1QUMA

Crystal structure of escherichia coli endonuclease iv in complex with damaged dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the DNA repair enzyme endonuclease IV and its DNA complex: double-nucleotide flipping at abasic sites and three-metal-ion catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords 5'-D(*CP*GP*TP*CP*C)-3'
total genus 105
structure length 279
sequence length 279
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 1999-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1qumA00
4Q7IA 1XLJA 1YX1A 2NQHA 4ZB0A 4YTUA 3BWWA 3BDKA 4HHLA 4OVXA 4PGLA 5EMLA 1XYBA 4YTRA 1XYAA 3BZGA 3NGFA 4HHMA 3U3HA 3VNIA 6XIMA 2NQ9A 1XIBA 2QUMA 3ITOA 4PFHA 4ZB2A 2X7VA 2HCVA 4EACA 2GLKA 1XIMA 2I56A 2QULA 3M0VA 3KBWA 3P14A 2GUBA 3UU0A 4HGXA 1A0CA 3GNXA 5AVHA 2I57A 3VNLA 4DVOA 1GW9A 1CLKA 4GQBA 3BZJA 4QE5A 4HNOA 1BXCA 3TC3A 1K77A 1XLHA 3QC0A 5H6HA 6XIAA 3M0YA 4E3VA 3FVMA 3KCLA 2QW5A 2OU4A 3C0QA 3QZAA 1XYCA 3N4AA 4XISA 3KCOA 4LNCA 4EAYA 1XLLA 1XP3A 4J4KA 4K1GA 1DIEA 2G4JA 3L23A 4DUOA 2XISA 4YTQA 1MNZA 3KBMA 4X61A 1XLGA 2Q02A 5AVNA 3XISA 4US6A 1XLMA 1XLFA 3AYVA 1XIJA 5B7ZA 1XLAA 5XIAA 5B7YA 1XICA 1XIEA 5J8LA 3VNJA 3BANA 3ITYA 1XYLA 4A8IA 3P6LA 4A8NA 4GJIA 4GLEA 1D8WA 3CQIA 1XIGA 4QE1A 3UA4A 4QEHA 4QDWA 3VNKA 4A8LA 1S5MA 4XKMA 1DE5A 1OADA 1I60A 4QE4A 3CQJA 5EMKA 1XLDA 3VYLA 2ZDSA 8XIMA 1XLBA 3M0LA 4X63A 4W4QA 3AYTA 3KWSA 3IUIA 3KBSA 1A0EA 2XINA 8XIAA 1DIDA 1XLIA 1XLKA 4QEEA 5EMMA 5B80A 1MUWA 1QUMA 1DE6A 3U0HA 3AAMA 4XSLA 1XINA 3UXIA 3XIMA 3ITTA 4GJJA 4X60A 3CQKA 4XSMA 3UVAA 4KW2A 3C0SA 4XIAA 3CQHA 3ITXA 2J6VA 3M0XA 2XIMA 4YTSA 3ITLA 3KCJA 1QT1A 9XIAA 4XIMA 3KBJA 9XIMA 5I7GA 1O1HA 1A0DA 1TZ9A 7XIMA 2GVEA 3M0MA 2GYIA 4QDPA 3TVAA 3WQOA 5XIMA 5C9ZA 3AALA 5EMJA 3VNMA 4YTTA 3ITVA 5TNVA 1XIIA 2ZVRA 2NQJA 3C0LA 3JU2A 1S5NA 2G0WA 1XISA 3IUHA 3CNYA 1XIHA 3KBVA 1QTWA 2HK0A 3QXBA 3UA3A 3XINA 4G56A 3DBNA 3KBNA 1XLCA 3KTCA 4K3ZA 1I6NA 2QUNA 1XLEA 3OBEA 1XIFA 1DXIA 1XIDA 3LMZA 1XYMA 3DX5A 4A8RA 3M0HA 4ZBCA 5XINA 1BXBA 3CWHA 3IUDA 2X7WA 2HK1A 4ZB5A 5FA5A 3QYSA 5H1WA
chains in the Genus database with same CATH superfamily
3QJAA 2ICSA 1IEXA 5GQBA 2NQ9A 1FKWA 2Y8UA 1WDPA 4W7UA 4OV9A 5AYZA 1OY0A 1VEOA 4QP0A 3AXHA 1Q8JA 3ZT6A 4AZGA 1WP6A 4JTJA 5FOOA 3GG8A 5HJYA 2B4GA 2H9AA 1HTIA 3WQDA 2GK1A 3THUA 4AD4A 5LGXA 1W3LA 4H8HA 1XP3A 1UW9A 5EY5A 1V0KA 3N17A 4DI9A 2PLKA 2E0PA 1V6YA 4EPDC 5BNKA 4LBSA 2Z6JA 3S2JA 4JS3A 4LNYA 2X0YA 3SCSA 3GFXA 1TVLA 1TMQA 4Q3MA 1FHDA 3V5OA 3MKCA 3UWWA 2ZFAA 2HXTA 2PGEA 1EO5A 3U2OA 1LL6A 5GNXA 1REQB 2VHLA 1J10A 3EB4A 1XGDA 2WHMA 3C52A 3TQKA 1BQCA 5BW6A 5M1TA 2WJEA 5M3WA 5C9ZA 4X3ZA 3NOYA 4LPCA 2BSLA 3STGA 5HJXA 2VYOA 3VC6A 2W3ZA 5EMYA 3HV9A 3VGHA 4D71A 2D3NA 3BCFA 4AQLA 4X0NA 1PX3A 4AZBA 4CQDA 3BV7A 3NFUA 3WQ8A 2PDHA 3NZ1A 4O8AA 1M7OA 4OVXA 1XYAA 5JVLA 2Q8ZA 4IQEA 1SO6A 1W1B1 3F2CA 3L0NA 3SUTA 4Q8OA 2I56A 3DFHA 1PV8A 4B2DD 4QE5A 2AAMA 1PWMA 1W3IA 3N14A 3GG7A 1OX5A 1KKRA 2WC4A 4QCFA 1AL7A 1W56A 5A6LA 5A69A 1AMKA 1LUCA 4PMZA 1PHWA 2Y89A 3P60A 2VDIA 3ATZA 4N9DA 2CHOA 4QNEA 2D24A 5CLWA 3M44A 1TE6A 3AHZA 3TSBA 3UEQA 4O1AA 3EMCA 1PWLA 4XAZA 4LEFA 5EBAA 5HR6A 7TIMA 2YA0A 3UXLA 4Z0JA 3S6OA 4QX4A 1QUMA 2YFOA 2V8ZA 4IGNA 5I23A 4N7QA 2YKKA 2R24A 4XTDA 3NQCA 1TFVA 3EDDA 3ABZA 3LHTA 4XUYA 3VUPA 3TAOA 1N55A 4KESA 2NQZA 3GVWA 2DV0A 1UMLA 1US2A 2XVPA 1JEZA 4LX4A 2ZOXA 2PLJA 1Q6OA 1VAHA 3M4HA 4B3KA 4XD3A 2XIOA 4QG8A 5AC7A 1VJIA 3I4EA 3PUEA 4MWAD 2PBGA 4JIIX 1XX1A 1UD6A 2PDLA 3UG8A 1BXNA 4FNSA 2OX4A 3SFWA 2DT0A 4OOUA 1KM4A 5CC3A 2VFGA 3W07A 3VNLA 1J18A 1BD0A 5A2AA 2F6KA 4WDTA 4L1XA 4LB4A 2F61A 4CUCA 3EEZA 3BOXA 4UTTC 2MANA 3MYOA 3H8AA 1AQMA 1XCXA 2AQWA 3WUGA 5AYBA 3WLQA 1KD0A 3WLTA 4JIPA 1OHLA 1UWQA 2J7EA 1A4LA 5HANA 5JUVA 4J3XA 4QDWA 3NPXA 4TV6A 4GXMA 3RMJA 3RYSA 2FH6A 4ADUA 2XFWA 3FEMA 2DFAA 1UD5A 3CUHA 3IACA 3G1AA 3TTSA 3JRKA 1KTCA 3FSTA 3NZPA 4MB3A 2IW0A 3EYPA 4PE8A 5HATA 3UWZA 1VBHA 5A94A 1DP0A 2YL6A 1EXBA 1LTDA 1WNOA 3UPBA 4O15A 1QW7A 3G22A 3U7BA 2NWRA 4W85A 2WK2A 4IFRA 1XUUA 4BQ5A 4MKSA 1B9ZA 2FZBA 1VJZA 3WLMA 3C8NA 2VR2A 3HG3A 2ZX9A 1OFRA 4K3ZA 3TTQA 1XC6A 4FLSA 3D6NA 3BICA 3D0CA 5I09A 5KMYA 4GISA 4DZ5A 1QNQA 4UOJA 4IL2A 1CLVA 1DQXA 3OQ8A 4ZZ9A 1U2YA 4J1OA 4HD5A 1Q2RA 5I24A 3G18A 4NL1A 4HA4A 2LLEA 4JTFA 4FP1A 4LAZA 4CD4A 1UPMB 5I3FA 2D23A 2ATMA 3I68A 3UR7A 4Q4KA 4EPKA 3BMWA 1Q6DA 1RH9A 4O52A 1KBIA 4QJ3B 3AWNA 1NF7A 4UCFA 4KEVA 4NRRA 4IH3A 4B5WA 3VA8A 3VGFA 3LRKA 2E28A 3V18A 3C6CA 2E8ZA 1MW3A 4WIWA 4LC8A 3RU6A 4W5UA 1IYXA 2XWEA 1IXQA 1BSIA 3VX1A 4JFVA 3L2MA 3UBPC 2V63A 3SFKA 4Z2GA 1DE6A 1PIIA 3HTWA 2BTMA 5D02A 4HNVA 1V6WA 4Q4PA 3PHAA 2V30A 2OLAA 3R79A 4U31A 2BGSA 4UTWA 2R1LA 9XIMA 4F79A 7XIMA 4QDPA 3DFSA 3RM8A 1B90A 3MI2A 4OBTA 1KXQA 3P74A 5KZEA 3R1ZA 4HTBA 2XSXA 4I8DA 3ARZA 4GGBA 3O6YX 4DO5A 4LF2A 4WQ6A 4G8TA 5D33A 3BQ6A 1VYSX 1QHZA 2ZZ5A 3ZVHA 2ISDA 4DZAA 1T0OA 5AYIA 1QI4A 3IJLA 1TUXA 4MY1A 3GHUA 1DXFA 4JTRA 3UJEA 3NJ3A 4GY1A 3GNXA 1WXZA 3R2GA 1Z7AA 2VD9A 3B8SA 4GUJA 2OR2A 4FI4A 4XD5A 4UMCA 3NVTA 2EQDA 4LNCA 1NDYA 3TMQA 1W9VA 1W5PA 3NZGA 1Z69A 3AS3A 1BWKA 4U33A 4CQAA 1SM9A 2RDWA 3FA3A 3QLLA 4LS2A 1S38A 1JNDA 4FXSA 4Z42C 2ZZ6A 2PUZA 2W27A 1E5NA 1E6XM 5G2HA 1WAWA 5GJNA 3OVRA 1YTDA 1PE1A 2P10A 5EMMA 3MTWA 2GQ8A 5FAGA 4C6KA 2NQLA 1LT8A 4GI6A 5BXPA 1XDLA 4IJRA 3WELA 4AZCA 4MNLA 3HPAA 3B40A 3QGKC 3SN0A 3K5XA 4JHOA 2CXGA 3E2RA 3NO3A 3BARA 3NDOA 1QTWA 1UD3A 1UPPA 3SN4A 5LIWX 1ZHAA 3KTCA 4YU1A 4IWWA 4H41A 3PZTA 2YJQA 3MMWA 3FXYA 4LV9A 2ACUA 4JX5A 1OZMA 4C1NB 1PKMA 3B9DA 1FWGC 3OODA 3EX6A 4ICNA 4MLJA 1HGYA 2V67A 2PLMA 4OUIA 4LS0A 1XF0A 3W7RA 3OLEA 2FLIA 2ADAA 3FDGA 1IWBA 3E2QA 1UZHA 2ZQ0A 2EJ1A 2FMNA 3DFNA 1ZBWA 2TRSA 3Q67A 3SUUA 1CECA 5RUBA 3V0TA 3NA8A 3GW3A 2G3JA 4O17A 2WSRA 1LLWA 5AVNA 1ZP4A 4PUEA 5GJMA 3TYUA 2PDNA 1SQ7A 3IIPA 3BAJA 1HJSA 1HVXA 2X30A 5HK4A 4PMVA 3FA4A 4NXSA 4RNIA 1MW1A 4MZ1A 3PVFA 3AXIA 1GUVA 3U0HA 4C1NA 4ASTA 2VT0A 1B3ZA 2QJNA 1QPKA 4NAEB 3W84A 3RM9A 3ITXA 1Z44A 2A2IA 1XRSA 1BGAA 3R7MA 3G1SA 1MRQA 4ZQOA 2XSBA 2UBPC 4CQCA 1P0NA 4GKTA 4HMEA 4JCLA 1W9PA 5E6ZA 1IGSA 1KM3A 1POKA 3K46A 5D30A 1TREA 1IZKA 3GDKA 3PWGA 5DMMA 4Y96A 1XIFA 3PG8A 1QPQA 5G1YA 4UTHA 3RAOA 3L4YA 2QPUA 1H0IA 1B31A 1SJCA 2X7VA 3MSRA 4MJ2A 4FIRA 4QG9A 3W70A 2DP3A 3W1UA 1PYMA 4PN2A 4PB4A 2VEFA 5H6HA 4XUGA 2PZ0A 1K4HA 4HOZA 3TK7A 4RJEA 3RJYA 2O9PA 2QQ6A 4AVFA 2ZICA 1XLMA 1IIGA 2XVNA 4EX4A 3AFBA 4C6MA 4C6NA 4X2PA 1LYXA 5FJIA 3T55A 1TV3A 1Q13A 4PMNA 1NFGA 2DH3A 3U5YA 2DW7A 4G2DA 1EFZA 2VFFA 3G8RA 2P0OA 1BWLA 3CMJA 3AI0A 4CGTA 2OTDA 4Y6GA 4UTLA 4WY0F 5F4XA 3D3FA 4M6UA 3GG0A 2ZBTA 4KCWA 4LY8A 3MSYA 1ZY9A 3WYZA 3AU6A 4A6GA 1C7SA 2BOEX 3RPTA 1XQLA 2R8WA 3EKZA 2EPHA 4C6LA 4JQ2A 4JQ3A 4FX7A 1DJHA 4B9ZA 1AFSA 1FX6A 4KETA 2EPKX 1DJXA 2GVYA 2VURA 3L65A 2VGBA 4UFKA 4NI3A 3VNIA 5K2ZA 2E6DA 2QUMA 2Q01A 3NXFA 3S6DA 2ZA1A 4K2SA 2OSYA 2NUXA 4FA3A 5FF3A 3LLXA 3VNDA 1PKYA 3S1WA 2GJNA 2V68A 3B0XA 3PULA 4EXBA 2ZUWA 2J66A 3KCLA 2ONEA 4WY0B 3PZNA 3T6CA 3NL6A 4R7OA 3R6IA 4Q4MA 4EAYA 4F0SA 3U2ZA 3KE0A 2Y8KA 1VYRA 4FALA 3BLEA 4GJIA 3GVGA 5KTLA 1DOSA 4OBRA 3QY8A 4DWSB 3P0XA 4Y7EA 3NO1A 3USBA 3MO4A 1DXEA 1S2TA 1TZZA 2YLAA 4HK6A 5DCEA 3TAKA 2GQAA 2H90A 2IPWA 3NQVA 3VKBA 3VINA 4ACZB 3NQ2A 2JIWA 1NARA 1FFRA 1I45A 1F61A 1B30A 1LOQA 2DGAA 3WEOA 1VEPA 4A3QA 4B5TA 2V2CA 4UWMA 4QITA 1K7FA 4S3JA 3IAPA 4NXKA 4WSHA 5E6YA 1JPKA 4HSOA 4ZTYA 4IG2A 4ZOBA 1H2JA 2B7OA 5TIMA 2GPTA 3TW9A 1HJXA 1YYAA 4UB9A 1BVWA 4PFHA 4RXFA 2EPLX 4IMAA 3GXNA 3F1QA 3FOKA 4IFKA 2C7FA 4CQ9A 3S1GA 3K2GA 3S9ZA 3W2JA 1Y65A 4DRSA 1JCLA 2WHKA 3AUOA 3PZQA 4M81A 4RE2A 3PZ9A 3W7KA 5C2XA 1KBLA 2YYTA 3TOYA 1VFMA 1XLLA 3GLCA 3W6LA 5H2ZA 1XPYA 2G4JA 2QCFA 3BAIA 5LIKX 3VD4A 1P7TB 3MUZ1 4IP5A 3ARTA 2Z26A 2ON3A 4MYXA 2J7FA 1L2QA 1U5VA 4BF5A 1LLOA 4P8VA 4H00A 4XKMA 1DE5A 5E1QA 1LLZA 3GTNA 1CNVA 4JFTA 4JN7A 2GVLA 4H3DA 1W5OA 2Y63A 4DJFD 2YW3A 3W6MA 3WQVA 3UXIA 4GJJA 3DHDA 4JKKA 4E2BA 4FS9A 4JL2A 5DN1A 5ECVA 3S9YA 5I7GA 3P8JA 1FA2A 4PULA 4C6PA 3CEUA 5BRPA 4M6PA 3PP7A 4OZOA 5HBFA 3HGJA 4NZFA 3W22A 1U83A 2RKXA 1R30A 3E9AA 1V93A 1P1XA 1YRRA 4LV4A 2FVMA 2E1DA 2AL2B 3N13A 1XIMA 1N7KA 2Y62A 1OD0A 4IHCA 1PX8A 2P5NA 4MY9A 2J9XA 1OVDA 2Y5EA 5G1MA 1S1RA 5DFAA 1EC8A 2X2YA 4LC6A 3ZT5A 3KHJA 5FF7A 3OOQA 2B0MA 4Y9NA 4B16A 1RPKA 1K1DA 1NWUA 1LWJA 5B7ZA 3TIMA 4L9XA 1SZGA 4FX8A 4PBEA 1DQWA 4H4IA 3VNYA 1QBBA 4QEHA 4LUIA 3B3DA 4FF5A 2RFGA 4D72A 2BVTA 3LLFA 2OODA 2DU2A 1I60A 3P7YA 5HNTA 2HPIA 2OMAA 5CZSA 2DZSA 1ECEA 2BZNA 4TOQA 3K8MA 5J5DA 4JX6A 5TBOA 2HPMA 3ZXWA 2YYUA 1EOMA 4N6EA 1SYTA 4H7ZA 4D6HA 1IXPA 1PJ9A 2HDJA 1RK6A 3Q2DA 3PJTA 3UFYA 2XGIA 2WV8A 1QBAA 1TCMA 4IQJA 4X9YA 4JX4A 3EDFA 3BLOA 3QFEA 5DT5A 4IM4A 2G3NA 1Q63A 1SPQA 3L5AA 5HMDA 3D47A 4G56A 2VENA 3TJIA 3UCDA 4A8RA 3UR8A 3SB0A 4MF4A 1W91A 2CYGA 5CBBA 2X1UA 4WR3A 2NQHA 2FZ9A 1K8CA 3O15A 4FMVA 1KRBC 3AWOA 1PDZA 3TTYA 2JF6A 3P0WA 1Q66A 3L66A 2NW0A 3VIIA 4IUOA 1RY8A 2R1KA 3TWBA 2XGBA 2J7CA 3A47A 3M41A 2AGTA 3QRHA 3SCQA 3M0YA 4J40A 3IIXA 2OU4A 2B7NA 1AQHA 1BTMA 1OGGA 3P93A 2O55A 2AKMA 2Z25A 4GABA 1JYVA 3SCWA 1RP8A 3AYSA 3MVIA 3BC9A 2HISA 2I5IA 2EKGA 2FB2A 4JBRA 4Z0SA 5I5RA 2QMJA 2DZWA 2AGKA 2WMJA 1EEXA 1TQJA 2PDUA 4IPLA 1B0IA 3KAOA 4RKAA 3CBWA 1X7FA 1XRVA 2QV4A 4REQA 1OFEA 1DJQA 2W66A 3SCPA 3IPWA 2V5DA 1B4EA 1UJQA 2XFYA 3WK0A 3VIGA 3PBWA 3PTKA 1U5HA 2BG5A 3MVTA 1T40A 2J9YA 3WIJA 1OG0A 4WXYA 2NQJA 1SVDA 3JS3A 3C61A 3AMKA 4XO6A 3N9SA 3WCZA 1H61A 4G7EA 3B8DA 4J2MA 1XIBA 3WLIA 3I3EA 1UWTA 5CG7A 4IIEA 4M51A 1R47A 1RA5A 2NVCA 2X42A 1C29A 2XZ9A 2OLSA 3MZNA 3WF4A 2J8FA 3U2CA 1ALDA 3PPFA 1PZ1A 1ISXA 4UOZA 1KR1A 2ZVIA 3T08A 3R8HA 4B5VA 1C8VA 4YPJA 5F2GA 3S2CA 2ZUUA 4PSRA 3UGVA 4JYFA 3V4BA 1I2PA 3U7VA 3GDMA 1XC4A 1UP0A 4PEEA 4AISA 3K4AA 3A64A 1GWJA 1SZNA 2A3AA 5K3VA 2E5BA 4HHHA 3LTPA 3P62A 5U7SA 4ZQRA 3G6LA 1EC9A 4PODA 1LCOA 3VD7A 4B9YA 1ODUA 2DSZA 4FNQA 4AF0B 3TR2A 3G3MA 3U57A 1U33A 2EPNA 1YBQA 3SAZA 1V3LA 2PWGA 1GNXA 1T96A 3P67A 4PRTA 3KFTA 2IPGA 2JKPA 2DSKA 1HQTA 1KQYA 1KGXA 3ABSA 3LGDA 3NO5A 2WMKA 1XLEA 3V3WA 1CBGA 4KWUA 4I7VA 5FJUA 1VF8A 4QDMA 1G1YA 4PTXA 4WX2A 3BW4A 4LRSA 4U2ZA 1R38A 4LY4A 4MM1A 2YXXA 1P0DA 5D2YA 2EEXA 1A5MC 3I65A 4E0CA 3VDCA 2ZC1A 3VIHA 3SSZA 1E0WA 4ZENA 4C6EA 2WMHA 4OIFA 1T41A 3WQFA 1TPB1 3ZSSA 3C5QA 4Q4SA 4Q8MA 2C13A 4JQ1A 4EANA 1R46A 1KBBA 3OPSA 2G50A 2DZPA 3E0VA 4JTDA 2IMRA 3DGRA 2HJPA 4H2HA 3BOLA 4J7RA 3SI9A 1N2VA 3GXFA 1A3XA 1DJIA 5LSMA 2WHLA 1FCBA 3VGDA 1XBXA 1S1PA 4HOXA 1CGTA 1OK4A 3TONA 4CU8A 1EXPA 4JIRA 3CAKA 3IIOA 3TQPA 1LP6A 3K4DA 3EKLA 1XXXA 5C0QA 3G1XA 2WZEA 1RA0A 2XSAA 1FWNA 3VD9A 1OFQA 4QAWA 4GQGA 1RJQA 4A35A 2GYIA 1UD8A 2D20A 3MW7A 3W86A 4WGHA 1ZBCA 3DG7A 3KOFA 2VQUA 4AB4A 3KBNA 1Z8AA 3E74A 4I9MA 2QAFA 1VB9A 2QCLA 4ZQMA 1X6LA 4MSSA 1H1YA 1GJWA 1XBYA 2RDTA 4AHQA 2O92A 3C3NA 5K9DA 1YE4A 3GHTA 5JBDA 2FJKA 4XQ6A 1ISWA 2D69A 3VKCA 5AHNA 4IP7A 3AU2A 1R86A 3EWYA 3QKEA 3FA5A 3O6DA 3DOPA 1JD9A 3G77A 2OYMA 1PZ2A 1X39A 3C86A 4PCSA 4JDYA 1POJA 2ASHA 3N2CA 1S3TC 4L4PA 4L7ZA 3LV5A 2OYKA 3WQ4A 4DJDC 3F03K 3TQVA 2J7DA 2E77A 3N3TA 3NQMA 3UA4A 3WH5A 3L4VA 1YADA 5CZJA 3GM8A 4CD8A 3VKKA 1I75A 3DBPA 3PNZA 3GK0A 2HBXA 4YWSA 5BRBA 6CGTA 2GDQA 1NOWA 4ZSUA 2PTZA 2XFRA 2Q09A 1RQHA 1ZAIA 1E70M 2GJPA 4C7GA 1UCWA 3HQ1A 3LERA 1UROA 2VEKA 3BTNA 4RUBA 2BY0A 1OYCA 3EWXA 3OO2A 3UG3A 2HBVA 4IIDA 3EOUA 1O6IA 2ZVRA 2ISWA 2BHYA 5FEWA 4AVOA 4AHOA 1HJQA 4NI8A 4D8ZA 4PCNA 5FJPA 4CN1A 3OHMB 2Y0FA 1F9CA 3GVRA 1B54A 3VABA 2DT1A 3R4IA 5FJRA 3E0LA 1B3WA 3E1F1 3QR1A 4HJFA 5LA2A 1X1OA 3MS8A 1JPDX 1W3NA 2NUYA 2PDFA 3G0XA 3R8RA 3B0VC 4FO4A 1E55A 1ZAHA 4YLWA 3QV6A 4Q4QA 1RR2A 2A3BA 5C7VA 5JIWA 5MKGB 1FWCC 4GQBA 3LQLA 4L6DA 4S23A 1GQNA 2DIJA 2XFFA 1TR9A 1HVQA 4TU1A 4AMAA 2GWNA 1L9WA 1WUFA 2CLIA 3WJYA 4FPSA 4IIFA 4ZQCA 4DQWA 3AYVA 1WDQA 3FV9A 4D6FA 4IL0A 2EG6A 4FNPA 2R6OA 4GQQA 2CBIA 1XIGA 5DXYA 2Y5JA 4YWIA 5A8OA 2WVTA 3CK5A 1R87A 3O8AA 4TVCA 3B05A 3T4WA 3BCDA 3NR0A 4HPHA 1A0EA 1NFPA 2OXNA 1QOPA 3ECQA 3MUCA 3BGGA 4AIOA 2OOGA 3MV01 1TO3A 4ZXOA 4J27A 1QOQA 3PB2A 1K6AA 4AD3A 1EX5A 3ISIX 1E4MM 4Q4RA 3FKKA 4IICA 4POCA 4GYPA 2OEJA 2CLKA 2E4TA 1A5LC 1E6SM 4JNMA 4UQAA 3H2OA 4RPPA 4PMDA 4NJJA 2ZXBA 5CPQA 1IR2A 3PB0A 3SCNA 1R3YA 3D46A 4I9TA 1M68A 3NGJA 4DO7A 4YIWA 5F1VA 2GSHA 3EMZA 3W87A 1IEVA 4UTFA 2DZAA 1T8XA 2FFIA 3LOTA 1V51A 1JYXA 1C92A 3V35A 1DWFM 4FNUA 4JTQA 3GR8A 1V5XA 3T81A 1K9EA 3ARSA 1ONRA 2XPKA 3LHZA 2QIWA 5AC6A 1OG6A 3WL0A 4FOJA 4MKVA 1FWHC 4W87A 3T0CA 3K1DA 4X2RA 2YCLB 3MI6A 4K6AA 1GVYA 3UT0A 3WBEA 5GNYA 5T91A 5HDRA 1IT7A 1JRCA 6ENLA 2YDAA 3KOYA 3RPDA 2W9MA 1LBMA 4DNHA 4C5YA 2WC3A 1QASA 1QXLA 2GJLA 4UQCA 5G4EA 4Z1DA 4HPXA 3Q65A 5FF4A 4UTTA 3CGTA 2ACQA 4Q4OA 1W5NA 4YHEA 3PS7A 2Y70A 4XZBA 4FXFA 4GXPA 5CZTA 7REQA 2PURA 2NQ5A 2TPSA 4MNMA 4NJKA 4UZUA 2OGJA 2WJDA 4ZFCA 3GWQA 3URBA 1K8XA 3H2NA 2CZ5A 2PP1A 3GH4A 3TJ4A 3CB8A 4TQTA 1UQYA 1DV7A 4EP8C 2W92A 3QZAA 4U3AA 1V6TA 7TAAA 1UWAA 5LXXA 2WVSA 3KLKA 2PPGA 1T7LA 3ZO9A 1KV8A 1XLAA 4ACYA 2BLEA 2CLOA 2VEMA 3CQIA 4R53A 4KCUA 1XD1A 4QJ5B 3AIQA 5LA0A 3RX3A 3F2DA 2PP0A 2F2KA 1XLDA 2B81A 3CV6A 2OZ3A 3A5VA 3WDIA 4FX6M 2XH2A 8XIAA 2YCEA 1EIBA 1QNVA 4DWDA 1IZJA 1RQBA 3HB9A 4XSMA 1A4MA 1FXPA 4PMYA 4HKPA 4P7RA 1S5VA 2WMIB 2GVJA 3WD1A 4Q8WA 1RUSA 1Y8BA 6A3HA 1D9EA 1FWEC 3CPGA 3T0DA 1R3RA 2J4GA 3HPZA 5C6MA 1XIIA 1LZOA 3E5PA 3GE7A 5BMXA 4CVUA 3CNYA 3FLUA 3OZPA 3QOKA 1JZ4A 1XPGA 3EGJA 1XRTA 3ID7A 3PANA 1HL9A 5TF0A 1H7XA 4GNVA 3E02A 4BI5A 2NV2A 3ORWA 2EHHA 3Q45A 4WCJA 3REQA 4E4FA 4JTIA 5MHBA 1AJZA 2INEA 4FLQA 2YDRA 3DFYA 4GNKB 2E68A 1YLVA 3UF9A 5HWJA 1XS2A 2FVKA 2PMQA 3UU0A 2CLLA 5FJTA 3T9PA 2QCGA 3T7VA 1TPFA 2JALA 2CPUA 5GJPA 4ZGYA 4LFYA 1JPMA 1MEIA 3MWAA 3OGSA 3KCOA 3LMYA 2XN2A 1EPVA 3AHTA 4JYEA 5E9AA 3NPUA 1UOZA 3KBMA 2DSWA 4Z08A 1LRQA 5D9PA 4ERAA 2RJHA 1XYLA 4LANA 2BB0A 2CCRA 3NEHA 4M7TA 3PBYA 4UCGA 4J35A 4O11A 2GOKA 1XLBA 3RR1A 1MQQA 4KWVA 4KWSA 4Q7BA 2CWNA 1ELSA 4YCOA 1EYEA 5BXSA 3P61A 1P5BA 4L80A 1QWGA 4V33A 2ZXQA 1NIUA 3LGEA 1ZS2A 1KM1A 1A50A 1TVPA 1RV8A 3T78A 3LXBA 4L64A 3NQDA 5DF0A 2WB5A 4A3HA 3E5BA 2ZXAA 1NH6A 4BJHA 4EPBC 2A0NA 3GHRA 2C18A 1I0DA 4DWSA 3W6YA 2QUTA 1H0GA 3AS2A 3TOPA 4DXVA 3RFAA 3U2EA 1RJRA 3WY1A 3CL8A 3TUUA 3HIJA 3LPPA 1EQCA 3B4YA 3L67A 3KVJA 4XD4A 1XSJA 4Q32A 3G1DA 8RUCA 3DUGA 3AS1A 1M41A 1JR1A 3WENA 1I8JA 2MNRA 2C71A 3PWAA 1S39A 2J27A 4CLMA 1TUFA 1MNZA 2GK1B 2P3ZA 4NNBA 3GHSA 3WK1A 4N9CA 1G4TA 1NFBA 4TO8A 3C2OA 1BPLB 4PA8A 3UWEA 4OQVA 5A5WA 1H7WA 2YCKX 2GDVA 3E0WA 5LZLA 1GG1A 4BWLC 1OYAA 4I5XA 1QO5A 1XCFA 4TTUA 2P50A 1Q5MA 3FW6A 5ECUA 1FH8A 5AECA 1ITUA 1TJ0A 1HO4A 1PTDA 4FF7A 5C8BB 1EP2A 1TSIA 3RCMA 3VFLA 4JY8A 3I7RA 3L68A 4CU6A 3WX7A 1HJUA 4F3HA 3RO6A 3B04A 2ZRXA 2WNNA 4H6RA 2ZUMA 3GNDA 4AZ6A 3FJ6A 3HG5A 5CJ5A 2XU2A 1P0BA 2DIEA 3N2XA 2Y88A 3NGFA 3ANYA 4W7WA 5TAOA 2PF0A 2P76A 3NQEA 4XVEA 3DYMA 3MV11 4E8CA 1WO2A 5D37A 2P8BA 3B8VA 1JYWA 1XLHA 2DUAA 4AYGA 5BOFA 3DGBA 1Q85A 3EX3A 1Z9AA 5D2TA 5DO8A 4LVGA 3P81A 3N04A 4BQ2A 4E2DA 2E9BA 5A8QA 2BBFA 2TODA 4C6JA 4UTIA 3W7EA 4HA3A 4UUIA 1PIGA 3WJWA 3O7UA 4FXJA 4M7SA 3WFLA 2HZGA 2C6QA 3HGOA 1WZKA 1VJSA 3ZQ9A 1FP8A 3F4DA 3L5LA 2HRWA 2YBUA 3THCA 3KUMA 1H3GA 1KW1A 4UFJA 3BAWA 3CT2A 3VU2A 4B4FA 1W3HA 3IJDA 1MFVA 4MNKA 3NQFA 4ZE5A 3QN3A 2RH9A 2I17A 3CUXA 4P7OA 4RV8A 4R88A 1QW8A 4PMRA 4I9AA 3QXBA 1P6CA 1K02A 4GFIA 1SSDA 4WHBA 1UUQA 2EG8A 2JE8A 1JDAA 2Z1VA 3PJUA 2H3DA 3WN6A 4W8AA 3N18A 5LNWA 1WBJA 3LI1A 3T0TA 2CXEA 2O56A 4GUIA 3NIYA 1IV8A 4J3SA 3SCOA 4Z1AA 1EWDA 4I7WA 5U4NA 3Q4DA 4EACA 5KITA 3PUOA 4DUVA 5C7HA 8TIMA 2DVXA 4AZCB 3GDRA 2Z2UA 4UFIA 3A4AA 3FYYA 4AX7A 3QC0A 3KOZA 2A7NA 3DFQA 4MWAC 3C0QA 3WNNA 1WUEA 3MJMA 1SR9A 2GJRA 4LAUA 2WM0A 1QVBA 3WQPA 4IZGA 4NZJA 4TTGA 3W2NA 4JOMA 3BAXA 1XRFA 1Q7ZA 3WK2A 4ZO7A 2JIEA 4W8BA 4OKDA 3CU2A 1JQVA 4GVIA 5HJLA 1TE1A 2PDWA 3R89A 8XIMA 4A4AA 4IGHA 4Z2KA 2YL5A 3DERA 3H53A 4CNNA 1QPRA 2YIHA 1J4EA 2IPJA 2Y4SA 3IJIA 1AVAA 2WMIA 4YXGA 5CSSA 2WJFA 1BFNA 3KOWA 4M0XA 3D5HA 3RLVA 3RDKA 2WZHA 1QO2A 4S39A 3GUWA 3GNNA 2DQXA 2NXGA 2YBTA 2HVMA 3B0UX 4U3CA 1IT0A 1R3SA 4UTWC 9CGTA 1Q4NX 3OVPA 2E3ZA 1K3UA 3R25A 1KKOA 1TG7A 1H1ZA 2HCVA 4B5XA 1W3JA 4JTCA 2CLPA 2X1SA 1ZJIA 2XM1A 1CLKA 2XN1A 3R58A 3TC3A 4MGGA 1CGWA 1V6XA 1FWBC 4XVDA 4WSJA 5LNVA 2G4FA 1WE5A 1J5SA 3F5LA 3PZMA 3QZ6A 1GZ1A 3WQGA 4KEMA 3HO8A 1YXYA 3EDEA 1NQKA 3NTYA 3RHGA 3B8TA 3OG3A 4DELA 5FKYA 2ESCA 4GH1A 3QLDA 4EVZA 1E3ZA 2VD8A 1IZCA 5I77A 5T26A 2VO5A 3L4XA 1GQIA 2NX1A 4MFEA 1UC5A 3W7GA 4W4QA 5E9XA 3GAYA 3EX2A 2PZNA 2R1MA 1XKYA 1XLKA 1YMYA 3IS4A 1BVNP 4GVFA 3DG3A 3LCGA 3NZRA 3KZPA 3KRUA 3S1XA 4I3GA 5J04A 1M6JA 1CB2A 5DMNA 3H4WA 4BCEA 3DXIA 3TJXA 4NASA 4H9MA 3JZEA 1A0DA 1Q45A 4EIVA 4MB1A 1R3TA 3WNPA 4XAYA 1G4SA 1A5AA 5LYRA 2EXOA 2BGNE 4KBXA 5HMFA 1EUNA 4FOKA 3EPMA 3LS9A 1O95A 3A9BA 1AD4A 2VVNA 1EJVC 4RZ6A 4NYUA 5IHRA 1VRXA 3WF0A 4KT2A 4J3ZA 1MXDA 5AKQA 4AYSA 1LWIA 3W7DA 2A6NA 4V1XA 4LF1A 3DZ1A 3GH7A 4HNNA 4LVFA 1A0CA 1FDZA 2QDHA 4DM2A 3BZJA 1FP9A 3VOIA 2TSYA 3W25A 3G8EA 3FSUA 4C6FA 3QVQA 4LUTB 4HB7A 1V3JA 5H8MA 3II1A 1GYMA 1EDTA 5ENLA 3B0PA 1H50A 2D0FA 4A8IA 1DWIM 3E0IA 3K30A 4MDOA 3QQWA 4JHMA 2F6UA 1JI2A 1OADA 5LNRA 5BYWA 5AY7A 4J3UA 2ZDSA 3MSGA 4KS0A 3A3XA 1X8FA 4NX0A 1XH2A 1LRNA 1LF1A 3LZ5A 3TP4A 3EOSA 8CGTA 1W6TA 4NVTA 1JAKA 1EHAA 1VP5A 4P7LA 1V79A 4MB4A 1LWHA 1R3QA 2UY4A 3M6YA 2QS8A 3KDNA 1ZU8A 3AUJA 1JDCA 3GKAA 3PZVA 3CPRA 4GYJA 2ZWZA 1AODA 4H01A 2DSVA 2VUNA 3C0LA 5LNSA 3U6WA 3KBVA 3HMCA 3P80A 4GWEA 3FX4A 2A6LA 3GU9A 3ARVA 2FPVA 1PKLA 2DEPA 4YTUA 1FOBA 1PCWA 4GJ1A 1Q3NA 1C3FA 6XIMA 1CW2A 1FH9A 3ELFA 3W7PA 3EX4A 5K4XA 4HA1A 2QCHA 4DX3A 4IXHA 1OFAA 3VIMA 4Q6JA 5DT7A 3VK5A 3TYAA 5AVHA 3URQA 1W1IE 3TC7A 3GBEA 1Q6QA 1BWVA 2Z1WA 3FYOA 1TWWA 3O2LA 4DI8A 4DNMA 1I2NA 3W81A 5REQA 3YPIA 5FSDC 3CWNA 3WLRA 1L8NA 2YDQA 2OX1A 2PWFA 5C9WA 4UFHA 4PMXA 4OBSA 3OQEA 3TFCA 2Y2WA 3MCNA 3KL0A 4QE1A 5IHSA 1F73A 1J0ZA 4HBKA 4BI7A 1Q6FA 1OYBA 1K03A 1W9UA 1QK2A 2A3CA 1UWSA 1VS1A 3OU8A 3H6OA 1QATA 1ZFJA 5C71A 1VPQA 3NSNA 1X6NA 3EA2A 5EL1A 1HNYA 2ZA2A 1B3OA 1ZRQA 3VIOA 4BR1A 3WNOA 1F5ZA 4CNPA 2G8ZA 3FN9A 3QZEA 1L6SA 3LCIA 2ISVA 2J79A 3HZ3A 4ILSA 1DVJA 1E1FA 1GONA 3W83A 1E6RA 4PUJA 5BWAA 3DX5A 3WH7A 3B8IA 1DTNA 5KINA 2J62A 3B9OA 4JXCA 4F48A 3VMPA 1MQPA 3LRLA 1GKQA 5MF5A 3C2RA 4BK9A 2GLKA 1IE7C 3MMUA 4X22A 3H7RA 3R94A 3RITA 3DECA 2NT1A 5CLTA 4GI9A 1EGVA 3GTIA 4WY0A 3ARUA 5HWMA 3AROA 3SY5A 3QFWA 4KFNA 1GORA 4B5SA 1EKOA 4IPPA 2SFPA 2ZX5A 2I7GA 4D9PA 4QS5A 3GNRA 4S3DA 2ZDRA 1UKOA 2OQHA 2RJGA 2Y85A 2VL4A 2VELA 3L21A 1VBRA 1JIBA 1GHSA 3A4XA 5T9BG 4XO7A 1TPVA 3ZR6A 5AC4A 2PDXA 4H19A 1XH1A 3LZ3A 5G4WA 3I7QA 3IRSA 4KFPA 1K8YA 4A22A 3BK0A 1UR0A 1KCKA 1WA3A 5CPNA 5DRIA 3BVJA 4EWJA 5DLCA 3R12A 3WBWA 2WSYA 3C0SA 3CAVA 1O5XA 3W38A 4H6QA 2QAPA 3HGSA 3LM3A 1QNRA 1RBOB 4DM1A 5FL1A 4LEQA 3AMGA 3QMRA 3UYIA 4IX2A 4Q6XA 4C6DA 1OIMA 1Q6GA 2D0HA 3K4WA 4FLRA 2CHNA 5IFPA 3G2GA 1QMLA 4PUKA 3HPFA 4BF7A 2V2HA 3ABOA 2CETA 4GMEA 1F7BA 4O1FA 2PWUA 3F5JA 5D4YA 4DPQA 4G1KA 3U3HA 4IFKB 1S5TA 4S3FA 1NOUA 3H2MA 4LUJA 1X8CA 1W3KA 3CO8A 4PFMA 3GIQA 4LYQA 4QS6A 1EPXA 1M53A 4NSBA 2GZXA 4KFOA 2OZ0A 1YEYA 1W54A 2C15A 4UQEA 3TWAA 3HG4A 3VGBA 3N4AA 1LOLA 4RLIA 3LNMA 4GFSA 1WYIA 4F2TA 4ROPA 1WKFA 3RGTA 3UR2A 3FYPA 1GCYA 4A29A 2OZTA 1SO4A 2GVGA 2ZZ7A 4JTGA 4A3RA 1GOOA 1EX1A 3OLIA 4LBUA 2X0HA 1WX0A 3QGVA 3VYLA 1BYAA 1QI5A 4RZBA 3RU8X 1X38A 4XSLA 1TMLA 4FNTA 5C2CA 4Z2HA 4MHBA 4KRUA 3N2BA 2GGEA 1QPOA 2ACRA 4DY1A 3NL3A 1QT1A 1EJXC 1RALA 1ICSA 4EXAA 4HMCA 5JH2A 2Z29A 1BHGA 3PJXA 1F74A 1AJ0A 4CNOA 3FDKA 1JF5A 1Q2SA 3Q58A 1S5NA 1UR8A 4S38A 1ZUAX 3JUGA 3MBFA 3W3OA 3D3AA 1YNQA 4PUNA 4LUYA 1SZRA 3RPMA 3ONBA 3PWIA 3STFA 3CB3A 3M07A 5EKYA 1E6ZA 1EDQA 2Y7DA 4O0ZA 3AHXA 1R7AA 2YOCA 4RE0A 2ZRYA 3ARXA 2C14A 1EP1A 5HNNA 4XTIA 3WD0A 3QBUA 5CPSA 1BQGA 1SJBA 4MJZA 4XZHA 3G1HA 3E38A 3F4CA 4KCVA 3T07A 4O54A 1LJYA 1CLXA 2DT2A 5CXPA 4NJHA 2EGZA 4TX8A 3LLDA 3FS2A 2GSJA 3TN5A 3L12A 4WJ8A 1W1A1 3CH0A 3AMCA 3S9IA 1BRLA 1OF6A 4LH8A 4NILA 2YX0A 1I9CB 2P53A 1FVPA 3TYDA 3PY2A 1UIOA 4U10A 4H9XA 1XL9A 1EB3A 2E67A 1D3GA 3UXDA 1TPWA 2KX9A 1F6KA 2DSUA 4OV4A 2I5GA 2ZTKA 3CHEA 4I7UA 3U48A 1F4AA 4YTTA 3ZMRA 3UZWA 1DIOA 1WCGA 3GSMA 1MDRA 1PAMA 3WLSA 5I3GA 4AIBA 1WAUA 1GYLA 5CC6A 4PMUA 3R43A 1O4UA 4TX9A 1P43A 4CCEA 2ZKMX 5DELA 1KTNA 5LXEA 3GR4A 1E56A 3P14A 1UB3A 3L0KA 1K9TA 3EOLA 1WKDA 3L9CA 4GKLA 4M1BA 5HR7A 1FWWA 3AQUA 1BXCA 1GQKA 1KC7A 3DEQA 3FVMA 5D32A 1R9ZA 1GVOA 4J28A 3EKGA 1QI0A 3WDHA 5K7JA 1FHLA 3ZJ8A 1MO0A 4B90A 4LALA 4DXXA 1E0VA 1W9XA 3ERPA 2VR4A 4D1IA 1JPIA 1FWSA 2G3FA 2CLMA 2BY2A 4DF0A 3LSCA 1FCVA 3H2EA 4XZIA 1B9BA 2V5CA 2PF8A 1SUXA 4M1RA 4L5ZA 3M46A 5LKYA 4HNUA 5D09A 1SSGA 1ZNNA 3WEZA 4Q7NA 3CHFA 2VC6A 2VFHA 2CBVA 3A4WA 4BI6A 4H8UA 5C2GA 2XYLA 4XIAA 5E70A 3VIFA 1YTEA 1V3HA 1VLWA 4RNFA 1XR2A 1KGWA 1S2VA 2XG9A 3L4TA 4FEZA 2BX7A 3WQWA 3W2MA 1ISVA 4Z2LA 3L4ZA 1K70A 4XAGA 2QJJA 4U28A 5ABTA 4HPJA 4NIRA 3S2MA 1LL4A 3JVAA 4CNTA 4PBGA 5EGRA 4K8HA 3HGRA 3DN5A 4AZ7A 4YMZA 4K8GA 4IISA 1H5YA 1O5QA 6PTDA 1HKJA 1W1ZA 3EDJA 4UIOA 4GX9A 3QGAC 2QCMA 2PFHA 2FZDA 3WUBA 4CU7A 1FWTA 2D2GA 5LA1A 1E43A 3DFPA 4MPQA 3AIVA 2TYSA 4GACA 2VX4A 4HSNA 1P0KA 1OBAA 3WLOA 4N2YA 5I78A 2BOGX 4X61A 3GG1A 1DL3A 3G1RA 1V02E 4A8NA 2PC4A 4F0RA 4GLEA 3AJ7A 1OM0A 3FVDA 4QG6A 4IX0A 3W2KA 2HXUA 2F7FA 4C60A 4RV3A 4LYRA 1EGZA 3M5YA 2FTYA 2QLYA 2VCCA 2WHJA 3R8GA 3IANA 4BZYA 4ECLA 3ZLHA 2OFJA 4JIEA 2ZC8A 1OB0A 4JKMA 3NSXA 4PCFA 1A5KC 4GY7A 3CZJA 2W91A 4J3VA 2BFGA 3QPYA 4ENLA 5BCAA 4MTVA 3NSMA 5BOEA 5IBXC 1OCBA 3VMOA 1S3HA 3MANA 1QWKA 4IXXA 2G0WA 1GZJA 1OGBA 1DWHM 3UVIA 1E9LA 3MUY1 2X41A 3AOFA 5FACA 3WG6A 1EF3A 3TSDA 1EZ2A 4ZB0A 3BMVA 3F4WA 1TA3B 1E72M 3JZUA 2ZE0A 4LWWA 4U4MA 1TX2A 3A4JA 3TV8A 3F7JA 3KW3A 2O0TA 3WH6A 2XVKA 3I6TA 3ALGA 4P5UA 4R27A 1D3CA 3WQCA 3OZYA 2XH4A 4N9BA 3L4WA 4F9DA 3MCMA 3OIHA 3THQA 1DTUA 2VWSA 3MB9A 1E4NA 3H2CA 3VDHA 2BGQA 4DO6A 4LW7A 4ROQA 4WJXA 4EF8A 2WCSA 3UXKA 2E6YA 1X98A 2QZRA 4UTUA 1EUAA 4JNZA 1UG6A 3MDUA 4IG2B 5D04C 3OJGA 2QHAA 4JCMA 2VUYA 3UY8A 3R0DA 4AHPA 1V08A 3TYBA 1VCFA 1JNEA 1TPH1 3TXZA 4H7CA 3AZRA 3B06A 4WOZA 3VZZA 2DZBA 4A21A 5HA7A 4WEVX 1EJSC 3VM5A 2ZADA 3L7RA 4O0KA 2Y8VA 5FESA 2VZUA 2Z7GA 3M0KA 2PDGA 1IR1A 2H3BA 2QNEA 3QHNA 4OU1A 3GXPA 2CWXA 3AZSA 4DBWA 1RLCL 1TIWA 2WMGA 4GUHA 3GTXA 4GO9A 3BE7A 3T8QA 2WKGA 3PZUA 3A12A 2DW6A 4DF2A 1ECQA 3USZA 2V38A 4YJ5A 3SW6A 1RAKA 1QRQA 2XIQA 2V0TA 2RDUA 3W26A 3SURA 2Z1XA 5TD4A 2BDQA 2F38A 1I1XA 2WSKA 2MUCA 4GBUA 4FIQA 5HULA 1PXGA 3CZ8A 1M7XA 2OJPA 3C0JA 3MMTA 3MSDA 4GHRA 3CAWA 4L1WA 3ZJ7A 3XISA 2V9DA 2QDDA 4KEUA 2VX6A 2X05A 4HYWA 5CQ1A 4GIRA 4AD2A 1XH0A 1BF2A 3RX2A 2VI0A 2VFDA 5AHEA 3W7QA 4HPGA 3BSHA 3GBDA 3ICJA 4Q8UA 3S4TA 3EBVA 4L6HA 4Q8QA 3GC2A 1J11A 1CX9A 2AQVA 4QTGA 2AAAA 2WO5A 3UJRA 1GJUA 3M43A 4PB3A 2BXVA 4UR9A 3LCXA 3UCQA 4UMBA 4AWUA 2TMDA 3WJXA 3IGSA 1VYPX 2VCAA 5F2LA 3TYEA 1YQ2A 4Q8PA 1UYQA 1KM5A 1UR3M 1MNSA 2IKIA 2WZIA 4GINA 3DC8A 1TJ1A 1X1NA 1TWSA 4HU0A 5JXQA 3UZZA 1AUSL 1XIHA 2HK1A 3NUKA 1XLJA 4AF0A 1HO1A 3B03A 1GT8A 2VCBA 1J0HA 3BJFA 1CGYA 3ITOA 4E5TA 4LB3A 1EOKA 4JTUA 4GE8A 2ISFA 2QULA 5JMUA 1MEWA 5K9XA 3MJYA 3NG3A 1AW2A 2VMFA 3F5KA 2FB3A 3NM3A 2GUYA 1VHNA 1GVQA 2QYGA 4IUGA 3VDBA 3AO0A 4NX5A 3H12A 1K6WA 2WQPA 4US6A 3TXVA 2CZEA 1EIXA 5B7YA 1CI1A 3T40A 1ZBKA 3H4GA 1D8WA 4JTLA 3LNPA 1RJPA 1LQAA 4AMCA 2Z2BA 3GFYA 2FDSA 3WFAA 3CZGA 3UQNA 1CENA 3M0LA 1VFFA 4OECA 1ZB5A 4QROA 2GGJA 1VFHA 3RR4A 4RZ5A 1AH4A 1GGOA 3TEVA 2HMCA 4PRRA 3VE9A 1M1BA 2A4AA 2PTWA 2I14A 3W1TA 1U22A 2EPOA 1VGAA 2WCAA 2Q3OA 1PDYA 1I2QA 1AK5A 4Z17A 3M47A 3VFCA 4HT3A 4PTDA 1KWKA 4RR4A 1E6PA 3B8WA 1V3IA 5D8WA 4O12A 1QNPA 4IMDA 5CSYA 4PZVA 3FHAA 2WKJA 3APGA 1KWGA 4AG0A 3UWQA 3VO0A 4MKNA 3OVGA 3RRAA 1Y5VA 4MZYA 1GG0A 4NNCA 2BV9A 4PTNA 3O1NA 2YCLA 2KAUC 3ARPA 2D1ZA 3W2UA 4CD7A 1VH7A 4YYCA 4AWEA 2GOUA 3W71A 1MZHA 2PSNA 3PUDA 1TQXA 2NLIA 4BKNA 3CASA 3SUWA 3GC4A 4F0MA 1KXTA 2ZRUA 5AHIA 4G9PA 3GQYA 1AW5A 1TV2A 1AJ2A 3W24A 3B0YA 2PU1A 3KBSA 5C54A 4B2DA 4EOUA 2X1RA 4JTTA 3V7PA 3LSBA 3UVAA 2VOTA 1RY0A 2PA6A 1SFJA 1REQA 2XJ7A 3TH6A 1ZBVA 3ES8A 2GGIA 5A2CA 3MQTA 2BS9A 1VIWA 3ABXA 3SRKA 3AALA 3OLDA 5EMJA 3UWVA 3G0UA 3G24A 3SIZA 3UWUA 3TN4A 4QM1A 1JAEA 1OX6A 4P8XA 1A49A 3R0KA 3PM6A 4JL1A 3VPLA 4J9JA 4B92A 1CYGA 2PBOA 3K13A 2FDMA 1KXVA 1YDVA 1TTQA 1F3EA 1G6CA 2BVDA 3AHVA 2X40A 4IQDA 4JEJA 1PCKA 5C55A 2NWSA 2YXOA 3APTA 2NXHA 3AJXA 1OEPA 1VFSA 4QLKA 1XYCA 1X1ZA 3O07A 4DUOA 2W62A 1F6PA 5HQLA 2UWFA 1EDGA 1VFUA 3RJXA 4R9OA 3ZWTA 4FAMA 5I06A 4RK8A 3P6LA 4DAFA 1OGSA 2POZA 5D2VA 1CGVA 2QCDB 1PVNA 2Z1KA 3ZR4A 4DAIA 3WBYA 3C56A 3NWRA 3PZGA 1F3WA 2NSOA 3DI0A 4Y9OA 4US5A 1SFLA 4H9ZA 2O4QA 1WXJA 5A6TC 2QCEA 1JZ2A 1CZ1A 3MP3A 2B7PA 1OCJA 4ADTA 1HF6A 3W1MA 1EA9C 1A5CA 4DJDA 2ZX7A 4N4QA 5D8ZA 4DBEA 3LK6A 4N9EA 3I10A 1LBLA 5CZ0A 4ZQNA 1NDWA 3U4AA 1FWIC 2ZUSA 4GH3A 3IUHA 3BQ5A 4L9ZA 3SY1A 5BMWA 1A80A 4LJ3A 3CL6A 2BASA 4WDUA 2OOFA 4XV0A 3S2LA 2REQA 2WBKA 4ORIA 1ENUA 3DC0A 1UASA 1GOKA 3OA5A 3V0SA 1JGMA 4FK9A 2R1PA 3A3WA 4I90A 3DIPA 2XM2A 3GZ3A 4HGXA 2W61A 3U5UA 3SGGA 4Y2WA 1XKJA 1K77A 3R13A 4E3TA 4BA0A 4DUWA 5I2UA 3RIKA 3P5YA 3S0CA 4JTSA 5BXRA 2DZVA 4IMEA 1AG1O 4AWSA 3AXKA 4F0HA 1YW1A 1QAPA 5D9OA 4IQLA 5GPRA 4PR4A 1M03A 2Q71A 3BOFA 3I6EA 1FWAC 4HU8A 1T5AA 1IWPA 4X9SA 4NHVA 1VZWA 3O06A 1NTHA 4NRSA 1RD5A 5HAOA 1N8WA 1W1PA 4M56A 1L6YA 6TAAA 1RVKA 2V5BA 3KTXA 4LCSA 4F40A 4ICMA 3T44A 1TCDA 1UZ4A 5A1AA 2DY3A 4MPKA 1ISZA 4YTSA 3FFSA 2QJGA 5AC8A 3UGRA 2CLHA 4ZSTA 2HS6A 4IIHA 3MI3A 2GL5A 3RILA 5CAKA 3LI0A 3P82A 1Z6KA 2A21A 2W6RA 1JCXA 1EJWC 2FZ8A 3J7HA 4K39A 1KCLA 3Q37A 2JKEA 1TV7A 1FKXA 2G95A 3CS2A 3EWBX 3PFRA 4M3PA 1DHPA 3UPMA 3BSGA 3NYZA 4MVAA 1J0YA 4JN8A 2VRJA 3W1NA 3QSTA 3SADA 2J13A 2GJXA 4NZCA 1GYNA 3VD5A 1A53A 1TA3A 2UY3A 5D2XA 2PD5A 1UC4A 3QR3A 4C7FA 3ZS4A 3UP8A 1XIJA 5KETA 1C8YA 1G9HA 3QPEA 1SR0A 2OKOA 3AXMA 2PGWA 2XIBA 2PTYA 1XBZA 1ZJAA 4DXKA 4UNIA 3N9KA 3LY0A 1JUBA 2WWDA 1RCXB 2FGZA 5BXTA 1CEOA 2AMXA 4XBJA 4J2PA 1TJ2A 2Z6IA 1S2UA 2DH2A 2ZE3A 3LPOA 4FOUA 5JIPA 3RXZA 1TWDA 2OPJA 4JIHA 3TROA 1OZQA 4DHGA 3H2AA 4IP4A 3TFXA 4Y8EA 1R3WA 3M0MA 4MWAB 3H23A 4E4PA 3GAKA 3KWXA 1HL2A 3OHIA 4IFOA 1FXQA 1H7RA 2INZA 1ADOA 5CBIA 4U5IA 1Q8AA 2J74A 2ZIDA 1FWRA 4LAMA 1MFUA 3HJZA 4ZTXA 3WD3A 4TVUA 4NG3A 3UG4A 1XV8A 4O8RA 4BF9A 1UKPA 2HNHA 1VFLA 3QSRA 4U5KA 3FEQA 2OZ8A 2QT3A 4RZ4A 2YL9A 4C6BA 3MKVA 2QDGA 5M2FX 2CLEA 1HX0A 2WKLA 5CC5A 4GIEA 4R7JA 3O16A 4XZ9A 3PBVA 4AIUA 3LD5A 2J8GA 4I6KA 5D38A 4US5D 1GVRA 3V1HA 4MAZA 3GKFA 2E40A 4LQ1A 2HNEA 2WLYA 2IXVA 2I5QA 2IKHA 2I16A 1UD2A 4F9JA 3TC6A 1MW0A 3BJTA 1W8GA 1BAGA 1CIUA 1A5OC 2NT0A 3CQKA 5LHEA 3M7SA 1VFOA 4TVDA 3BW2A 1E9ZB 3KP1A 3A22A 1QR7A 1E0XA 1W8SA 2EF9A 5T8GA 3TJLA 3VNMA 3NQGA 1T99A 1XHGA 5BU9A 2WVUA 4DJEA 1XDJA 4MJ4A 3GNPA 5REQB 1EJUC 4RX0A 4R85A 1K4GA 2XVLA 4ZB5A 3PNUA 3BO9A 2HVOA 3A5FA 2G37A 1I2OA 1M7PA 4DIAA 3K1GA 1JDFA 3CIWA 3GTHA 3SY8A 2F6XA 4A3YA 5A6KA 1E9YB 4OWGA 2CZVA 4WKFA 4AY7A 3QTPA 1U1JA 4MUZA 1F05A 5A95A 1YTKA 4Z2JA 4WSKA 5HQMA 4B3LA 4NAFB 1L0PA 4U2YA 4KEZA 4WK9A 4CNSA 3AZTA 4LRTA 2DUXA 4K8EA 4ALDA 2PWEA 3PF3A 3FXGA 2DVTA 3VVGA 2Z27A 1X97A 1JUEA 3T2OA 4GNJA 3PSVA 3SQMA 1G7VA 1ZP3A 2ZUTA 5F2IA 3W1QA 3WDJA 4JTAA 3BLKA 3FAWA 1RZMA 2FTPA 4S3KA 4IJBA 3S5YA 4LYPA 3MPGA 1UH2A 5B80A 1OJXA 1YDOA 1KLZA 1R9XA 2X09A 2A3HA 3G0SA 2EPMX 4HZ8A 3QM3A 3EXRA 1VBUA 2YA1A 2YLLA 3TMLA 4AC1X 1W2PA 3ITLA 2Z2AA 2IKGA 5FEPA 5A8PA 3DENA 4ZFMA 4AW7A 2E5DA 4P7NA 3UA3A 3VOJA 1JZ8A 5CPMA 1SFTA 1HFBA 2CFFA 5AOUA 3VCCA 2X7WA 1VD6A 3GNOA 1OIFA 3LM7A 5LNUA 1XYBA 3MYPA 4W93A 3LCFA 1HKWA 4LAOA 1NWTA 1XI3A 3CH9A 1EO7A 3AC0A 2QVHA 2VZOA 4UTKA 5KZ6A 2PI6A 4MG4A 4QBXA 3E2VA 4PL2A 1AA1B 4LUSA 2YW4A 2VEPA 1NM9A 3N73A 4RDWA 1E0TA 2Y7FA 3BLIA 3SRDA 1RK5A 2J88A 4HIBA 1IT8A 1IGWA 3RRXA 4IMFA 3WD4A 2FZMA 4AX6A 3E2SA 4O1BA 5HWNA 3MUIA 4PUMA 1VBJA 3KTSA 1R6WA 1R5YA 4YVPA 3N11A 1E4LA 4W9TA 5CJMA 4RW5A 4WF7A 4XAPA 5CPOA 1YDYA 2V6AA 4MUPA 4ZXLA 3WBXA 5I3JA 1X7IA 1ICPA 4L56A 2Y5SA 2Z28A 3ME3A 3NVDA 3CLWA 2HVNA 3IGUA 3M5VA 1GHRA 3N12A 4NYYA 2ZZ2A 2YZ5A 1L6WA 1FCUA 3EEGA 2ZRVA 3PPHA 1V0NA 2E09A 2PCEA 4PH6A 3A9IA 5AYXA 3C2EA 3N2OA 2VGGA 4A2RA 2BHUA 2TAAA 1IHIA 2J77A 3VOFA 1W37A 2Y24A 4RDVA 4R33A 1O5KA 1PUDA 4TR9A 3VUSA 4AEOA 4LYKA 2D2JA 1XIDA 3M0HA 2POTA 4CCCA 1YX1A 1HN1A 4O4VA 1OINA 1JDEA 4LVDA 5AYYA 4L61A 4W84A 2DZTA 5M5DA 1Q6RA 4XZMX 3M0VA 3W02A 5DQPA 4HPNA 3LU2A 4YL2A 1ZCCA 1JVNA 1OCQA 1NDZA 4ZE4A 1NY1A 3ZJ6A 3N3MA 2IUZA 3TSMA 4DF1A 4REQB 5FAJA 3QY7A 1F2JA 4H9UA 5L9FA 3H24A 1XUZA 4DZHA 4GK8A 4NAFA 2BHZA 4V27A 4D6CA 1EJTC 3HQNA 5D9NA 3DKLA 3HM7A 3LG3A 3OBKA 2YPIA 3IIZA 4XZNX 4FHAA 3VGEA 1RXOB 4K7VA 4JTEA 1E4IA 3K8KA 3O0FA 4MAVA 1QK0A 3Q94A 4OT7A 4RW3A 2GQ9A 3NCOA 4ZCWA 1MUWA 2OWXA 4KIRA 5CKSA 1NWRA 1WOAA 2ATSA 3KHDA 3SRHA 4R34A 3ANVA 5HPOA 4O1EA 2Y61A 4GI4A 2WJZA 4DB7A 3W74A 1XQKA 1CCWB 3AS0A 3PC0A 5FD0A 2OYLA 5XIMA 1WDRA 4JDBA 1NAL1 3UZYA 3GFZA 1XYFA 1ITQA 2ISSA 3W23A 3WMSA 3LUTA 3VIJA 1K7EA 3ZT7A 3M0IA 4Y90A 2VC5A 3QYSA 1KFLA 5LIYX 3SDOA 1F6YA 3GUGA 3RLHA 3ZJKA 3EA3A 3BLDA 2PEVA 4X0VA 1WZMA 1US3A 1GZGA 5JQ9A 4C91A 3MMDA 4FNRA 2FMOA 3O0KA 3UNDA 4O4WA 1NDVA 1I1WA 3WJZA 2C0HA 4DJFC 2GSEA 1GPFA 4UZSA 1BYBA 3VKDA 6ALDA 4WZHA 4PB5A 3KM8A 1J12A 4GQ0A 1P7TA 1TYGA 3UZ5A 1R85A 1GTHA 1KQZA 3WLHA 2I9EA 1UIPA 4DJFA 2FGLA 1HG3A 2CESA 5SWUA 1OABA 3EWWA 4UBPC 3V5CA 1JL8A 1JZ5A 1TIMA 2G3IA 1V7AA 5CGMA 3OZOA 1BSLA 3UCCA 2VX7A 5I00A 4Q22A 1VENA 4KWWA 4MJMA 3W7NA 4NJGA 3ZWSA 2JGYA 1U1HA 1KCXA 1PEZA 1EBHA 1KBJA 4O28A 2QVNA 3W2LA 1JFHA 1M01A 2J47A 2QUUA 4IGSA 3M9YA 3NXLA 3N2TA 2XGZA 1WDSA 1T6MA 4Z1CA 3GYEA 1C91A 1FTXA 1XFCA 3UD6A 2VWTA 3FK4A 1FCQA 5I02A 1L6FA 3HF3A 3L2LA 3W1PA 2G41A 3CL7A 2J25A 4GC3A 1LOSA 1P6BA 2YSWA 1JCYA 5CH9A 3SM0A 1RHCA 3BLFA 4ZB2A 1GVFA 3VKAA 1OC7A 2QJMA 4PEKA 4HNCA 3A13A 4HK7A 3P3BA 3TX9A 2NVDA 1ZZMA 1GKPA 1UBSA 3KVKA 2XH7A 3TCEA 3IK4A 2ZZ4A 1CB7B 4HJWA 4O10A 1M3UA 3AXXA 2VM8A 2QKFA 3LEPA 4K1GA 1KXHA 5I3KA 4AFYA 4YTQA 5LHFA 2XN0A 1DWAM 1ITXA 4JHZA 1J5TA 1XIEA 3IJ7A 4GXWA 1I4NA 4BEUA 2CKRA 1SJDA 2C8NA 2C1HA 2BP1A 1EYWA 5EA9A 5JBEA 2OQYA 2FQIA 2WNZA 1YE6A 3FJLA 3GB6A 2A79A 4RE3A 4MLRA 4HK5A 2UZ9A 2XTKA 2PP3A 3FJNA 1XWYA 2E1WA 4KW2A 4QISA 2PS2A 3PSWA 3HURA 2VRQA 4NT0A 3BAYA 3M0XA 5D9MA 3WZ0E 3PJWA 3IV8A 3UW6A 1TR1A 1R7OA 4OUEA 2CBUA 4D6DA 2Z00A 5CSUA 2HSAA 3KRSA 3M0ZA 3BAKA 4DYEA 4GYFA 1G5AA 1TTJA 4HHLA 2DDXA 4LU0A 3E3HA 4AEEA 1R8LA 1A5BA 2PCQA 3LHUA 1DHKA 2H9AB 1SJAA 5CZKA 3VOHA 3OA3A 4UOQA 4F4RA 3T4CA 2PDBA 3AMDA 3EAUA 4MNJA 1F76A 4O19A 1B57A 5CCZA 1XG4A 3HPSA 1NJJA 4FR1A 4DZIA 3ALFA 3CV7A 4BQ4A 3P5ZA 1NF0A 2QV5A 5BWFA 3IJQA 3TR9A 2DJLA 5A3HA 2GWGA 4PUDA 1GOWA 2QCNA 1O68A 3MU7A 3A21A 4QE4A 4TMCA 3LN3A 2X16A 3WL1A 3SQLA 3N15A 1IIHA 3ZVHB 1DIDA 5JH1A 3AHYA 1CT5A 5G2WA 2GDUA 3IVTA 4YVVA 3KRBA 1LQ2A 1J79A 1OFOA 2VDHA 4PTMA 1WPCA 1JD7A 4JZ5A 1CDGA 2JF7A 3UJSA 1NP2A 5ABFB 3CMFA 1HP5A 3GIYA 4BFAA 3UERA 5KZDA 1ZSXA 3ITVA 2E9LA 2NZLA 3N2MA 4O1DA 5DBUA 3UJ2A 3N34A 4G7EB 4CN4A 3GTFA 1D8CA 1EGMA 3U4FA 5XINA 4JY9A 4AUBA 1UR9A 1RD6A 4ACZA 1N8FA 3W7JA 1KRAC 3LXCA 5DXXA 3L0GA 1DJGA 1GK8A 2VEGA 3SR7A 1OC5A 1OSEA 1C9DA 4KH2A 1ZCOA 4F0LA 4M24A 1KFBA 3QV9A 5EU9A 5HQEA 3VX0A 3PBMA 4BS0A 3OG2A 1KM2A 1AL8A 1R2RA 3PBGA 2E7FA 3COTA 2NX3A 4LOCA 4Y9AA 2PC8A 3SCUA 1K8ZA 1V02A 3FJ4A 1CXHA 3W7CA 3GXIA 2VGIA 3NURA 4HZ6A 1TB3A 4XISA 4NQ1A 3L23A 4DYJA 1IF2A 1LQ0A 3I6RA 1PZ3A 3HMJG 2JGQA 3FKRA 4R3UA 3P8IA 3T05A 3KS6A 1ZPTA 1YKWA 4P61A 1OCNA 4JN6A 1E1CA 3CJPA 5HOSA 2V3FA 2YA2A 3RX4A 1SMAA 3AYRA 3WO8A 2J8TA 3WQEA 3QMSA 9RUBA 4Z1BA 3BG3A 5F7UA 5DMLA 1XINA 1OWQA 3B9EA 3TCSA 3G3DA 3PBUA 3W72A 1HT6A 3NQ6A 2W63A 4JTKA 9XIAA 1JPHA 4A2SA 3O63A 4XKYB 3THDA 2EG7A 2Z1BA 1F8IA 4TXEA 1HW6A 1J0KA 1TPDA 1E73M 3S5SA 3BDKA 5EMLA 4UQBA 4KF1A 3RM4A 5EB8A 3VOGA 4ZOEA 1B3XA 2V5KA 1W17A 1NEYA 3WMLA 5IOBA 5IBXA 3SECA 4CKQA 1W32A 4QSFA 4NAEA 3WLNA 2WPGA 3OLGA 2Z7KA 4LBRA 2VFEA 3NQ7A 4L65A 1P48A 4XBSA 3W1RA 1VBGA 2XISA 2QCCA 1HKVA 1OF8A 2C16A 3CZKA 1IWAA 1HJWA 7CGTA 2KZHA 3SCRA 1A5NC 4GCAA 3MUXA 2Z1SA 3PZIA 2ZWYA 3U9IA 1N8IA 2PU0A 4HNLA 2C79A 1OT1A 3IWPA 1KO0A 1Q4WA 3S5NA 3AIUA 4AXNA 3RLUA 3OYZA 1YNPA 1BF6A 4E4UA 1J96A 3AAMA 5KSWA 4P2VA 1UA7A 4MDPA 4L9YA 3T0BA 1OK6A 3NEVA 3EWCA 2I9UA 3CQHA 4LT9A 4N4PA 3QV7A 3EDKA 5FF2A 3M1ZA 5E93A 3L4UA 2QPXA 1E6QM 4GUGA 1GW1A 4TUFA 1XBVA 3MT1A 3OBAA 2WW5A 3WD2A 1PX4A 3G5EA 1CXEA 1ZJBA 1XYMA 5K9CA 2QR6A 1VLIA 1Y5WA 1LM1A 2DZUA 3POCA 1Q6LA 5C9XA 1TRDA 1ME7A 4F66A 2VOMA 2E25A 1O1ZA 1JXKA 2OELA 4IMCA 2FJUB 1C93A 2I57A 3CUGA 1J2BA 1Z48A 1EP3A 1SMDA 4LVAA 5BU6A 3W1XA 2QW5A 4UNLA 5DY3A 4XWUA 3DDMA 3MBDA 1BVZA 5F2MA 4HCLA 1LUCB 1GQJA 4C90A 1XLGA 4GVGA 1H51A 1RP9A 4NF7A 5LGZA 2ZA3A 1L2UA 3RG6A 3EXTA 4QFUA 3KDOA 3G1YA 3TLLA 4A05A 1JXJA 5ABEA 1W31A 4IOTA 3CHDA 1EH9A 3HN3A 2IS7A 4DLFA 3DYPA 3BV4A 1AH0A 4GG9A 1TV5A 4ONVA 4GX8A 1B3YA 2RUSA 1VCGA 1QHOA 1E9IA 5HMSA 2NVAA 4JQ4A 2WLZA 1H7OA 4DBSA 1VIZA 4DJDD 3W1AA 4QNWA 1JI1A 2XIJA 3HBLA 1HKMA 5H8UA 3WEMA 2FHCA 4RPQA 3IARA 4HN4A 1ZENA 3M6DA 1WV2A 3GU2A 2Y7EA 1QFEA 3IGHX 2FVLA 3NQAA 5C5YA 2WCGA 1HP4A 1BG4A 3TQ0A 1H5VA 4FSAA 1OC6A 1T8QA 3KS5A 1J93A 5IDIA 4IIGA 3WLKX 4WLCA 1J6PA 2ZXDA 4H9YA 4AD5A 4KIEA 4N6FA 2VTFA 5F4SA 1GJPA 2DVUA 2GGHA 2JKAA 4KGLA 3TA9A 4HU3A 1VQTA 4ORMA 1V3KA 1BYDA 3IK2A 2EO7A 3URNA 2V3GA 4F2UA 1VR6A 3INPA 1P4CA 3W76A 4OTKA 4D8LA 1UZDA 2OT0A 1B2YA 4A8LA 4KWOA 3PTMA 1XDMA 2X8RA 3MY9A 1YBQB 3UJFA 5EMKA 4I9JA 2PTXA 3RF9A 5G2IA 1UWUA 1ICQA 1NU5A 2AMGA 3ZIZA 2D0GA 3ANUA 3NNTA 1FFQA 2ODOA 4AWTA 3B8UA 4K1WA 4EXQA 1B5TA 3RLGA 1DWJM 3AIWA 2YB4A 3C2VA 5EFDA 3WDQA 3LBCA 3TU9A 3W73A 4D2JA 2J75A 3H4XA 4RNHA 4E6MA 2PDIA 1O1HA 2OO0A 2PGRA 1F8MA 3IEBA 1JCTA 1AW1A 1KFKA 2WBGA 1KR0A 4XZWA 3C8FA 1D3HA 3VXGA 2D73A 1JZ6A 1I6NA 3TE9A 3V0UA 1BXBA 1AMYA 2IPFA 4QAIA 2HS8A 3FHQA 2F9RA 2V5LA 3PG9A 1ISYA 3HPXA 2VXNA 2C1IA 1UP3A 4H6EA 3MWCA 1EWEA 4AY8A 3ARQA 5IFTA 3PR2A 1JULA 5AN7A 4CD6A 1NVMA 5A2BA 2O7QA 3LGGA 2HV5A 1FHVA 1IEQA 1UP2A 5G4HC 1KV5A 2G97A 1XG3A 4V1YA 5E0CA 1QI3A 3W53A 1D2KA 1O12A 3SSJA 3QW4B 1XLFA 3EPOA 1M04A 4FB7A 4RL3A 3N19B 3MP5A 4O18A 1PTAA 3NQ8A 1S5MA 1UKQA 3ZR5A 4UQ9A 4E38A 2AQOA 4MYAA 3AIRA 1SZEA 2ABBA 4AZHA 2UV8G 4QIUA 3QW3A 5KEZA 1R2SA 1SW7A 3VM7A 4HCDA 4JFSA 4N42A 4AAJA 1DJWA 3EZ4A 1FH7A 2XIMA 3BPWA 3KCJA 1W5QA 2ACSA 4DBDA 3ABRA 1MUCA 2H8XA 2PD9A 2QJHA 2BY3A 3SUSA 4WUIA 2WVVA 3A24A 2OG9A 2CLFA 1J0JA 3APYA 4B3ZA 4DLMA 2V3EA 4CD5A 2E6FA 2CKSA 1H60A 2WOQA 1UD4A 3MDWA 3VCRA 3E49A 3V16A 3S42A 3VMNA 2PDCA 4MMWA 5EBUA 4LXFA 3ONCA 5I3DA 3N6QA 4HHMA 3I7SA 1HUVA 2Z24A 2QDEA 3GXDA 3V36A 4MY8A 2FPTA 3LCLA 2PGFA 2G96A 2F84A 3WDPP 3DESA 3LB0A 1Y5XA 1WZLA 3LA4A 1UKSA 1CXKA 1TV4A 1K7XA 3QQ1A 1PYFA 3TNBA 4C6CA 1H62A 4E2VA 3OEXA 3H2FA 4L4LA 2VDGA 4CCZA 5ABFA 2CBJA 3PAJA 3WF3A 3EWZA 2YGYA 2RHGA 3QR0A 2VQTA 3GD6A 1TVNA 3MKKA 3LHVA 3CT7A 3GXMA 5FSEC 2FTWA 1AD1A 1JYNA 3LRMA 1QPNA 4AY1A 1M5WA 2VZSA 1F3XA 2OCZA 1FHUA 1OX4B 1E3XA 3DHPA 1FWDC 1PL9A 2ZUVA 4GZJA 3BW3A 5DBTA 4KRZA 3W85A 5CPLA 1UR1A 5FEZA 2C0AA 3PTDA 3GDLA 3O3RA 1FDYA 1E71M 4HU4A 4KKXA 3W7MA 3EA1A 4IIBA 3M7WA 4WRHA 1JGIA 1R2TA 1O5RA 2RGLA 1V3MA 4ZMGA 1H11A 3T8LA 1H41A 4L1GA 3WMCA 2QJIA 2ZCGA 3O05A 1UA3A 3VTRA 3BLLA 2JEQA 3VCNA 3W7IA 4S3BA 4DPPA 3B4UA 2ZYFA 1WKYA 3WKZA 5BOOA 1TWZA 3KP0A 4H2CA 1LBFA 2V81A 3CWOX 3GVQA 3UNTA 1MQRA 1PHQA 3STEA 4ERIA 2J78A 4J4KA 1C8XA 3W37A 1JQXA 4M6QA 3CO4A 2Q3RA 4BY3A 3O6AA 2VJXA 3PTQA 3QMTA 4UTMA 4M5PA 1XCWA 4O13A 3JW7A 3KL5A 1RVGA 1Z32X 4LSBA 3KWSA 4QEEA 3LYEA 1SGJA 4W8LA 1GOQA 3IAQA 3CPUA 2O9TA 4MIMA 2JEPA 5CBJA 3AMLA 4YCPA 1UQZA 3WLJA 1EJ7L 1JUKA 1CTNA 2ZUNA 4L4OA 3SZ8A 3W75A 1KFJA 2WYSA 4C7DA 3IV3A 4WKAA 2OO6A 2W4XA 1J6OA 1XISA 2XDFA 2PDMA 1TJRA 2HK0A 2Y6ZA 4F2BA 5FEXA 3CUJA 1W1TA 1B4KA 3W4RA 3W9ZA 3OB8A 2D3LA 4F8XA 1S5WA 2J7HA 1SO5A 1V4YA 1VRDA 1BLIA 1KTBA 4YS1A 4MOZA 3S3GA 3QKZA 3LHYA 1XFBA 1AZ1A 2E8YA 3UY7A 1LORA 3FGCB 2HE5A 1UJPA 1P1MA 4WKHA 1L8PA 3WLPA 1PB0A 1RBAA 4J3TA 1MEHA 3UXAA 4GI8A 4HSHA 5AFDA 1Q6CA 4G7FA 4S3AA 3GRIA 4K38A 4QXIA 5D03A 1MZRA 2PDPA 3BANA 2QCDA 3OVQA 3WH9A 4YVXA 2BVWA 4W5ZA 1SU5A 4NZ3A 4ES4A 4DWSD 4XAFA 4HYVA 4GO8A 5ABHA 4UQDA 1ZTVA 4FXRA 2B7QA 2CIPA 3OGRA 4K36A 4PTVA 3BGAA 1GOMA 2H6RA 3NDYA 1Z89A 1TJPA 2P8CA 4ML9A 3WF2A 2GUUA 3VGGA 4IMGA 3CTLA 1TPEA 4UFLA 4XIMA 4Z2IA 4IPNB 1AQFA 1H1NA 1YHTA 1TKKA 3B9AA 3BMXA 3DG6A 4S3CA 3VKJA 5HINA 3TKFA 1TTIA 3PN8A 5GNZA 3W82A 4FLOA 3CHVA 1ME8A 3LPFA 1E5JA 4CNUA 3E6EA 3CQ0A 1US0A 2JBMA 4I5RA 1FY6A 3C2YA 4OGZA 3DHUA 2ZX8A 1ML1A 4F0KA 1KBKA 3PZOA 5AC5A 6TIMA 5H91A 1FRBA 3LBMA 1G69A 5G1TA 1KFCA 1AQ0A 4NNAA 3EX1A 3QPZA 3S5ZA 3ZVIA 3RO8A 3ZM8A 2ANUA 7REQB 1OFBA 5XIAA 3IJ9A 3VNJA 4UNKA 2PLCA 3WUEA 2PWHA 3LHWA 1N82A 3TNOA 1F4HA 3LTYA 3N29A 2YCIX 4HQVA 1XD0A 1MWOA 2VEIA 4OOZA 3HQPA 5E09A 5JBFA 1EA0A 4X60A 3VNZA 4XBKA 1E51A 4HA0A 3C3UA 1R9YA 1ZALA 2P88A 3HJEA 1J01A 1W1YA 2VZTA 1XGZA 2OKTA 1VPXA 3FAXA 1D7KA 1AH3A 1Y0EA 1ONXA 4DUXA 2ZZ3A 2WSPA 5FIPA 4JAWA 2X2GA 1E6NA 3TN6A 1KRCC 2DT3A 3CTTA 1IEWA 3STPA 1DWGM 4ZO8A 1BRLB 2UY2A 4DBUA 1DJYA 4FZIA 1MVYA 1ZAJA 5LIUX 4D8AA 3H26A 4P8WA 4DVOA 4ATWA 3QEZA 2PAJA 1EC7A 1XSKA 2R14A 4Q8VA 4E3VA 3UG5A 4JICA 3AISA 4EKJA 4NZ1A 2OLHA 3EPNA 4B4HA 2PRLA 3DI1A 1S2AA 1FWJC 2WSQA 4ZO6A 3QC3A 1B1YA 5I3IA 3MC5A 4KRTA 3NOEA 1O66A 4ZOCA 4LGXA 4Q8TA 3ARRA 3LENA 3C4UA 1DBTA 4XB3A 1OFDA 2PDQA 4IPIA 4B91A 3CQJA 1GKRA 2Q8LA 3DCPA 3BG5A 3BH4A 1UHVA 1YPIA 1WOBA 5CGTA 4RDZA 3CV2A 3AIBA 1G7UA 1MYRA 2PDJA 4HVXA 2O7SA 1KB3A 4WD0A 2Y7GA 3WNMA 2DJXA 2GJXB 2R94A 2WVVB 7ODCA 4IF2A 1V6VA 1P0EA 4E8DA 4DYKA 3FCPA 2W5FA 4HMDA 3KVMA 5E0KA 3CZLA 3GO2A 3PAOA 3UZXA 3OBEA 4W7VA 2YZRA 4DN1A 5FA5A 5H1WA 3LDVA 1YXDA 4GVHA 3IRDA 4MWAE 4YTRA 1GQLA 3CC1A 3DFOA 4EAMA 2A7PA 3GX9A 3CIVA 3RCYA 2W0UA 1EBGA 2Q8XA 2R1NA 4QQ3A 3LX9A 4ZODA 3N4FA 4RDYA 3SO7A 4GA8A 4GCXA 3LCWA 6XIAA 5CC7A 1XYZA 1F07A 3FNDA 2C1GA 3ZLFA 1XJBA 3W88A 1JCNA 3DYOA 2GFTA 3NL5A 2WNWA 1EL3A 1XICA 1JRBA 1JCMP 3ITYA 4ZVJA 4URIA 1HGWA 3RK8A 2WNQA 4EPEC 4UXDA 3T0AA 4AEFA 2FGBA 4PSPA 3UPWA 4NKCA 3VILA 2R91A 1OFPA 3REQB 4NY2A 2X1IA 4C1KA 1MW2A 5A8NA 3EB2A 1V6UA 1UR2A 1E1CB 4S2CA 1TV8A 4C5ZA 2NV9A 3W29A 2QXWA 5A6JA 2HE8A 2J6VA 2FZNA 3S46A 5A6MA 1UBPC 5A8MA 1A47A 4QQUA 3QV8A 3WBAA 2DUZA 4H8VA 4RCXA 4UFMA 3MUAA 4AVNA 2OSXA 5C9UA 4NZ4A 3BG9A 3EXSA 2NUWA 3A6OA 2V69A 1KLYA 1BEUA 3T1GA 1DJNA 3EOEA 1UWRA 2BVYA 3TDFA 3KX6A 3KLLA 1Y7VA 3GYCA 3TLQA 1EJRC 4PMJA 3RUBL 1ITCA 4PC8A 1YNYA 4ZOAA 1RSCA 2QEZA 3VE7A 1MXSA 4IPJA 2YBVA 2PTDA 2XWDA 2I1OA 1DIEA 1UUMA 1JG9A 4LUTA 3GDBA 4CQBA 1G94A 3I3DA 2P0IA 5FJOA 1WBHA 2DIKA 2IXUA 5DY2A 5F4WA 1JF6A 4GOAA 2DQWA 1KM0A 3VDGA 1S2WA 1J8VA 1NELA 1TX0A 4JQAA 3H21A 3M5XA 5D2WA 3WNLA 1A3HA 1O7AA 4DJEC 1SZFA 4W89A 3SIMA 1XLIA 4H83A 4O57A 3KOXA 1E0UA 4LVBA 2W67A 4WJEA 3QF0A 3QQ0A 1DJZA 1TZ9A 3CUFA 5CAHA 3W7LA 2RDXA 4CVWA 1W2VA 2WAGA 1QNSA 3SJ3A 3CZEA 2G3MA 1XLCA 2BXZA 4DJED 2REQB 3GVVA 3IUDA 2XH0A 1S46A 3NDZA 4H7VA 5IM51 3SUVA 2DPEA 3BZGA 4NZ5A 3BJSA 3H55A 1IXOA 1H49A 1SW0A 3UETA 4DWSC 1C7TA 5HMEA 5BZAA 3H7UA 3I4KA 3T09A 1QDSA 3UWYA 1H7PA 3VC5A 1Q65A 3EWUA 1TRIA 3BCJA 3DKJA 3LBOA 3HQOA 3MZ2A 4GYPC 1KM6A 4ZL1A 1M65A 3DAQA 4WDXA 1KFWA 3MP4A 2Q02A 2QF7A 1JDDA 1GOIA 3ARWA 2G5WA 3ES7A 3UZJA 2A85A 1MRAA 2INFA 3TYZA 4PMQA 3AICA 1CXIA 3VNKA 2VGFA 4L6OA 1JZ3A 5T9CE 1P6WA 1SO3A 3GW0A 5KZMA 3HU7A 2QMKA 3IUIA 4P7QA 4GZ7A 2E5CA 1MI3A 1WQ5A 1CXFA 4JKLA 3XIMA 3ITTA 3MO7A 5HUOA 3N25A 3NAVA 3W1LA 1EQPA 5CEWA 4GZIA 3H54A 4OE7A 4KMQA 4HZMA 1UKTA 4AZ5A 1Z41A 3VZXA 2V82A 5IXEA 2ZX6A 3ZYZA 3KBJA 3P84A 4QR6A 1VCVA 2OB3A 3WK3A 3NPVA 2PODA 5TNVA 1LDCA 5EYWA 3JU2A 3S6TA 1PTGA 3NYDA 1CPUA 1MSSA 3VIKA 1DKWA 3S5OA 1DXIA 2WZTA 4WVXA 2O9RA 1A3WA 4XZLX 4GBDA 2XIIA 4EWND 3DH7A 8A3HA 1IQ8A 4FR6A 4D1JA 1O94A 3EB3A 2OWCA 3ITCA 2BNJA 2VRKA 3NZQA 3W01A 3RCNA 4HP5A 3SGUA 2Y1HA 1ONEA 1PSCA 2W79A 2UY5A 3CIXA 3L5MA 3O6CA 5L6UA 1I2RA 4JGDA 3R10A 5G5IA 3SJNA 3NM1A 1EEPA 4UC5A 2YXGA 2R82A 1ZQ5A 5AHFA 4D6IA 1J0IA 3SQSA 4QSHA 1Q7MA 1C8QA 2AOSA 3N4EA 4S1FA 3CUZA 4X63A 1L6GA 2VP8A 4M80A 2A3LA 1RCQA 1JFXA 2IQTA 5I6SA 1VPYA 3SEPA 2VKZG 5AZ1A 4BHYA 4CEXC 1YDNA 4S3EA 2WMFA 1RBLA 5GVJA 1QHPA 2FPYA 5HXMA 4WGXA 2FYMA 3WF1A 5PTDA 2GVEA 1HL8A 1LG1A 1QU4A 1EF2A 2OT1A 3N6HA 4UMAA 1VFTA 3SCTA 1NWSA 3XINA 2YDSA 2NXIA 4XX6A 1E1EA 5FL0A 1HKIA 3CWHA 3LTSA 4IT1A 1BG9A 3CMGA 4KGJA 3R11A 3THAA 1QNOA 3BWWA 3ZOAA 4ATDA 2PDYA 3L2IA 4KCTA 4WOQA 3DHFA 4JYDA 3G1VA 2ALDA 3WFZA 3OP2A 5EMUA 1UUOA 2PRMA 5CSRA 4KQNA 3CV1A 2XHYA 4M29A 1RLDA 4AD0A 2R9RA 5C9RA 1NSJA 1TPC1 1QOXA 2ZZ1A 4QLJA 3FY1A 3C2FA 1WXYA 1RCOB 2CC0A 2Q6ZA 2ZTJA 4N02A 2JK2A 3URAA 3N6JA 2OWWA 4H9TA 1BKHA 4GY0A 5DANA 1GVIA 4ICCX 7A3HA 1GEHA 5AHMA 3TTOA 2C19A 1YIXA 3LCHA 4K68A 3MA8A 3PPCA 1DEDA 1VHCA 3H7VA 4C1LA 3BSMA 2GQ3A 4ZA0A 4B5NA 4H9VA 3VOCA