1QTNB

Crystal structure of the complex of caspase-8 with the tetrapeptide inhibitor ace-ietd-aldehyde
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
90
structure length
90
Chain Sequence
TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-8
publication title The atomic-resolution structure of human caspase-8, a key activator of apoptosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 20
structure length 90
sequence length 90
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 1999-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1qtnB00
1RHRB 1RWXB 2H5JB 2HBZB 2HBQB 4ZVPB 1IBCB 1RHJB 2H4WB 2H5IB 4JB8B 3R7BB 2P2CB 2H54B 3R5JB 3P45B 2QL7B 1RWNB 4DCOB 2XYGB 2C2OB 2CNLB 3GJRB 2QLBB 2CNNB 1RWWB 4ZVQB 1QTNB 2CJXB 2XZTB 3P4UB 2C1EB 4DCPB 2QL9B 2HBRB 1RHKB 2Y0BB 4ZVRB 2XYHB 1RWOB 3R6LB 1PAUB 1RWVB 2HBYB 2CDRB 1PYOB 2C2MB 1SC1B 2C2KB 3NS7B 2CNOB 1F9EB 2FQQB 3R6GB 3GJSB 1I51B 1NMEB 5IC6B 2QLFB 5IC4B 1GFWB 1SC4B 3D6HB 1SC3B 2XZDB 2C2ZB 1QDUB 3KJNB 3D6FB 3R7NB 3R7SB 3SIPB 2Y1LB 2CNKB 3KJQB 1ICEB 2QL5B 3RJMB 3GJQB 1RWKB 3EDQB 1I3OB 2H4YB 1RHUB 1RE1B 3EDRB 4ZVSB 3GJTB 1RWMB 5K20B 4ZVTB 1RHMB 3IBCB 4LSZB 3IBFB 3KJFB 2H48B 4DCJB 2DKOB 1RHQB 3QNWB 4ZVUB 2H51B 2H65B 2XYPB 1RWPB 2CJYB 3D6MB 1BMQB 2QLJB 4ZVOB
chains in the Genus database with same CATH superfamily
2IPOB 1R43A 2ZEJA 3LALA 4DLGA 2AYGA 2CVIA 3NNAA 3OVBA 2RDJA 3M8QB 1UEVA 1T11A 3FBEA 3KXDA 3QQCD 5C24B 4ED6A 4Y2CA 1FXRA 1VQYA 5L8RC 2E66A 5C25A 5KFMA 1NH7A 3K7RA 1CVJA 3I9V9 1S6QA 4C48A 5IV3A 4RO0A 2WVBA 5A8KA 5BYRA 5D0RA 3ZTPA 4HYKA 3CVKA 1O51A 1BXNA 2D3UA 3R9LA 1FO1A 3IRXA 3K57A 3JSBA 3GFZA 2RRBA 3TVKA 5DLFA 4RWXA 1NK5A 4K4SA 4PZVA 4M5DB 2YNGB 2HVIA 3C8YA 1A6LA 4LF6J 4JI2J 3HX9A 4DV2F 2FIUA 2XY7A 3KJFB 5LM7E 1RHQB 4FN5A 4EU0A 3FVYA 4BHQA 1H7WA 4B9SA 4LBHA 5LJ3Y 2NQPA 4DOZA 5C2GA 2MKSA 1MROB 4EUVA 1RTZA 2FZCB 1FHTA 3C15A 2B7CB 3KUGA 1C0TA 2EG1A 3MAQA 2ZWOA 2VA3A 1F60B 1YQHA 2J7KA 4JI5F 3MCSA 4OZNA 2K7JA 2WCXA 1Q8IA 2LEAA 3OD2A 1HNZJ 3US5A 2HVHA 1HD0A 3SQOP 4NI2A 2EEYA 2AEJA 4YHHJ 3HD2A 3DDKA 1VRQC 2LLZA 3BKTA 1ZETA 4QZVB 1H2UX 2OPPB 4ES3A 2WVEA 1BWEA 3N0VA 3U1NA 2GNKA 3NCQA 5A2QY 3PW2A 2DYAA 3K17A 2NXCA 3KLHB 1JNRB 3KLFA 2LQBA 3PYEA 4S0MA 2ZJQQ 3QFWA 4PG4A 4OIXA 2GAGC 1HI1A 1R7IA 5AE2A 3M6VA 1SKWA 2B4PA 1UVLA 1SQFA 3UNYA 3TP2A 1F5AA 4DL3A 1G2EA 4OJ3A 4K4YA 3L7PA 4LIRA 1GTHA 2HMIB 3JYTB 1JLEA 1ROFA 1V5VA 1VR6A 2YKQA 3D66A 5HMZA 2QGFB 3G96A 3D68A 2R7VA 2VQFJ 2M7SA 5T7LA 3DOMA 4MYTA 2R7OA 3AY0A 3SFUA 4P2XA 2UXDJ 1Q79A 3IAS9 2BW2A 1SQGA 3GJSB 3RR8A 2RUGA 2XZDB 4WWSA 4ZPTR 2DR6A 5B0AA 1HNXJ 1HWUA 5ITHA 1F3VA 8AT1B 2UXBF 2EFNA 4HH0A 5H9FK 3BKFA 1BUXA 2HGLA 3E01B 4RW4A 4J9QA 3VQSA 1DARA 4ZVUB 4IFYA 4PUOB 3GSDA 1QAJA 3W2WB 3FK4A 3T5LA 3CO9A 1NO8A 4O4RA 3CE8A 3RB0A 2FGCA 2XLKA 5KFDA 1LEOA 2BABA 3R7BB 4ZVHA 5I42B 1RI7A 3OTEA 2W9CA 2KU7A 4J9RA 1VLOA 1N32F 2XGPA 2KXFA 3PNIA 3CMAS 2FHKA 4LRAA 2E5GA 4F2SA 4A8KA 1XNQF 3LP1A 2XLJA 3GZ7A 1BGXT 3FSYA 3RZAA 5AXKA 1FJ7A 1REGX 3KJVA 2R2SA 4B17A 4UZBA 4ILLA 3DGPB 2HK2A 3GV7B 2D7SA 1U6FA 4YB1P 4CO5A 2JZ5A 1ZAVA 1XMOF 3UO0A 3H4DA 4J9VA 4ECXA 2VC0A 3DRYA 1U7LA 3ZXWA 1XQIA 4YR0A 4IH7A 3QO9A 5E5NA 1WEYA 1KVIA 2CXEA 4USUA 4I6WA 3QIDA 1GMUA 1RHRB 1EARA 3TQ1A 4ZVPB 1YJVA 4HI1A 2IA0A 2VG6B 4UQTA 4YDXA 2IMOA 1SH2A 1CEZA 4CLZA 4LF4F 3JS9A 3HVAA 3MEEB 2FVSA 2ZVIA 3LP2B 4MKBA 3DM2B 3KMQA 2MLZA 3FUYA 3HVTB 3QRRA 4ER8A 3PW7A 2OTLS 2ASDA 2DISA 3IGNA 1KLMB 4LRBA 4DU7A 1LXNA 5L1IA 1R89A 5F0WA 2PC6A 1RAGB 2EBGA 5LOQA 2PMWA 4FNIA 3NCRA 3PYFA 4M1KA 2DHAA 5B08A 3OJUA 3L3CA 1YRUA 3RW6A 2RB7A 2KXNB 1RAHB 2Y1RI 1UP1A 2HHXA 5KFXA 3N4WA 4KY3A 3BYRA 3J7YI 2MY7A 2ZC4A 4CM0A 2HWHA 2RDIA 3OHAA 5HROA 2E9RX 2RU9A 3KNAA 3AXKA 4RUBA 2HAFA 1P9YA 5I3UB 4DS5A 1RTDA 2DPIA 2NR0A 4J9LA 5CD4H 4FBUA 2CQGA 2P9EA 2QFIA 4RWWA 4AL7A 1VQMS 2UVVA 3POTB 1MWQA 1WC0A 1XR5A 2QLWA 2NXEA 3OBIA 3ZTSA 3GU0A 5K14B 3DRPB 4KO0A 1N6QA 1QTNB 1U48A 2QL9B 3TZXA 4DMZA 2JL9A 3JSMA 4I2QA 4DV7F 2J0XA 1VK3A 2ZD1A 2L48A 4JV5J 2VG7B 2ERRA 1T3OA 4ECYA 4C98A 2U1AA 4USWA 2BE2A 4U96A 3PYGA 4ALZA 4LFBJ 3FC9A 4ZIWA 1FKPA 4N47A 3QSIA 3SI8A 4UOCA 4DR1J 2KVIA 1F3FA 1Y10A 3T1YJ 4WP8A 4IQMA 1WC4A 1I6JA 1T95A 4L72B 1WC3A 3W7BA 3DMJA 2ZHOA 3RR7A 2Y9HA 2VFRA 3IWLA 3QNWB 1XN9A 4OI6A 4ZCKA 1S1XB 2CQCA 4JI0J 2AGQA 2CZVC 2GHPA 1QLNA 1VQ8S 3N6NA 1RT7A 1N34J 1SKRA 2V63A 3NS6A 3BQ0A 1EZZB 5DGAA 3PR5B 2NXJA 1DAXA 5LSRA 4FPRA 3CJ4A 2YWFA 2ZFHA 3DRSA 4D3HA 4HTIA 1TUGB 3DLGB 2BMBA 3G9CA 4IUFA 4F3QA 2BANB 2BYCA 3SSSA 1BLUA 1LFWA 1K73T 3TAQA 1U1QA 2HFNA 1PC5A 4M63A 4P6QA 2XY5A 4X4RA 4ECVA 3N5BA 1Q81T 4O44A 2BACA 1TL7B 5KFJA 5KFHA 1MN7A 1IBLJ 1U47A 3VGTA 1X4GA 4IG0B 1WHVA 3A12A 4GO7X 3GIMA 3R27A 3FQLA 2BZ2A 4NMXA 1RBAA 1JLGB 3IBFB 2DR9A 4KHPF 4GVLA 1T05A 4BWMA 4QYRA 4RW8A 3CSKA 3K58A 2JJ4D 4E0DA 3DOLB 4O0IA 1VBYA 4U67Q 5J1EB 2Z8QA 2CWKA 3LPEA 1RU2A 1YKWA 1B7FA 1PSDA 2RILA 1VK8A 2ZZMA 2DY9A 4ECTA 2AD9A 3MEDB 1B99A 4NCGA 5KG1A 1S9GA 2W2OP 5L46A 1U0HB 5HMXA 1H73A 4ZJQA 3G6YA 4Y6IA 4OYBA 4ZMMA 2DGUA 2WZ1A 5A8WA 2CNOB 4LF9J 3GCXP 1X5PA 4CTAB 4B9UA 2XMWA 3KKFA 2BJDA 5CD4A 4PWDA 2ZM6J 2C3PA 3EUNA 3HHLA 2IYGA 5C42A 1LW0B 3OFHA 5G0RA 3ILIA 3BSAA 4IO9Q 4GO5X 5M2UA 2YNIA 3CJKA 1ZA2B 2V69A 4DL4A 1NPRA 4E98A 5A76A 2JC0A 3QRQA 1Q8KA 4YR3A 2WTFA 2KKHA 1K47A 4ECQA 4Q44A 4X66F 3QZ8A 3PACA 3TNVA 1Z2LA 1RBOB 4WKYA 2H54B 1HLWA 1PG5B 1NDLA 2XMVA 1ZPVA 2CNLB 1SVDA 3ISND 5KFGA 4J9NA 4F02A 4ED0A 4OX9J 4NXNJ 5HAOA 2HLUA 3HJVA 5CYJA 4NLRA 1RT1A 2VJUA 4X65J 1VQ7S 3R6GB 4B9VA 2Z4PA 1I51B 2G2YA 5J2NB 4DV3F 3N5FA 2M5YA 3G87A 2JEGA 1VQ4S 4GVBA 2CPFA 1VIOA 3KK2B 2VFUA 1FA0A 1I3OB 4I1TA 5KT6A 4OYIA 2Q43A 2YWWA 2GMJA 2F7VA 2DGTA 4UF4A 4Z2XA 3PX4A 4OFZA 1KFSA 2I5JA 2NZCA 4HACA 3M9MB 4P10A 1XC9A 3HHNB 2XYPB 4QU6A 1NZ8A 2HHQA 4FYVB 3QMQA 5F9LA 4UT4A 1YJNS 3I31A 1RHJB 4ZP6A 1TKXB 4JV2A 3CJ0A 3W2VA 4OL8A 3SFGA 1VQLS 5D0HA 1XJWB 1TK8A 4U8VA 5HBMA 2W2NP 1I5OB 3HVWA 2ZKTA 2HNYA 3JB9k 1Q78A 1APSA 2BDPA 3CC2S 1UA0A 4DN9A 4C0OC 1REVB 1DLOB 3N9UC 4QIGA 2NCKL 4QCLA 4OX7A 3W8GA 3KG1A 1XR7A 5IT9U 4TNOA 1VC5A 4CLTA 1VQPS 2R8JA 4DR5F 4FBTA 3DRRB 1E6VA 1HQEB 1XBWA 4J5OA 4XPEA 1D09B 2WSCC 3HULA 3L7UA 3H25A 4DCJB 2HW3A 2BX6A 2C3MA 3P8BB 4LJMA 2XSJB 4RUAA 4EYHB 4ANDA 4PG8A 2XMAA 2XY6A 4LR9A 4JB8B 1O0PA 1ZM3A 2F1FA 3M1VA 2LDYA 3UD3P 4B3RF 1R8HA 1SH3A 4I64A 1HNWJ 1JIHA 4YB7A 3GPAA 4OYAA 1WELA 4R0EA 1GAOA 2DNRA 2XULA 2CJ9A 2H3EB 1YBUA 3IM9A 1S9EA 5C7PA 4FZVA 4F8RA 1SXLA 3HJFA 3U7JA 2VKRA 1Q5VA 4EZ6A 3D4JA 4USIA 1FKOA 1D8ZA 3OJSA 3O1LA 3FZ2A 2NREA 2DY1A 1HARA 5A6PA 2DRDA 4FF2A 1D9AA 4DUTA 1MMNA 2LA6A 1DTTB 3PJWA 1UJ5A 5LMUJ 1I1GA 3EVOA 1R8CA 1EKSA 4GKJJ 1XNRF 4B9MA 1W26A 4AXIA 4UQGA 1DHMA 4ELTA 2DGOA 5ETTA 2CQPA 3G71S 1TVRB 4DR4J 3LGMA 2MKIA 3P5TL 2J0WA 5D15A 3IA0A 4MT1A 2RS2A 3ZZ0A 4PQUA 1IR2A 3ZNJ1 4RR5A 2ZH1A 1TKTB 4OYXA 4R5PA 2OJ3A 4RZRA 2HWIA 2K1RB 1S99A 2HNDB 5DDRC 2DEJA 3BBCA 4H4OB 4G6VB 2NSBA 1L5UA 3I55S 3FJ2A 1YITS 5IM0A 3HMJG 1HFEL 4ELUA 3V6HA 1M0SA 1B4SA 4O3RA 4K4VA 2V50A 3QJPA 3NCPA 2OUGA 3C16A 2CNKB 2DNGA 4IFVB 4BLGA 1D8YA 4P74A 1X9SA 1U1OA 1N48A 1JXLA 2P9CA 3NGRA 4IDKB 4H4MB 3M2VB 2JNJA 1CJUB 3H8YA 1X9MA 3IR7B 4W4MA 3PXGa 5KFUA 2X51A 1IR1A 4PRFA 1F9HA 4ZVOB 5C5JA 4AE5A 3E51A 3MM6B 3CCES 2V68A 2W01A 2XZWA 2P2CB 1XK8A 1NNDA 5DZ7A 5FJ4A 1S1TA 5GAHU 1BQXA 2XYGB 2YTCA 4A8XA 1YJWS 3BREA 5HP1A 4F0KA 2NZ4A 2IM0A 1FKAF 3TVZA 1R31A 5DLGA 3LGHA 5CA5A 2OMOA 2ZKUA 1WEZA 4TY8B 2CDRB 1ZOTA 1KHVA 4UOFA 2ZOMA 5A8RB 3RG6A 3K5MA 2RQKA 2UUCJ 3BZQA 4USKA 3T1HF 1FF2A 2U2FA 3OL6A 1MWZA 1NJZA 2IJRA 1TFYA 3C66A 2OPQB 2ZE2A 2GW8A 1IM6A 1KHWA 1LWEB 1K0VA 1ZM2A 2AF6A 3QT8A 3KLIB 2KRRA 3FNNA 3U1LA 5H9EK 3DHWC 4J37A 4WU2A 3IP0A 2V94A 2Q6BA 4C8LA 1KTQA 1GNKA 1RT4B 1VISA 2YKMB 1TFWA 4FF4A 3PRBA 3BBFA 2Y0BB 2AGOA 3DHXA 1IKXA 3CDWA 2HFUA 4DSFA 1RCXB 3MPDA 3OR2A 1FWPA 3ENAA 5CAAA 3PHTA 3HO1A 3CD6S 5B0EA 2WOMA 1IBKJ 4PXBA 2PA3A 1UFWA 4FF3A 5J2PA 2DR5A 3BV8A 1Q86T 2DNPA 5CYQB 5IT9Y 1RGVA 4U7CA 3CMQA 3CWJA 3CD5A 4OZ0A 4DPOA 4F50A 5KG4A 3R5BA 4WYLA 3ZZOA 1HQ2A 3NWGA 2PSZA 4MIAA 2IJNA 3TX0A 3MFIA 1RISA 4EO8A 3MXHP 1YTYA 1M5SA 2VDIA 2LKZA 2W8KA 4NCBA 3RB3A 2V8PA 2PN6A 2KI2A 1PJ5A 4WXOA 4OX8A 3S6EA 2IDEA 2DD8S 2YBVA 3IFEA 4LSNA 1GX5A 2RUSA 3WC0A 4YB6A 1L3TA 2CPDA 3HVRA 3VAGA 3TA0A 1C1BA 2D69A 2DR7A 2YQ1A 5E3PA 5KFWA 1WUUA 2BJ7A 2V4JA 1YLXA 4Q45A 2OFHX 3AODA 2HHHJ 2VBYA 5AXLA 3ITHA 1GXUA 3UDVA 3EZOA 5ETMA 3CIZA 3W61A 2QYGA 4NLYA 2O3DA 3SXLA 4OHXA 4A8YA 1R0BG 1EETA 2LDIA 3N6LA 1VFJA 2AJ2A 3V81A 3BR8A 2OPSB 2YY3A 5B0FA 1UCNA 2WSEC 2HURA 3M7VA 3MCNA 2FVPA 4L76A 1AFIA 5DO2A 2V2VA 3I82A 4F7VA 1FTCA 2YKNA 1OQ3A 1IKWA 2MMYA 1M1GA 4OLOA 1JLCA 4OHZA 1N36J 1Q4RA 1RWNB 3VCDA 3I0RA 1RTIB 3IG1B 5J1PA 2VA2A 4HVZA 2EFQA 1S1WB 2BQ3A 5L9XA 3VALA 2P8IA 2XYHB 1SV5A 1Q5YA 4ILMA 3TJ9A 2MB0B 1SKSA 1YX2A 1SC1B 2XS7A 5CQGA 4GRSA 4RNHA 3HKZD 4Y28C 2BE7D 3JSYA 2KZZA 4QYZJ 3GIIA 5IT4A 4QPTA 4DPUA 4ZHRB 3EVWA 5F9NA 3L7OA 1SPBP 5KFSA 1WG5A 4DR6J 3C6UB 3CCRS 4ZPVR 2BUNA 2ACYA 3D7SB 2F5GA 4QIEA 2NPFA 2KDOA 5U47A 4DXLA 2CQ4A 2MKJA 1I94J 4W92B 3M8YA 2WW4A 5LXRA 3TZYA 4UUXA 2Y8WA 3KK1A 4AFFA 5C2CA 1XMQJ 4DFKA 4PXEA 1BQNA 1BQMB 3SSRA 4JP8A 4NLWA 2YXLA 2XLIA 2ZBPA 3FCVA 1FVQA 3ILJA 5IQ6A 5ETOA 5KAKA 2EKNA 3UD4P 2J8SA 4IG3A 4IH6A 2FJEB 2HZCA 2XI3A 1TUWA 4DZDA 4DF4A 4B3OA 2CPYA 2E1AA 2D3ZA 1SKUB 3TWZA 1LWXA 4JI6J 2UUBJ 2HBYB 2CPEA 1FEHA 2QZ8A 3UE2A 3UR3C 5CYMA 2GAHC 4RW7A 4USJC 4ZIVA 2CQIA 1H6KX 4K4ZA 4KKOB 1O6XA 2DRAA 3WHIA 1WTFA 2PI5A 3GB0A 5D0GA 2HKEA 3PIPQ 3M8QA 4NXMF 2YWHA 2CPJA 3W9IA 1CJVA 2E5LJ 2VPWB 1M5PC 4XK8C 5C24A 2DNOA 1YZ6A 3F41A 1D0EA 2CKWA 2R7TA 4AL6A 4NX9A 1URNA 2GO8A 3CJQA 2GQ2A 1C2PA 1P1TA 4CLPA 2JLGA 2OTJS 3R5CA 2MY8A 3UCGA 3LQVA 2MQOA 1WHWA 4FS2A 5KFLA 1CULB 2BM1A 3D28A 5KTQA 4M5DA 2YNGA 1TKZB 2B3TB 2JSXA 2DRBA 2OH2A 1LK7A 2G13A 1FVSA 1S97A 5DDQC 4JI2F 2C2ZB 3AHPA 2HWTA 1NHUA 4O3PA 4GC6A 3E2EA 3TQEA 3I5CA 3D9BA 4PQAA 1MROA 4IKAA 4DL7A 1N5VA 2IVYA 3WBZA 2ZH5A 1N5SA 1JKHB 3TX8A 2GVZB 2J6TA 4KIAA 1HI0P 3SDEB 3SYZA 2RKIB 1HYSB 5IWAJ 2H65B 4FP9A 2B6AB 1H2VZ 3THTA 3LP0B 2XGQA 4CO2A 3PVXA 5HVGA 1RWXB 1G4CA 2UV8A 4HT5A 1SL1A 2QFJA 8ATCB 4ZP7A 5GAHI 1M5HA 1YVFA 2CQHA 1UETA 3FRYA 1PKUA 3C14B 4U95A 3B78A 2DO0A 1K44A 3H4BA 1BD6A 4BC7A 2OPPA 4L73A 2HQCA 2ZHAA 2QTWA 4DV4F 3KLHA 3AA9A 2X1BA 5GMDA 4DV0J 4I2PB 4OZ1A 4Y34A 3FCHA 2N7YA 1IBMF 2HQDA 2ATLA 3CJ5A 3FEZA 3KJQB 1HQUB 3JAMY 3LAMA 3RJMB 2C2RA 2OFGX 4DV5F 5DDPC 4M5GA 3EDRB 3VVUA 4DV6F 4LFCF 1VQ6S 3CJSA 1Q8BA 3OL7A 2HQ3A 3ZZRA 2MPUA 1HR0J 4M5IA 2HMIA 4QIWD 3JYTA 3A8JA 4DX7A 3OUYB 3D67A 3BH6B 5FIIA 2XNRA 2P9GA 5HK4A 1YI2S 2QEXS 1FD2A 2ZH3A 4C97A 3NBPB 2FLPA 4J9KA 3CDAA 2EG2A 4TU8A 4A8MP 1HBNB 2YWKA 5H9FJ 1F9FA 2C3UA 1WF1A 2G2OA 2XQCA 2UXDF 1KDNA 1IWAA 3GV8B 1Y0HA 4RNOA 3H98A 1FERA 5CCMA 4WZQA 3PR4A 1UPMB 3CC7S 2CFXA 3KDOA 3DU6A 3CCJS 3BGLA 3Q0AA 2CRLA 1VCTA 2VDHA 3MTJA 3HHEA 1W7WA 3MPWA 3E01A 3MECB 3N6MA 4ID5B 3T5KA 5K8OA 5KFRA 1N56A 1S6PB 1NSPA 4ECZA 3KLEB 3Q24A 3W2WA 3W65A 5BR8F 4PG6A 2MKYA 1R6VA 4QR1A 3GFYA 4WBFA 1S1UB 5I42A 2G0IA 2HHVA 2DKOB 2CUYA 5E3AA 1PCAA 3NWRA 4M5KA 2J7UA 1UFKA 5AE3A 2POKA 3G86A 1U4BA 1SJRA 4C8YA 4Y2AA 5MAOA 2RQCA 1QUPA 2H4WB 3TZWA 5B0BA 4YEAA 1M1HA 2KFZA 1J2VA 4NYPA 1E6YB 2HFSA 2M2BA 2VIHA 4URSA 2Q1LA 2J0QD 5GMKa 1NU4A 5KG6A 3DGPA 2DGVA 2B7BB 1FT8A 4FYWB 2GQCA 4DZ6A 3SMZA 4FF1A 4CT9A 1YJ7A 4USTA 3HI9A 3FMBA 4KBIA 4TN2A 3CCVS 4QOTA 4OZJA 1ZM9A 2CPZA 2CJAA 4OZ3A 2L3MA 2NSCA 3PM9A 3M8SA 1QVFR 4K50A 1PO6A 2KFYA 1V3RA 2H9ZA 4UOHA 4RL1A 2VG6A 4WFZA 4X4NA 3CMES 3TR5A 2HHWA 1YJUA 4NOHA 4Y3CA 3MEEA 5F8IA 4NLPA 3LP2A 2MHNA 4LVOP 4NYOA 3HVTA 1QSSA 2VBZA 5LSOA 3QLHB 5KFIA 2Z2ZA 4MK8A 1KLMA 1CBKA 2FB0A 3LPYA 3R97A 2OELA 1D9FA 1HBUB 2C3OA 3KNGA 2VG5B 2YNFB 5L38A 1UJ6A 1F0XA 1SBRA 2F4FA 4PPZA 3KG4A 3BO3A 3SSQA 3PCOB 2AHOB 2K8GA 2Q79A 5JUMA 1UVKA 2MQNA 3OTCA 2CZ9A 2QLFB 3QAEA 3HT0A 1FNXH 2HIQA 3PW5A 3GLJA 4ZVFA 5RUBA 3A13A 3T41A 5DQIA 5I3UA 5F8GA 4JI5J 2W7OA 3M9NB 4HT7A 1NSAA 3BSCA 4ZVTB 2LVWA 5MLCV 3H59A 4J9PA 3SQGB 3I4PA 3POTA 3FBCA 4DSKA 1YRTA 5D78A 5K14A 2Z2YB 1FJGF 3DRPA 3HDSA 3DI6B 4NMLA 2GVDB 3B4MA 3Q2SC 3S1TA 1FFWB 4I6AA 5EX0A 2VG7A 5ETLA 1V5IB 4OMFG 2ZH4A 3HFVA 1WF2A 2P6SA 1P8GA 2ACMA 2CG8A 2X3DA 1U1LA 4O0NA 1DRZA 4LFBF 2ZITA 2D1CA 4KGMA 4FVCA 4DR2J 2KRBA 1FX2A 1YZ7A 1R8AA 2MKCA 1KQKA 1WTBA 4DR1F 2ZUAA 3UNGC 3IMQJ 3OXFA 1FDBA 3MM8B 1FESA 1ZA1B 2JEFA 4ZJLA 2YNHB 3I4HX 2OKQA 3BF4A 3CCTA 4N7TA 2AJFE 1O8BA 2FJXA 3EWGA 1KR4A 1S1XA 1TR0A 2CQDA 1RAIB 4OZ5A 4G65A 4ZVSB 1VQSA 3IBCB 4FPIA 2Z2LA 1QE1A 1R0AB 2FLLA 1XMBA 3G82B 5EDWA 3RRKA 2B51A 3RAMA 4EBDA 1SJ3P 2HVEA 3DLGA 2BANA 3PY8A 1FNOA 4CLUA 2AJQA 3I32A 4I56A 4K5RA 3V4MA 4AQYF 2Z57B 5KG7A 5GMEA 1TL7A 3KUHA 2BQRA 2HHPA 2DXDA 4IG0A 4EBCA 1RTJB 2M52A 3OVAA 3L95X 2AX1A 1IVZA 2PFFB 2GC8A 1YK9A 2HHSA 1JLGA 4PYAA 1S49A 2PDAA 3H90A 3NG8A 1UZHA 3F44A 2EFPA 1YJTA 2YWEA 2MQPA 1QY7A 3BM7A 3DOLA 1NKBA 5J1EA 3NL0A 2APOA 2KM8C 2ZH6A 2F65A 2WVDA 2I9SA 4NL5A 3GSIA 4ANCA 1FRKA 1FRIA 4JI4J 1N8RT 1RZMA 3MEDA 3QFHA 1UWBB 2OSQA 3GFHA 2FPHX 3T5HA 3PIOQ 1HNIB 1U6ZA 2BM0A 1VBZA 1GX6A 2MZSA 3FSXA 4KB7A 4BCAA 1T03B 2GGPB 3LWMA 5HJYA 1QD1A 2VUGA 1XMOJ 4CTAA 1U1NA 4B3MF 2W2MP 1LW0A 2BRLA 4NWBA 3QGHA 1UEKA 2AEMA 1KOOA 3ISNC 1S1VA 4LF4J 4O3SA 2IAJB 4ZVGA 3BGFA 3K2YA 1NJIT 4F4YA 2LU2A 1Q0NA 1IKYB 2IM1A 4MYUA 3A3NB 2E5IA 1B0VA 5B0DA 1HWLA 1UTAA 1VYAA 4FKYA 4RKUC 1U8SA 4XAKA 3UI3A 3I9ZA 4P2FA 3UR0A 1JXEA 4Y2IA 3HFZB 3M6XA 2V2ZA 4C4WA 6AT1B 3DLHA 4NXNF 2JRSA 3AB4B 3EE3A 2RJZA 4ZOSA 3KLGB 3PHEA 4X65F 3HM9A 2D9PA 3V4IB 4UY85 2RIJA 4DJBA 5KFFA 4TY9A 1AB8A 5DJBA 3L4BC 3KK2A 1X60A 3OQ2A 4M5NA 4OYZA 3RW7A 4NZ6A 4F0HA 1S59A 1RCOB 2QE5A 1UMJA 4QU7A 1ZYQA 1S0NA 2DNZA 4P75A 5DG7A 3TVYA 3TEHB 4FS1A 3VVTA 1WWHA 4NZ0A 1FXDA 3PYDA 3P49B 4KV8B 1TKXA 2BKNA 4O3QA 4LSZB 3NKYA 2XSFA 4O4GB 2AU0A 3VQTA 4ZN3A 3GMGA 4P2MA 2JEJA 1NH8A 3MPVA 2BVZA 4F4KA 4YP3A 3OXLA 1C4CA 1XIQA 2FHJA 3KWMA 1JLQB 3MR6A 5GAGU 4DPYA 3ZZZA 4QWDA 1PILA 4HHUA 3TI0A 2W9AA 1REVA 1DLOA 3JTPA 3L9ZA 3UDLA 3OV7A 1VRTB 3DLBA 4LR7A 2BJ3A 1X4EA 3NGUA 3W3SA 1VQOS 3DRRA 1HQEA 3D1OA 1RKJA 4QJVA 1H74A 1EKRA 5LL6d 2YPZA 1VJQA 5DDOC 1XR6A 1U26A 3R1LA 2CDQA 1WD6A 3W64A 4IH5A 4IO1A 4K4UA 2A2DA 2HVDA 3GIJA 1X4AA 2UVUA 1WOSA 2OD6A 3PW4A 3A8IA 1FCAA 4LBPA 4ID8A 3DYAB 3ZTRA 2PEBA 3UN2A 2JLEA 3Q2TC 3CCZA 3MAAB 4I67A 2GCFA 3CJ3A 2ZDOA 3CCUS 2AJ1A 1RKIA 4NPOA 5THWA 2YQ0A 3R5JB 4AL5A 2QLXA 5HATA 3TO8A 2ASJA 3MR5A 2C2NA 5EN1A 3K5LA 2VPZB 2RDDA 2WBMA 5I3QA 4M5MA 3AD8C 1RT6B 1DTTA 5JVGQ 3IC1A 1RP5A 3HP6A 1R8BA 1RT3B 3T19A 4EMDA 2XO7A 2O5DA 2J0SD 3KG0A 4WTYA 4ZCLA 8RUCA 2KVQE 2HAIA 1XTZA 4OI3A 3EPGA 3EDQB 4F67A 1TVRA 1ZBTA 3GR1A 2LEBA 1TK5A 4NCGB 1S6UA 3HCXA 1S9GB 1X4FA 2Y1JA 2KL8A 3D1QA 2BKOA 1TKTA 2ZBIA 4EZ9A 2FHMA 2K1RA 4UUWA 2HNDA 2VOPA 2RF2B 3PX0A 2GHWA 5IZHA 1Q7YT 2QIFA 4Q2LA 4H4OA 2GQQA 1T02A 4X84A 2E1RA 3MPYA 3V6JA 1VBXA 4PXDA 2DHHA 2ZHBA 4DCPB 2LECA 1ZS6A 5E2QA 4WU3A 2BXJA 2R7RA 2EI5A 5JXSA 3EXCX 2DBBA 4IFVA 2OPRB 4X66J 1NZAA 2C2KB 4CQ1A 4OJ1A 4A8QA 4DFMA 4C9DA 4IDKA 4H4MA 2HGNA 2AGPA 1K1QA 4F26A 4FYDA 1L3KA 1RSCA 2R7XA 2KFNA 1UPPA 1OY8A 3LA0A 2PA8D 3MM6A 1LK5A 4WP3A 4G3IA 4HDHA 1T9XA 3GJTB 3H2UB 1F1BB 3G6XA 4A48A 2AWZA 1WC6A 3DOKB 2Z58B 2ZJPQ 4U7UD 3NRBA 5BJRA 2VFTA 5HQ8A 1W25A 5KFTA 2ZOGA 4DV3J 3OTOF 3KTQA 1J5EF 3H5YA 2E9ZA 1HMVB 3Q8PB 3CT9A 1KOHA 4YY3F 4TY8A 4CCHA 4FYXB 4N56A 1NLKL 1AZSB 1FJCA 2JVOA 1LW2B 5A8RA 1Q53A 1BHNA 3NMRA 3MUMP 4JI1F 2V8HA 3TAPA 4P7TA 2LQ5A 2B4UA 4A8FA 1FE4A 3ENWA 3M32B 4M8LA 4TYBA 5D8HB 3HSGA 1X4CA 4DI6A 2B43A 2KB2A 2EFVA 3NGKA 2OPQA 4HACB 3C6TB 3C19A 1NPPA 5H9EJ 1LWEA 5LT5A 3M30B 4OV1A 5KFNA 5KT4A 1FEEA 3KJNB 3D6FB 2DH7A 5AJ3J 3KLIA 4WIQA 3BPSP 1UVMA 2Y1LB 4ZPBA 2LMIA 4J9SA 2HFOA 5HBMB 3S8SA 4DL2A 3VHQA 2E5HA 3NEKA 3W5ZA 4CYUB 2MTLA 2WW8A 2G1DA 1W2IA 3D2WA 1RWPB 2OMLA 1HA1A 1RT4A 2YKMA 2AEFA 4FKXA 3H20A 3DN9A 4I7FB 1K8AT 2FVCA 1CS4B 1NAQA 4DQIA 3ZC4A 3OXGA 2FY1A 1YIJS 2F4VJ 5FLXU 2DHGA 2A2CA 1IBKF 2W2QP 3VAMA 5CYQA 3MR2A 3CB4A 2AMCB 5CXTA 3UD5A 1GFWB 1DQ9A 3THPA 4X2BA 1L3VA 3QIPB 3QAUA 4YMEA 2E5JA 4OI2A 2NPIA 4A46A 3B54A 5KT3A 2BJEA 4B3RJ 2XHCA 1CSJA 1KQSR 3UVJB 2O01C 2XMUA 2E29A 4DQSA 2Z30B 1EX8A 3KMSA 2KH9A 3B8HA 1G3OA 4MFBB 2GJIA 1S7HA 2FD2A 3AD9C 3R2CJ 1Q16B 1JWWA 3CIMA 1U25A 2K7KA 1IBCB 1SH0A 2N4DA 1S0VA 4Z37A 2XNQA 2FC8A 4ERDA 3P6YC 3DDIA 1DTQB 1CJKA 1O5JA 1FD8A 2FC9A 4WCEQ 2ROEA 1QTMA 2XEXA 1XNRJ 2DNKA 4NA2A 4RBUA 3TUPA 3RRHA 3OR1B 4JI7J 2UU9F 1RYSA 2WAQD 1C0UB 1SL0A 3A8EA 3GYGA 1RBLA 3MF5A 2J8AA 2GIQA 3HSZA 3QT7A 5CZVA 5AT1B 2FQQB 4QW8A 3CGIA 4NLDA 2OPSA 1P6TA 1QVGR 3AAWB 1FX4A 4B08A 1C1CB 1QJHA 4KRWA 2W8LA 1RTHB 3D0GE 4RUCA 1AFJA 3PW0A 1FDNA 2QL5B 4IOAQ 1LXJA 4DF8A 4RPFA 1B64A 2BOAA 4ZLNA 1U8WA 3MOZA 4EYIB 2JOQA 1RT5B 1FRMA 3DLLQ 1IKVB 1RTIA 3IG1A 3RGIA 1NBEB 4K5SA 1S1WA 4ETXA 2QYCA 4ETZA 1VC6A 5GAGI 1CJTB 1TL5A 3T6JA 1V6HA 3DLEB 3J81U 4WK3A 1X0PA 1AUSL 1XERA 3RBEA 5IXUA 4F04B 1RU1A 2GX8A 2ZBQA 4X4QA 3LANA 2N3LA 3AXMA 3WQPA 4DBQA 4RW6B 4EO6A 2GJ2A 3A4TA 2L9WA 4ZHRA 3MM5B 2FJAB 3PRDA 3EGVA 5KFBA 3C6UA 4IRCA 4DR6F 1SIWB 4ES1A 1KN6A 2IBKA 1R8PA 5GVQA 5IC6B 2ZZTA 2VHGA 3G8QA 1FFSB 2MQQA 2DXFA 1G7CB 7FDRA 4HDGA 1NHKL 3RBDA 4DFJA 2DO4A 2ZH7A 2D3O1 1NRKA 5HP1B 1BQMA 4P52A 1X8DA 4LMZA 3G2XA 4DUYJ 3UQSA 2CPHA 4I68A 2HQGA 4P7VA 2CJKA 2HS3A 2BRKA 1N5YB 2MQMA 2Q66A 1IUJA 2KN4A 3HZEA 4B9TA 3T1HJ 2GV1A 1RLCL 3S01A 3GIRA 1Q1KA 3FBBA 2BV3A 3GJRB 2B4OA 4CLLA 1KS2A 3M8PB 4BS2A 4KKOA 3Q83A 3FRZA 2YKOA 4TVAB 1TMMA 4DUZJ 2VICA 1CQMA 1IN0A 3ULHA 2B5JB 3RRGA 3K8WA 4PWUA 2E44A 3EZUA 3M8ZA 2HQIA 3I5BA 2JLFA 3R2DJ 1AA1B 1U1MA 1X4HA 4YN3B 2JEIA 2MDAA 3HXMA 2LYVA 3PFEA 2BJ9A 1DY3A 1OS5A 4LFAF 2H51B 5K8NA 2K06A 2J6UA 2MJNA 5IV4A 1ULRA 1YG0A 2DNYA 1VQ5S 4KH0B 1DQAA 4NLGA 4U7UK 2IM2A 4QR2A 5B0GA 3P45B 3MURP 3OL9A 1TKZA 2QA4G 4PG5A 2XZTB 3G8TA 2MZ1A 3NAHA 3AA8A 4TU7A 4DR3F 2OI2A 4XO0A 3PRVA 2OP5A 1PAUB 2WK4A 2YWGA 4ECUA 3NS7B 1R6YA 2RMLA 1S4EA 1WG1A 3BQ1A 2COLA 1V9OA 1M5VC 1SC4B 1JKHA 2GVZA 2WB1D 3W8PA 1SQEA 2AV5A 2CYYA 3SDEA 2RKIA 4WFBQ 1EP4B 1HYSA 1GXLA 2V4QA 1SJQA 3LP0A 5IWAF 3OLAA 1IWGA 2VQEF 2H4YB 4NLQA 4WE1B 1M5KC 5G4DA 4ZS6A 2HS4A 1HL6A 1RAEB 4K0KF 4KGKA 2PGCA 2RHSB 3OTBA 4FDFA 3DC2A 4DR7F 4C0HA 2KXHA 3C14A 3C2PA 2B9XA 3AJDA 4OZ2A 3Q8UA 4NLTA 3OPKA 2VFSA 3TAMB 3CW2C 2H5IB 1DFDA 2QV6A 3ITHB 1IR0A 1Y4ZB 2NYIA 3HK2A 2OIHA 2PO4A 3KK3B 2B9EA 1PIEA 3IN5A 4I2PA 1YJ9S 5CCLA 4RNMA 1U02A 2CJQA 1RJJA 3LUYA 1KVJA 2FUG9 1NK8A 5A6WA 1QM9A 1HQUA 3QPIA 3EICA 4LUBA 4LF8F 4DSJA 2V8VA 3K59A 3B6BA 3V2UC 5LMNJ 2BW7A 1U2FA 3GYNA 2Y0SD 2EFGA 4MAKA 5ADZA 5IS2A 3OUYA 2NUHA 3V6DB 1OIAA 3VGVA 4CP5A 1K1SA 3NBPA 5L9NA 4KHRA 4IOBA 2MGZB 1HBNA 1X5TA 3J7ZT 4TU9A 2HHUA 5BYSA 4GKKF 3S7RA 3GQCA 4K59A 3FFIB 2FYXA 1LKZA 2OEJA 5E33A 4JYAJ 1KD1T 3MGJA 3X1LB 4FXDA 2FHOB 1ZAXA 1Z2ZA 3J7YU 2NUUG 3J81Y 1YJRA 2JHEA 4I6YA 2OHDA 2HNZB 2OLWA 3CULA 5IQQA 3LWLA 3G4SS 4IRKA 2C2DA 4DWIA 1L3UA 3MECA 4ID5A 1S6PA 1IXKA 3KLEA 2DGQA 1AXQA 4Z7YA 5F3ZA 3M05A 1J5OB 1U0SA 1S48A 4C8MA 3WZ0A 3ETOA 4OHWA 4G1IA 5LXYA 5GADU 4N77A 1S1UA 4R8UB 2KM8B 1MW7A 3PFOA 3BN4A 4XDDA 3PO4A 2R3VA 3O8WA 3BO2A 4PR6A 4DL6A 3VGUA 5L39A 4CH7A 4IG3B 1RHMB 1FRJA 4TXSA 2CPXA 1KTVA 3ETMA 3JQKA 1E6YA 2DIUA 2VODA 4KPCA 2XCAA 4ILRA 4RW9B 4FXVA 3EXYA 3LW5C 2RE1A 1NSKL 2MZRA 5K5MA 5KFKA 1RLDA 4ED2A 2DH9A 2ILYA 4ENOA 4KFBB 4NXMJ 1TAQA 3M2UB 2KTQA 1PAEX 2ROGA 5HQLA 1CJVB 3OW2R 3M8RA 3VV2B 3MMCB 3DCAA 1VGYA 1ZM4A 1XEZA 3NNHA 3MD3A 3WIUA 1VC0A 5ETKA 4LF5F 1KBRA 3D5MA 2O67A 1N4LA 3NLCA 5CABA 2B0GA 4WXWA 3GFXA 1OY6A 2KZMA 3QLHA 3TARA 1HPZB 4X62J 1OQ6A 2LCWA 3V6KA 4LBIA 4ECRA 4Q7AA 3CC4S 2LP4A 4J7CA 4OQJA 3U1MA 3CO0P 1TL1B 1RAOA 3ZO7A 1BMQB 1WSVA 4NLOA 1N5QA 2PMZD 3OFGA 1HBUA 2HZAA 2VG5A 4H54A 2YNFA 4X4OA 4MIWA 4FNHA 4TKTA 4NE9C 4F3MA 2QO3A 3G6ES 1S0OA 1VS3A 4KYZA 2K2PA 2CNNB 1NKCA 1SCJB 1LWFB 4JI8F 4URQU 3VAFA 1WC5A 4K8RA 4WFNQ 4M95A 3QRPA 3RTVA 5D6GA 1WKKA 3I56S 4WFXA 1RYRA 5HLFB 2J9DE 1UA1A 3W5XA 3CJRA 2UZAA 2DTJA 1OSCA 4PWWA 4QW9A 3OTDA 2V0NA 3SQGA 1TMJA 4CO4A 3BPDA 3O3LA 4L3KA 2R8HA 1HBMB 2W2PP 3DI6A 2GVDA 4QWCA 1U45A 3SCLE 2V2QA 2R2RA 1NJWA 3I5AA 1GH8A 4MKAA 4DV4J 4RNFA 2CJYB 2FGOA 2RHQB 4LT6A 1L3SA 3NGDA 4HLBA 2HBQB 3MR3A 4YFUA 2UV8G 2XS2A 1IBMJ 1AW0A 1T9TA 2X7IA 2KJWA 2O1PA 1V3SA 2QL7B 4DR2F 5HI7A 4RJVA 3MM8A 4DV5J 1Q8LA 4DV6J 1NK6A 4LFCJ 3SCIE 1HBOB 3IS9B 2YNHA 4QR0A 1VHFA 3FEYB 3ICLA 1S10A 3KFWX 4HL9A 1PYOB 4HHHA 3Q8YA 4WFYA 2M8DB 5I3PA 1HHQA 1M90T 4B3TF 1KP6A 7FD1A 2MKHA 2IVMA 3EGNA 4P73A 4CO0A 4M5LA 1R0AA 9RUBA 1T8EA 1CC8A 1PC4A 3G82A 3DLKB 4DQPA 3THVA 2LQJA 4ZN1A 2F63A 1WKLA 1PJ7A 4ED7A 1JLBB 2CIMA 1JLFB 4ED5A 1DQ8A 4C2MA 2YQ3A 4DEZA 3UN5A 2E9TA 2LXIA 3IR5B 3IWNC 2ZH2A 3HPOA 3Q22A 1S5ZA 1EB0A 4W90B 3BSNA 3MOJB 4NA1A 4OYOA 1RTJA 4CH0S 5BR8J 4TYAA 2DITA 2ZVSA 2KHCA 4A8SA 5F8LA 1WJ9A 5KFAA 1F2GA 3EGWB 2HBRB 2IIHA 4IQXA 4DG1B 3M8WA 3NGTA 2WONB 5F8NA 2EC2A 2HQFA 3A1YG 1Y5NB 2QC3A 3I87A 1YDLA 4JV0A 1HIYA 3CPWR 1MU2B 1TZ0A 2QMXA 2ABYA 2VASA 3SBMA 4CLFA 2QG9B 4OHYA 1WDTA 3MCMA 3MEGB 2EKYA 4GC7A 1KQGB 3FGVA 4R0JA 3VZHA 2WSFC 1UWBA 4JI4F 3NOCA 4MK7A 1RHUB 3MTKA 1HNIA 3OSPA 4JUZA 2CA9A 4F3OA 1UWAA 3MHYA 3PX6A 2XC9A 1Z1ZA 1T03A 1U6BA 2GGPA 1IJEB 2FJWA 5ETVA 4O3OA 4CRJA 2JFDA 2L08A 4LSLB 4KSEB 2FZKB 1B3TA 2M0GB 1SJFA 2MLXA 4ZDNA 5ETNA 4IOCQ 1UW9A 3X3UA 4DX5A 4NLSA 1JJ4A 1RDRA 2F9DA 2R7QA 2ASYA 1WSRA 4FYYB 4C3KA 3RB4A 4KH1B 2IAJA 3OVSA 3QWUA 1IKYA 4B02A 2DHXA 5ETSA 1T7PA 1FDDA 2MZTA 1X31C 3QJLA 4URGA 5HL7Q 2I0XA 5D77A 5L1LA 4DQRA 1M5OC 4J9UE 4ZCMA 2E7VA 1OYEA 4PPDA 3JQJA 2CQ3A 4LVNP 5EWFA 3K5NA 1RAFB 3M6WA 3FZBA 5T14A 3Q8VA 1RAAB 4USVA 3GR0A 3HF5A 3H2LA 3U02A 4Q0BB 4RU9A 1RA7A 4I0WA 4ITSA 3EJMA 3KLGA 2V34A 4W98A 3V4IA 3HSJA 5FDLB 1KQFB 4C7QA 3TW0A 1NDCA 3EMTA 2F3JA 2OEKA 4MJKA 1RWUA 4USMA 2W9BB 4EBEA 2FTRA 3HHLC 2HSEB 3PDNA 1T9WA 5A0YB 4X64F 1VI7A 5L1KA 2CQ2A 2F8MA 3SZ2A 5J2MB 1UKUA 1FK9B 3MMBB 4ZPCA 5GADI 2O66A 2XWYA 4XIUA 2QJ3A 1FJGJ 4ATNA 3VAJA 5GAEU 4KV8A 1IM4A 3ZNUA 4BC9A 1YGYA 2UUAJ 4C11B 4O4GA 4MMOA 4F4AA 2XMMA 2HYIB 1YHQS 1VRUA 2VD3A 3E3XA 4MK9A 3SIPB 5L1JA 1JX4A 1B0TA 1N52B 4L3NA 4DS4A 3CCLS 1GK8A 2HRTA 2DNHA 5DS7A 3Q23A 1D1UA 4V1Ak 1JLQA 4AUKA 4F4XA 1RAJA 2CVEA 4B3SF 5AXMA 3J7A1 2G0JA 1TTHB 2NYHA 3EZ5A 2C42A 2BOPA 3GE9A 5J2QB 1BWVA 1SUQB 1VRTA 2K3KA 3AJ1A 4LRFA 4WP9A 2ALYB 4C3LA 1KC8T 2I8EA 1BE4A 2IYIA 1DBDA 4XDCA 1KKHA 3LOUA 4DX6A 2RT3A 5JMNA 1N54B 2C1EB 1RHKB 3CDUA 1JB0C 3IO1A 2UXCF 2PT0A 5DZ6A 4KPYA 1TL4A 3JXOA 4OI1A 1QE1B 2V6AA 4G1PA 3MMAB 2GMLA 3O44A 4K4XA 2L9NA 4OI0A 2IRXA 2HLTA 1RT2B 1ZZFA 2IJFA 2PMHA 4N5SA 4DPTA 1P9QC 1IQZA 3DYAA 1TV6B 4CT8A 3MAAA 1TKDA 3OSNA 2KT2A 3D1HA 1NEEA 2H5EA 3MD1A 2KG0A 3IRWP 4AQYJ 2JVRA 2MKKA 1GMWA 4L75A 3MM7B 4HH1A 3UPFA 5F3TA 3FMWA 2JH3A 3PJXA 3TANA 2GZOA 3RU0A 2K3IA 4PKDB 2RNEA 2EPIA 2VOOA 1FI4A 2HBZB 3H5XA 2N82B 4ZLJA 1HW8A 4Q5VA 2LA4A 3CCWA 1RT6A 2UUTA 1S0MA 3B82A 1RT3A 3ET6B 1MMLA 1MLAA 4KAIA 4LF6F 2FHJD 1N33J 4NLVA 1JLAB 2H1YA 2GIRA 2VFVA 2QX0A 3CD0A 1WNEA 4HI2A 2IC3B 2AQ4A 3D0HE 3TJAA 4CNYA 1ZPWX 3B4DA 3UCUP 2J9EA 1Q7LB 2YX4A 4KC5A 1N0UA 4Q2MA 2VZ9A 4ZLLA 4E8UA 4YDDB 2VPXB 2VPYB 5DGBA 5BXIA 4CNZA 3KHHA 5M2RA 5KOWA 4YUDA 3GTYX 2RF2A 1UEUA 2AYMA 2LXUA 4LF7J 4B3MJ 3IWXA 1HNZF 1U1RA 4KT0C 4L6V3 5HMYA 2MEWA 3TZZA 1V3ZA 2EC0A 3EYZA 4YHHF 3Q8RB 2M9KA 1AROP 4RU2A 1KVKA 1K0TA 1SC6A 2Y3YA 1SIZA 1NUEA 1S1VB 4WPAA 3W66A 2OPRA 4DV1J 1NCLA 3GP9A 1TL3B 1FJEB 2HFZA 4PAAA 3H40A 1H0HB 4J90A 1KSPA 3MZIA 5F8MA 4QBUA 2CWXA 4ED1A 3NOGA 1GT8A 2B9YA 3KOAA 3BQ2A 2MSTA 3K0JA 3BGRB 3I0SB 1LWCB 2B8QA 5HO4A 4UY8T 3F56A 1FFGB 1X4BA 4P72A 1H7XA 2OO4A 2HZVA 3DOKA 4N41A 4M5HA 4HTJA 4ICLB 2ZUGA 2RU3A 2VC1A 1F2HA 4OHVA 5LSLA 1UAWA 4RBTA 1DURA 1HMVA 1WI6A 3V5RA 1WG4A 1HNVB 2A0FB 3DRXA 2VQFF 1AZSA 2BJ1A 2OD4A 4LRDA 2C22A 1LW2A 2BKPA 4DSEA 3MEKA 4WK1A 3AOAA 5E7OB 1CLFA 1EIYB 4J9OA 3M2RB 1YBTA 5E41A 3M32A 1FRLA 3O5TB 1EHWA 4WKRA 3M4XA 5H1SV 3C6TA 1J27A 1HNXF 2CJBA 3BGUA 3TYTA 1F6TA 2BR0A 4CLKA 3T1AA 1WDDA 3AB2B 1QUVA 4DL0C 3P4UB 3KUEA 3M30A 2QA1A 2M3DA 3UCZP 4PUOA 2PEHA 2XCPA 5EGYA 5AJ3F 3MPUB 3CCQS 1K9MT 2W4CA 5IOLA 3O6QA 1UJ4A 2MYFA 4U6PA 4TQSA 5KT7A 3RAQA 1BY9A 3K89A 4CYUA 1QSLA 1QDUB 2I1RA 5CH7B 5KFEA 3R7NB 2P6TA 2E7XA 4X4SA 4PCQA 3KHGA 4I7FA 3JSRA 1CS4A 2AT1B 3EM1A 4JI3J 2BEFA 2JC1A 3NY0A 1MSWD 2BBEA 3KLVA 2DXEA 2DB1A 3MM9B 2P5VA 3UFCX 4ZVEA 3H42A 2F4VF 1Z4UA 4O3NA 1DZ5A 2QT7A 3MMJA 1NDPA 4G1QB 5D3GB 4BWJA 1JJHA 2A1BA 4ZVQB 3HHKA 3DLJA 1KLNA 3QIPA 1CQNA 3VWSA 4ED3A 2AKWB 3BDPA 2ZNZA 1WHXA 4C8OA 4LIWA 3UVJA 3PKMA 2QRRA 1UVNA 4DHVA 5C25B 2BE9B 4NLXA 2JWNA 3HHDA 4U9RA 4MFBA 2D3OR 4DSLA 1WOPA 3DM2A 1S6QB 2A6OA 2YH0A 5I4MA 4NA3A 2FZGB 3EPIA 5A8KB 2V2KA 3MAHA 1JJCB 3JQMA 4PABA 1DTQA 5CZXA 3PO5A 1UFLA 3OT9A 4OJHA 3IRXB 1KWMA 4F4WA 4CZCA 2DNMA 4EWTA 1S9FA 2HGMA 4ZP9A 5DETA 4DV2J 2IRYA 3OR1A 3CD7A 4NRUA 2HRUA 1C0UA 1U49A 4JI7F 4A8WA 3R8YA 2I6WA 1NB7A 3BS9A 3H2VE 2VONA 2Y8YA 3C15B 1C1CA 5J1NA 1RTHA 1C0TB 5GAEI 5B7WA 1OSDA 4IRDA 2YPYA 1VIXA 1MNEA 2J9CA 5IFMA 2AIRB 2WRMA 1RT5A 1IKVA 1TAUA 3KDNA 1VDHA 2R8GA 1X7VA 2FVRA 2VJVA 4NI2B 3MCOA 5SZTA 1WF0A 1CJTA 5DRKA 3DLEA 5DM6Q 2KT3A 4K2JA 4ZCIA 2DNLA 3WX4A 3AD7C 4JV5F 1G6BA 4U8YA 1IJFB 4RW6A 2Y1IA 4NRTA 1VQNS 3MM5A 2YKAA 1EQMA 3KLFB 2X1GA 4DCOB 5DQHA 3ZFVA 2FJVA 5EWGA 1BC6A 4WIIA 5DM7Q 4KJIA 3T1YF 2B4VA 3W5YA 2HRYA 5T41A 1UL3A 2EVZA 4CWBA 3GG0A 4Q8FA 3J81j 2LQ8A 4HHJA 3BKUA 1JLEB 1NMEB 2DT9A 4JI0F 3OTOJ 1PGZA 1R27B 1J5EJ 4CLYA 3TEGA 1ELOA 5F0UA 1OY9A 2EBEA 5HANA 4EK2A 3ZTOA 5HVHA 5FD1A 3QWPA 4DUYF 4YY3J 1N5YA 3ZZYA 5T7LB 1N34F 1C4AA 2OEMA 3DOMB 1S7IA 3W9HA 4CO1A 4JI1J 3ZZUA 2ALZA 2YVSA 2ZH9A 1CG2A 2HEKA 3SEOA 2B9WA 3W62A 3QGPA 2DNNA 2C28A 3RUBL 1R0CB 5EX3A 2UXBJ 2XTJP 3BSOA 2QLJB 3M8PA 1JNZB 2M8HA 2MLYA 5EUHA 2RRAA 4RNNA 3HSDA 4X4PA 4RW4B 3AFGA 3I6PA 4OYWA 2J9DA 2XM3A 4ECSA 1KRPA 4IFYB 2ZNYA 1IBLF 4DUZF 2A18A 2B5JA 2ROPA 4DFPA 2NS1B 3EX7B 2HFVA 4V19J 1OPZA 1N32J 5F8JA 3EGZA 2X3GA 2W9CB 5SUHA 2DVIA 2AYEA 1A0OB 2LFVA 2A3JA 3W1YC 1KNZA 2V8DA 2L41A 2KHDA 1X5SA 1OJ4A 1XNQJ 1SC3B 4RUHA 4QQBA 2M70A 1UZDA 3LP1B 1P27B 2RS8A 5D4PA 1PBUA 1U1KA 1VJWA 2GMHA 3GJQB 1S12A 1ZAWA 3ADAC 1S77D 1WC1A 1U0HA 3RAXA 1GTEA 1YSJA 3KJVB 3HD1A 3CF5Q 1S4FA 3NXZA 5HJXA 5CHCB 3QATA 4LF9F 4WF9Q 3AJ2A 4LF1A 4XPCA 3BGOP 4AT1B 3K8VA 2HG4A 1JXVA 4CM2A 2VKZG 1RB0A 3QO9B 2W25A 4C8KA 2ZM6F 3CTRA 4P2SA 2DK2A 2BQUA 3I96A 4KTQA 5LJ5Y 2V8GA 2Z2MA 4WTOB 1VOMA 3VAIA 1D3WA 2RSQA 1EP4A 3DXBA 2LXFA 4ZPDA 1P1LA 4WE1A 1OPIA 2EK6A 1T9VA 2E1MC 1B70B 4MTPA 1OYDA 2DH8A 2DJWA 3D6HB 1U2RA 3Q8SB 4OV6A 1Y3KA 4HEA9 4WYWA 2ZH8A 1XWLA 4LR8A 1CJKB 2ZJRQ 4YB5A 1RWKB 3IGVA 3BO4A 3TAMA 1RE1B 3D0IE 4OLPA 2UU9J 2DPJA 3DU5A 3MI7X 4OX9F 1FDAA 2H48B 4CLWA 4QWAA 2IBOA 3PJ9A 4LF2A 3JAMU 3KK3A 3PG9A 5K8MA 5J2NA 3DGVA 4C0BA 1GMVA 2JFKA 2ZDPA 5HROB 2EK1A 2XI2A 1Q82T 3QBCA 3VAKA 1HWIA 1VQKS 2V9KA 4ELVA 4C6AA 1RXOB 2OAUA 3QGIA 1RTDB 2AZ1A 2G1HA 1NK7A 2N3OA 1T94A 2FDNA 4O23A 3BJYA 5ETRA 5LMNF 2A6MA 5JJBA 5KFYA 2R4FA 3V6DA 2EWHA 3CJ8A 4AD6A 2HPUA 4Y2KA 4MH8A 4UZCA 3GIKA 4F25A 2LU1A 5IC4B 4KO0B 1N6QB 2MGZA 3P5BP 4DV7J 4Y0FA 3HHLD 4L74A 3JSMB 2VB6A 4I2QB 4A47A 2ZD1B 1H38A 3R7SB 1EJ7L 3MUTP 4KE5A 4LQ9A 2FY8A 3FFIA 4PYDA 2BE2B 3A3OB 4I4BA 4A4JA 4I69A 2ZOFA 2HK3A 4JYAF 2J76E 2L9DA 1FKPB 4KGVB 2FJBB 3AH6A 5B09A 3J7Z5 2HNZA 2MQ8A 4PEOA 3P3DA 2VL1A 3AQPA 2EFOA 4M94A 4N8NA 3J7AN 1S79A 4CLSA 2R7UA 1HI8A 4DX8H 4J9MA 1J5OA 3DMJB 4K2XA 2QSFA 1Y00A 1CPZA 4EGLA 3MWBA 4R8UA 5AE1A 2UVWA 4C3MA 2CQBA 1R3NA 1RT7B 3AOCA 5D4LA 2AZ3A 2GO9A 2XSJA 2J5AA 2MHEA 2FLOA 1JMTA 2YKPA 4MIBA 4ZKAA 3BH7B 2BA9A 1Y7PA 3DRSB 6FD1A 3IM8A 4N8OA 3GWCA 4F0MA 4RW9A 1HNWF 1WEXA 3WC2A 4WFAQ 1RWMB 1N0VC 5JVHQ 2R8IA 4O44B 2PD1A 2MZQA 4FXWA 4DDFA 3PZPA 4DL5A 3TRGA 3MR7A 2UVRA 2D74B 2KO1A 3K5PA 1B7YB 2MZJA 2IHR1 4KFBA 1HWKA 4KHPJ 3M2UA 4KQZA 3KHLA 5E3CA 3JTOA 4XTTA 1T05B 3CCMS 4RW8B 3MMCA 4DSIA 5LMUF 1SB6A 1WORA 3LGNA 4GKJF 1GXTA 4UTGA 1HD1A 1FWKA 2VH7A 1LFPA 3PKYA 2IMWP 3KHRA 2VV5A 4LFAJ 2MJUA 2RD5C 4NASA 3C46A 1NK4A 3HLUA 2XO6A 3ELHA 1F9EB 1HPZA 3QYYA 3AOBA 1A7GE 4X62F 4DR4F 4Z7CA 2C3YA 4CO3A 4C8ZA 1DJ0A 2MQLA 2NXNA 4EEYA 1TL1A 3ONQA 3Q8QB 1S6OA 3F0NA 1TUVA 2GIFA 3RBZA 5A8WB 3R3TA 2CZ4A 1Y9OA 4DR3J 1ZZNA 4KHMA 3BR9A 3ENVA 1FNMA 5DQGA 4PWDB 2XB2D 4KR0B 1RADB 2GJFA 3GONA 3HHLB 1LWFA 5C42B 3A8KA 5G0RB 4LREA 1X0FA 3U27A 3D3BJ 2YNIB 3CJKB 2DGXA 3TUZC 5KFOA 4Y2MA 4ED8A 5HLFA 4YQWA 4IR1A 2XMJA 2VQEJ 1UW4A 3L09A 4RBVA 1SI9A 3W9JA 3M2VA 2ILZA 1CJUA 4K0KJ 2QN6B 3MFHA 3ENQA 4PXCA 4DR7J 1NM2A 4ZLPA 3LTOA 1FRHA 4OYMA 3BB5A 3BEGB 1HBMA 2IY5B 1AT1B 1N88A 3CDEA 2G4BA 1WHYA 3CCSS 4NCAA 2E7WA 3BBBA 2ATCB 3R1HA 2QMWA 1PBAA 3UW1A 1NK9A 1RT1B 1HKAA 2CPIA 1W2BR 3AT1B 2FVQA 5EHHA 3G6VA 3R5AA 2GA7A 4USHA 1MWYA 4E2FB 4DPWA 4YS2A 2YX1A 4CH1A 4GVBB 2DHSA 4LF8J 4MKYA 2X1AA 4PG7A 1HBOA 5KFQA 3IS9A 2I38A 2M88A 2UUCF 1Q95G 2IRUA 1Y5IB 2I5JB 1GEHA 3RYLA 4DPXA 2EW9A 4F2RA 3A3PB 2QLBB 4GMKA 4IR9A 3H5UA 1FRXA 3DDNA 1TELA 3RBXA 1NJXA 1VLYA 3R6LB 3SCKE 3W2VB 3DLKA 2ADCA 1H72C 2R2TA 4EFAC 4GKKJ 1FXLA 1QAIA 5HMWA 1OWXA 1F5CA 2HNYB 1JLBA 1JLFA 3VR1A 1OO0B 1FE0A 4JV1A 1OMSA 4N76A 3TA2A 4UOGA 2CQ1A 5F8HA 5HVFA 5KT5A 1NKEA 5EWEA 3J80U 1N5TA 4LRCA 3GYXB 1QAYA 3N79A 3T3FA 3EVMA 4AXJA 1KFDA 5D4NA 4WJBA 2IDLA 2WVCA 3BYPA 4DR5J 3T5JA 2IVFB 2HVZA 2W7PA 2WHOA 2KYXA 4ZITA 1E6VB 2QSWA 1TQLA 4DG1A 2WONA 4H4KC 5F41A 1CC7A 4NEYA 4ECWA 2YX7A 1MU2A 4QWBA 3CDBA 4QWEA 2DGWA 2NXUA 1WKJA 3HT3A 3MEGA 2VBXA 1HWJA 4BBYA 3NMAA 1RA6A 1U09A 2N4CA 3M1VB 2VF3A 3AQOA 2C2MB 2W4PA 3VAHA 2FLNA 1VQ9S 2AJ0A 2Z0GA 5KFZA 5KFPA 3ISZA 1NHVA 4Q43A 2CQ0A 4Y65A 1VHIA 4Q8EA 5KG0A 1S9EB 3DFEA 1TU0B 4QIFA 4UW2A 2IFXA 4LSLA 4RX6A 1FKOB 4JBCA 1URRA 2ZBRA 2YH1A 1NJYA 2XS5A 2B56A 4TLQA 4P9SA 5DG9A 3CJTA 1NSQA 3VTIA 2VU5A 2RVJA 4K4WA 2HHHF 3C3LA 4LF5J 1RACB 1YWXA 1IQTA 5D4OA 5K8PA 2JDJA 2ASLA 3D6TB 3BN7A 1QSYA 1H98A 2J7WA 3IXQA 3HFKA 3HZGA 3RB6A 1JJ2R 3TJ8A 4ZVRB 1JQGA 2ZWPA 2W4DA 1B0PA 2AX0A 1RWVB 1U1PA 5KG2A 2QA4S 4PQUB 1MN9A 4NZ7A 3SV3A 1ITPA 3FSIA 2W1BA 2D41A 4R5PB 4Q0BA 5KFCA 3N01A 1HHSA 3OL8A 1PJ6A 3WDOA 1NXIA 1N36F 4X4UA 5FDLA 4JI8J 5IM0B 2V5HG 3ILOA 2AP6A 3UDEA 1VMBA 4OJGA 2B8PA 4NLUA 3R5DA 2W9BA 1ZTTA 5BYQA 3C16B 5A0YA 4NYZA 2XWXA 2V4RA 4K4TA 1T9YA 2MSSA 1EQ0A 5J2MA 4V19X 3T9NA 1FK9A 2F8HA 3MMBA 3ZTQA 4EI2A 4FVMA 5E0OA 1RWWB 2AJ4A 5ETPA 3M6UA 4IYQA 1I94F 1Y11A 4C11A 3JTNA 3QT5A 2UUAF 2MXYA 1RWOB 2CADA 3NAIA 1S1TB 5KT2A 5K9FA 3CXCR 1RUSA 1RABB 5HQMA 1XMQF 4YOEA 2PFDA 1HW9A 3MUVP 1X4DA 3DKDA 1MMDA 5DG8A 2DNQA 1KONA 1U2CA 2OSRA 2F9JA 3LH2S 1MG7A 3UWTA 2R7SA 2GFFA 2HIYA 5J2QA 1JK9B 4Y00A 1SUQA 1UVJA 1F5BA 1S57A 4H4KA 3N28A 1HHTP 4R25A 2HS0A 1EAYC 2JX2A 5E3QA 4JI6F 2UUBF 2DIVA 3F73A 2QMUB 2ZE2B 4B3TJ 9ATCB 1X9WA 3ZZPA 2H5JB 6FDRA 3QGGA 4WZMA 2DCLA 1S76D 2XBPA 4DU8A 2RRNA 1NK0A 3K5OA 3OFFA 4X4TA 2G2ZA 3MMAA 4K7QA 3TUJC 2DCUB 3H7HB 2UP1A 2V9WA 2Q3PA 2ZZNA 1RT2A 4DLEA 4ZPAA 3D3CJ 2UUWA 3M9OB 2ZBCA 4D3GA 4MKVA 3OFEA 2WB4A 4QIVA 1TV6A 2PIIA 3PEJA 3KYLA 1NPKA 3GCWP 2E5LF 1VBKA 3VGSA 1T0TV 2PI4A 4NEZA 2BJ8A 5HN0A 3MM7A 1TP7A 4ED4A 3NGSA 4BDPA 3NP5A 2W7AA 1IKXB 4HR2A 1KEKA 3J80Y 3UN3A 3E8OA 3BDEA 3OR2B 4ZP8A 2C2EA 4DQQA 2M4MA 4KGZB 1SJ1A 2CG4A 1RQ0A 1T3NA 1PYSB 3P96A 2WOMB 4OX6A 2LQ9A 2DEIA 1CULA 2OGUA 2RH3A 1NB2A 2HHTA 5J2PB 3ET6A 2WBRA 1WOOA 2XMKA 2E1PA 2V67A 5FLXY 1JLAA 3T6BA 4ZK7M 1N33F 2LEPA 3FDSA 2IC3A 3WX8A 2R9LA 4HKQA 4AYBD 4B9LA 5KG5A 3R5GA 1AUDA 1NDKA 2ZC3A 3PV8A 2RQ4A 3H5SA 3OHBA 3WIVA 2B6AA 4LSNB 4YR2A 3QSYB 2N7CA 5E3RA 1H3DA 4ES2A 4KGXB 4CIOA 2PE8A 3IR6B 3NNCA 2GHVC 1C1BB 4OI4A 3GILA 4LF7F 4CDIA 4J91A 1ICEB 2V4JB 5A2QU 3W63A 2RAQA 3MDFA 4M5JA 5ETQA 1M1KT 3FCWA 2KT5A 2R42A 4X4VA 1TL3A 4OZLA 3GG1A 4A8OA 4DV1F 3TOQA 3Q86A 1GMWD 3FKBA 3TUIC 4ANEA 1EETB 2XG8A 4DV0F 1G1XA 3H0PA 3V81B 1LNQA 5KOXA 3O2IA 1YRXA 1PYTA 3DXSX 1Y3JA 4CI0B 3IAM9 3VZIA 2R2UA 2KYZA 3BGRA 2C2OB 3I0SA 3PTWA 3T9ZA 1LWCA 2Z56B 5M2PA 2CJXB 2NLWA 2IM3A 1X5OA 2W24A 2YKNB 1IKWB 3DNCA 4C8NA 2FJDB 1HR0F 1GQEA 4ICLA 1JLCB 1Y5LB 1D9DA 3I0RB 7AT1B 4OYPA 4RLEA 2KG1A 1ZH5A 2RQMA 1HNVA 3IBWA 3CEDA 1SV5B 2R7WA 1UVIA 3Q89A 5AXNA 3M2RA 4X64J 2F8EX 2AYBA 1SJ4P 3TA1A 5IT0A 1A9NB 4F36A 5B0CA 4TLRA 4F4ZA 4ZA1A 3FQKA 1ZTWA 3CJ2A 2ADBA 2G0CA 2QA2A 2AW0A 3GV5B 1TK0A 3QZ7A 4QYZK 5KFVA 2CAJA 1H2TZ 2DGSA 5HSPA 1U24A 2A10A 3NS5A 2F40A 1VRUB 3QJJA 2KJVA 3D54A 2GS8A 3KK1B 3PEHA 3HKWA 2DR8A 2SXLA 3SV4A 4ZJOA 4B9NA 4ZPWR 1BQNB 2IA6A 5D0EA 1WACA 4QPXA 2XMTA 3FEXB 3CUNA 1LV5A 2X1FA 4B3SJ 1QAXA 1WI8A 2G9OA 4JOUA 1LOUA 3OLBA 4P71A 2J6SA 3G8SA 4DN0A 4B3OB 4LQ3A 4JI3F 3QT6A 3UDCA 1FWLA 1ACMB 3FBFA 2D9OA 3W60A 1RK8A 5KG3A 3MM9A 1T9UA 2EXUA 1FTRA 1S72S 2I2YA 3CNQP 1SL2A 3LF0A 3ILLA 1AYEA 5CYMB 1YBAA 5K20B 3ZZTA 3SCJE 2UXCJ 2R8KA 2Q6CA 4RW7B 4G1QA 3LO3A 5D3GA 2VBWA 3VF0B 2XHWA 1LQ9A 2E1CA 2WVFA 3LAKA 4TQRA 3D6MB
chains in the Genus database with same CATH topology
1RHRB 1RWXB 2H5JB 2HBZB 2HBQB 4ZVPB 1IBCB 1RHJB 2H4WB 2H5IB 4JB8B 3R7BB 2P2CB 2H54B 3R5JB 3P45B 2QL7B 1RWNB 4DCOB 2XYGB 2C2OB 2CNLB 3GJRB 2QLBB 2CNNB 1RWWB 4ZVQB 1QTNB 2CJXB 2XZTB 3P4UB 2C1EB 4DCPB 2QL9B 2HBRB 1RHKB 2Y0BB 4ZVRB 2XYHB 1RWOB 3R6LB 1PAUB 1RWVB 2HBYB 2CDRB 1PYOB 2C2MB 1SC1B 2C2KB 3NS7B 2CNOB 1F9EB 2FQQB 3R6GB 3GJSB 1I51B 1NMEB 5IC6B 2QLFB 5IC4B 1GFWB 1SC4B 3D6HB 1SC3B 2XZDB 2C2ZB 1QDUB 3KJNB 3D6FB 3R7NB 3R7SB 3SIPB 2Y1LB 2CNKB 3KJQB 1ICEB 2QL5B 3RJMB 3GJQB 1RWKB 3EDQB 1I3OB 2H4YB 1RHUB 1RE1B 3EDRB 4ZVSB 3GJTB 1RWMB 5K20B 4ZVTB 1RHMB 3IBCB 4LSZB 3IBFB 3KJFB 2H48B 4DCJB 2DKOB 1RHQB 3QNWB 4ZVUB 2H51B 2H65B 2XYPB 1RWPB 2CJYB 3D6MB 1BMQB 2QLJB 4ZVOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHR B;  1RWX B;  2H5J B;  2HBZ B;  2HBQ B;  4ZVP B;  1IBC B;  1RHJ B;  2H4W B;  2H5I B;  4JB8 B;  3R7B B;  2P2C B;  2H54 B;  3R5J B;  3P45 B;  2QL7 B;  1RWN B;  4DCO B;  2XYG B;  2C2O B;  2CNL B;  3GJR B;  2QLB B;  2CNN B;  1RWW B;  4ZVQ B;  1QTN B;  2CJX B;  2XZT B;  3P4U B;  2C1E B;  4DCP B;  2QL9 B;  2HBR B;  1RHK B;  2Y0B B;  4ZVR B;  2XYH B;  1RWO B;  3R6L B;  1PAU B;  1RWV B;  2HBY B;  2CDR B;  1PYO B;  2C2M B;  1SC1 B;  2C2K B;  3NS7 B;  2CNO B;  1F9E B;  2FQQ B;  3R6G B;  3GJS B;  1I51 B;  1NME B;  5IC6 B;  2QLF B;  5IC4 B;  1GFW B;  1SC4 B;  3D6H B;  1SC3 B;  2XZD B;  2C2Z B;  1QDU B;  3KJN B;  3D6F B;  3R7N B;  3R7S B;  3SIP B;  2Y1L B;  2CNK B;  3KJQ B;  1ICE B;  2QL5 B;  3RJM B;  3GJQ B;  1RWK B;  3EDQ B;  1I3O B;  2H4Y B;  1RHU B;  1RE1 B;  3EDR B;  4ZVS B;  3GJT B;  1RWM B;  5K20 B;  4ZVT B;  1RHM B;  3IBC B;  4LSZ B;  3IBF B;  3KJF B;  2H48 B;  4DCJ B;  2DKO B;  1RHQ B;  3QNW B;  4ZVU B;  2H51 B;  2H65 B;  2XYP B;  1RWP B;  2CJY B;  3D6M B;  1BMQ B;  2QLJ B;  4ZVO B; 
#chains in the Genus database with same CATH topology
 2IPO B;  1R43 A;  2ZEJ A;  3LAL A;  4DLG A;  2AYG A;  2CVI A;  3NNA A;  3OVB A;  2RDJ A;  3M8Q B;  1UEV A;  1T11 A;  3FBE A;  3KXD A;  3QQC D;  5C24 B;  4ED6 A;  4Y2C A;  1FXR A;  1VQY A;  5L8R C;  2E66 A;  5C25 A;  5KFM A;  1NH7 A;  3K7R A;  1CVJ A;  3I9V 9;  1S6Q A;  4C48 A;  5IV3 A;  4RO0 A;  2WVB A;  5A8K A;  5BYR A;  5D0R A;  3ZTP A;  4HYK A;  3CVK A;  1O51 A;  1BXN A;  2D3U A;  3R9L A;  1FO1 A;  3IRX A;  3K57 A;  3JSB A;  3GFZ A;  2RRB A;  3TVK A;  5DLF A;  4RWX A;  1NK5 A;  4K4S A;  4PZV A;  4M5D B;  2YNG B;  2HVI A;  3C8Y A;  1A6L A;  4LF6 J;  4JI2 J;  3HX9 A;  4DV2 F;  2FIU A;  2XY7 A;  3KJF B;  5LM7 E;  1RHQ B;  4FN5 A;  4EU0 A;  3FVY A;  4BHQ A;  1H7W A;  4B9S A;  4LBH A;  5LJ3 Y;  2NQP A;  4DOZ A;  5C2G A;  2MKS A;  1MRO B;  4EUV A;  1RTZ A;  2FZC B;  1FHT A;  3C15 A;  2B7C B;  3KUG A;  1C0T A;  2EG1 A;  3MAQ A;  2ZWO A;  2VA3 A;  1F60 B;  1YQH A;  2J7K A;  4JI5 F;  3MCS A;  4OZN A;  2K7J A;  2WCX A;  1Q8I A;  2LEA A;  3OD2 A;  1HNZ J;  3US5 A;  2HVH A;  1HD0 A;  3SQO P;  4NI2 A;  2EEY A;  2AEJ A;  4YHH J;  3HD2 A;  3DDK A;  1VRQ C;  2LLZ A;  3BKT A;  1ZET A;  4QZV B;  1H2U X;  2OPP B;  4ES3 A;  2WVE A;  1BWE A;  3N0V A;  3U1N A;  2GNK A;  3NCQ A;  5A2Q Y;  3PW2 A;  2DYA A;  3K17 A;  2NXC A;  3KLH B;  1JNR B;  3KLF A;  2LQB A;  3PYE A;  4S0M A;  2ZJQ Q;  3QFW A;  4PG4 A;  4OIX A;  2GAG C;  1HI1 A;  1R7I A;  5AE2 A;  3M6V A;  1SKW A;  2B4P A;  1UVL A;  1SQF A;  3UNY A;  3TP2 A;  1F5A A;  4DL3 A;  1G2E A;  4OJ3 A;  4K4Y A;  3L7P A;  4LIR A;  1GTH A;  2HMI B;  3JYT B;  1JLE A;  1ROF A;  1V5V A;  1VR6 A;  2YKQ A;  3D66 A;  5HMZ A;  2QGF B;  3G96 A;  3D68 A;  2R7V A;  2VQF J;  2M7S A;  5T7L A;  3DOM A;  4MYT A;  2R7O A;  3AY0 A;  3SFU A;  4P2X A;  2UXD J;  1Q79 A;  3IAS 9;  2BW2 A;  1SQG A;  3GJS B;  3RR8 A;  2RUG A;  2XZD B;  4WWS A;  4ZPT R;  2DR6 A;  5B0A A;  1HNX J;  1HWU A;  5ITH A;  1F3V A;  8AT1 B;  2UXB F;  2EFN A;  4HH0 A;  5H9F K;  3BKF A;  1BUX A;  2HGL A;  3E01 B;  4RW4 A;  4J9Q A;  3VQS A;  1DAR A;  4ZVU B;  4IFY A;  4PUO B;  3GSD A;  1QAJ A;  3W2W B;  3FK4 A;  3T5L A;  3CO9 A;  1NO8 A;  4O4R A;  3CE8 A;  3RB0 A;  2FGC A;  2XLK A;  5KFD A;  1LEO A;  2BAB A;  3R7B B;  4ZVH A;  5I42 B;  1RI7 A;  3OTE A;  2W9C A;  2KU7 A;  4J9R A;  1VLO A;  1N32 F;  2XGP A;  2KXF A;  3PNI A;  3CMA S;  2FHK A;  4LRA A;  2E5G A;  4F2S A;  4A8K A;  1XNQ F;  3LP1 A;  2XLJ A;  3GZ7 A;  1BGX T;  3FSY A;  3RZA A;  5AXK A;  1FJ7 A;  1REG X;  3KJV A;  2R2S A;  4B17 A;  4UZB A;  4ILL A;  3DGP B;  2HK2 A;  3GV7 B;  2D7S A;  1U6F A;  4YB1 P;  4CO5 A;  2JZ5 A;  1ZAV A;  1XMO F;  3UO0 A;  3H4D A;  4J9V A;  4ECX A;  2VC0 A;  3DRY A;  1U7L A;  3ZXW A;  1XQI A;  4YR0 A;  4IH7 A;  3QO9 A;  5E5N A;  1WEY A;  1KVI A;  2CXE A;  4USU A;  4I6W A;  3QID A;  1GMU A;  1RHR B;  1EAR A;  3TQ1 A;  4ZVP B;  1YJV A;  4HI1 A;  2IA0 A;  2VG6 B;  4UQT A;  4YDX A;  2IMO A;  1SH2 A;  1CEZ A;  4CLZ A;  4LF4 F;  3JS9 A;  3HVA A;  3MEE B;  2FVS A;  2ZVI A;  3LP2 B;  4MKB A;  3DM2 B;  3KMQ A;  2MLZ A;  3FUY A;  3HVT B;  3QRR A;  4ER8 A;  3PW7 A;  2OTL S;  2ASD A;  2DIS A;  3IGN A;  1KLM B;  4LRB A;  4DU7 A;  1LXN A;  5L1I A;  1R89 A;  5F0W A;  2PC6 A;  1RAG B;  2EBG A;  5LOQ A;  2PMW A;  4FNI A;  3NCR A;  3PYF A;  4M1K A;  2DHA A;  5B08 A;  3OJU A;  3L3C A;  1YRU A;  3RW6 A;  2RB7 A;  2KXN B;  1RAH B;  2Y1R I;  1UP1 A;  2HHX A;  5KFX A;  3N4W A;  4KY3 A;  3BYR A;  3J7Y I;  2MY7 A;  2ZC4 A;  4CM0 A;  2HWH A;  2RDI A;  3OHA A;  5HRO A;  2E9R X;  2RU9 A;  3KNA A;  3AXK A;  4RUB A;  2HAF A;  1P9Y A;  5I3U B;  4DS5 A;  1RTD A;  2DPI A;  2NR0 A;  4J9L A;  5CD4 H;  4FBU A;  2CQG A;  2P9E A;  2QFI A;  4RWW A;  4AL7 A;  1VQM S;  2UVV A;  3POT B;  1MWQ A;  1WC0 A;  1XR5 A;  2QLW A;  2NXE A;  3OBI A;  3ZTS A;  3GU0 A;  5K14 B;  3DRP B;  4KO0 A;  1N6Q A;  1QTN B;  1U48 A;  2QL9 B;  3TZX A;  4DMZ A;  2JL9 A;  3JSM A;  4I2Q A;  4DV7 F;  2J0X A;  1VK3 A;  2ZD1 A;  2L48 A;  4JV5 J;  2VG7 B;  2ERR A;  1T3O A;  4ECY A;  4C98 A;  2U1A A;  4USW A;  2BE2 A;  4U96 A;  3PYG A;  4ALZ A;  4LFB J;  3FC9 A;  4ZIW A;  1FKP A;  4N47 A;  3QSI A;  3SI8 A;  4UOC A;  4DR1 J;  2KVI A;  1F3F A;  1Y10 A;  3T1Y J;  4WP8 A;  4IQM A;  1WC4 A;  1I6J A;  1T95 A;  4L72 B;  1WC3 A;  3W7B A;  3DMJ A;  2ZHO A;  3RR7 A;  2Y9H A;  2VFR A;  3IWL A;  3QNW B;  1XN9 A;  4OI6 A;  4ZCK A;  1S1X B;  2CQC A;  4JI0 J;  2AGQ A;  2CZV C;  2GHP A;  1QLN A;  1VQ8 S;  3N6N A;  1RT7 A;  1N34 J;  1SKR A;  2V63 A;  3NS6 A;  3BQ0 A;  1EZZ B;  5DGA A;  3PR5 B;  2NXJ A;  1DAX A;  5LSR A;  4FPR A;  3CJ4 A;  2YWF A;  2ZFH A;  3DRS A;  4D3H A;  4HTI A;  1TUG B;  3DLG B;  2BMB A;  3G9C A;  4IUF A;  4F3Q A;  2BAN B;  2BYC A;  3SSS A;  1BLU A;  1LFW A;  1K73 T;  3TAQ A;  1U1Q A;  2HFN A;  1PC5 A;  4M63 A;  4P6Q A;  2XY5 A;  4X4R A;  4ECV A;  3N5B A;  1Q81 T;  4O44 A;  2BAC A;  1TL7 B;  5KFJ A;  5KFH A;  1MN7 A;  1IBL J;  1U47 A;  3VGT A;  1X4G A;  4IG0 B;  1WHV A;  3A12 A;  4GO7 X;  3GIM A;  3R27 A;  3FQL A;  2BZ2 A;  4NMX A;  1RBA A;  1JLG B;  3IBF B;  2DR9 A;  4KHP F;  4GVL A;  1T05 A;  4BWM A;  4QYR A;  4RW8 A;  3CSK A;  3K58 A;  2JJ4 D;  4E0D A;  3DOL B;  4O0I A;  1VBY A;  4U67 Q;  5J1E B;  2Z8Q A;  2CWK A;  3LPE A;  1RU2 A;  1YKW A;  1B7F A;  1PSD A;  2RIL A;  1VK8 A;  2ZZM A;  2DY9 A;  4ECT A;  2AD9 A;  3MED B;  1B99 A;  4NCG A;  5KG1 A;  1S9G A;  2W2O P;  5L46 A;  1U0H B;  5HMX A;  1H73 A;  4ZJQ A;  3G6Y A;  4Y6I A;  4OYB A;  4ZMM A;  2DGU A;  2WZ1 A;  5A8W A;  2CNO B;  4LF9 J;  3GCX P;  1X5P A;  4CTA B;  4B9U A;  2XMW A;  3KKF A;  2BJD A;  5CD4 A;  4PWD A;  2ZM6 J;  2C3P A;  3EUN A;  3HHL A;  2IYG A;  5C42 A;  1LW0 B;  3OFH A;  5G0R A;  3ILI A;  3BSA A;  4IO9 Q;  4GO5 X;  5M2U A;  2YNI A;  3CJK A;  1ZA2 B;  2V69 A;  4DL4 A;  1NPR A;  4E98 A;  5A76 A;  2JC0 A;  3QRQ A;  1Q8K A;  4YR3 A;  2WTF A;  2KKH A;  1K47 A;  4ECQ A;  4Q44 A;  4X66 F;  3QZ8 A;  3PAC A;  3TNV A;  1Z2L A;  1RBO B;  4WKY A;  2H54 B;  1HLW A;  1PG5 B;  1NDL A;  2XMV A;  1ZPV A;  2CNL B;  1SVD A;  3ISN D;  5KFG A;  4J9N A;  4F02 A;  4ED0 A;  4OX9 J;  4NXN J;  5HAO A;  2HLU A;  3HJV A;  5CYJ A;  4NLR A;  1RT1 A;  2VJU A;  4X65 J;  1VQ7 S;  3R6G B;  4B9V A;  2Z4P A;  1I51 B;  2G2Y A;  5J2N B;  4DV3 F;  3N5F A;  2M5Y A;  3G87 A;  2JEG A;  1VQ4 S;  4GVB A;  2CPF A;  1VIO A;  3KK2 B;  2VFU A;  1FA0 A;  1I3O B;  4I1T A;  5KT6 A;  4OYI A;  2Q43 A;  2YWW A;  2GMJ A;  2F7V A;  2DGT A;  4UF4 A;  4Z2X A;  3PX4 A;  4OFZ A;  1KFS A;  2I5J A;  2NZC A;  4HAC A;  3M9M B;  4P10 A;  1XC9 A;  3HHN B;  2XYP B;  4QU6 A;  1NZ8 A;  2HHQ A;  4FYV B;  3QMQ A;  5F9L A;  4UT4 A;  1YJN S;  3I31 A;  1RHJ B;  4ZP6 A;  1TKX B;  4JV2 A;  3CJ0 A;  3W2V A;  4OL8 A;  3SFG A;  1VQL S;  5D0H A;  1XJW B;  1TK8 A;  4U8V A;  5HBM A;  2W2N P;  1I5O B;  3HVW A;  2ZKT A;  2HNY A;  3JB9 k;  1Q78 A;  1APS A;  2BDP A;  3CC2 S;  1UA0 A;  4DN9 A;  4C0O C;  1REV B;  1DLO B;  3N9U C;  4QIG A;  2NCK L;  4QCL A;  4OX7 A;  3W8G A;  3KG1 A;  1XR7 A;  5IT9 U;  4TNO A;  1VC5 A;  4CLT A;  1VQP S;  2R8J A;  4DR5 F;  4FBT A;  3DRR B;  1E6V A;  1HQE B;  1XBW A;  4J5O A;  4XPE A;  1D09 B;  2WSC C;  3HUL A;  3L7U A;  3H25 A;  4DCJ B;  2HW3 A;  2BX6 A;  2C3M A;  3P8B B;  4LJM A;  2XSJ B;  4RUA A;  4EYH B;  4AND A;  4PG8 A;  2XMA A;  2XY6 A;  4LR9 A;  4JB8 B;  1O0P A;  1ZM3 A;  2F1F A;  3M1V A;  2LDY A;  3UD3 P;  4B3R F;  1R8H A;  1SH3 A;  4I64 A;  1HNW J;  1JIH A;  4YB7 A;  3GPA A;  4OYA A;  1WEL A;  4R0E A;  1GAO A;  2DNR A;  2XUL A;  2CJ9 A;  2H3E B;  1YBU A;  3IM9 A;  1S9E A;  5C7P A;  4FZV A;  4F8R A;  1SXL A;  3HJF A;  3U7J A;  2VKR A;  1Q5V A;  4EZ6 A;  3D4J A;  4USI A;  1FKO A;  1D8Z A;  3OJS A;  3O1L A;  3FZ2 A;  2NRE A;  2DY1 A;  1HAR A;  5A6P A;  2DRD A;  4FF2 A;  1D9A A;  4DUT A;  1MMN A;  2LA6 A;  1DTT B;  3PJW A;  1UJ5 A;  5LMU J;  1I1G A;  3EVO A;  1R8C A;  1EKS A;  4GKJ J;  1XNR F;  4B9M A;  1W26 A;  4AXI A;  4UQG A;  1DHM A;  4ELT A;  2DGO A;  5ETT A;  2CQP A;  3G71 S;  1TVR B;  4DR4 J;  3LGM A;  2MKI A;  3P5T L;  2J0W A;  5D15 A;  3IA0 A;  4MT1 A;  2RS2 A;  3ZZ0 A;  4PQU A;  1IR2 A;  3ZNJ 1;  4RR5 A;  2ZH1 A;  1TKT B;  4OYX A;  4R5P A;  2OJ3 A;  4RZR A;  2HWI A;  2K1R B;  1S99 A;  2HND B;  5DDR C;  2DEJ A;  3BBC A;  4H4O B;  4G6V B;  2NSB A;  1L5U A;  3I55 S;  3FJ2 A;  1YIT S;  5IM0 A;  3HMJ G;  1HFE L;  4ELU A;  3V6H A;  1M0S A;  1B4S A;  4O3R A;  4K4V A;  2V50 A;  3QJP A;  3NCP A;  2OUG A;  3C16 A;  2CNK B;  2DNG A;  4IFV B;  4BLG A;  1D8Y A;  4P74 A;  1X9S A;  1U1O A;  1N48 A;  1JXL A;  2P9C A;  3NGR A;  4IDK B;  4H4M B;  3M2V B;  2JNJ A;  1CJU B;  3H8Y A;  1X9M A;  3IR7 B;  4W4M A;  3PXG a;  5KFU A;  2X51 A;  1IR1 A;  4PRF A;  1F9H A;  4ZVO B;  5C5J A;  4AE5 A;  3E51 A;  3MM6 B;  3CCE S;  2V68 A;  2W01 A;  2XZW A;  2P2C B;  1XK8 A;  1NND A;  5DZ7 A;  5FJ4 A;  1S1T A;  5GAH U;  1BQX A;  2XYG B;  2YTC A;  4A8X A;  1YJW S;  3BRE A;  5HP1 A;  4F0K A;  2NZ4 A;  2IM0 A;  1FKA F;  3TVZ A;  1R31 A;  5DLG A;  3LGH A;  5CA5 A;  2OMO A;  2ZKU A;  1WEZ A;  4TY8 B;  2CDR B;  1ZOT A;  1KHV A;  4UOF A;  2ZOM A;  5A8R B;  3RG6 A;  3K5M A;  2RQK A;  2UUC J;  3BZQ A;  4USK A;  3T1H F;  1FF2 A;  2U2F A;  3OL6 A;  1MWZ A;  1NJZ A;  2IJR A;  1TFY A;  3C66 A;  2OPQ B;  2ZE2 A;  2GW8 A;  1IM6 A;  1KHW A;  1LWE B;  1K0V A;  1ZM2 A;  2AF6 A;  3QT8 A;  3KLI B;  2KRR A;  3FNN A;  3U1L A;  5H9E K;  3DHW C;  4J37 A;  4WU2 A;  3IP0 A;  2V94 A;  2Q6B A;  4C8L A;  1KTQ A;  1GNK A;  1RT4 B;  1VIS A;  2YKM B;  1TFW A;  4FF4 A;  3PRB A;  3BBF A;  2Y0B B;  2AGO A;  3DHX A;  1IKX A;  3CDW A;  2HFU A;  4DSF A;  1RCX B;  3MPD A;  3OR2 A;  1FWP A;  3ENA A;  5CAA A;  3PHT A;  3HO1 A;  3CD6 S;  5B0E A;  2WOM A;  1IBK J;  4PXB A;  2PA3 A;  1UFW A;  4FF3 A;  5J2P A;  2DR5 A;  3BV8 A;  1Q86 T;  2DNP A;  5CYQ B;  5IT9 Y;  1RGV A;  4U7C A;  3CMQ A;  3CWJ A;  3CD5 A;  4OZ0 A;  4DPO A;  4F50 A;  5KG4 A;  3R5B A;  4WYL A;  3ZZO A;  1HQ2 A;  3NWG A;  2PSZ A;  4MIA A;  2IJN A;  3TX0 A;  3MFI A;  1RIS A;  4EO8 A;  3MXH P;  1YTY A;  1M5S A;  2VDI A;  2LKZ A;  2W8K A;  4NCB A;  3RB3 A;  2V8P A;  2PN6 A;  2KI2 A;  1PJ5 A;  4WXO A;  4OX8 A;  3S6E A;  2IDE A;  2DD8 S;  2YBV A;  3IFE A;  4LSN A;  1GX5 A;  2RUS A;  3WC0 A;  4YB6 A;  1L3T A;  2CPD A;  3HVR A;  3VAG A;  3TA0 A;  1C1B A;  2D69 A;  2DR7 A;  2YQ1 A;  5E3P A;  5KFW A;  1WUU A;  2BJ7 A;  2V4J A;  1YLX A;  4Q45 A;  2OFH X;  3AOD A;  2HHH J;  2VBY A;  5AXL A;  3ITH A;  1GXU A;  3UDV A;  3EZO A;  5ETM A;  3CIZ A;  3W61 A;  2QYG A;  4NLY A;  2O3D A;  3SXL A;  4OHX A;  4A8Y A;  1R0B G;  1EET A;  2LDI A;  3N6L A;  1VFJ A;  2AJ2 A;  3V81 A;  3BR8 A;  2OPS B;  2YY3 A;  5B0F A;  1UCN A;  2WSE C;  2HUR A;  3M7V A;  3MCN A;  2FVP A;  4L76 A;  1AFI A;  5DO2 A;  2V2V A;  3I82 A;  4F7V A;  1FTC A;  2YKN A;  1OQ3 A;  1IKW A;  2MMY A;  1M1G A;  4OLO A;  1JLC A;  4OHZ A;  1N36 J;  1Q4R A;  1RWN B;  3VCD A;  3I0R A;  1RTI B;  3IG1 B;  5J1P A;  2VA2 A;  4HVZ A;  2EFQ A;  1S1W B;  2BQ3 A;  5L9X A;  3VAL A;  2P8I A;  2XYH B;  1SV5 A;  1Q5Y A;  4ILM A;  3TJ9 A;  2MB0 B;  1SKS A;  1YX2 A;  1SC1 B;  2XS7 A;  5CQG A;  4GRS A;  4RNH A;  3HKZ D;  4Y28 C;  2BE7 D;  3JSY A;  2KZZ A;  4QYZ J;  3GII A;  5IT4 A;  4QPT A;  4DPU A;  4ZHR B;  3EVW A;  5F9N A;  3L7O A;  1SPB P;  5KFS A;  1WG5 A;  4DR6 J;  3C6U B;  3CCR S;  4ZPV R;  2BUN A;  2ACY A;  3D7S B;  2F5G A;  4QIE A;  2NPF A;  2KDO A;  5U47 A;  4DXL A;  2CQ4 A;  2MKJ A;  1I94 J;  4W92 B;  3M8Y A;  2WW4 A;  5LXR A;  3TZY A;  4UUX A;  2Y8W A;  3KK1 A;  4AFF A;  5C2C A;  1XMQ J;  4DFK A;  4PXE A;  1BQN A;  1BQM B;  3SSR A;  4JP8 A;  4NLW A;  2YXL A;  2XLI A;  2ZBP A;  3FCV A;  1FVQ A;  3ILJ A;  5IQ6 A;  5ETO A;  5KAK A;  2EKN A;  3UD4 P;  2J8S A;  4IG3 A;  4IH6 A;  2FJE B;  2HZC A;  2XI3 A;  1TUW A;  4DZD A;  4DF4 A;  4B3O A;  2CPY A;  2E1A A;  2D3Z A;  1SKU B;  3TWZ A;  1LWX A;  4JI6 J;  2UUB J;  2HBY B;  2CPE A;  1FEH A;  2QZ8 A;  3UE2 A;  3UR3 C;  5CYM A;  2GAH C;  4RW7 A;  4USJ C;  4ZIV A;  2CQI A;  1H6K X;  4K4Z A;  4KKO B;  1O6X A;  2DRA A;  3WHI A;  1WTF A;  2PI5 A;  3GB0 A;  5D0G A;  2HKE A;  3PIP Q;  3M8Q A;  4NXM F;  2YWH A;  2CPJ A;  3W9I A;  1CJV A;  2E5L J;  2VPW B;  1M5P C;  4XK8 C;  5C24 A;  2DNO A;  1YZ6 A;  3F41 A;  1D0E A;  2CKW A;  2R7T A;  4AL6 A;  4NX9 A;  1URN A;  2GO8 A;  3CJQ A;  2GQ2 A;  1C2P A;  1P1T A;  4CLP A;  2JLG A;  2OTJ S;  3R5C A;  2MY8 A;  3UCG A;  3LQV A;  2MQO A;  1WHW A;  4FS2 A;  5KFL A;  1CUL B;  2BM1 A;  3D28 A;  5KTQ A;  4M5D A;  2YNG A;  1TKZ B;  2B3T B;  2JSX A;  2DRB A;  2OH2 A;  1LK7 A;  2G13 A;  1FVS A;  1S97 A;  5DDQ C;  4JI2 F;  2C2Z B;  3AHP A;  2HWT A;  1NHU A;  4O3P A;  4GC6 A;  3E2E A;  3TQE A;  3I5C A;  3D9B A;  4PQA A;  1MRO A;  4IKA A;  4DL7 A;  1N5V A;  2IVY A;  3WBZ A;  2ZH5 A;  1N5S A;  1JKH B;  3TX8 A;  2GVZ B;  2J6T A;  4KIA A;  1HI0 P;  3SDE B;  3SYZ A;  2RKI B;  1HYS B;  5IWA J;  2H65 B;  4FP9 A;  2B6A B;  1H2V Z;  3THT A;  3LP0 B;  2XGQ A;  4CO2 A;  3PVX A;  5HVG A;  1RWX B;  1G4C A;  2UV8 A;  4HT5 A;  1SL1 A;  2QFJ A;  8ATC B;  4ZP7 A;  5GAH I;  1M5H A;  1YVF A;  2CQH A;  1UET A;  3FRY A;  1PKU A;  3C14 B;  4U95 A;  3B78 A;  2DO0 A;  1K44 A;  3H4B A;  1BD6 A;  4BC7 A;  2OPP A;  4L73 A;  2HQC A;  2ZHA A;  2QTW A;  4DV4 F;  3KLH A;  3AA9 A;  2X1B A;  5GMD A;  4DV0 J;  4I2P B;  4OZ1 A;  4Y34 A;  3FCH A;  2N7Y A;  1IBM F;  2HQD A;  2ATL A;  3CJ5 A;  3FEZ A;  3KJQ B;  1HQU B;  3JAM Y;  3LAM A;  3RJM B;  2C2R A;  2OFG X;  4DV5 F;  5DDP C;  4M5G A;  3EDR B;  3VVU A;  4DV6 F;  4LFC F;  1VQ6 S;  3CJS A;  1Q8B A;  3OL7 A;  2HQ3 A;  3ZZR A;  2MPU A;  1HR0 J;  4M5I A;  2HMI A;  4QIW D;  3JYT A;  3A8J A;  4DX7 A;  3OUY B;  3D67 A;  3BH6 B;  5FII A;  2XNR A;  2P9G A;  5HK4 A;  1YI2 S;  2QEX S;  1FD2 A;  2ZH3 A;  4C97 A;  3NBP B;  2FLP A;  4J9K A;  3CDA A;  2EG2 A;  4TU8 A;  4A8M P;  1HBN B;  2YWK A;  5H9F J;  1F9F A;  2C3U A;  1WF1 A;  2G2O A;  2XQC A;  2UXD F;  1KDN A;  1IWA A;  3GV8 B;  1Y0H A;  4RNO A;  3H98 A;  1FER A;  5CCM A;  4WZQ A;  3PR4 A;  1UPM B;  3CC7 S;  2CFX A;  3KDO A;  3DU6 A;  3CCJ S;  3BGL A;  3Q0A A;  2CRL A;  1VCT A;  2VDH A;  3MTJ A;  3HHE A;  1W7W A;  3MPW A;  3E01 A;  3MEC B;  3N6M A;  4ID5 B;  3T5K A;  5K8O A;  5KFR A;  1N56 A;  1S6P B;  1NSP A;  4ECZ A;  3KLE B;  3Q24 A;  3W2W A;  3W65 A;  5BR8 F;  4PG6 A;  2MKY A;  1R6V A;  4QR1 A;  3GFY A;  4WBF A;  1S1U B;  5I42 A;  2G0I A;  2HHV A;  2DKO B;  2CUY A;  5E3A A;  1PCA A;  3NWR A;  4M5K A;  2J7U A;  1UFK A;  5AE3 A;  2POK A;  3G86 A;  1U4B A;  1SJR A;  4C8Y A;  4Y2A A;  5MAO A;  2RQC A;  1QUP A;  2H4W B;  3TZW A;  5B0B A;  4YEA A;  1M1H A;  2KFZ A;  1J2V A;  4NYP A;  1E6Y B;  2HFS A;  2M2B A;  2VIH A;  4URS A;  2Q1L A;  2J0Q D;  5GMK a;  1NU4 A;  5KG6 A;  3DGP A;  2DGV A;  2B7B B;  1FT8 A;  4FYW B;  2GQC A;  4DZ6 A;  3SMZ A;  4FF1 A;  4CT9 A;  1YJ7 A;  4UST A;  3HI9 A;  3FMB A;  4KBI A;  4TN2 A;  3CCV S;  4QOT A;  4OZJ A;  1ZM9 A;  2CPZ A;  2CJA A;  4OZ3 A;  2L3M A;  2NSC A;  3PM9 A;  3M8S A;  1QVF R;  4K50 A;  1PO6 A;  2KFY A;  1V3R A;  2H9Z A;  4UOH A;  4RL1 A;  2VG6 A;  4WFZ A;  4X4N A;  3CME S;  3TR5 A;  2HHW A;  1YJU A;  4NOH A;  4Y3C A;  3MEE A;  5F8I A;  4NLP A;  3LP2 A;  2MHN A;  4LVO P;  4NYO A;  3HVT A;  1QSS A;  2VBZ A;  5LSO A;  3QLH B;  5KFI A;  2Z2Z A;  4MK8 A;  1KLM A;  1CBK A;  2FB0 A;  3LPY A;  3R97 A;  2OEL A;  1D9F A;  1HBU B;  2C3O A;  3KNG A;  2VG5 B;  2YNF B;  5L38 A;  1UJ6 A;  1F0X A;  1SBR A;  2F4F A;  4PPZ A;  3KG4 A;  3BO3 A;  3SSQ A;  3PCO B;  2AHO B;  2K8G A;  2Q79 A;  5JUM A;  1UVK A;  2MQN A;  3OTC A;  2CZ9 A;  2QLF B;  3QAE A;  3HT0 A;  1FNX H;  2HIQ A;  3PW5 A;  3GLJ A;  4ZVF A;  5RUB A;  3A13 A;  3T41 A;  5DQI A;  5I3U A;  5F8G A;  4JI5 J;  2W7O A;  3M9N B;  4HT7 A;  1NSA A;  3BSC A;  4ZVT B;  2LVW A;  5MLC V;  3H59 A;  4J9P A;  3SQG B;  3I4P A;  3POT A;  3FBC A;  4DSK A;  1YRT A;  5D78 A;  5K14 A;  2Z2Y B;  1FJG F;  3DRP A;  3HDS A;  3DI6 B;  4NML A;  2GVD B;  3B4M A;  3Q2S C;  3S1T A;  1FFW B;  4I6A A;  5EX0 A;  2VG7 A;  5ETL A;  1V5I B;  4OMF G;  2ZH4 A;  3HFV A;  1WF2 A;  2P6S A;  1P8G A;  2ACM A;  2CG8 A;  2X3D A;  1U1L A;  4O0N A;  1DRZ A;  4LFB F;  2ZIT A;  2D1C A;  4KGM A;  4FVC A;  4DR2 J;  2KRB A;  1FX2 A;  1YZ7 A;  1R8A A;  2MKC A;  1KQK A;  1WTB A;  4DR1 F;  2ZUA A;  3UNG C;  3IMQ J;  3OXF A;  1FDB A;  3MM8 B;  1FES A;  1ZA1 B;  2JEF A;  4ZJL A;  2YNH B;  3I4H X;  2OKQ A;  3BF4 A;  3CCT A;  4N7T A;  2AJF E;  1O8B A;  2FJX A;  3EWG A;  1KR4 A;  1S1X A;  1TR0 A;  2CQD A;  1RAI B;  4OZ5 A;  4G65 A;  4ZVS B;  1VQS A;  3IBC B;  4FPI A;  2Z2L A;  1QE1 A;  1R0A B;  2FLL A;  1XMB A;  3G82 B;  5EDW A;  3RRK A;  2B51 A;  3RAM A;  4EBD A;  1SJ3 P;  2HVE A;  3DLG A;  2BAN A;  3PY8 A;  1FNO A;  4CLU A;  2AJQ A;  3I32 A;  4I56 A;  4K5R A;  3V4M A;  4AQY F;  2Z57 B;  5KG7 A;  5GME A;  1TL7 A;  3KUH A;  2BQR A;  2HHP A;  2DXD A;  4IG0 A;  4EBC A;  1RTJ B;  2M52 A;  3OVA A;  3L95 X;  2AX1 A;  1IVZ A;  2PFF B;  2GC8 A;  1YK9 A;  2HHS A;  1JLG A;  4PYA A;  1S49 A;  2PDA A;  3H90 A;  3NG8 A;  1UZH A;  3F44 A;  2EFP A;  1YJT A;  2YWE A;  2MQP A;  1QY7 A;  3BM7 A;  3DOL A;  1NKB A;  5J1E A;  3NL0 A;  2APO A;  2KM8 C;  2ZH6 A;  2F65 A;  2WVD A;  2I9S A;  4NL5 A;  3GSI A;  4ANC A;  1FRK A;  1FRI A;  4JI4 J;  1N8R T;  1RZM A;  3MED A;  3QFH A;  1UWB B;  2OSQ A;  3GFH A;  2FPH X;  3T5H A;  3PIO Q;  1HNI B;  1U6Z A;  2BM0 A;  1VBZ A;  1GX6 A;  2MZS A;  3FSX A;  4KB7 A;  4BCA A;  1T03 B;  2GGP B;  3LWM A;  5HJY A;  1QD1 A;  2VUG A;  1XMO J;  4CTA A;  1U1N A;  4B3M F;  2W2M P;  1LW0 A;  2BRL A;  4NWB A;  3QGH A;  1UEK A;  2AEM A;  1KOO A;  3ISN C;  1S1V A;  4LF4 J;  4O3S A;  2IAJ B;  4ZVG A;  3BGF A;  3K2Y A;  1NJI T;  4F4Y A;  2LU2 A;  1Q0N A;  1IKY B;  2IM1 A;  4MYU A;  3A3N B;  2E5I A;  1B0V A;  5B0D A;  1HWL A;  1UTA A;  1VYA A;  4FKY A;  4RKU C;  1U8S A;  4XAK A;  3UI3 A;  3I9Z A;  4P2F A;  3UR0 A;  1JXE A;  4Y2I A;  3HFZ B;  3M6X A;  2V2Z A;  4C4W A;  6AT1 B;  3DLH A;  4NXN F;  2JRS A;  3AB4 B;  3EE3 A;  2RJZ A;  4ZOS A;  3KLG B;  3PHE A;  4X65 F;  3HM9 A;  2D9P A;  3V4I B;  4UY8 5;  2RIJ A;  4DJB A;  5KFF A;  4TY9 A;  1AB8 A;  5DJB A;  3L4B C;  3KK2 A;  1X60 A;  3OQ2 A;  4M5N A;  4OYZ A;  3RW7 A;  4NZ6 A;  4F0H A;  1S59 A;  1RCO B;  2QE5 A;  1UMJ A;  4QU7 A;  1ZYQ A;  1S0N A;  2DNZ A;  4P75 A;  5DG7 A;  3TVY A;  3TEH B;  4FS1 A;  3VVT A;  1WWH A;  4NZ0 A;  1FXD A;  3PYD A;  3P49 B;  4KV8 B;  1TKX A;  2BKN A;  4O3Q A;  4LSZ B;  3NKY A;  2XSF A;  4O4G B;  2AU0 A;  3VQT A;  4ZN3 A;  3GMG A;  4P2M A;  2JEJ A;  1NH8 A;  3MPV A;  2BVZ A;  4F4K A;  4YP3 A;  3OXL A;  1C4C A;  1XIQ A;  2FHJ A;  3KWM A;  1JLQ B;  3MR6 A;  5GAG U;  4DPY A;  3ZZZ A;  4QWD A;  1PIL A;  4HHU A;  3TI0 A;  2W9A A;  1REV A;  1DLO A;  3JTP A;  3L9Z A;  3UDL A;  3OV7 A;  1VRT B;  3DLB A;  4LR7 A;  2BJ3 A;  1X4E A;  3NGU A;  3W3S A;  1VQO S;  3DRR A;  1HQE A;  3D1O A;  1RKJ A;  4QJV A;  1H74 A;  1EKR A;  5LL6 d;  2YPZ A;  1VJQ A;  5DDO C;  1XR6 A;  1U26 A;  3R1L A;  2CDQ A;  1WD6 A;  3W64 A;  4IH5 A;  4IO1 A;  4K4U A;  2A2D A;  2HVD A;  3GIJ A;  1X4A A;  2UVU A;  1WOS A;  2OD6 A;  3PW4 A;  3A8I A;  1FCA A;  4LBP A;  4ID8 A;  3DYA B;  3ZTR A;  2PEB A;  3UN2 A;  2JLE A;  3Q2T C;  3CCZ A;  3MAA B;  4I67 A;  2GCF A;  3CJ3 A;  2ZDO A;  3CCU S;  2AJ1 A;  1RKI A;  4NPO A;  5THW A;  2YQ0 A;  3R5J B;  4AL5 A;  2QLX A;  5HAT A;  3TO8 A;  2ASJ A;  3MR5 A;  2C2N A;  5EN1 A;  3K5L A;  2VPZ B;  2RDD A;  2WBM A;  5I3Q A;  4M5M A;  3AD8 C;  1RT6 B;  1DTT A;  5JVG Q;  3IC1 A;  1RP5 A;  3HP6 A;  1R8B A;  1RT3 B;  3T19 A;  4EMD A;  2XO7 A;  2O5D A;  2J0S D;  3KG0 A;  4WTY A;  4ZCL A;  8RUC A;  2KVQ E;  2HAI A;  1XTZ A;  4OI3 A;  3EPG A;  3EDQ B;  4F67 A;  1TVR A;  1ZBT A;  3GR1 A;  2LEB A;  1TK5 A;  4NCG B;  1S6U A;  3HCX A;  1S9G B;  1X4F A;  2Y1J A;  2KL8 A;  3D1Q A;  2BKO A;  1TKT A;  2ZBI A;  4EZ9 A;  2FHM A;  2K1R A;  4UUW A;  2HND A;  2VOP A;  2RF2 B;  3PX0 A;  2GHW A;  5IZH A;  1Q7Y T;  2QIF A;  4Q2L A;  4H4O A;  2GQQ A;  1T02 A;  4X84 A;  2E1R A;  3MPY A;  3V6J A;  1VBX A;  4PXD A;  2DHH A;  2ZHB A;  4DCP B;  2LEC A;  1ZS6 A;  5E2Q A;  4WU3 A;  2BXJ A;  2R7R A;  2EI5 A;  5JXS A;  3EXC X;  2DBB A;  4IFV A;  2OPR B;  4X66 J;  1NZA A;  2C2K B;  4CQ1 A;  4OJ1 A;  4A8Q A;  4DFM A;  4C9D A;  4IDK A;  4H4M A;  2HGN A;  2AGP A;  1K1Q A;  4F26 A;  4FYD A;  1L3K A;  1RSC A;  2R7X A;  2KFN A;  1UPP A;  1OY8 A;  3LA0 A;  2PA8 D;  3MM6 A;  1LK5 A;  4WP3 A;  4G3I A;  4HDH A;  1T9X A;  3GJT B;  3H2U B;  1F1B B;  3G6X A;  4A48 A;  2AWZ A;  1WC6 A;  3DOK B;  2Z58 B;  2ZJP Q;  4U7U D;  3NRB A;  5BJR A;  2VFT A;  5HQ8 A;  1W25 A;  5KFT A;  2ZOG A;  4DV3 J;  3OTO F;  3KTQ A;  1J5E F;  3H5Y A;  2E9Z A;  1HMV B;  3Q8P B;  3CT9 A;  1KOH A;  4YY3 F;  4TY8 A;  4CCH A;  4FYX B;  4N56 A;  1NLK L;  1AZS B;  1FJC A;  2JVO A;  1LW2 B;  5A8R A;  1Q53 A;  1BHN A;  3NMR A;  3MUM P;  4JI1 F;  2V8H A;  3TAP A;  4P7T A;  2LQ5 A;  2B4U A;  4A8F A;  1FE4 A;  3ENW A;  3M32 B;  4M8L A;  4TYB A;  5D8H B;  3HSG A;  1X4C A;  4DI6 A;  2B43 A;  2KB2 A;  2EFV A;  3NGK A;  2OPQ A;  4HAC B;  3C6T B;  3C19 A;  1NPP A;  5H9E J;  1LWE A;  5LT5 A;  3M30 B;  4OV1 A;  5KFN A;  5KT4 A;  1FEE A;  3KJN B;  3D6F B;  2DH7 A;  5AJ3 J;  3KLI A;  4WIQ A;  3BPS P;  1UVM A;  2Y1L B;  4ZPB A;  2LMI A;  4J9S A;  2HFO A;  5HBM B;  3S8S A;  4DL2 A;  3VHQ A;  2E5H A;  3NEK A;  3W5Z A;  4CYU B;  2MTL A;  2WW8 A;  2G1D A;  1W2I A;  3D2W A;  1RWP B;  2OML A;  1HA1 A;  1RT4 A;  2YKM A;  2AEF A;  4FKX A;  3H20 A;  3DN9 A;  4I7F B;  1K8A T;  2FVC A;  1CS4 B;  1NAQ A;  4DQI A;  3ZC4 A;  3OXG A;  2FY1 A;  1YIJ S;  2F4V J;  5FLX U;  2DHG A;  2A2C A;  1IBK F;  2W2Q P;  3VAM A;  5CYQ A;  3MR2 A;  3CB4 A;  2AMC B;  5CXT A;  3UD5 A;  1GFW B;  1DQ9 A;  3THP A;  4X2B A;  1L3V A;  3QIP B;  3QAU A;  4YME A;  2E5J A;  4OI2 A;  2NPI A;  4A46 A;  3B54 A;  5KT3 A;  2BJE A;  4B3R J;  2XHC A;  1CSJ A;  1KQS R;  3UVJ B;  2O01 C;  2XMU A;  2E29 A;  4DQS A;  2Z30 B;  1EX8 A;  3KMS A;  2KH9 A;  3B8H A;  1G3O A;  4MFB B;  2GJI A;  1S7H A;  2FD2 A;  3AD9 C;  3R2C J;  1Q16 B;  1JWW A;  3CIM A;  1U25 A;  2K7K A;  1IBC B;  1SH0 A;  2N4D A;  1S0V A;  4Z37 A;  2XNQ A;  2FC8 A;  4ERD A;  3P6Y C;  3DDI A;  1DTQ B;  1CJK A;  1O5J A;  1FD8 A;  2FC9 A;  4WCE Q;  2ROE A;  1QTM A;  2XEX A;  1XNR J;  2DNK A;  4NA2 A;  4RBU A;  3TUP A;  3RRH A;  3OR1 B;  4JI7 J;  2UU9 F;  1RYS A;  2WAQ D;  1C0U B;  1SL0 A;  3A8E A;  3GYG A;  1RBL A;  3MF5 A;  2J8A A;  2GIQ A;  3HSZ A;  3QT7 A;  5CZV A;  5AT1 B;  2FQQ B;  4QW8 A;  3CGI A;  4NLD A;  2OPS A;  1P6T A;  1QVG R;  3AAW B;  1FX4 A;  4B08 A;  1C1C B;  1QJH A;  4KRW A;  2W8L A;  1RTH B;  3D0G E;  4RUC A;  1AFJ A;  3PW0 A;  1FDN A;  2QL5 B;  4IOA Q;  1LXJ A;  4DF8 A;  4RPF A;  1B64 A;  2BOA A;  4ZLN A;  1U8W A;  3MOZ A;  4EYI B;  2JOQ A;  1RT5 B;  1FRM A;  3DLL Q;  1IKV B;  1RTI A;  3IG1 A;  3RGI A;  1NBE B;  4K5S A;  1S1W A;  4ETX A;  2QYC A;  4ETZ A;  1VC6 A;  5GAG I;  1CJT B;  1TL5 A;  3T6J A;  1V6H A;  3DLE B;  3J81 U;  4WK3 A;  1X0P A;  1AUS L;  1XER A;  3RBE A;  5IXU A;  4F04 B;  1RU1 A;  2GX8 A;  2ZBQ A;  4X4Q A;  3LAN A;  2N3L A;  3AXM A;  3WQP A;  4DBQ A;  4RW6 B;  4EO6 A;  2GJ2 A;  3A4T A;  2L9W A;  4ZHR A;  3MM5 B;  2FJA B;  3PRD A;  3EGV A;  5KFB A;  3C6U A;  4IRC A;  4DR6 F;  1SIW B;  4ES1 A;  1KN6 A;  2IBK A;  1R8P A;  5GVQ A;  5IC6 B;  2ZZT A;  2VHG A;  3G8Q A;  1FFS B;  2MQQ A;  2DXF A;  1G7C B;  7FDR A;  4HDG A;  1NHK L;  3RBD A;  4DFJ A;  2DO4 A;  2ZH7 A;  2D3O 1;  1NRK A;  5HP1 B;  1BQM A;  4P52 A;  1X8D A;  4LMZ A;  3G2X A;  4DUY J;  3UQS A;  2CPH A;  4I68 A;  2HQG A;  4P7V A;  2CJK A;  2HS3 A;  2BRK A;  1N5Y B;  2MQM A;  2Q66 A;  1IUJ A;  2KN4 A;  3HZE A;  4B9T A;  3T1H J;  2GV1 A;  1RLC L;  3S01 A;  3GIR A;  1Q1K A;  3FBB A;  2BV3 A;  3GJR B;  2B4O A;  4CLL A;  1KS2 A;  3M8P B;  4BS2 A;  4KKO A;  3Q83 A;  3FRZ A;  2YKO A;  4TVA B;  1TMM A;  4DUZ J;  2VIC A;  1CQM A;  1IN0 A;  3ULH A;  2B5J B;  3RRG A;  3K8W A;  4PWU A;  2E44 A;  3EZU A;  3M8Z A;  2HQI A;  3I5B A;  2JLF A;  3R2D J;  1AA1 B;  1U1M A;  1X4H A;  4YN3 B;  2JEI A;  2MDA A;  3HXM A;  2LYV A;  3PFE A;  2BJ9 A;  1DY3 A;  1OS5 A;  4LFA F;  2H51 B;  5K8N A;  2K06 A;  2J6U A;  2MJN A;  5IV4 A;  1ULR A;  1YG0 A;  2DNY A;  1VQ5 S;  4KH0 B;  1DQA A;  4NLG A;  4U7U K;  2IM2 A;  4QR2 A;  5B0G A;  3P45 B;  3MUR P;  3OL9 A;  1TKZ A;  2QA4 G;  4PG5 A;  2XZT B;  3G8T A;  2MZ1 A;  3NAH A;  3AA8 A;  4TU7 A;  4DR3 F;  2OI2 A;  4XO0 A;  3PRV A;  2OP5 A;  1PAU B;  2WK4 A;  2YWG A;  4ECU A;  3NS7 B;  1R6Y A;  2RML A;  1S4E A;  1WG1 A;  3BQ1 A;  2COL A;  1V9O A;  1M5V C;  1SC4 B;  1JKH A;  2GVZ A;  2WB1 D;  3W8P A;  1SQE A;  2AV5 A;  2CYY A;  3SDE A;  2RKI A;  4WFB Q;  1EP4 B;  1HYS A;  1GXL A;  2V4Q A;  1SJQ A;  3LP0 A;  5IWA F;  3OLA A;  1IWG A;  2VQE F;  2H4Y B;  4NLQ A;  4WE1 B;  1M5K C;  5G4D A;  4ZS6 A;  2HS4 A;  1HL6 A;  1RAE B;  4K0K F;  4KGK A;  2PGC A;  2RHS B;  3OTB A;  4FDF A;  3DC2 A;  4DR7 F;  4C0H A;  2KXH A;  3C14 A;  3C2P A;  2B9X A;  3AJD A;  4OZ2 A;  3Q8U A;  4NLT A;  3OPK A;  2VFS A;  3TAM B;  3CW2 C;  2H5I B;  1DFD A;  2QV6 A;  3ITH B;  1IR0 A;  1Y4Z B;  2NYI A;  3HK2 A;  2OIH A;  2PO4 A;  3KK3 B;  2B9E A;  1PIE A;  3IN5 A;  4I2P A;  1YJ9 S;  5CCL A;  4RNM A;  1U02 A;  2CJQ A;  1RJJ A;  3LUY A;  1KVJ A;  2FUG 9;  1NK8 A;  5A6W A;  1QM9 A;  1HQU A;  3QPI A;  3EIC A;  4LUB A;  4LF8 F;  4DSJ A;  2V8V A;  3K59 A;  3B6B A;  3V2U C;  5LMN J;  2BW7 A;  1U2F A;  3GYN A;  2Y0S D;  2EFG A;  4MAK A;  5ADZ A;  5IS2 A;  3OUY A;  2NUH A;  3V6D B;  1OIA A;  3VGV A;  4CP5 A;  1K1S A;  3NBP A;  5L9N A;  4KHR A;  4IOB A;  2MGZ B;  1HBN A;  1X5T A;  3J7Z T;  4TU9 A;  2HHU A;  5BYS A;  4GKK F;  3S7R A;  3GQC A;  4K59 A;  3FFI B;  2FYX A;  1LKZ A;  2OEJ A;  5E33 A;  4JYA J;  1KD1 T;  3MGJ A;  3X1L B;  4FXD A;  2FHO B;  1ZAX A;  1Z2Z A;  3J7Y U;  2NUU G;  3J81 Y;  1YJR A;  2JHE A;  4I6Y A;  2OHD A;  2HNZ B;  2OLW A;  3CUL A;  5IQQ A;  3LWL A;  3G4S S;  4IRK A;  2C2D A;  4DWI A;  1L3U A;  3MEC A;  4ID5 A;  1S6P A;  1IXK A;  3KLE A;  2DGQ A;  1AXQ A;  4Z7Y A;  5F3Z A;  3M05 A;  1J5O B;  1U0S A;  1S48 A;  4C8M A;  3WZ0 A;  3ETO A;  4OHW A;  4G1I A;  5LXY A;  5GAD U;  4N77 A;  1S1U A;  4R8U B;  2KM8 B;  1MW7 A;  3PFO A;  3BN4 A;  4XDD A;  3PO4 A;  2R3V A;  3O8W A;  3BO2 A;  4PR6 A;  4DL6 A;  3VGU A;  5L39 A;  4CH7 A;  4IG3 B;  1RHM B;  1FRJ A;  4TXS A;  2CPX A;  1KTV A;  3ETM A;  3JQK A;  1E6Y A;  2DIU A;  2VOD A;  4KPC A;  2XCA A;  4ILR A;  4RW9 B;  4FXV A;  3EXY A;  3LW5 C;  2RE1 A;  1NSK L;  2MZR A;  5K5M A;  5KFK A;  1RLD A;  4ED2 A;  2DH9 A;  2ILY A;  4ENO A;  4KFB B;  4NXM J;  1TAQ A;  3M2U B;  2KTQ A;  1PAE X;  2ROG A;  5HQL A;  1CJV B;  3OW2 R;  3M8R A;  3VV2 B;  3MMC B;  3DCA A;  1VGY A;  1ZM4 A;  1XEZ A;  3NNH A;  3MD3 A;  3WIU A;  1VC0 A;  5ETK A;  4LF5 F;  1KBR A;  3D5M A;  2O67 A;  1N4L A;  3NLC A;  5CAB A;  2B0G A;  4WXW A;  3GFX A;  1OY6 A;  2KZM A;  3QLH A;  3TAR A;  1HPZ B;  4X62 J;  1OQ6 A;  2LCW A;  3V6K A;  4LBI A;  4ECR A;  4Q7A A;  3CC4 S;  2LP4 A;  4J7C A;  4OQJ A;  3U1M A;  3CO0 P;  1TL1 B;  1RAO A;  3ZO7 A;  1BMQ B;  1WSV A;  4NLO A;  1N5Q A;  2PMZ D;  3OFG A;  1HBU A;  2HZA A;  2VG5 A;  4H54 A;  2YNF A;  4X4O A;  4MIW A;  4FNH A;  4TKT A;  4NE9 C;  4F3M A;  2QO3 A;  3G6E S;  1S0O A;  1VS3 A;  4KYZ A;  2K2P A;  2CNN B;  1NKC A;  1SCJ B;  1LWF B;  4JI8 F;  4URQ U;  3VAF A;  1WC5 A;  4K8R A;  4WFN Q;  4M95 A;  3QRP A;  3RTV A;  5D6G A;  1WKK A;  3I56 S;  4WFX A;  1RYR A;  5HLF B;  2J9D E;  1UA1 A;  3W5X A;  3CJR A;  2UZA A;  2DTJ A;  1OSC A;  4PWW A;  4QW9 A;  3OTD A;  2V0N A;  3SQG A;  1TMJ A;  4CO4 A;  3BPD A;  3O3L A;  4L3K A;  2R8H A;  1HBM B;  2W2P P;  3DI6 A;  2GVD A;  4QWC A;  1U45 A;  3SCL E;  2V2Q A;  2R2R A;  1NJW A;  3I5A A;  1GH8 A;  4MKA A;  4DV4 J;  4RNF A;  2CJY B;  2FGO A;  2RHQ B;  4LT6 A;  1L3S A;  3NGD A;  4HLB A;  2HBQ B;  3MR3 A;  4YFU A;  2UV8 G;  2XS2 A;  1IBM J;  1AW0 A;  1T9T A;  2X7I A;  2KJW A;  2O1P A;  1V3S A;  2QL7 B;  4DR2 F;  5HI7 A;  4RJV A;  3MM8 A;  4DV5 J;  1Q8L A;  4DV6 J;  1NK6 A;  4LFC J;  3SCI E;  1HBO B;  3IS9 B;  2YNH A;  4QR0 A;  1VHF A;  3FEY B;  3ICL A;  1S10 A;  3KFW X;  4HL9 A;  1PYO B;  4HHH A;  3Q8Y A;  4WFY A;  2M8D B;  5I3P A;  1HHQ A;  1M90 T;  4B3T F;  1KP6 A;  7FD1 A;  2MKH A;  2IVM A;  3EGN A;  4P73 A;  4CO0 A;  4M5L A;  1R0A A;  9RUB A;  1T8E A;  1CC8 A;  1PC4 A;  3G82 A;  3DLK B;  4DQP A;  3THV A;  2LQJ A;  4ZN1 A;  2F63 A;  1WKL A;  1PJ7 A;  4ED7 A;  1JLB B;  2CIM A;  1JLF B;  4ED5 A;  1DQ8 A;  4C2M A;  2YQ3 A;  4DEZ A;  3UN5 A;  2E9T A;  2LXI A;  3IR5 B;  3IWN C;  2ZH2 A;  3HPO A;  3Q22 A;  1S5Z A;  1EB0 A;  4W90 B;  3BSN A;  3MOJ B;  4NA1 A;  4OYO A;  1RTJ A;  4CH0 S;  5BR8 J;  4TYA A;  2DIT A;  2ZVS A;  2KHC A;  4A8S A;  5F8L A;  1WJ9 A;  5KFA A;  1F2G A;  3EGW B;  2HBR B;  2IIH A;  4IQX A;  4DG1 B;  3M8W A;  3NGT A;  2WON B;  5F8N A;  2EC2 A;  2HQF A;  3A1Y G;  1Y5N B;  2QC3 A;  3I87 A;  1YDL A;  4JV0 A;  1HIY A;  3CPW R;  1MU2 B;  1TZ0 A;  2QMX A;  2ABY A;  2VAS A;  3SBM A;  4CLF A;  2QG9 B;  4OHY A;  1WDT A;  3MCM A;  3MEG B;  2EKY A;  4GC7 A;  1KQG B;  3FGV A;  4R0J A;  3VZH A;  2WSF C;  1UWB A;  4JI4 F;  3NOC A;  4MK7 A;  1RHU B;  3MTK A;  1HNI A;  3OSP A;  4JUZ A;  2CA9 A;  4F3O A;  1UWA A;  3MHY A;  3PX6 A;  2XC9 A;  1Z1Z A;  1T03 A;  1U6B A;  2GGP A;  1IJE B;  2FJW A;  5ETV A;  4O3O A;  4CRJ A;  2JFD A;  2L08 A;  4LSL B;  4KSE B;  2FZK B;  1B3T A;  2M0G B;  1SJF A;  2MLX A;  4ZDN A;  5ETN A;  4IOC Q;  1UW9 A;  3X3U A;  4DX5 A;  4NLS A;  1JJ4 A;  1RDR A;  2F9D A;  2R7Q A;  2ASY A;  1WSR A;  4FYY B;  4C3K A;  3RB4 A;  4KH1 B;  2IAJ A;  3OVS A;  3QWU A;  1IKY A;  4B02 A;  2DHX A;  5ETS A;  1T7P A;  1FDD A;  2MZT A;  1X31 C;  3QJL A;  4URG A;  5HL7 Q;  2I0X A;  5D77 A;  5L1L A;  4DQR A;  1M5O C;  4J9U E;  4ZCM A;  2E7V A;  1OYE A;  4PPD A;  3JQJ A;  2CQ3 A;  4LVN P;  5EWF A;  3K5N A;  1RAF B;  3M6W A;  3FZB A;  5T14 A;  3Q8V A;  1RAA B;  4USV A;  3GR0 A;  3HF5 A;  3H2L A;  3U02 A;  4Q0B B;  4RU9 A;  1RA7 A;  4I0W A;  4ITS A;  3EJM A;  3KLG A;  2V34 A;  4W98 A;  3V4I A;  3HSJ A;  5FDL B;  1KQF B;  4C7Q A;  3TW0 A;  1NDC A;  3EMT A;  2F3J A;  2OEK A;  4MJK A;  1RWU A;  4USM A;  2W9B B;  4EBE A;  2FTR A;  3HHL C;  2HSE B;  3PDN A;  1T9W A;  5A0Y B;  4X64 F;  1VI7 A;  5L1K A;  2CQ2 A;  2F8M A;  3SZ2 A;  5J2M B;  1UKU A;  1FK9 B;  3MMB B;  4ZPC A;  5GAD I;  2O66 A;  2XWY A;  4XIU A;  2QJ3 A;  1FJG J;  4ATN A;  3VAJ A;  5GAE U;  4KV8 A;  1IM4 A;  3ZNU A;  4BC9 A;  1YGY A;  2UUA J;  4C11 B;  4O4G A;  4MMO A;  4F4A A;  2XMM A;  2HYI B;  1YHQ S;  1VRU A;  2VD3 A;  3E3X A;  4MK9 A;  3SIP B;  5L1J A;  1JX4 A;  1B0T A;  1N52 B;  4L3N A;  4DS4 A;  3CCL S;  1GK8 A;  2HRT A;  2DNH A;  5DS7 A;  3Q23 A;  1D1U A;  4V1A k;  1JLQ A;  4AUK A;  4F4X A;  1RAJ A;  2CVE A;  4B3S F;  5AXM A;  3J7A 1;  2G0J A;  1TTH B;  2NYH A;  3EZ5 A;  2C42 A;  2BOP A;  3GE9 A;  5J2Q B;  1BWV A;  1SUQ B;  1VRT A;  2K3K A;  3AJ1 A;  4LRF A;  4WP9 A;  2ALY B;  4C3L A;  1KC8 T;  2I8E A;  1BE4 A;  2IYI A;  1DBD A;  4XDC A;  1KKH A;  3LOU A;  4DX6 A;  2RT3 A;  5JMN A;  1N54 B;  2C1E B;  1RHK B;  3CDU A;  1JB0 C;  3IO1 A;  2UXC F;  2PT0 A;  5DZ6 A;  4KPY A;  1TL4 A;  3JXO A;  4OI1 A;  1QE1 B;  2V6A A;  4G1P A;  3MMA B;  2GML A;  3O44 A;  4K4X A;  2L9N A;  4OI0 A;  2IRX A;  2HLT A;  1RT2 B;  1ZZF A;  2IJF A;  2PMH A;  4N5S A;  4DPT A;  1P9Q C;  1IQZ A;  3DYA A;  1TV6 B;  4CT8 A;  3MAA A;  1TKD A;  3OSN A;  2KT2 A;  3D1H A;  1NEE A;  2H5E A;  3MD1 A;  2KG0 A;  3IRW P;  4AQY J;  2JVR A;  2MKK A;  1GMW A;  4L75 A;  3MM7 B;  4HH1 A;  3UPF A;  5F3T A;  3FMW A;  2JH3 A;  3PJX A;  3TAN A;  2GZO A;  3RU0 A;  2K3I A;  4PKD B;  2RNE A;  2EPI A;  2VOO A;  1FI4 A;  2HBZ B;  3H5X A;  2N82 B;  4ZLJ A;  1HW8 A;  4Q5V A;  2LA4 A;  3CCW A;  1RT6 A;  2UUT A;  1S0M A;  3B82 A;  1RT3 A;  3ET6 B;  1MML A;  1MLA A;  4KAI A;  4LF6 F;  2FHJ D;  1N33 J;  4NLV A;  1JLA B;  2H1Y A;  2GIR A;  2VFV A;  2QX0 A;  3CD0 A;  1WNE A;  4HI2 A;  2IC3 B;  2AQ4 A;  3D0H E;  3TJA A;  4CNY A;  1ZPW X;  3B4D A;  3UCU P;  2J9E A;  1Q7L B;  2YX4 A;  4KC5 A;  1N0U A;  4Q2M A;  2VZ9 A;  4ZLL A;  4E8U A;  4YDD B;  2VPX B;  2VPY B;  5DGB A;  5BXI A;  4CNZ A;  3KHH A;  5M2R A;  5KOW A;  4YUD A;  3GTY X;  2RF2 A;  1UEU A;  2AYM A;  2LXU A;  4LF7 J;  4B3M J;  3IWX A;  1HNZ F;  1U1R A;  4KT0 C;  4L6V 3;  5HMY A;  2MEW A;  3TZZ A;  1V3Z A;  2EC0 A;  3EYZ A;  4YHH F;  3Q8R B;  2M9K A;  1ARO P;  4RU2 A;  1KVK A;  1K0T A;  1SC6 A;  2Y3Y A;  1SIZ A;  1NUE A;  1S1V B;  4WPA A;  3W66 A;  2OPR A;  4DV1 J;  1NCL A;  3GP9 A;  1TL3 B;  1FJE B;  2HFZ A;  4PAA A;  3H40 A;  1H0H B;  4J90 A;  1KSP A;  3MZI A;  5F8M A;  4QBU A;  2CWX A;  4ED1 A;  3NOG A;  1GT8 A;  2B9Y A;  3KOA A;  3BQ2 A;  2MST A;  3K0J A;  3BGR B;  3I0S B;  1LWC B;  2B8Q A;  5HO4 A;  4UY8 T;  3F56 A;  1FFG B;  1X4B A;  4P72 A;  1H7X A;  2OO4 A;  2HZV A;  3DOK A;  4N41 A;  4M5H A;  4HTJ A;  4ICL B;  2ZUG A;  2RU3 A;  2VC1 A;  1F2H A;  4OHV A;  5LSL A;  1UAW A;  4RBT A;  1DUR A;  1HMV A;  1WI6 A;  3V5R A;  1WG4 A;  1HNV B;  2A0F B;  3DRX A;  2VQF F;  1AZS A;  2BJ1 A;  2OD4 A;  4LRD A;  2C22 A;  1LW2 A;  2BKP A;  4DSE A;  3MEK A;  4WK1 A;  3AOA A;  5E7O B;  1CLF A;  1EIY B;  4J9O A;  3M2R B;  1YBT A;  5E41 A;  3M32 A;  1FRL A;  3O5T B;  1EHW A;  4WKR A;  3M4X A;  5H1S V;  3C6T A;  1J27 A;  1HNX F;  2CJB A;  3BGU A;  3TYT A;  1F6T A;  2BR0 A;  4CLK A;  3T1A A;  1WDD A;  3AB2 B;  1QUV A;  4DL0 C;  3P4U B;  3KUE A;  3M30 A;  2QA1 A;  2M3D A;  3UCZ P;  4PUO A;  2PEH A;  2XCP A;  5EGY A;  5AJ3 F;  3MPU B;  3CCQ S;  1K9M T;  2W4C A;  5IOL A;  3O6Q A;  1UJ4 A;  2MYF A;  4U6P A;  4TQS A;  5KT7 A;  3RAQ A;  1BY9 A;  3K89 A;  4CYU A;  1QSL A;  1QDU B;  2I1R A;  5CH7 B;  5KFE A;  3R7N B;  2P6T A;  2E7X A;  4X4S A;  4PCQ A;  3KHG A;  4I7F A;  3JSR A;  1CS4 A;  2AT1 B;  3EM1 A;  4JI3 J;  2BEF A;  2JC1 A;  3NY0 A;  1MSW D;  2BBE A;  3KLV A;  2DXE A;  2DB1 A;  3MM9 B;  2P5V A;  3UFC X;  4ZVE A;  3H42 A;  2F4V F;  1Z4U A;  4O3N A;  1DZ5 A;  2QT7 A;  3MMJ A;  1NDP A;  4G1Q B;  5D3G B;  4BWJ A;  1JJH A;  2A1B A;  4ZVQ B;  3HHK A;  3DLJ A;  1KLN A;  3QIP A;  1CQN A;  3VWS A;  4ED3 A;  2AKW B;  3BDP A;  2ZNZ A;  1WHX A;  4C8O A;  4LIW A;  3UVJ A;  3PKM A;  2QRR A;  1UVN A;  4DHV A;  5C25 B;  2BE9 B;  4NLX A;  2JWN A;  3HHD A;  4U9R A;  4MFB A;  2D3O R;  4DSL A;  1WOP A;  3DM2 A;  1S6Q B;  2A6O A;  2YH0 A;  5I4M A;  4NA3 A;  2FZG B;  3EPI A;  5A8K B;  2V2K A;  3MAH A;  1JJC B;  3JQM A;  4PAB A;  1DTQ A;  5CZX A;  3PO5 A;  1UFL A;  3OT9 A;  4OJH A;  3IRX B;  1KWM A;  4F4W A;  4CZC A;  2DNM A;  4EWT A;  1S9F A;  2HGM A;  4ZP9 A;  5DET A;  4DV2 J;  2IRY A;  3OR1 A;  3CD7 A;  4NRU A;  2HRU A;  1C0U A;  1U49 A;  4JI7 F;  4A8W A;  3R8Y A;  2I6W A;  1NB7 A;  3BS9 A;  3H2V E;  2VON A;  2Y8Y A;  3C15 B;  1C1C A;  5J1N A;  1RTH A;  1C0T B;  5GAE I;  5B7W A;  1OSD A;  4IRD A;  2YPY A;  1VIX A;  1MNE A;  2J9C A;  5IFM A;  2AIR B;  2WRM A;  1RT5 A;  1IKV A;  1TAU A;  3KDN A;  1VDH A;  2R8G A;  1X7V A;  2FVR A;  2VJV A;  4NI2 B;  3MCO A;  5SZT A;  1WF0 A;  1CJT A;  5DRK A;  3DLE A;  5DM6 Q;  2KT3 A;  4K2J A;  4ZCI A;  2DNL A;  3WX4 A;  3AD7 C;  4JV5 F;  1G6B A;  4U8Y A;  1IJF B;  4RW6 A;  2Y1I A;  4NRT A;  1VQN S;  3MM5 A;  2YKA A;  1EQM A;  3KLF B;  2X1G A;  4DCO B;  5DQH A;  3ZFV A;  2FJV A;  5EWG A;  1BC6 A;  4WII A;  5DM7 Q;  4KJI A;  3T1Y F;  2B4V A;  3W5Y A;  2HRY A;  5T41 A;  1UL3 A;  2EVZ A;  4CWB A;  3GG0 A;  4Q8F A;  3J81 j;  2LQ8 A;  4HHJ A;  3BKU A;  1JLE B;  1NME B;  2DT9 A;  4JI0 F;  3OTO J;  1PGZ A;  1R27 B;  1J5E J;  4CLY A;  3TEG A;  1ELO A;  5F0U A;  1OY9 A;  2EBE A;  5HAN A;  4EK2 A;  3ZTO A;  5HVH A;  5FD1 A;  3QWP A;  4DUY F;  4YY3 J;  1N5Y A;  3ZZY A;  5T7L B;  1N34 F;  1C4A A;  2OEM A;  3DOM B;  1S7I A;  3W9H A;  4CO1 A;  4JI1 J;  3ZZU A;  2ALZ A;  2YVS A;  2ZH9 A;  1CG2 A;  2HEK A;  3SEO A;  2B9W A;  3W62 A;  3QGP A;  2DNN A;  2C28 A;  3RUB L;  1R0C B;  5EX3 A;  2UXB J;  2XTJ P;  3BSO A;  2QLJ B;  3M8P A;  1JNZ B;  2M8H A;  2MLY A;  5EUH A;  2RRA A;  4RNN A;  3HSD A;  4X4P A;  4RW4 B;  3AFG A;  3I6P A;  4OYW A;  2J9D A;  2XM3 A;  4ECS A;  1KRP A;  4IFY B;  2ZNY A;  1IBL F;  4DUZ F;  2A18 A;  2B5J A;  2ROP A;  4DFP A;  2NS1 B;  3EX7 B;  2HFV A;  4V19 J;  1OPZ A;  1N32 J;  5F8J A;  3EGZ A;  2X3G A;  2W9C B;  5SUH A;  2DVI A;  2AYE A;  1A0O B;  2LFV A;  2A3J A;  3W1Y C;  1KNZ A;  2V8D A;  2L41 A;  2KHD A;  1X5S A;  1OJ4 A;  1XNQ J;  1SC3 B;  4RUH A;  4QQB A;  2M70 A;  1UZD A;  3LP1 B;  1P27 B;  2RS8 A;  5D4P A;  1PBU A;  1U1K A;  1VJW A;  2GMH A;  3GJQ B;  1S12 A;  1ZAW A;  3ADA C;  1S77 D;  1WC1 A;  1U0H A;  3RAX A;  1GTE A;  1YSJ A;  3KJV B;  3HD1 A;  3CF5 Q;  1S4F A;  3NXZ A;  5HJX A;  5CHC B;  3QAT A;  4LF9 F;  4WF9 Q;  3AJ2 A;  4LF1 A;  4XPC A;  3BGO P;  4AT1 B;  3K8V A;  2HG4 A;  1JXV A;  4CM2 A;  2VKZ G;  1RB0 A;  3QO9 B;  2W25 A;  4C8K A;  2ZM6 F;  3CTR A;  4P2S A;  2DK2 A;  2BQU A;  3I96 A;  4KTQ A;  5LJ5 Y;  2V8G A;  2Z2M A;  4WTO B;  1VOM A;  3VAI A;  1D3W A;  2RSQ A;  1EP4 A;  3DXB A;  2LXF A;  4ZPD A;  1P1L A;  4WE1 A;  1OPI A;  2EK6 A;  1T9V A;  2E1M C;  1B70 B;  4MTP A;  1OYD A;  2DH8 A;  2DJW A;  3D6H B;  1U2R A;  3Q8S B;  4OV6 A;  1Y3K A;  4HEA 9;  4WYW A;  2ZH8 A;  1XWL A;  4LR8 A;  1CJK B;  2ZJR Q;  4YB5 A;  1RWK B;  3IGV A;  3BO4 A;  3TAM A;  1RE1 B;  3D0I E;  4OLP A;  2UU9 J;  2DPJ A;  3DU5 A;  3MI7 X;  4OX9 F;  1FDA A;  2H48 B;  4CLW A;  4QWA A;  2IBO A;  3PJ9 A;  4LF2 A;  3JAM U;  3KK3 A;  3PG9 A;  5K8M A;  5J2N A;  3DGV A;  4C0B A;  1GMV A;  2JFK A;  2ZDP A;  5HRO B;  2EK1 A;  2XI2 A;  1Q82 T;  3QBC A;  3VAK A;  1HWI A;  1VQK S;  2V9K A;  4ELV A;  4C6A A;  1RXO B;  2OAU A;  3QGI A;  1RTD B;  2AZ1 A;  2G1H A;  1NK7 A;  2N3O A;  1T94 A;  2FDN A;  4O23 A;  3BJY A;  5ETR A;  5LMN F;  2A6M A;  5JJB A;  5KFY A;  2R4F A;  3V6D A;  2EWH A;  3CJ8 A;  4AD6 A;  2HPU A;  4Y2K A;  4MH8 A;  4UZC A;  3GIK A;  4F25 A;  2LU1 A;  5IC4 B;  4KO0 B;  1N6Q B;  2MGZ A;  3P5B P;  4DV7 J;  4Y0F A;  3HHL D;  4L74 A;  3JSM B;  2VB6 A;  4I2Q B;  4A47 A;  2ZD1 B;  1H38 A;  3R7S B;  1EJ7 L;  3MUT P;  4KE5 A;  4LQ9 A;  2FY8 A;  3FFI A;  4PYD A;  2BE2 B;  3A3O B;  4I4B A;  4A4J A;  4I69 A;  2ZOF A;  2HK3 A;  4JYA F;  2J76 E;  2L9D A;  1FKP B;  4KGV B;  2FJB B;  3AH6 A;  5B09 A;  3J7Z 5;  2HNZ A;  2MQ8 A;  4PEO A;  3P3D A;  2VL1 A;  3AQP A;  2EFO A;  4M94 A;  4N8N A;  3J7A N;  1S79 A;  4CLS A;  2R7U A;  1HI8 A;  4DX8 H;  4J9M A;  1J5O A;  3DMJ B;  4K2X A;  2QSF A;  1Y00 A;  1CPZ A;  4EGL A;  3MWB A;  4R8U A;  5AE1 A;  2UVW A;  4C3M A;  2CQB A;  1R3N A;  1RT7 B;  3AOC A;  5D4L A;  2AZ3 A;  2GO9 A;  2XSJ A;  2J5A A;  2MHE A;  2FLO A;  1JMT A;  2YKP A;  4MIB A;  4ZKA A;  3BH7 B;  2BA9 A;  1Y7P A;  3DRS B;  6FD1 A;  3IM8 A;  4N8O A;  3GWC A;  4F0M A;  4RW9 A;  1HNW F;  1WEX A;  3WC2 A;  4WFA Q;  1RWM B;  1N0V C;  5JVH Q;  2R8I A;  4O44 B;  2PD1 A;  2MZQ A;  4FXW A;  4DDF A;  3PZP A;  4DL5 A;  3TRG A;  3MR7 A;  2UVR A;  2D74 B;  2KO1 A;  3K5P A;  1B7Y B;  2MZJ A;  2IHR 1;  4KFB A;  1HWK A;  4KHP J;  3M2U A;  4KQZ A;  3KHL A;  5E3C A;  3JTO A;  4XTT A;  1T05 B;  3CCM S;  4RW8 B;  3MMC A;  4DSI A;  5LMU F;  1SB6 A;  1WOR A;  3LGN A;  4GKJ F;  1GXT A;  4UTG A;  1HD1 A;  1FWK A;  2VH7 A;  1LFP A;  3PKY A;  2IMW P;  3KHR A;  2VV5 A;  4LFA J;  2MJU A;  2RD5 C;  4NAS A;  3C46 A;  1NK4 A;  3HLU A;  2XO6 A;  3ELH A;  1F9E B;  1HPZ A;  3QYY A;  3AOB A;  1A7G E;  4X62 F;  4DR4 F;  4Z7C A;  2C3Y A;  4CO3 A;  4C8Z A;  1DJ0 A;  2MQL A;  2NXN A;  4EEY A;  1TL1 A;  3ONQ A;  3Q8Q B;  1S6O A;  3F0N A;  1TUV A;  2GIF A;  3RBZ A;  5A8W B;  3R3T A;  2CZ4 A;  1Y9O A;  4DR3 J;  1ZZN A;  4KHM A;  3BR9 A;  3ENV A;  1FNM A;  5DQG A;  4PWD B;  2XB2 D;  4KR0 B;  1RAD B;  2GJF A;  3GON A;  3HHL B;  1LWF A;  5C42 B;  3A8K A;  5G0R B;  4LRE A;  1X0F A;  3U27 A;  3D3B J;  2YNI B;  3CJK B;  2DGX A;  3TUZ C;  5KFO A;  4Y2M A;  4ED8 A;  5HLF A;  4YQW A;  4IR1 A;  2XMJ A;  2VQE J;  1UW4 A;  3L09 A;  4RBV A;  1SI9 A;  3W9J A;  3M2V A;  2ILZ A;  1CJU A;  4K0K J;  2QN6 B;  3MFH A;  3ENQ A;  4PXC A;  4DR7 J;  1NM2 A;  4ZLP A;  3LTO A;  1FRH A;  4OYM A;  3BB5 A;  3BEG B;  1HBM A;  2IY5 B;  1AT1 B;  1N88 A;  3CDE A;  2G4B A;  1WHY A;  3CCS S;  4NCA A;  2E7W A;  3BBB A;  2ATC B;  3R1H A;  2QMW A;  1PBA A;  3UW1 A;  1NK9 A;  1RT1 B;  1HKA A;  2CPI A;  1W2B R;  3AT1 B;  2FVQ A;  5EHH A;  3G6V A;  3R5A A;  2GA7 A;  4USH A;  1MWY A;  4E2F B;  4DPW A;  4YS2 A;  2YX1 A;  4CH1 A;  4GVB B;  2DHS A;  4LF8 J;  4MKY A;  2X1A A;  4PG7 A;  1HBO A;  5KFQ A;  3IS9 A;  2I38 A;  2M88 A;  2UUC F;  1Q95 G;  2IRU A;  1Y5I B;  2I5J B;  1GEH A;  3RYL A;  4DPX A;  2EW9 A;  4F2R A;  3A3P B;  2QLB B;  4GMK A;  4IR9 A;  3H5U A;  1FRX A;  3DDN A;  1TEL A;  3RBX A;  1NJX A;  1VLY A;  3R6L B;  3SCK E;  3W2V B;  3DLK A;  2ADC A;  1H72 C;  2R2T A;  4EFA C;  4GKK J;  1FXL A;  1QAI A;  5HMW A;  1OWX A;  1F5C A;  2HNY B;  1JLB A;  1JLF A;  3VR1 A;  1OO0 B;  1FE0 A;  4JV1 A;  1OMS A;  4N76 A;  3TA2 A;  4UOG A;  2CQ1 A;  5F8H A;  5HVF A;  5KT5 A;  1NKE A;  5EWE A;  3J80 U;  1N5T A;  4LRC A;  3GYX B;  1QAY A;  3N79 A;  3T3F A;  3EVM A;  4AXJ A;  1KFD A;  5D4N A;  4WJB A;  2IDL A;  2WVC A;  3BYP A;  4DR5 J;  3T5J A;  2IVF B;  2HVZ A;  2W7P A;  2WHO A;  2KYX A;  4ZIT A;  1E6V B;  2QSW A;  1TQL A;  4DG1 A;  2WON A;  4H4K C;  5F41 A;  1CC7 A;  4NEY A;  4ECW A;  2YX7 A;  1MU2 A;  4QWB A;  3CDB A;  4QWE A;  2DGW A;  2NXU A;  1WKJ A;  3HT3 A;  3MEG A;  2VBX A;  1HWJ A;  4BBY A;  3NMA A;  1RA6 A;  1U09 A;  2N4C A;  3M1V B;  2VF3 A;  3AQO A;  2C2M B;  2W4P A;  3VAH A;  2FLN A;  1VQ9 S;  2AJ0 A;  2Z0G A;  5KFZ A;  5KFP A;  3ISZ A;  1NHV A;  4Q43 A;  2CQ0 A;  4Y65 A;  1VHI A;  4Q8E A;  5KG0 A;  1S9E B;  3DFE A;  1TU0 B;  4QIF A;  4UW2 A;  2IFX A;  4LSL A;  4RX6 A;  1FKO B;  4JBC A;  1URR A;  2ZBR A;  2YH1 A;  1NJY A;  2XS5 A;  2B56 A;  4TLQ A;  4P9S A;  5DG9 A;  3CJT A;  1NSQ A;  3VTI A;  2VU5 A;  2RVJ A;  4K4W A;  2HHH F;  3C3L A;  4LF5 J;  1RAC B;  1YWX A;  1IQT A;  5D4O A;  5K8P A;  2JDJ A;  2ASL A;  3D6T B;  3BN7 A;  1QSY A;  1H98 A;  2J7W A;  3IXQ A;  3HFK A;  3HZG A;  3RB6 A;  1JJ2 R;  3TJ8 A;  4ZVR B;  1JQG A;  2ZWP A;  2W4D A;  1B0P A;  2AX0 A;  1RWV B;  1U1P A;  5KG2 A;  2QA4 S;  4PQU B;  1MN9 A;  4NZ7 A;  3SV3 A;  1ITP A;  3FSI A;  2W1B A;  2D41 A;  4R5P B;  4Q0B A;  5KFC A;  3N01 A;  1HHS A;  3OL8 A;  1PJ6 A;  3WDO A;  1NXI A;  1N36 F;  4X4U A;  5FDL A;  4JI8 J;  5IM0 B;  2V5H G;  3ILO A;  2AP6 A;  3UDE A;  1VMB A;  4OJG A;  2B8P A;  4NLU A;  3R5D A;  2W9B A;  1ZTT A;  5BYQ A;  3C16 B;  5A0Y A;  4NYZ A;  2XWX A;  2V4R A;  4K4T A;  1T9Y A;  2MSS A;  1EQ0 A;  5J2M A;  4V19 X;  3T9N A;  1FK9 A;  2F8H A;  3MMB A;  3ZTQ A;  4EI2 A;  4FVM A;  5E0O A;  1RWW B;  2AJ4 A;  5ETP A;  3M6U A;  4IYQ A;  1I94 F;  1Y11 A;  4C11 A;  3JTN A;  3QT5 A;  2UUA F;  2MXY A;  1RWO B;  2CAD A;  3NAI A;  1S1T B;  5KT2 A;  5K9F A;  3CXC R;  1RUS A;  1RAB B;  5HQM A;  1XMQ F;  4YOE A;  2PFD A;  1HW9 A;  3MUV P;  1X4D A;  3DKD A;  1MMD A;  5DG8 A;  2DNQ A;  1KON A;  1U2C A;  2OSR A;  2F9J A;  3LH2 S;  1MG7 A;  3UWT A;  2R7S A;  2GFF A;  2HIY A;  5J2Q A;  1JK9 B;  4Y00 A;  1SUQ A;  1UVJ A;  1F5B A;  1S57 A;  4H4K A;  3N28 A;  1HHT P;  4R25 A;  2HS0 A;  1EAY C;  2JX2 A;  5E3Q A;  4JI6 F;  2UUB F;  2DIV A;  3F73 A;  2QMU B;  2ZE2 B;  4B3T J;  9ATC B;  1X9W A;  3ZZP A;  2H5J B;  6FDR A;  3QGG A;  4WZM A;  2DCL A;  1S76 D;  2XBP A;  4DU8 A;  2RRN A;  1NK0 A;  3K5O A;  3OFF A;  4X4T A;  2G2Z A;  3MMA A;  4K7Q A;  3TUJ C;  2DCU B;  3H7H B;  2UP1 A;  2V9W A;  2Q3P A;  2ZZN A;  1RT2 A;  4DLE A;  4ZPA A;  3D3C J;  2UUW A;  3M9O B;  2ZBC A;  4D3G A;  4MKV A;  3OFE A;  2WB4 A;  4QIV A;  1TV6 A;  2PII A;  3PEJ A;  3KYL A;  1NPK A;  3GCW P;  2E5L F;  1VBK A;  3VGS A;  1T0T V;  2PI4 A;  4NEZ A;  2BJ8 A;  5HN0 A;  3MM7 A;  1TP7 A;  4ED4 A;  3NGS A;  4BDP A;  3NP5 A;  2W7A A;  1IKX B;  4HR2 A;  1KEK A;  3J80 Y;  3UN3 A;  3E8O A;  3BDE A;  3OR2 B;  4ZP8 A;  2C2E A;  4DQQ A;  2M4M A;  4KGZ B;  1SJ1 A;  2CG4 A;  1RQ0 A;  1T3N A;  1PYS B;  3P96 A;  2WOM B;  4OX6 A;  2LQ9 A;  2DEI A;  1CUL A;  2OGU A;  2RH3 A;  1NB2 A;  2HHT A;  5J2P B;  3ET6 A;  2WBR A;  1WOO A;  2XMK A;  2E1P A;  2V67 A;  5FLX Y;  1JLA A;  3T6B A;  4ZK7 M;  1N33 F;  2LEP A;  3FDS A;  2IC3 A;  3WX8 A;  2R9L A;  4HKQ A;  4AYB D;  4B9L A;  5KG5 A;  3R5G A;  1AUD A;  1NDK A;  2ZC3 A;  3PV8 A;  2RQ4 A;  3H5S A;  3OHB A;  3WIV A;  2B6A A;  4LSN B;  4YR2 A;  3QSY B;  2N7C A;  5E3R A;  1H3D A;  4ES2 A;  4KGX B;  4CIO A;  2PE8 A;  3IR6 B;  3NNC A;  2GHV C;  1C1B B;  4OI4 A;  3GIL A;  4LF7 F;  4CDI A;  4J91 A;  1ICE B;  2V4J B;  5A2Q U;  3W63 A;  2RAQ A;  3MDF A;  4M5J A;  5ETQ A;  1M1K T;  3FCW A;  2KT5 A;  2R42 A;  4X4V A;  1TL3 A;  4OZL A;  3GG1 A;  4A8O A;  4DV1 F;  3TOQ A;  3Q86 A;  1GMW D;  3FKB A;  3TUI C;  4ANE A;  1EET B;  2XG8 A;  4DV0 F;  1G1X A;  3H0P A;  3V81 B;  1LNQ A;  5KOX A;  3O2I A;  1YRX A;  1PYT A;  3DXS X;  1Y3J A;  4CI0 B;  3IAM 9;  3VZI A;  2R2U A;  2KYZ A;  3BGR A;  2C2O B;  3I0S A;  3PTW A;  3T9Z A;  1LWC A;  2Z56 B;  5M2P A;  2CJX B;  2NLW A;  2IM3 A;  1X5O A;  2W24 A;  2YKN B;  1IKW B;  3DNC A;  4C8N A;  2FJD B;  1HR0 F;  1GQE A;  4ICL A;  1JLC B;  1Y5L B;  1D9D A;  3I0R B;  7AT1 B;  4OYP A;  4RLE A;  2KG1 A;  1ZH5 A;  2RQM A;  1HNV A;  3IBW A;  3CED A;  1SV5 B;  2R7W A;  1UVI A;  3Q89 A;  5AXN A;  3M2R A;  4X64 J;  2F8E X;  2AYB A;  1SJ4 P;  3TA1 A;  5IT0 A;  1A9N B;  4F36 A;  5B0C A;  4TLR A;  4F4Z A;  4ZA1 A;  3FQK A;  1ZTW A;  3CJ2 A;  2ADB A;  2G0C A;  2QA2 A;  2AW0 A;  3GV5 B;  1TK0 A;  3QZ7 A;  4QYZ K;  5KFV A;  2CAJ A;  1H2T Z;  2DGS A;  5HSP A;  1U24 A;  2A10 A;  3NS5 A;  2F40 A;  1VRU B;  3QJJ A;  2KJV A;  3D54 A;  2GS8 A;  3KK1 B;  3PEH A;  3HKW A;  2DR8 A;  2SXL A;  3SV4 A;  4ZJO A;  4B9N A;  4ZPW R;  1BQN B;  2IA6 A;  5D0E A;  1WAC A;  4QPX A;  2XMT A;  3FEX B;  3CUN A;  1LV5 A;  2X1F A;  4B3S J;  1QAX A;  1WI8 A;  2G9O A;  4JOU A;  1LOU A;  3OLB A;  4P71 A;  2J6S A;  3G8S A;  4DN0 A;  4B3O B;  4LQ3 A;  4JI3 F;  3QT6 A;  3UDC A;  1FWL A;  1ACM B;  3FBF A;  2D9O A;  3W60 A;  1RK8 A;  5KG3 A;  3MM9 A;  1T9U A;  2EXU A;  1FTR A;  1S72 S;  2I2Y A;  3CNQ P;  1SL2 A;  3LF0 A;  3ILL A;  1AYE A;  5CYM B;  1YBA A;  5K20 B;  3ZZT A;  3SCJ E;  2UXC J;  2R8K A;  2Q6C A;  4RW7 B;  4G1Q A;  3LO3 A;  5D3G A;  2VBW A;  3VF0 B;  2XHW A;  1LQ9 A;  2E1C A;  2WVF A;  3LAK A;  4TQR A;  3D6M B; 
#chains in the Genus database with same CATH homology
 1RHR B;  1RWX B;  2H5J B;  2HBZ B;  2HBQ B;  4ZVP B;  1IBC B;  1RHJ B;  2H4W B;  2H5I B;  4JB8 B;  3R7B B;  2P2C B;  2H54 B;  3R5J B;  3P45 B;  2QL7 B;  1RWN B;  4DCO B;  2XYG B;  2C2O B;  2CNL B;  3GJR B;  2QLB B;  2CNN B;  1RWW B;  4ZVQ B;  1QTN B;  2CJX B;  2XZT B;  3P4U B;  2C1E B;  4DCP B;  2QL9 B;  2HBR B;  1RHK B;  2Y0B B;  4ZVR B;  2XYH B;  1RWO B;  3R6L B;  1PAU B;  1RWV B;  2HBY B;  2CDR B;  1PYO B;  2C2M B;  1SC1 B;  2C2K B;  3NS7 B;  2CNO B;  1F9E B;  2FQQ B;  3R6G B;  3GJS B;  1I51 B;  1NME B;  5IC6 B;  2QLF B;  5IC4 B;  1GFW B;  1SC4 B;  3D6H B;  1SC3 B;  2XZD B;  2C2Z B;  1QDU B;  3KJN B;  3D6F B;  3R7N B;  3R7S B;  3SIP B;  2Y1L B;  2CNK B;  3KJQ B;  1ICE B;  2QL5 B;  3RJM B;  3GJQ B;  1RWK B;  3EDQ B;  1I3O B;  2H4Y B;  1RHU B;  1RE1 B;  3EDR B;  4ZVS B;  3GJT B;  1RWM B;  5K20 B;  4ZVT B;  1RHM B;  3IBC B;  4LSZ B;  3IBF B;  3KJF B;  2H48 B;  4DCJ B;  2DKO B;  1RHQ B;  3QNW B;  4ZVU B;  2H51 B;  2H65 B;  2XYP B;  1RWP B;  2CJY B;  3D6M B;  1BMQ B;  2QLJ B;  4ZVO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...