;  5F8G A;  5CYQ A;  3EZU A;  1HR0 J;  1S5Z A;  2E5L F;  1KD1 T;  2G1H A;  4X4O A;  4MFB B;  1ZM9 A;  2I6W A;  2AEJ A;  3HXM A;  1DTQ B;  4O3Q A;  2UUB F;  2AWZ A;  2BEF A;  4OJH A;  1LFW A;  1CSJ A;  2CQC A;  5DLG A;  1LW2 A;  1FES A;  3TR5 A;  1WG5 A;  2I0X A;  4CLW A;  1JLG A;  4ILR A;  5DGA A;  2JWN A;  4USM A;  1TL4 A;  1D8Z A;  2BKO A;  2W9C A;  4M1K A;  3TUZ C;  1FXL A;  2XMK A;  2VKR A;  2RF2 A;  4WBF A;  1YJ7 A;  3OXG A;  3TO8 A;  3QRR A;  3GJR B;  3EGN A;  1FWP A;  3UO0 A;  1RT2 A;  5HI7 A;  4DG1 A;  2WBM A;  2HHH F;  4IOC Q;  3PXG a;  2SXL A;  4JYA F;  3PJ9 A;  1M5V C;  2DH8 A;  3H4D A;  1WF2 A;  1YZ7 A;  3IS9 B;  4IO9 Q;  3QJP A;  2QX0 A;  2BAN B;  1YJV A;  1DAR A;  1V9O A;  3W5Y A;  2IVM A;  3CCM S;  3A4T A;  5LJ3 Y;  4RJV A;  4KRW A;  2UP1 A;  5DDR C;  2R4F A;  4I2P B;  3CCS S;  2ZH6 A;  3ZZP A;  3BSA A;  3DCA A;  3JYT B;  2B9E A;  3G8S A;  1UKU A;  3F73 A;  4MIB A;  4C8Y A;  2MLZ A;  4L74 A;  5B0C A;  1MRO B;  2ZZN A;  4AE5 A;  2HKE A;  5C25 A;  2FJE B;  5DQG A;  2G9O A;  1AB8 A;  2BQ3 A;  3H5S A;  2DGO A;  2ZE2 A;  5IS2 A;  3MUT P;  3W66 A;  1KOH A;  5HLF B;  4WTY A;  1XN9 A;  3L09 A;  4NZ6 A;  4RW9 A;  4UF4 A;  2XI3 A;  4Q8E A;  3KLV A;  2P8I A;  2ZKT A;  3ILJ A;  3TRG A;  1YJR A;  2R7W A;  2IY5 B;  2PFD A;  2YQ3 A;  3MM5 A;  5KFT A;  2KM8 C;  4ZIV A;  2BBE A;  4ED3 A;  3QJJ A;  2I2Y A;  1F1B B;  3ISN C;  5DET A;  1S1U A;  2YKO A;  1M1K T;  3GON A;  1WNE A;  2MGZ A;  3UCG A;  4ELU A;  3TAM B;  4HTJ A;  1NDL A;  2CKW A;  4H4O A;  4IYQ A;  2QT7 A;  2ZUG A;  4ZPV R;  2ZBI A;  2DHG A;  1T03 A;  1FFS B;  1W25 A;  3TEH B;  1RZM A;  3DLE B;  2HHS A;  4FZV A;  3CUL A;  4KT0 C;  4CO4 A;  3GIK A;  1R8C A;  5EGY A;  4ID8 A;  1Z4U A;  1NKC A;  4P52 A;  4NI2 A;  2F4V J;  1AYE A;  1FJ7 A;  2FJW A;  3DDI A;  3UNG C;  1V3Z A;  4KFB A;  3TAP A;  2OD4 A;  4WIQ A;  4O44 A;  4JI4 J;  4PWW A;  1Q8I A;  2WSC C;  3T9Z A;  2KU7 A;  3VCD A;  3W64 A;  4FPI A;  5KT3 A;  4ZN1 A;  1F2H A;  2DVI A;  2WVE A;  2UUA F;  2G2Y A;  4OI3 A;  2ZZT A;  2W24 A;  1KS2 A;  4GKJ J;  3PW5 A;  1RT7 B;  2M8D B;  4QIG A;  2BE2 A;  4FF1 A;  2F65 A;  3UW1 A;  1VDH A;  3V6D B;  3M1V B;  2XMT A;  3ISZ A;  1MWY A;  1UVK A;  1ICE B;  1S99 A;  2HWH A;  3G86 A;  4DQQ A;  2HQG A;  4JI3 J;  4K59 A;  1KVK A;  2GV1 A;  2FHJ D;  2F9D A;  3I55 S;  3AJ2 A;  2DD8 S;  1NK6 A;  3M30 B;  3MMC B;  3KMQ A;  3R8Y A;  1GTE A;  2EK6 A;  1FCA A;  3H4B A;  3M7V A;  1JLC B;  2VG7 A;  1LEO A;  5DLF A;  2KXH A;  2XBP A;  1IBM F;  2J5A A;  1XNR F;  4OHX A;  2HYI B;  1FER A;  2VOO A;  1HW9 A;  3DRP B;  3HVA A;  4GKK J;  2QEX S;  1TL3 B;  2HBY B;  1MWZ A;  1B0P A;  2K1R B;  2MSS A;  4F4W A;  4H54 A;  3ENW A;  3HX9 A;  1YIJ S;  2HUR A;  4BC9 A;  5KT7 A;  4JI0 F;  3C3L A;  4DV3 F;  2HZA A;  2LXU A;  2RIJ A;  2D3U A;  3PNI A;  1RHK B;  1VQO S;  2RHS B;  1DY3 A;  4MAK A;  2FZC B;  1Q79 A;  1S1W A;  4X64 F;  1KN6 A;  2L9D A;  3V2U C;  2GW8 A;  5ETL A;  4TY9 A;  2KDO A;  2DCL A;  2YH1 A;  3IWN C;  2BRL A;  4NLG A;  3MPV A;  1KOO A;  3HMJ G;  2C3Y A;  3MAA B;  2YWE A;  4WCE Q;  1FFG B;  4LBI A;  3UE2 A;  4ER8 A;  3E51 A;  3CDU A;  3ZTP A;  1XBW A;  1CJK B;  2VFV A;  2LA4 A;  4DR5 F;  1WDD A;  3W7B A;  1DUR A;  2BJE A;  3PX0 A;  1B64 A;  5M2P A;  4RW8 A;  3R1L A;  5HN0 A;  3LP0 B;  4DL4 A;  3VAF A;  4W92 B;  1JXE A;  2FY1 A;  3QZ8 A;  5AJ3 J;  2XZT B;  2FLO A;  2W9B A;  4PQA A;  3BEG B;  1SBR A;  2C42 A;  4P71 A;  3OUY A;  4AND A;  2MJU A;  2QO3 A;  4NMX A;  4FYY B;  2GJ2 A;  4B3S J;  3GR1 A;  2NZ4 A;  4DQR A;  4GVB A;  2F8H A;  1HQ2 A;  5F8J A;  1KWM A;  1U24 A;  4CP5 A;  4KO0 B;  2QZ8 A;  1IVZ A;  3C16 A;  2CPI A;  4OYB A;  2J6T A;  3ICL A;  3Q23 A;  5ETR A;  1UPP A;  2QIF A;  3HHN B;  4A47 A;  2OLW A;  3CCQ S;  3BJY A;  1RTI A;  4DL2 A;  2R42 A;  3B54 A;  3P45 B;  3OL7 A;  4L3K A;  1N6Q B;  3QT6 A;  2GAG C;  1JLF A;  4KGK A;  4RW6 A;  3WZ0 A;  5D0H A;  2JNJ A;  4DPW A;  1RK8 A;  2YNI A;  3DC2 A;  2OML A;  2MZS A;  4ICL A;  3NY0 A;  3KMS A;  3HVW A;  3MOZ A;  5A2Q U;  1R8P A;  2CQI A;  2ZUA A;  2B9X A;  2IYI A;  2AHO B;  1NSK L;  2ZHA A;  3EZO A;  2PMH A;  4IR1 A;  5CCM A;  4XTT A;  4OYZ A;  2FVP A;  4ZHR B;  4YR3 A;  2XS2 A;  3EX7 B;  1JJ2 R;  2F8E X;  3G82 B;  2BJ8 A;  3UD4 P;  4TLQ A;  2KFZ A;  1I6J A;  4A4J A;  2DIT A;  1Y5N B;  1IBL J;  5GAE U;  4RPF A;  4GC7 A;  5DG7 A;  2EG1 A;  3M8P B;  1UWB A;  4USH A;  3G87 A;  2GVZ B;  3F56 A;  4QW9 A;  4HLB A;  5KG3 A;  4A8M P;  1AZS B;  3KHL A;  2B4O A;  1MSW D;  2QV6 A;  3GZ7 A;  1KNZ A;  2CNL B;  1QJH A;  3GR0 A;  2W8K A;  2DKO B;  4WE1 A;  1R7I A;  2KJV A;  2MY8 A;  3AHP A;  1GT8 A;  5GAH U;  4OX8 A;  5A0Y A;  1R89 A;  2E7W A;  3QIP B;  1LKZ A;  4ANC A;  1LWE B;  4X65 F;  2HEK A;  4TU8 A;  3J81 j;  3W9H A;  1RTH B;  2X3D A;  1SC4 B;  5KG6 A;  1PCA A;  4Z2X A;  2XNQ A;  3LPY A;  1XR7 A;  1WTB A;  1QAJ A;  3TUJ C;  3MUM P;  3LTO A;  3D6M B;  4ENO A;  1H73 A;  1S0O A;  2VAS A;  3R6L B;  3KK3 A;  4JV2 A;  4FBT A;  4CWB A;  4RUA A;  4CM0 A;  4TVA B;  4J9N A;  4LF4 J;  2KT3 A;  4R5P A;  3AB2 B;  3C15 A;  3NMR A;  3EMT A;  5CAA A;  1MLA A;  5L9X A;  3CE8 A;  1X9W A;  4P7T A;  1K0V A;  3P8B B;  3KLF A;  3SV3 A;  2Q3P A;  4BBY A;  3AD7 C;  1SKS A;  2W4C A;  2VPX B;  5LJ5 Y;  2B6A A;  4I6W A;  1LW0 B;  5CYM B;  3U1M A;  3BPS P;  4FS1 A;  1FJG J;  2DH9 A;  1X4D A;  3IC1 A;  1PJ5 A;  1TKZ B;  2HND B;  2OIH A;  1S49 A;  4OHV A;  4JOU A;  4OI6 A;  1X60 A;  1YBU A;  3HHL A;  2IRY A;  5KFO A;  4Q8F A;  4UZC A;  1ZZN A;  3DRX A;  2ZNZ A;  3Q0A A;  4USV A;  5KFF A;  3G4S S;  2E29 A;  3FK4 A;  4HHH A;  4FDF A;  4CZC A;  1Q8B A;  1U6F A;  2VBY A;  2LQ9 A;  3SFG A;  3BQ2 A;  4DV0 F;  1GXU A;  2ZKU A;  1KFS A;  3W2W A;  2F3J A;  1EIY B;  3MR6 A;  1Y3K A;  2KL8 A;  2FVC A;  2GHW A;  1S6Q B;  4MYU A;  4DBQ A;  1IKW B;  4NYP A;  4OZ5 A;  6AT1 B;  2Y8W A;  3CJS A;  1U02 A;  1ZBT A;  1VJQ A;  2ROG A;  2G0C A;  1MG7 A;  1C2P A;  4CIO A;  4ZP7 A;  2AMC B;  5M2R A;  2ZJQ Q;  1BMQ B;  2VF3 A;  3Q8V A;  3P96 A;  4M63 A;  3RW7 A;  3QLH A;  4TU7 A;  3G6E S;  3KHH A;  4A8F A;  3C46 A;  3QO9 B;  2ZM6 F;  2GIQ A;  1H0H B;  3O44 A;  3V81 B;  4HKQ A;  1RGV A;  4ZJL A;  2H54 B;  3TX0 A;  3FJ2 A;  2Q79 A;  3LUY A;  3MAH A;  1RCX B;  4QPT A;  3CSK A;  2BVZ A;  4U95 A;  3DM2 B;  4KY3 A;  2WOM A;  4J5O A;  4X66 J;  4GRS A;  1BWV A;  3NGT A;  1S0V A;  1TL7 A;  1S0N A;  2CQG A;  2MZ1 A;  1VQ5 S;  4N76 A;  5FJ4 A;  3DOL B;  2FJD B;  4ED1 A;  5DZ6 A;  1HA1 A;  1IKY A;  3HSG A;  1M1H A;  2OP5 A;  1SJQ A;  2EPI A;  2XEX A;  1HBU B;  3NCQ A;  3AXM A;  3PRV A;  3M6V A;  4E98 A;  1N34 J;  1M5H A;  1GK8 A;  2MYF A;  1IUJ A;  1MMN A;  1BQN A;  3N01 A;  5IT0 A;  1HFE L;  1TV6 B;  5DO2 A;  3WX8 A;  3UNY A;  4K7Q A;  1SL1 A;  1XR5 A;  4N47 A;  1KQG B;  4URG A;  4UQG A;  4OZ0 A;  4C2M A;  1H7X A;  2BJ3 A;  3D9B A;  2LP4 A;  1FK9 A;  2GIF A;  1OYE A;  1RIS A;  1UTA A;  3CJR A;  5AXK A;  4LUB A;  1TUV A;  1F5A A;  1UVN A;  3NP5 A;  4QYZ J;  2KG0 A;  3UCZ P;  5C5J A;  1R6Y A;  5K20 B;  3PHE A;  2R2R A;  5EN1 A;  1SUQ A;  5K8O A;  3AQO A;  1U47 A;  3VWS A;  4DWI A;  2DIU A;  4ID5 B;  1DLO A;  5T7L B;  3LP2 A;  3LPE A;  1XEZ A;  1L3U A;  4USJ C;  3T1Y F;  5CZV A;  3BR9 A;  3K5M A;  2F40 A;  3KG0 A;  1NM2 A;  3FMW A;  4XAK A;  4DPO A;  3PKM A;  3E2E A;  1UVL A;  5GAD I;  4CTA B;  2YNF A;  2AEM A;  1ELO A;  1NDK A;  1IKX B;  1ZM3 A;  2XSJ A;  2G2Z A;  5FII A;  5A2Q Y;  4LR8 A;  3B82 A;  2PN6 A;  3QQC D;  2K06 A;  3S6E A;  3GSD A;  2DO4 A;  1QSY A;  1Z2L A;  2OEK A;  5L1I A;  4FNI A;  2ASY A;  2DNO A;  2HS4 A;  1G7C B;  4LVN P;  2PE8 A;  1KQK A;  4B3T J;  1NZ8 A;  4RNF A;  1SB6 A;  2RJZ A;  1K8A T;  2JC1 A;  1IM4 A;  4ATN A;  1YK9 A;  2ZOG A;  3K59 A;  3MPW A;  1X0F A;  5KAK A;  5K8N A;  1U45 A;  5HMW A;  1BLU A;  4Y3C A;  4LF8 J;  3IR7 B;  3C6U B;  4ECR A;  2Y9H A;  2QYC A;  2BKP A;  1IR0 A;  1JLQ A;  7FD1 A;  3TZW A;  4MKV A;  3VAH A;  3QBC A;  5A6W A;  2UXD F;  4PPD A;  2PDA A;  2MKS A;  3VAL A;  3SYZ A;  3KG1 A;  1WHY A;  5LSR A;  4GO5 X;  1BQM A;  3FRZ A;  2IRX A;  2HQI A;  3EGW B;  2CJQ A;  4KGM A;  5HQM A;  4DR7 F;  1NDC A;  4B3M J;  3BYP A;  2KFN A;  2V63 A;  2HW3 A;  3D67 A;  3DYA B;  3OVS A;  1JIH A;  5F3T A;  4LF4 F;  1GMW D;  3CJ4 A;  3NKY A;  2J7K A;  1T05 B;  4UUW A;  4X2B A;  4NE9 C;  2IAJ A;  2X1A A;  3R1H A;  5B0A A;  4H4M B;  1TTH B;  1RU1 A;  3Q2T C;  5H9E K;  1X5P A;  1X4F A;  1FX4 A;  1S1T A;  5IC4 B;  5C24 A;  3EDR B;  4QIW D;  5HAO A;  1JNZ B;  4DV1 F;  3N5F A;  4U7C A;  4YR0 A;  1WKL A;  1T9W A;  2KHC A;  2CJY B;  3CCT A;  2V4J A;  4Q2L A;  1FHT A;  5L8R C;  3TQ1 A;  2AGQ A;  1A6L A;  2POK A;  2HFZ A;  5DDQ C;  4OHW A;  1X4H A;  3KFW X;  2CJ9 A;  2CWK A;  1FRJ A;  3LO3 A;  2LQJ A;  3IGN A;  2C2N A;  2ASD A;  3OHA A;  1D9A A;  4HAC B;  3NGS A;  2OPS A;  4IQM A;  5IM0 B;  4AL5 A;  4P75 A;  1T9Y A;  1N48 A;  1ZAV A;  2F8M A;  3CO9 A;  1V5V A;  4ZVO B;  2M0G B;  2UUT A;  2Z2Y B;  1SQF A;  2V6A A;  5T14 A;  3GYN A;  2J0W A;  4IG3 B;  1MW7 A;  4ED0 A;  1CC7 A;  4HVZ A;  1VRU B;  2Z2M A;  3DMJ B;  3FNN A;  5F3Z A;  1GMU A;  4XK8 C;  4TYA A;  3KNG A;  2R2T A;  5D3G A;  2R2S A;  1VQ4 S;  1WC6 A;  3C6T B;  5KFB A;  5K14 A;  1JXV A;  3Q83 A;  5BR8 J;  4QWD A;  4I6A A;  1JLE A;  4DFM A;  4EGL A;  4CH1 A;  2AJF E;  1YJW S;  5A8W A;  1M1G A;  2XO6 A;  4J9L A;  1WD6 A;  1JLA B;  4OJG A;  3R5B A;  2FYX A;  4ZPA A;  2X1G A;  1S1X B;  2FB0 A;  4PAA A;  3K58 A;  3NEK A;  3G6X A;  3WBZ A;  3CPW R;  1HD0 A;  2RDJ A;  3UDV A;  5H9F K;  4IFV A;  3CCZ A;  1NK8 A;  1Q53 A;  4USU A;  1RHU B;  2MXY A;  4YY3 F;  1VC5 A;  2LDI A;  2CAD A;  4JI2 J;  1D8Y A;  4LF7 J;  3I0R A;  2IMO A;  4YHH F;  3AD9 C;  4C3L A;  2QLB B;  3GIR A;  3J80 U;  1S57 A;  4IQX A;  2KRB A;  2NYI A;  3C19 A;  4Y2I A;  3DI6 A;  2RT3 A;  3T1H F;  5GVQ A;  4TLR A;  1C0U B;  1T7P A;  1FVQ A;  1WC5 A;  4P9S A;  1YBA A;  4ZA1 A;  3TX8 A;  3BGR A;  1DBD A;  3GV8 B;  2XMW A;  1Z2Z A;  3TZX A;  4JV0 A;  5L39 A;  2KVI A;  3RRG A;  4UOC A;  3V6J A;  3B6B A;  1NJX A;  3KHR A;  2OO4 A;  4NWB A;  1X31 C;  1XWL A;  4WP9 A;  4KB7 A;  1S97 A;  5CXT A;  3K8W A;  2Q6B A;  2VPZ B;  2QSF A;  2XQC A;  1NZA A;  3W9I A;  4PWD A;  5GMD A;  3BKU A;  3I82 A;  3NAI A;  1S9G A;  2OPR B;  2H9Z A;  3SFU A;  2DGX A;  4NEZ A;  4KH0 B;  2DPJ A;  3P49 B;  3FEZ A;  4CYU B;  2RKI B;  4AUK A;  4KH1 B;  1LFP A;  3Q8S B;  4OI0 A;  1AT1 B;  2FHM A;  2KZM A;  1KLM A;  1VBK A;  2CWX A;  4DSI A;  4I6Y A;  3TA2 A;  2XUL A;  5CCL A;  4CLY A;  1SJ1 A;  3PW4 A;  1FDA A;  4ED6 A;  3R27 A;  1KFD A;  3EM1 A;  2ZDO A;  2XTJ P;  4JP8 A;  2E7V A;  4J9O A;  3GMG A;  4X4T A;  1HWJ A;  3PRD A;  2M3D A;  5AE1 A;  4JI8 J;  5I42 B;  4C97 A;  2HBR B;  4OIX A;  4BWJ A;  1IQZ A;  1XMO J;  1FWL A;  2M88 A;  1FKO B;  4QR2 A;  2VQF F;  1RAA B;  4KPC A;  1RDR A;  2IDE A;  4DHV A;  1OY6 A;  3ZTR A;  2R9L A;  2FC8 A;  3MMJ A;  1AFJ A;  3MM8 A;  3W63 A;  1VRT A;  1HWL A;  4IRC A;  3HM9 A;  4DV5 J;  3D3B J;  3NBP A;  4RBV A;  1X9M A;  3IG1 A;  3E01 B;  2OAU A;  2VON A;  1X5O A;  4J37 A;  3R5D A;  5AE2 A;  2QSW A;  1B70 B;  4NYZ A;  3WHI A;  3DXS X;  2LU1 A;  1X4A A;  2K2P A;  2NUU G;  3A1Y G;  3W5Z A;  1H38 A;  4JV5 J;  5KG2 A;  1S72 S;  2FLL A;  3H5U A;  1LWX A;  4J9K A;  1FTC A;  4ZPB A;  3R5J B;  2RD5 C;  4JI1 J;  3JYT A;  3Q86 A;  1FD8 A;  4QIF A;  5FDL A;  2MQP A;  1P9Q C;  1R0A B;  2ZVI A;  1WC3 A;  4D3H A;  3NCR A;  2EI5 A;  1S4F A;  1FNM A;  1F9F A;  1PSD A;  4RZR A;  4B9N A;  1OY8 A;  4AT1 B;  4F0H A;  1N33 J;  2CQD A;  4RWW A;  1PGZ A;  2CQH A;  2V50 A;  5D0E A;  1X7V A;  3SDE A;  4V19 X;  2XYG B;  2DNL A;  5ETV A;  3CCU S;  4LRF A;  3VGU A;  3T41 A;  4DF4 A;  2MB0 B;  2RUG A;  4C3M A;  2UU9 J;  2DCU B;  5LMU F;  4IRD A;  1APS A;  2HAF A;  4IUF A;  3I5C A;  4L75 A;  4B02 A;  2J0Q D;  2MJN A;  2E9R X;  3MEC B;  3I5A A;  2XMJ A;  1R8H A;  3MTJ A;  3TQE A;  3LOU A;  1C0T B;  2B5J B;  4MIW A;  3NS6 A;  3CNQ P;  3TAM A;  3P6Y C;  2YX4 A;  1NSP A;  2PA8 D;  4ZKA A;  1YHQ S;  2J8A A;  4K5R A;  4AYB D;  3N0V A;  3O8W A;  2XHW A;  1ULR A;  3M9M B;  5ETO A;  1VHI A;  3C8Y A;  1SV5 A;  1EHW A;  2ADC A;  1FDN A;  1TEL A;  3AQP A;  3DLE A;  2MQO A;  3OSN A;  1EAR A;  2DHA A;  2VL1 A;  2AW0 A;  3MED B;  1Y3J A;  5AXN A;  4LF9 J;  4C11 A;  5IXU A;  3BH6 B;  2HHU A;  1XTZ A;  4LFB J;  3PZP A;  4M5G A;  1FDD A;  2BZ2 A;  3A3O B;  2APO A;  5J1N A;  2RHQ B;  4CM2 A;  4ED7 A;  2VJU A;  1NEE A;  2RRB A;  2IVY A;  2VD3 A;  3CIZ A;  1KC8 T;  2J7W A;  3PIO Q;  2XMV A;  3BKT A;  1OPI A;  3OFE A;  1CG2 A;  5HSP A;  2KT2 A;  1NHV A;  1RT5 A;  3RBZ A;  1N0U A;  1TAQ A;  2E5J A;  2RRN A;  5KFP A;  3FBB A;  2CPD A;  2RDD A;  3QAU A;  5B08 A;  8RUC A;  5HAT A;  1TU0 B;  2HPU A;  2ZIT A;  3UN5 A;  3IAS 9;  4J90 A;  5D4O A;  2R2U A;  5BYQ A;  1DTT B;  4DXL A;  3CT9 A;  5C2C A;  3UWT A;  2DPI A;  1ZZF A;  1VJW A;  4QWC A;  4MIA A;  1CEZ A;  2V8D A;  3D2W A;  3MMC A;  5D8H B;  1HNW F;  4DFJ A;  3K57 A;  2JRS A;  1UJ5 A;  2FJA B;  1FNO A;  2AJ1 A;  1I51 B;  1UEK A;  1D09 B;  5ADZ A;  3HLU A;  4ELV A;  5IWA J;  3FSY A;  1TP7 A;  1HIY A;  3FBC A;  4RLE A;  4HL9 A;  2F4F A;  4UZB A;  2ZH1 A;  4DJB A;  2V68 A;  2NQP A;  3MCN A;  4JI5 F;  3J80 Y;  1C1C A;  2WW8 A;  4LF2 A;  4M5M A;  4C98 A;  1UAW A;  1U49 A;  5HQ8 A;  1TL3 A;  1HBN B;  3I32 A;  1KP6 A;  2FPH X;  2RQ4 A;  1R8B A;  1O8B A;  4NLW A;  1WOR A;  2K1R A;  3TW0 A;  3CD0 A;  1PBA A;  2FZG B;  1F60 B;  2R7U A;  4QWA A;  3R5G A;  3TAR A;  1RAI B;  4J9S A;  1PIL A;  3HVT B;  5K9F A;  4OX7 A;  1I5O B;  1RLD A;  2FVR A;  2BJ9 A;  1RBO B;  4GVL A;  4QWE A;  4V1A k;  1S7H A;  5D4N A;  1JJ4 A;  2HLU A;  2C28 A;  2R7O A;  4RNM A;  1CJT B;  3X3U A;  3QGP A;  3ISN D;  4LR9 A;  2DGS A;  1QM9 A;  2RQM A;  3DKD A;  4EUV A;  2GQQ A;  4DX7 A;  2Q6C A;  4O23 A;  4JI7 F;  3PY8 A;  4K4V A;  3T6J A;  3OLB A;  1VRQ C;  1CJK A;  2OPP B;  4KHP J;  3CDB A;  2YKM A;  5I3U A;  4RU2 A;  2E5G A;  2HGL A;  4P2X A;  4ZIT A;  3KDN A;  4OZN A;  3QRP A;  3SQG B;  1OQ3 A;  1XMB A;  4KSE B;  4EO6 A;  2K7J A;  1UWA A;  1ZOT A;  4AQY J;  2L9N A;  4ZPW R;  5LL6 d;  3ONQ A;  1J2V A;  4OL8 A;  4OYM A;  3FGV A;  2DO0 A;  4DUZ J;  1N32 F;  1IKV B;  3HO1 A;  1K1S A;  2D3O 1;  3CJK B;  1H3D A;  1NLK L;  3DNC A;  3OR2 B;  2CPF A;  2VUG A;  4CO5 A;  2HNY A;  3SZ2 A;  2W1B A;  4FP9 A;  2RH3 A;  4FNH A;  3IRW P;  2E9T A;  3HVR A;  2FVQ A;  2YNG A;  4ZJQ A;  1J5E J;  4KV8 B;  3UN3 A;  4ZVG A;  1YQH A;  4NL5 A;  2PI4 A;  2KG1 A;  1B0V A;  2FHJ A;  1BUX A;  1RAE B;  4KHR A;  5IV3 A;  3NCP A;  2LDY A;  1HWK A;  1U1N A;  4K4X A;  4PG6 A;  3CJQ A;  3LGH A;  1REG X;  4ECU A;  1QTM A;  1L3K A;  4X84 A;  2HK3 A;  3TAQ A;  5ETT A;  2J6S A;  4KGV B;  3M2U A;  2JVO A;  4RKU C;  1VHF A;  1YJN S;  5J2N B;  3TUI C;  4MK9 A;  4P2M A;  4IH5 A;  1LQ9 A;  1XIQ A;  2OKQ A;  4MMO A;  5DRK A;  4KQZ A;  5E41 A;  5LOQ A;  3VVT A;  2V69 A;  4N5S A;  5LM7 E;  4KYZ A;  4KGX B;  2ASJ A;  2IM1 A;  1PAU B;  2IM0 A;  2XNR A;  1LWC B;  1RT3 B;  4X4N A;  4QR0 A;  3GU0 A;  2ZOF A;  5KT6 A;  5IOL A;  4E8U A;  4N77 A;  2E1R A;  2IC3 A;  4LVO P;  1P27 B;  3G82 A;  4CDI A;  3H42 A;  3P3D A;  3K17 A;  2DR9 A;  4O3P A;  4U7U K;  5E5N A;  2MKC A;  3OTE A;  2HHV A;  2H5E A;  1QD1 A;  2EEY A;  4WJB A;  2AJ4 A;  5E3R A;  3VZH A;  4OI4 A;  5CHC B;  1JB0 C;  1HLW A;  3M8P A;  2WBR A;  5JVH Q;  3DOK A;  3OTO J;  4F3O A;  3AAW B;  4DR2 J;  1QAY A;  5HRO B;  5F9L A;  2HQF A;  3DRS B;  3Q8Q B;  1FT8 A;  2W9A A;  5HBM B;  4LQ3 A;  3WX4 A;  1HMV A;  3V5R A;  2V9W A;  5KFY A;  3NWG A;  3UR3 C;  4LF6 J;  2UV8 G;  5KFR A;  3NS7 B;  1HNV B;  1EP4 B;  3RAM A;  3F44 A;  3JAM U;  4R25 A;  3PVX A;  3DLH A;  5CYQ B;  2H3E B;  1F6T A;  2CVE A;  4DQP A;  4LF9 F;  2M8H A;  1MN9 A;  3W3S A;  4OQJ A;  2B8Q A;  1NJI T;  1RTH A;  1SVD A;  3LA0 A;  2XLJ A;  3AD8 C;  3K7R A;  2ZH2 A;  4YDD B;  4CH7 A;  5IT4 A;  4RW4 A;  1R3N A;  2WSF C;  1LW2 B;  2H51 B;  2RUS A;  1JLG B;  2ERR A;  3J81 U;  1YTY A;  1REV A;  4ZCK A;  2P6T A;  2E5H A;  2W9C B;  2YBV A;  4HYK A;  4ZLN A;  4IDK A;  2M4M A;  2RE1 A;  4U96 A;  2UXC J;  3IGV A;  1FKA F;  2HWI A;  4DZD A;  3ET6 A;  3JTP A;  1F0X A;  2DXD A;  3FQK A;  3GYX B;  1X9S A;  1RT2 B;  4QQB A;  4DG1 B;  4B08 A;  4K4Y A;  4J9M A;  4LSL A;  1WDT A;  3CTR A;  1G2E A;  2OEJ A;  1LW0 A;  1YJU A;  3EE3 A;  2H5I B;  2KO1 A;  5J1E A;  3O6Q A;  5A76 A;  9ATC B;  3WIU A;  2CQ2 A;  4FBU A;  1NDP A;  4B3R J;  1H2T Z;  5ETQ A;  4DV7 F;  3HFZ B;  3T3F A;  1G1X A;  2ZH9 A;  2P9G A;  4F4Y A;  1WG4 A;  1QSS A;  1VQS A;  4J9V A;  5L1J A;  2DNG A;  1OS5 A;  4X62 J;  1WEX A;  1TK8 A;  4CO3 A;  4F36 A;  4WKR A;  1YVF A;  3MEE B;  2L41 A;  5C25 B;  1JLB A;  1U2R A;  2X1F A;  3H40 A;  5EDW A;  3W1Y C;  4L73 A;  2ZE2 B;  2R7X A;  3R97 A;  1RAC B;  4DOZ A;  3L3C A;  4QU7 A;  2O5D A;  4DI6 A;  3HDS A;  2WZ1 A;  4F8R A;  2LEC A;  1S6Q A;  1IKW A;  3CME S;  1U1L A;  2YX1 A;  4C0B A;  3AB4 B;  3P4U B;  2QFJ A;  1WF0 A;  3ENQ A;  3MXH P;  4RW7 A;  2KH9 A;  4LIW A;  2IVF B;  2RNE A;  5CQG A;  2XM3 A;  3MCS A;  4CO1 A;  1S6O A;  1W7W A;  2KYX A;  4DR1 F;  1QVF R;  1S1U B;  1RLC L;  2EFG A;  5FD1 A;  2DK2 A;  2MGZ B;  4ZVF A;  3QFH A;  2Z2L A;  4FKX A;  2Z8Q A;  4NLX A;  3POT B;  4WFA Q;  3VVU A;  5DM6 Q;  1WC0 A;  1LV5 A;  4URS A;  3ETO A;  4UQT A;  3BR8 A;  4O3S A;  4S0M A;  4FF4 A;  4B9T A;  4O3N A;  4PZV A;  4LF5 J;  1ZPW X;  1F9H A;  1FA0 A;  3HI9 A;  2EFN A;  4K5S A;  3GFH A;  4MJK A;  2QYG A;  4NI2 B;  3JSM A;  2GQC A;  1CBK A;  4I69 A;  1DAX A;  1JJC B;  2R8H A;  2HVD A;  1IBK J;  4C6A A;  2DNH A;  4KFB B;  3MD3 A;  5A8R A;  3PO4 A;  3H98 A;  3SSS A;  3BBC A;  4TU9 A;  4O44 B;  2YWF A;  5KFW A;  1TV6 A;  1UFL A;  3IA0 A;  3T5K A;  4DX8 H;  4G1P A;  4I56 A;  3DU5 A;  3HFV A;  5E33 A;  4NRU A;  3R7N B;  4QYZ K;  1FF2 A;  2XGP A;  2HQC A;  2QRR A;  1RT4 B;  2A6M A;  1GQE A;  2PO4 A;  1NK5 A;  1JXL A;  5IFM A;  3CGI A;  3D66 A;  3M8R A;  5HK4 A;  4QWB A;  4NRT A;  2BE2 B;  3JS9 A;  2MY7 A;  2OTJ S;  1R31 A;  5D6G A;  4P72 A;  2VDH A;  4OYX A;  2ZBQ A;  2DJW A;  2OMO A;  3H2U B;  4F7V A;  3ZFV A;  4RUC A;  1KBR A;  1Q82 T;  2ZOM A;  2WTF A;  2IDL A;  1Q7L B;  2FGO A;  3W9J A;  1NND A;  1RHJ B;  1Z1Z A;  1TMM A;  2RIL A;  3AOD A;  4EK2 A;  5J2P A;  3HP6 A;  2VG7 B;  3DHW C;  3D0I E;  2L9W A;  1T9V A;  4BC7 A;  2AF6 A;  1U2F A;  1EAY C;  3VAG A;  4CLU A;  3LAN A;  5F8L A;  1S77 D;  2XLI A;  1XNQ F;  3H5X A;  4URQ U;  1VQY A;  3KTQ A;  4CTA A;  4ERD A;  5KT5 A;  2NZC A;  2PII A;  2I5J B;  2WK4 A;  1YG0 A;  3NAH A;  4DR3 F;  3IM8 A;  1HBM B;  4PG4 A;  4LFA J;  2VPW B;  3DHX A;  1HI1 A;  4EWT A;  2UXB J;  3OXF A;  3EPI A;  2OEM A;  2NLW A;  3NWR A;  1TAU A;  4IH7 A;  3GJQ B;  4X4U A;  1HKA A;  2CZ4 A;  4WFZ A;  1RT6 A;  2W2O P;  3OL6 A;  3C14 A;  1MML A;  1S1W B;  5L9N A;  2XG8 A;  2V8G A;  3GSI A;  1TUW A;  4FYD A;  2VBZ A;  2BJ1 A;  1HYS A;  4M5J A;  4NLD A;  2JOQ A;  4NXM F;  3PYD A;  4RBU A;  3VQT A;  1RTD A;  5HVH A;  2CQ3 A;  3N28 A;  5E0O A;  1CJU B;  1UJ4 A;  2W4D A;  4F3M A;  4F4A A;  1OMS A;  4NA2 A;  2IYG A;  2FZK B;  1J5O A;  2FDN A;  3H59 A;  3MCO A;  1G3O A;  1UA1 A;  3PFE A;  2Y0B B;  3LGN A;  2MKH A;  4EEY A;  3HCX A;  3JAM Y;  2P2C B;  1S59 A;  5D0G A;  5HJY A;  2V94 A;  2YQ0 A;  2E1A A;  3M05 A;  5BYR A;  4ZPT R;  1T11 A;  3VR1 A;  1X5S A;  2CA9 A;  4WTO B;  3CWJ A;  4GVB B;  1T05 A;  4ZVS B;  2PMZ D;  4Y28 C;  4H4M A;  4UUX A;  3C16 B;  2XS7 A;  2AP6 A;  3Q8Y A;  1SL0 A;  1RKJ A;  3J81 Y;  3Q22 A;  4WF9 Q;  4K2J A;  1RTZ A;  3W2V A;  1I94 J;  5EHH A;  1RTI B;  5F41 A;  1U1O A;  2LQB A;  3DGV A;  3IRX A;  3C2P A;  4ZP9 A;  5K8M A;  2RQC A;  1QUP A;  1O5J A;  2YXL A;  2GA7 A;  4WZM A;  4A8O A;  3V4I A;  4PRF A;  1OPZ A;  4CRJ A;  3RAQ A;  3DOM B;  2B43 A;  1KR4 A;  3KLH A;  4UOF A;  1X4B A;  2YNI B;  3VGT A;  4ICL B;  5K8P A;  4QIV A;  4DL3 A;  2JX2 A;  1PJ6 A;  1SC6 A;  4DSJ A;  2VIC A;  4DL5 A;  2VOD A;  2HWT A;  2EFQ A;  1M5P C;  2HZV A;  1EZZ B;  3NGR A;  2UUC J;  4WU3 A;  1WG1 A;  3GWC A;  4DDF A;  4ZCI A;  3M32 B;  2VG5 A;  4NA1 A;  3I4H X;  1IM6 A;  1RCO B;  2BE7 D;  2G0J A;  2ATL A;  4XDC A;  1CQN A;  4IG3 A;  5CD4 A;  3DMJ A;  1CS4 B;  3RBX A;  2GMH A;  3FEX B;  3OR1 A;  4ES2 A;  2QA1 A;  1W2B R;  5DZ7 A;  4ZMM A;  3A8I A;  2CUY A;  4Q0B A;  1F2G A;  3WIV A;  4WXO A;  4QZV B;  3C6T A;  3JSB A;  1RU2 A;  5L38 A;  1UWB B;  3AOA A;  4O4G A;  4C4W A;  1TUG B;  1N5V A;  1GMV A;  2HQ3 A;  2LA6 A;  3H8Y A;  4B9V A;  1HWI A;  4DSF A;  4LT6 A;  1Y4Z B;  4WE1 B;  1SC3 B;  1Y0H A;  1JLA A;  2YY3 A;  4LBP A;  5LSL A;  5KFN A;  2V8P A;  5KFE A;  3LP1 A;  4KIA A;  5A0Y B;  4H4K C;  4G3I A;  1Q1K A;  2K7K A;  5B0E A;  1NH8 A;  5J2Q B;  2GML A;  1YZ6 A;  1V6H A;  3SCJ E;  5D0R A;  3FQL A;  2LEA A;  2VFT A;  2P9C A;  4LFC J;  5ETS A;  4RBT A;  1HHT P;  2QLF B;  2K3I A;  4K4W A;  2CZ9 A;  2AKW B;  3H90 A;  5KFC A;  2DXF A;  3I4P A;  2VHG A;  3FBE A;  1GMW A;  3FRY A;  3GE9 A;  4K4S A;  2L3M A;  2XYP B;  3KK3 B;  3CUN A;  3CIM A;  4DV2 F;  3D54 A;  4R5P B;  1UEV A;  2Z57 B;  1HI8 A;  4OZL A;  3C15 B;  4Y2M A;  3I31 A;  4NPO A;  2CYY A;  4RUH A;  1BHN A;  2ILY A;  4ZJO A;  4FVM A;  1N36 J;  4OYP A;  3AOC A;  3J7Z T;  3RAX A;  4AFF A;  3HD2 A;  3ZZY A;  5AE3 A;  4KBI A;  3SCK E;  1U48 A;  4ZVU B;  4Y34 A;  4Z7C A;  2B6A B;  1N8R T;  2NUH A;  3TJA A;  4PPZ A;  4ZPD A;  1JX4 A;  4BHQ A;  4Q44 A;  3BO4 A;  1ZM2 A;  1HNI A;  3M8Y A;  1U0H A;  2CNN B;  3RB0 A;  2GHV C;  2DIS A;  2MEW A;  5I3P A;  4JUZ A;  3VGS A;  4YOE A;  3RUB L;  3PYE A;  2RAQ A;  4HDH A;  2MST A;  5JVG Q;  3L7P A;  3CED A;  2Z0G A;  3CCJ S;  4OZ3 A;  2DT9 A;  1GNK A;  2C1E B;  3KK1 B;  3IMQ J;  2OUG A;  1VIX A;  3QFW A;  2XY5 A;  3OSP A;  4UY8 T;  1KVJ A;  5AXM A;  1QE1 A;  3CJT A;  2AIR B;  1X5T A;  2Q66 A;  2LMI A;  2QLX A;  3EXY A;  3NLC A;  4M94 A;  2AJQ A;  2JL9 A;  3U1L A;  3QT8 A;  1FJE B;  4N8N A;  1XMQ F;  2Z56 B;  5LMN J;  3MUV P;  3MMB B;  5KFQ A;  1NBE B;  2CG4 A;  2VQE J;  3K2Y A;  5LSO A;  2RML A;  1FO1 A;  2P6S A;  1SQG A;  3MHY A;  4OYA A;  1NCL A;  4LIR A;  5I42 A;  2J7U A;  4I2Q A;  3W62 A;  3MCM A;  1QY7 A;  4WFB Q;  2HHX A;  3ZZO A;  3TI0 A;  2C2E A;  4K2X A;  5HVF A;  3PRB A;  2KJW A;  2OD6 A;  2Y1J A;  5CH7 B;  4NCG A;  1P1T A;  2WOM B;  1KSP A;  3BO2 A;  2ALZ A;  3PFO A;  4EZ6 A;  4USK A;  5L46 A;  5E3A A;  4DUY F;  4NXN F;  4ZS6 A;  1TL7 B;  2QA2 A;  2ZH5 A;  1RAG B;  3OLA A;  2VC1 A;  1U1Q A;  2LKZ A;  1IKY B;  2NXU A;  2MQN A;  4LR7 A;  1HR0 F;  2ZH7 A;  1RWV B;  4HT5 A;  3KOA A;  1OJ4 A;  1BQN B;  2NXN A;  3H2L A;  1CLF A;  2Y1R I;  3QID A;  4DS4 A;  3DRR A;  2ZH8 A;  2JFD A;  2MHE A;  4EBC A;  4IFY B;  2FJV A;  2HFV A;  3I5B A;  3ELH A;  2X7I A;  2J9C A;  2GO9 A;  2HMI A;  4W4M A;  5AT1 B;  1FK9 B;  3MOJ B;  1XR6 A;  3KJQ B;  1N5T A;  3R2D J;  5DS7 A;  1SJR A;  1QTN B;  2HVZ A;  1J27 A;  3US5 A;  4WP3 A;  1VQ8 S;  1S0M A;  4FXV A;  3VV2 B;  2DR7 A;  1H98 A;  1SUQ B;  1FRH A;  4NEY A;  4OZJ A;  1DLO B;  5KFU A;  1RJJ A;  1FE4 A;  3M2V A;  3EVW A;  1BQX A;  3LP2 B;  2BMB A;  1OYD A;  1PYO B;  3I0S A;  2IJF A;  1HNX J;  2QMX A;  5EWG A;  5ETM A;  5L1K A;  1W2I A;  1BY9 A;  1BGX T;  1Q78 A;  3CD5 A;  4DR4 J;  3MEG B;  1S48 A;  1VLY A;  3ETM A;  1KTV A;  3PYF A;  1RAO A;  2XSJ B;  1WWH A;  4GO7 X;  3NG8 A;  2HHQ A;  3PHT A;  1VMB A;  2DNR A;  3KLG A;  1A9N B;  4DN0 A;  4NML A;  2E5I A;  3M8S A;  2OH2 A;  2E5L J;  3CCR S;  3THT A;  2LU2 A;  5KT2 A;  4NLV A;  2WVD A;  3T5J A;  5FLX U;  5CA5 A;  4N56 A;  3QZ7 A;  3OBI A;  2UUB J;  3I56 S;  4YME A;  3CJ0 A;  3CCE S;  2W7P A;  2IBK A;  3EXC X;  2GFF A;  3D7S B;  1WHV A;  2AJ2 A;  3M8Z A;  3BRE A;  2D9O A;  3RW6 A;  1RTJ A;  2GAH C;  2H65 B;  3JXO A;  1TK5 A;  2OFH X;  4O4R A;  3GG0 A;  3DDK A;  1R27 B;  1JLQ B;  2HHH J;  3QYY A;  1XQI A;  4JYA J;  3ITH A;  2ZH4 A;  1DTT A;  2BA9 A;  1NB2 A;  2F4V F;  1BQM B;  1QDU B;  1NUE A;  2OPQ A;  3A8K A;  3H25 A;  2EKY A;  5HL7 Q;  3PYG A;  3EGZ A;  4DZ6 A;  2R7V A;  5HJX A;  3A8J A;  4ED8 A;  3OTC A;  4JI4 F;  5B09 A;  4Q7A A;  3FBF A;  3PAC A;  3GP9 A;  3EVM A;  5GAE I;  4RUB A;  2IAJ B;  3FEY B;  3SI8 A;  4NA3 A;  2V8H A;  4M8L A;  3QSY B;  2C3M A;  1TKT B;  2FIU A;  3VGV A;  4GKJ F;  3NOC A;  3N6M A;  2Y8Y A;  1L5U A;  1S1T B;  5C24 B;  1WEY A;  3UFC X;  1YRU A;  1E6V B;  2V4Q A;  1HQU B;  2KT5 A;  3N5B A;  3DXB A;  3IP0 A;  2YNH A;  4PCQ A;  2HSE B;  4A8X A;  1JNR B;  3PKY A;  2WVF A;  2AV5 A;  4MK8 A;  1U8S A;  1Q4R A;  5GAH I;  3GFZ A;  4DL6 A;  2E1M C;  2PD1 A;  1Q5Y A;  4JI3 F;  3HVT A;  1D9F A;  3QT5 A;  4ZLL A;  5ETN A;  3NXZ A;  1VYA A;  3HKW A;  4OLO A;  4M5K A;  2EW9 A;  4DS5 A;  2PMW A;  2K8G A;  2OPS B;  2QLJ B;  1VQP S;  3NNH A;  2IA6 A;  1HHQ A;  3MM6 B;  2VFR A;  3KLI A;  2BV3 A;  2AJ0 A;  3UVJ B;  4DU7 A;  1CJT A;  4DPT A;  2JLG A;  3TJ9 A;  5CAB A;  3DLK A;  4C8Z A;  3H2V E;  3BV8 A;  2FJX A;  1RAJ A;  3IR5 B;  3KKF A;  2RB7 A;  2YVS A;  3AJD A;  4BS2 A;  4GKK F;  2HAI A;  2OPP A;  1GFW B;  5KG5 A;  1R8A A;  3HT3 A;  4R0E A;  2MHN A;  3VZI A;  3SQG A;  4WU2 A;  4TXS A;  2NXJ A;  5D3G B;  2W01 A;  2J9D A;  4Z7Y A;  2L08 A;  2BM0 A;  2DNN A;  3DDN A;  2M9K A;  4EI2 A;  2A6O A;  3FZ2 A;  4CCH A;  2OFG X;  5K14 B;  1JLE B;  3MM7 A;  2PI5 A;  3ADA C;  2ILZ A;  2PSZ A;  4B9U A;  1EKS A;  1HBO B;  2FD2 A;  1FXD A;  4DQS A;  4F4Z A;  1U1R A;  1UP1 A;  2CPY A;  2MZR A;  3Q8P B;  2J8S A;  5J1P A;  4P73 A;  4PWU A;  4PYA A;  2UUA J;  4J7C A;  4KJI A;  1HPZ A;  3FSX A;  1G4C A;  1WSR A;  4DL0 C;  2XWX A;  2BW2 A;  2CXE A;  3CD7 A;  1U1K A;  3OJU A;  2WON A;  2WB4 A;  2ZVS A;  3HSD A;  3K0J A;  4IFV B;  1GX5 A;  1NJY A;  3EVO A;  3A3P B;  1NKB A;  1C1B B;  1RQ0 A;  1SH2 A;  1TKX A;  2NXC A;  4TQR A;  5EX0 A;  2F7V A;  1K47 A;  4C7Q A;  5KFK A;  2LYV A;  3QGH A;  3I0R B;  3HHE A;  2XB2 D;  1RT1 A;  1WTF A;  5AJ3 F;  1CUL B;  1NXI A;  1VIS A;  3RG6 A;  3DI6 B;  4Y0F A;  3A3N B;  1UZD A;  1ZS6 A;  2KXF A;  2Y3Y A;  4B3S F;  1IBM J;  2JC0 A;  3MFI A;  1XNR J;  5MAO A;  3SSQ A;  3M8Q A;  1UL3 A;  2YWW A;  3LQV A;  3CDW A;  2UVR A;  4F50 A;  3OXL A;  6FDR A;  5MLC V;  3TZY A;  2N4D A;  2BOP A;  2GC8 A;  3N9U C;  1DRZ A;  1FNX H;  2ZFH A;  2XZW A;  3T9N A;  3TP2 A;  2W2N P;  5G0R A;  2BW7 A;  5C42 A;  3ZZ0 A;  4XPE A;  2MZJ A;  2IFX A;  1K0T A;  3NGK A;  3PR4 A;  3MTK A;  4CLP A;  4IG0 A;  4J9U E;  4PWD B;  5LT5 A;  2D7S A;  2ZD1 A;  1UA0 A;  4KPY A;  1S9G B;  2HRY A;  3TVZ A;  3R7B B;  4O3O A;  4O0N A;  3HHL C;  5HP1 B;  1DQ8 A;  2ZBP A;  3G8Q A;  1UMJ A;  3ILL A;  4HI2 A;  3HUL A;  3CC2 S;  3IAM 9;  3M9N B;  1SIW B;  3DRS A;  4MTP A;  4B9M A;  1HL6 A;  5HBM A;  3RGI A;  4KKO A;  4R8U A;  1KLM B;  4MT1 A;  2M70 A;  3TJ8 A;  4G6V B;  3EIC A;  2J9E A;  1Y5L B;  1HNV A;  3WC0 A;  1EP4 A;  1T94 A;  3HZG A;  3ZO7 A;  2UVV A;  3QJL A;  4JI6 J;  3IXQ A;  1AFI A;  4DR5 J;  4CO2 A;  4DX6 A;  2JZ5 A;  2QMU B;  1VGY A;  2MQ8 A;  2ZH3 A;  4B9S A;  3GG1 A;  5I3Q A;  2X1B A;  3P5B P;  1IBL F;  2VA2 A;  4DX5 A;  2JDJ A;  3PW2 A;  2MKI A;  4A8S A;  4IOA Q;  3MPD A;  2J76 E;  3FCH A;  3M2R B;  3MPU B;  3D68 A;  4WPA A;  2ATC B;  4A46 A;  1UVM A;  1HD1 A;  2GJI A;  4ECY A;  4ZVT B;  4KHM A;  3MMA B;  4B17 A;  3JTO A;  1HQE A;  3MM8 B;  2G13 A;  1VRT B;  1KKH A;  3GFY A;  2BR0 A;  1N4L A;  2BDP A;  1RWU A;  2XY7 A;  4QR1 A;  2Y1L B;  5FLX Y;  3NBP B;  4A8K A;  3M6U A;  3IG1 B;  2CPZ A;  3KWM A;  1CJV B;  1SPB P;  5KG1 A;  3E3X A;  3BDP A;  1FKP B;  3HJV A;  3ZNU A;  1RWP B;  3CF5 Q;  3QWU A;  1IWG A;  2AGP A;  5KFD A;  2DNM A;  1CC8 A;  3OV7 A;  5HMY A;  1PO6 A;  3X1L B;  1B7Y B;  4ZK7 M;  3VHQ A;  2CIM A;  5DJB A;  4U8V A;  2PA3 A;  3RJM B;  4EFA C;  3OT9 A;  5FDL B;  5E3C A;  1RWW B;  2JLF A;  1L3T A;  3CVK A;  4ZDN A;  2Z4P A;  3MEE A;  4LRD A;  4ZLJ A;  3MM9 A;  1UZH A;  2WVB A;  1WEZ A;  5EWF A;  1LXJ A;  2MPU A;  3CC4 S;  2WB1 D;  2VZ9 A;  4F26 A;  3SDE B;  3KK2 B;  2CZV C;  1T9X A;  3U02 A;  5U47 A;  4ILM A;  4P7V A;  4HI1 A;  2CQ4 A;  3ZTQ A;  5DGB A;  1FJG F;  4M5D B;  2DRA A;  4DLE A;  2R7Q A;  1WC1 A;  2C2O B;  2I8E A;  1M5O C;  3ZZR A;  3ULH A;  4B3O A;  1ZYQ A;  2GX8 A;  2CJA A;  4RNH A;  2XSF A;  2HIY A;  1X0P A;  2A1B A;  1B0T A;  3HSZ A;  1D9D A;  2MDA A;  1T95 A;  3HHD A;  4DL7 A;  3I9V 9;  3FDS A;  1RAD B;  1NPR A;  3POT A;  2V5H G;  4FXD A;  1YSJ A;  1BE4 A;  3PM9 A;  4RNO A;  4G1Q A;  3T5H A;  1UVJ A;  2AT1 B;  4LSN B;  1SV5 B;  5BJR A;  3FVY A;  4A8Q A;  1YJT A;  4ILL A;  2KXN B;  3LH2 S;  4C11 B;  4NZ7 A;  4X65 J;  3GB0 A;  5A8K A;  4HH0 A;  2MMY A;  2HNZ B;  2O01 C;  3BBB A;  3BM7 A;  3S1T A;  1U25 A;  3K5L A;  4I7F A;  5E3Q A;  3WC2 A;  2M7S A;  3PEJ A;  3OTB A;  4NZ0 A;  4CI0 B;  3VAI A;  1RWM B;  4X4V A;  4XO0 A;  1TQL A;  2DTJ A;  3JTN A;  2HLT A;  4L3N A;  4L6V 3;  3CMA S;  4HTI A;  1UW4 A;  1RT4 A;  3MEK A;  3S8S A;  1UCN A;  1JKH A;  3V6H A;  1RT5 B;  2E1P A;  4LF1 A;  5F8I A;  4ZCL A;  4HDG A;  3CJ2 A;  4X66 F;  3BYR A;  3DLG A;  2VA3 A;  3OFG A;  2LQ8 A;  3HT0 A;  2COL A;  2D3Z A;  2ZEJ A;  2GNK A;  3EDQ B;  4W90 B;  3KG4 A;  1TKD A;  4WK1 A;  2W2Q P;  5B0B A;  3M6X A;  2G1D A;  2NXE A;  4HR2 A;  1KQS R;  1N34 F;  1D1U A;  2F1F A;  3G6Y A;  3AT1 B;  4IO1 A;  1AW0 A;  2JJ4 D;  1OSC A;  2GVD B;  3J7A 1;  1WAC A;  4F3Q A;  2DEJ A;  2JHE A;  3UDC A;  1YX2 A;  2C2R A;  1V5I B;  1NB7 A;  4PUO A;  4DV0 J;  1I3O B;  1TR0 A;  3NMA A;  2LXF A;  1EKR A;  1C1C B;  3F0N A;  2I5J A;  5KG7 A;  2B56 A;  4KE5 A;  3EWG A;  2V67 A;  4X4R A;  1VQL S;  3CD6 S;  2I1R A;  2EFO A;  2BM1 A;  1HBM A;  4DPX A;  2BUN A;  1Q86 T;  1M5S A;  3JB9 k;  3D28 A;  3QNW B;  2HFS A;  2DY1 A;  2E7X A;  2W7A A;  2VFS A;  4K8R A;  5J2M A;  1U1P A;  4IH6 A;  2U1A A;  3QRQ A;  1SC1 B;  4KTQ A;  2MLX A;  4DPU A;  1QVG R;  2VBX A;  4IRK A;  4FF3 A;  2AZ1 A;  3HK2 A;  2QN6 B;  4QW8 A;  2YKN B;  4D3G A;  1EQM A;  2MQL A;  2ZM6 J;  1WF1 A;  9RUB A;  3FCV A;  3MDF A;  3DGP A;  2WW4 A;  2DXE A;  4NLS A;  3FFI A;  2XO7 A;  4IKA A;  1K1Q A;  3KLE B;  5L1L A;  3RBD A;  4Y6I A;  4USW A;  1CJU A;  4OZ2 A;  4ELT A;  1GAO A;  2KYZ A;  2KKH A;  2XYH B;  4JI6 F;  3UPF A;  1N5Y B;  4XIU A;  3IO1 A;  2YKM B;  4TKT A;  3AJ1 A;  5I3U B;  5DG8 A;  2PFF B;  3HKZ D;  2W2P P;  2V8V A;  4PXB A;  1N56 A;  3CW2 C;  2ACY A;  1Q81 T;  1TVR B;  1VIO A;  1UEU A;  3GJT B;  4CLT A;  2VOP A;  2OHD A;  4ECT A;  1VBY A;  3NGD A;  5IQQ A;  4MFB A;  1CQM A;  3H0P A;  2ZJR Q;  2B4P A;  1Q16 B;  1DTQ A;  2C2K B;  4B3T F;  1UFW A;  4YR2 A;  2RQK A;  1HAR A;  4PG5 A;  1ZTT A;  2BYC A;  4DSL A;  1NK4 A;  3NNA A;  3KJV B;  2CQ0 A;  4AXI A;  4CLS A;  3Q24 A;  2AQ4 A;  1P1L A;  2GHP A;  2DNY A;  1VK8 A;  2HNY B;  1H7W A;  2YNG B;  4DEZ A;  3PIP Q;  2D41 A;  3BQ1 A;  4LF8 F;  1VBZ A;  2QA4 S;  1Y00 A;  1S9E B;  4WFX A;  1U6Z A;  1X8D A;  4OYI A;  4ZLP A;  3EPG A;  2DGW A;  2ACM A;  4C9D A;  3KUH A;  4JV1 A;  1D0E A;  4TYB A;  2AEF A;  1GEH A;  1PAE X;  1X4G A;  3VTI A;  2DEI A;  3IS9 A;  3GCW P;  5KFI A;  2BAN A;  3DOM A;  3M2U B;  4B3M F;  1IR1 A;  3R5A A;  3L95 X;  1S10 A;  2H4Y B;  3BSN A;  2BX6 A;  3ZZZ A;  4JBC A;  2NSC A;  4I2P A;  2CAJ A;  2FQQ B;  3G8T A;  4WKY A;  4U7U D;  4YB6 A;  1W26 A;  5K5M A;  3U7J A;  3QT7 A;  2P9E A;  5THW A;  4OZ1 A;  3T1Y J;  2LCW A;  5JJB A;  3ZNJ 1;  2OSQ A;  3M32 A;  1WOO A;  3P5T L;  2DRD A;  1MRO A;  2XMM A;  3BKF A;  4EO8 A;  1HWU A;  4ECW A;  3KUE A; 
#chains in the Genus database with same CATH homology
 2H65 B;  1PYO B;  3IBC B;  1RHJ B;  3EDQ B;  1RE1 B;  1RWV B;  3RJM B;  2CNO B;  2C2M B;  2H51 B;  2C2Z B;  1RHQ B;  2QL5 B;  2HBR B;  1RWW B;  1RHR B;  3P45 B;  4DCO B;  1BMQ B;  2HBQ B;  4ZVP B;  2H5J B;  2CNL B;  4LSZ B;  2DKO B;  2QL7 B;  2CJX B;  2QLJ B;  3GJS B;  1SC3 B;  1QDU B;  3P4U B;  4DCP B;  4ZVU B;  4ZVT B;  3D6H B;  3GJR B;  1RWN B;  1I51 B;  2XYG B;  3IBF B;  2XYH B;  4ZVO B;  1RWO B;  3SIP B;  2HBY B;  4ZVQ B;  3R7N B;  3D6F B;  1RHU B;  1IBC B;  5IC6 B;  2H54 B;  2Y0B B;  2Y1L B;  3KJF B;  2XZT B;  3KJQ B;  3R7B B;  2XZD B;  4JB8 B;  1I3O B;  2CNN B;  2P2C B;  4DCJ B;  1RWM B;  1QTN B;  1GFW B;  3NS7 B;  2H4W B;  2H4Y B;  1RHM B;  2H5I B;  3GJT B;  1SC4 B;  1NME B;  2QLF B;  2C2O B;  3GJQ B;  2QLB B;  2HBZ B;  5K20 B;  2FQQ B;  2CNK B;  1RHK B;  1F9E B;  3D6M B;  1ICE B;  5IC4 B;  3EDR B;  4ZVS B;  1RWP B;  2QL9 B;  1PAU B;  3QNW B;  3R6L B;  2C1E B;  1RWX B;  2C2K B;  4ZVR B;  3R6G B;  3R7S B;  1RWK B;  2XYP B;  2CDR B;  2CJY B;  1SC1 B;  3R5J B;  3KJN B;  2H48 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...