1QUBA

Crystal structure of the glycosylated five-domain human beta2-glycoprotein i purified from blood plasma
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
319
structure length
319
Chain Sequence
GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHTDASDVKPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (human beta2-Glycoprotein I)
publication title Adhesion mechanism of human beta(2)-glycoprotein I to phospholipids based on its crystal structure.
pubmed doi rcsb
molecule tags Membrane adhesion
total genus 53
structure length 319
sequence length 319
ec nomenclature
pdb deposition date 1999-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF09014 Sushi_2 Beta-2-glycoprotein-1 fifth domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1qubA04
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1qubA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1qubA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1qubA03
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1qubA05
4A5WB 2W80A 3TVJA 2RL0A 3EJHA 3MQLA 1SS2A 4B2SA 1OJYA 1G4FA 1OK9A 1QO6A 2EHFA 2UWNA 4AYEA 3ZRZA 3M7PA 3SW0X 1TPGA 3OXUD 3IX0A 2V8EA 4PZ5A 4AYDA 2RKYA 5I0QB 1SRZA 1OJVA 3OP8A 4ONTD 2EC3A 2A55A 4LOTA 2WIIC 3ERBA 1OJWA 3KXVA 4AYMA 4B2RA 3NFPI 2KMSA 1PPQA 1H2QP 1CKLA 5FO8C 4CSYA 4AYIA 1MD7A 4K12A 3INBC 3L89M 3CALA 1ZJKA 1QGBA 3ZD1A 1O9AA 1QUBA 2XRDA 1H2PP 3O8EB 1GKGA 1HFIA 4KKDA 1H03P 2O39C 1HCCA 2B5ID 2CG6A 1LY2A 2XWJI 2W81A 1U5MA 3GXEA 2XRBA 2ERJA 3R62A 1H04P 4J38B 4WJG2 1TPNA 1VVDA 2CG7A 1E5GA 1G4GA 2JGXA 1E88A 2YBYA 1TPMA 4MUCA 1UOTP 1OK3A 3GOVA 2XWBF 3T5OA 1OK1A 5HZPB 3IU3I 3OEDC 5JPMG 1Z92B 1VVCA 4FXGG 4C16A 5HYPA 4LOSA 2BZMA 2YRAA 2CKUA 2RKZA 3KZJA 2MCYA 1GHQB 3ZD2A 4DJZA 2JRAA 3RJ3D 2LOJA 4JHSA 5HYUB 2KRIA 1E8BA 2RLQA 1ELVA 2G7IA 1HFHA 1Q3XA 2XQWC 2RLPA 4ZH1D 1GKNA 2QY0A 1GPZA 1NWVA 1C1ZA 2MCZA 1OK2A 1FBRA 4YNXA 2IZ4A 4IGDA 1MD8A 5HYTB 2JGWA 4F4OC 2IZ3A
chains in the Genus database with same CATH superfamily
3ZLDA 4A5WB 2W80A 3F6KA 3TVJA 2RL0A 2Y8SA 3EJHA 3MQLA 1SS2A 5DN5A 3WSYA 1OJYA 4B2SA 1OK9A 1G4FA 1QO6A 2EHFA 2UWNA 4AYEA 3ZRZA 3M7PA 3SW0X 1TPGA 3OXUD 3IX0A 2V8EA 4PZ5A 4AYDA 2RKYA 5I0QB 1SRZA 4PO7A 1OJVA 3ZLEA 3OP8A 4ONTD 2EC3A 2A55A 4LOTA 4YIZA 2WIIC 3ERBA 1OJWA 3KXVA 4AYMA 4B2RA 3NFPI 2KMSA 1PPQA 1H2QP 5DN4A 1CKLA 5FO8C 4CSYA 4APLA 4AYIA 1MD7A 4K12A 3INBC 3L89M 3CALA 1ZJKA 1QGBA 4BWCA 3ZD1A 1O9AA 1QUBA 2XRDA 1H2PP 3O8EB 1GKGA 1HFIA 4KKDA 1H03P 2O39C 1HCCA 2B5ID 2CG6A 3FGTA 1LY2A 2XWJI 3VWOA 2W81A 1U5MA 3GXEA 2XRBA 2ERJA 3R62A 1H04P 4J38B 4WJG2 1TPNA 3K3TA 1VVDA 2I2LA 2CG7A 1E5GA 1G4GA 2JGXA 3NJAA 1E88A 2YBYA 1TPMA 4MUCA 1UOTP 3FGRA 1OK3A 2Y8RA 3GOVA 2XWBF 4N7EA 2ZYCA 3T5OA 1OK1A 5HZPB 3IU3I 3OEDC 5JPMG 1Z92B 1VVCA 4FXGG 4MSLA 4C16A 1RLHA 5HYPA 4LOSA 2BZMA 2YRAA 2CKUA 2RKZA 3KZJA 2MCYA 1GHQB 3ZD2A 4DJZA 2JRAA 3RJ3D 2LOJA 2X2ZA 4JHSA 5HYUB 2KRIA 3WSXA 1E8BA 2RLQA 1ELVA 2G7IA 1HFHA 1Q3XA 2XQWC 2RLPA 3CI0J 4ZH1D 1GKNA 2QY0A 1GPZA 1NWVA 1C1ZA 2MCZA 1OK2A 1FBRA 4YNXA 2IZ4A 2Y8TA 1MD8A 4IGDA 2JGWA 5HYTB 4F4OC 2IZ3A
chains in the Genus database with same CATH topology
4A5WB 2W80A 3TVJA 2RL0A 3EJHA 3MQLA 1SS2A 4B2SA 1OJYA 1G4FA 1OK9A 1QO6A 2EHFA 2UWNA 4AYEA 3ZRZA 3M7PA 3SW0X 1TPGA 3OXUD 3IX0A 2V8EA 4PZ5A 4AYDA 2RKYA 5I0QB 1SRZA 1OJVA 3OP8A 4ONTD 2EC3A 2A55A 4LOTA 2WIIC 3ERBA 1OJWA 3KXVA 4AYMA 4B2RA 3NFPI 2KMSA 1PPQA 1H2QP 1CKLA 5FO8C 4CSYA 4AYIA 1MD7A 4K12A 3INBC 3L89M 3CALA 1ZJKA 1QGBA 3ZD1A 1O9AA 1QUBA 2XRDA 1H2PP 3O8EB 1GKGA 1HFIA 4KKDA 1H03P 2O39C 1HCCA 2B5ID 2CG6A 1LY2A 2XWJI 2W81A 1U5MA 3GXEA 2XRBA 2ERJA 3R62A 1H04P 4J38B 4WJG2 1TPNA 1VVDA 2CG7A 1E5GA 1G4GA 2JGXA 1E88A 2YBYA 1TPMA 4MUCA 1UOTP 1OK3A 3GOVA 2XWBF 3T5OA 1OK1A 5HZPB 3IU3I 3OEDC 5JPMG 1Z92B 1VVCA 4FXGG 4C16A 5HYPA 4LOSA 2BZMA 2YRAA 2CKUA 2RKZA 3KZJA 2MCYA 1GHQB 3ZD2A 4DJZA 2JRAA 3RJ3D 2LOJA 4JHSA 5HYUB 2KRIA 1E8BA 2RLQA 1ELVA 2G7IA 1HFHA 1Q3XA 2XQWC 2RLPA 4ZH1D 1GKNA 2QY0A 1GPZA 1NWVA 1C1ZA 2MCZA 1OK2A 1FBRA 4YNXA 2IZ4A 4IGDA 1MD8A 5HYTB 2JGWA 4F4OC 2IZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A5W B;  2W80 A;  3TVJ A;  2RL0 A;  3EJH A;  3MQL A;  1SS2 A;  4B2S A;  1OJY A;  1G4F A;  1OK9 A;  1QO6 A;  2EHF A;  2UWN A;  4AYE A;  3ZRZ A;  3M7P A;  3SW0 X;  1TPG A;  3OXU D;  3IX0 A;  2V8E A;  4PZ5 A;  4AYD A;  2RKY A;  5I0Q B;  1SRZ A;  1OJV A;  3OP8 A;  4ONT D;  2EC3 A;  2A55 A;  4LOT A;  2WII C;  3ERB A;  1OJW A;  3KXV A;  4AYM A;  4B2R A;  3NFP I;  2KMS A;  1PPQ A;  1H2Q P;  1CKL A;  5FO8 C;  4CSY A;  4AYI A;  1MD7 A;  4K12 A;  3INB C;  3L89 M;  3CAL A;  1ZJK A;  1QGB A;  3ZD1 A;  1O9A A;  1QUB A;  2XRD A;  1H2P P;  3O8E B;  1GKG A;  1HFI A;  4KKD A;  1H03 P;  2O39 C;  1HCC A;  2B5I D;  2CG6 A;  1LY2 A;  2XWJ I;  2W81 A;  1U5M A;  3GXE A;  2XRB A;  2ERJ A;  3R62 A;  1H04 P;  4J38 B;  4WJG 2;  1TPN A;  1VVD A;  2CG7 A;  1E5G A;  1G4G A;  2JGX A;  1E88 A;  2YBY A;  1TPM A;  4MUC A;  1UOT P;  1OK3 A;  3GOV A;  2XWB F;  3T5O A;  1OK1 A;  5HZP B;  3IU3 I;  3OED C;  5JPM G;  1Z92 B;  1VVC A;  4FXG G;  4C16 A;  5HYP A;  4LOS A;  2BZM A;  2YRA A;  2CKU A;  2RKZ A;  3KZJ A;  2MCY A;  1GHQ B;  3ZD2 A;  4DJZ A;  2JRA A;  3RJ3 D;  2LOJ A;  4JHS A;  5HYU B;  2KRI A;  1E8B A;  2RLQ A;  1ELV A;  2G7I A;  1HFH A;  1Q3X A;  2XQW C;  2RLP A;  4ZH1 D;  1GKN A;  2QY0 A;  1GPZ A;  1NWV A;  1C1Z A;  2MCZ A;  1OK2 A;  1FBR A;  4YNX A;  2IZ4 A;  4IGD A;  1MD8 A;  5HYT B;  2JGW A;  4F4O C;  2IZ3 A; 
#chains in the Genus database with same CATH topology
 3ZLD A;  4A5W B;  2W80 A;  3F6K A;  3TVJ A;  2RL0 A;  2Y8S A;  3EJH A;  3MQL A;  1SS2 A;  5DN5 A;  3WSY A;  1OJY A;  4B2S A;  1OK9 A;  1G4F A;  1QO6 A;  2EHF A;  2UWN A;  4AYE A;  3ZRZ A;  3M7P A;  3SW0 X;  1TPG A;  3OXU D;  3IX0 A;  2V8E A;  4PZ5 A;  4AYD A;  2RKY A;  5I0Q B;  1SRZ A;  4PO7 A;  1OJV A;  3ZLE A;  3OP8 A;  4ONT D;  2EC3 A;  2A55 A;  4LOT A;  4YIZ A;  2WII C;  3ERB A;  1OJW A;  3KXV A;  4AYM A;  4B2R A;  3NFP I;  2KMS A;  1PPQ A;  1H2Q P;  5DN4 A;  1CKL A;  5FO8 C;  4CSY A;  4APL A;  4AYI A;  1MD7 A;  4K12 A;  3INB C;  3L89 M;  3CAL A;  1ZJK A;  1QGB A;  4BWC A;  3ZD1 A;  1O9A A;  1QUB A;  2XRD A;  1H2P P;  3O8E B;  1GKG A;  1HFI A;  4KKD A;  1H03 P;  2O39 C;  1HCC A;  2B5I D;  2CG6 A;  3FGT A;  1LY2 A;  2XWJ I;  3VWO A;  2W81 A;  1U5M A;  3GXE A;  2XRB A;  2ERJ A;  3R62 A;  1H04 P;  4J38 B;  4WJG 2;  1TPN A;  3K3T A;  1VVD A;  2I2L A;  2CG7 A;  1E5G A;  1G4G A;  2JGX A;  3NJA A;  1E88 A;  2YBY A;  1TPM A;  4MUC A;  1UOT P;  3FGR A;  1OK3 A;  2Y8R A;  3GOV A;  2XWB F;  4N7E A;  2ZYC A;  3T5O A;  1OK1 A;  5HZP B;  3IU3 I;  3OED C;  5JPM G;  1Z92 B;  1VVC A;  4FXG G;  4MSL A;  4C16 A;  1RLH A;  5HYP A;  4LOS A;  2BZM A;  2YRA A;  2CKU A;  2RKZ A;  3KZJ A;  2MCY A;  1GHQ B;  3ZD2 A;  4DJZ A;  2JRA A;  3RJ3 D;  2LOJ A;  2X2Z A;  4JHS A;  5HYU B;  2KRI A;  3WSX A;  1E8B A;  2RLQ A;  1ELV A;  2G7I A;  1HFH A;  1Q3X A;  2XQW C;  2RLP A;  3CI0 J;  4ZH1 D;  1GKN A;  2QY0 A;  1GPZ A;  1NWV A;  1C1Z A;  2MCZ A;  1OK2 A;  1FBR A;  4YNX A;  2IZ4 A;  2Y8T A;  1MD8 A;  4IGD A;  2JGW A;  5HYT B;  4F4O C;  2IZ3 A; 
#chains in the Genus database with same CATH homology
 4A5W B;  2W80 A;  3TVJ A;  2RL0 A;  3EJH A;  3MQL A;  1SS2 A;  4B2S A;  1OJY A;  1G4F A;  1OK9 A;  1QO6 A;  2EHF A;  2UWN A;  4AYE A;  3ZRZ A;  3M7P A;  3SW0 X;  1TPG A;  3OXU D;  3IX0 A;  2V8E A;  4PZ5 A;  4AYD A;  2RKY A;  5I0Q B;  1SRZ A;  1OJV A;  3OP8 A;  4ONT D;  2EC3 A;  2A55 A;  4LOT A;  2WII C;  3ERB A;  1OJW A;  3KXV A;  4AYM A;  4B2R A;  3NFP I;  2KMS A;  1PPQ A;  1H2Q P;  1CKL A;  5FO8 C;  4CSY A;  4AYI A;  1MD7 A;  4K12 A;  3INB C;  3L89 M;  3CAL A;  1ZJK A;  1QGB A;  3ZD1 A;  1O9A A;  1QUB A;  2XRD A;  1H2P P;  3O8E B;  1GKG A;  1HFI A;  4KKD A;  1H03 P;  2O39 C;  1HCC A;  2B5I D;  2CG6 A;  1LY2 A;  2XWJ I;  2W81 A;  1U5M A;  3GXE A;  2XRB A;  2ERJ A;  3R62 A;  1H04 P;  4J38 B;  4WJG 2;  1TPN A;  1VVD A;  2CG7 A;  1E5G A;  1G4G A;  2JGX A;  1E88 A;  2YBY A;  1TPM A;  4MUC A;  1UOT P;  1OK3 A;  3GOV A;  2XWB F;  3T5O A;  1OK1 A;  5HZP B;  3IU3 I;  3OED C;  5JPM G;  1Z92 B;  1VVC A;  4FXG G;  4C16 A;  5HYP A;  4LOS A;  2BZM A;  2YRA A;  2CKU A;  2RKZ A;  3KZJ A;  2MCY A;  1GHQ B;  3ZD2 A;  4DJZ A;  2JRA A;  3RJ3 D;  2LOJ A;  4JHS A;  5HYU B;  2KRI A;  1E8B A;  2RLQ A;  1ELV A;  2G7I A;  1HFH A;  1Q3X A;  2XQW C;  2RLP A;  4ZH1 D;  1GKN A;  2QY0 A;  1GPZ A;  1NWV A;  1C1Z A;  2MCZ A;  1OK2 A;  1FBR A;  4YNX A;  2IZ4 A;  4IGD A;  1MD8 A;  5HYT B;  2JGW A;  4F4O C;  2IZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...