1QUMA

Crystal structure of escherichia coli endonuclease iv in complex with damaged dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
b'MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*TP*CP*C)-3'
molecule tags Hydrolase/dna
source organism Escherichia coli
publication title Structure of the DNA repair enzyme endonuclease IV and its DNA complex: double-nucleotide flipping at abasic sites and three-metal-ion catalysis.
pubmed doi rcsb
total genus 105
structure length 279
sequence length 279
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 1999-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1qumA00
1XIHA 3UU0A 5B80A 5XINA 1XIFA 1D8WA 3U0HA 1OADA 3L23A 5TNVA 4EACA 3U3HA 1XLMA 4X61A 3ITLA 1XIGA 2I56A 4K1GA 1QUMA 2GVEA 4OVXA 3UVAA 4LNCA 3VNJA 2QUMA 2HK0A 3BWWA 3JU2A 3QXBA 2NQJA 1A0DA 3KCLA 2GYIA 3KBSA 3P14A 4Q7IA 3M0LA 5EMJA 4ZB0A 3UA3A 4A8NA 3DBNA 4J4KA 1QT1A 3ITYA 3GNXA 1GW9A 3KBNA 3AYVA 3TC3A 3XINA 4X63A 2G0WA 1DIEA 1XLHA 2XINA 4XSMA 2NQHA 4GJIA 4X60A 4YTQA 3QZAA 3KBMA 4DUOA 3VNKA 4DVOA 1XLCA 3AALA 2HK1A 4PFHA 4ZB5A 4GQBA 5I7GA 1XP3A 1DXIA 5J8LA 2I57A 1XYBA 1MNZA 1XLFA 3OBEA 3KBWA 3AAMA 3C0QA 3UXIA 1K77A 3VYLA 4XISA 3IUIA 1BXBA 1CLKA 1XIBA 4QEEA 1XIEA 3M0HA 3ITXA 1S5MA 5B7YA 1XLEA 5XIAA 3P6LA 8XIAA 1XISA 2QW5A 3FVMA 3BZJA 2G4JA 3KCJA 2X7WA 4EAYA 1XIDA 1XINA 1DE6A 3KTCA 3KBJA 4YTUA 1XYAA 1XICA 4K3ZA 2Q02A 1XLGA 3NGFA 5AVHA 3XISA 1QTWA 1XLJA 1TZ9A 3DX5A 1XIMA 4GJJA 3CNYA 6XIAA 3C0LA 1XLIA 2HCVA 2OU4A 2GUBA 3LMZA 2XIMA 5H1WA 3ITVA 7XIMA 1XYCA 3CQHA 3M0YA 1I6NA 5EMMA 4XKMA 1BXCA 3KCOA 4QDPA 1XIJA 3BANA 4YTRA 9XIMA 4GLEA 5H6HA 4YTTA 5C9ZA 1XLLA 4XSLA 3IUDA 4ZB2A 2QUNA 1A0CA 3ITTA 1A0EA 2ZDSA 3KBVA 1S5NA 3M0MA 4QE4A 1XYLA 2X7VA 4US6A 4QEHA 3C0SA 1YX1A 3VNIA 4HHMA 3TVAA 8XIMA 3QC0A 4ZBCA 4QE5A 1O1HA 4A8IA 6XIMA 4YTSA 5B7ZA 5EMLA 3M0VA 4QE1A 4QDWA 2GLKA 2J6VA 1XLDA 5FA5A 5XIMA 1I60A 2NQ9A 4XIMA 3CQIA 3VNMA 1XLKA 4KW2A 3CQKA 3CWHA 4HGXA 5EMKA 3UA4A 3AYTA 2XISA 3QYSA 3ITOA 1XLAA 3M0XA 3CQJA 3BDKA 4A8RA 1DE5A 4W4QA 1XLBA 4HHLA 4G56A 5AVNA 3WQOA 2QULA 4XIAA 3KWSA 1XYMA 3IUHA 3N4AA 3BZGA 9XIAA 3XIMA 4E3VA 4HNOA 3VNLA 1DIDA 4PGLA 2ZVRA 1XIIA 4A8LA 1MUWA
chains in the Genus database with same CATH superfamily
2GK1B 3CLMA 3O0FA 2YDAA 1AH4A 1GUVA 3DFHA 1RXOB 5CPOA 3O07A 4PB3A 1YBQB 2MNRA 4JN8A 4HA3A 2O56A 4HYRA 4P5UA 2HS8A 1S2VA 1FWNA 2Q8LA 4OFCA 3GZ3A 5I06A 4DJEA 1S3HA 3LI0A 4MJ4A 1W9XA 1UMLA 5G4WA 4JTUA 2GDQA 3SGZA 2BXVA 4M80A 4IL0A 2IKJA 4LBRA 1R47A 4XISA 2ZUVA 3RHGA 1LG1A 1LORA 1T40A 3H55A 2AMXA 1CEOA 3R13A 4K3ZA 2I5GA 4IPLA 1Z9AA 4UNKA 2PTWA 1X1ZA 1OF6A 3BTNA 3NO1A 4JTSA 4XTIA 1O95A 2D22A 3R5EA 5F7UA 2CLHA 1G94A 2PD5A 3GU1A 4Q22A 1KQZA 4QX4A 1SMAA 3DYMA 4GGHA 3EOLA 4NP7A 4YWIA 3N4EA 2W9MA 5B7ZA 1J10A 1E0XA 4NJJA 1C8YA 2GQAA 4DPPA 5EB8A 3L66A 3QMRA 4PMNA 3T0DA 3B8WA 1FVPA 1UR8A 4Y2WA 4HB7A 4O53A 4HA0A 3H2OA 1RK5A 2AAMA 4PB5A 3V0TA 1AL7A 2EPKX 1TJRA 3BARA 4GHRA 5LSMA 2PDBA 2NV2A 4XD6A 5FKYA 4JHOA 3G1FA 2D69A 5JU6A 1V8EA 2PTYA 1JNEA 4PH6A 2A7NA 4LC8A 2EXOA 1IXPA 2D24A 4H9VA 1EPXA 1B31A 3CV6A 2V5KA 1X97A 4MYAA 1MRQA 5A6TC 4C6MA 4JKMA 2D3LA 5TQLA 2AQVA 1NDVA 1J6OA 5I3JA 2J78A 5E9XA 3LBMA 4X0NA 2JKEA 4EKJA 4NZ4A 3S46A 3BG9A 4CNSA 3SUTA 8XIAA 4Z2IA 4M24A 4IMDA 2QMJA 1UKTA 3RU8X 3W53A 4KT2A 4DM1A 3RGTA 3OYXA 2PODA 1XLGA 1FP9A 2YZRA 4DBEA 4M8UA 2A3HA 3FXYA 4W87A 4DXKA 1Q2SA 2WCGA 2H9AA 2E7FA 3QW4B 1P43A 4YTTA 1CGXA 4AZCB 1A0EA 5T8GA 3M0MA 4D1JA 2X7VA 4B5WA 4FHAA 4GY7A 3IVTA 1GCYA 3BG5A 1R3WA 3P93A 3NZRA 4XZIA 3TR2A 1KFJA 3SFWA 3ZLFA 3GTFA 2ZA3A 2WJFA 5CH9A 1EC9A 4P7QA 1GQIA 1ZAHA 3CHVA 3U8GA 3F2CA 1XRVA 1JPMA 3EZ4A 4HZ7A 1XFBA 3WELA 3NDZA 3AXKA 1DL3A 2WMKA 3CASA 4DWSA 1CTNA 4MSSA 4P7RA 2RHGA 2J25A 1TJ0A 1B5TA 3SEPA 2XVPA 3BWWA 1OGBA 1TTJA 4PMDA 4HNVA 3VGFA 1RJPA 4O0ZA 1CXFA 1CB7B 2PD9A 5FSDC 2VHLA 3KBMA 2RFGA 3W88A 3BLPX 3S5OA 4AWUA 2CWXA 5FEZA 3AAMA 1EGVA 4YS1A 3CWNA 1UQZA 1FWFC 3CUZA 1FHDA 3A23A 3A5VA 4R9OA 4DIAA 1GEQA 5CXPA 4KPLA 1RK6A 4I9MA 4WSHA 4FX6M 3SCRA 3NL2A 3PZTA 4AF0B 4WEVX 3VIIA 3OLDA 2PDPA 4S3AA 5A69A 3EX4A 4XTDA 1OF8A 3GDKA 1VKFA 4LBSA 2EPOA 2V3DA 4F0KA 4IJBA 3MMDA 3ZVHA 2XWDA 3WUGA 3USZA 3TYUA 1TPC1 2CBUA 2HBXA 3TEVA 4PMZA 3AWNA 3VTRA 1UPPA 5AY7A 3HG3A 3PR2A 3KAOA 3LPGA 2ZQ0A 1UA3A 5I78A 4QJ1A 3TYCA 1XBXA 3GKFA 1Q65A 3EX2A 4GWEA 3DZ1A 1PTDA 5T9BG 3GDLA 5FEPA 5BOEA 3HN3A 4LNYA 5I3IA 1EO5A 2X05A 3GW3A 4BA0A 1CW2A 3F4CA 4MHBA 1H61A 2ZOXA 3LPFA 2ISWA 3S83A 1DHKA 1LL6A 3SAZA 3F7JA 1FDZA 1XGEA 5HQEA 5KTLA 1JPHA 3QTPA 4N7QA 3VOCA 1GPWA 3CIXA 1LOQA 4FX7A 5HANA 4YLWA 4XV0A 5JBEA 4D8ZA 2G4JA 1EJVC 2Y8KA 3BAIA 1ML1A 2FZ8A 4ZODA 2CKRA 3UR7A 4KRUA 3SFKA 5CC6A 4JYDA 1BTCA 5HNNA 3O8AA 5I00A 4ASTA 1OEPA 3SCOA 1AD4A 3NQMA 4M3PA 2E3ZA 3RXZA 1CBGA 1F05A 1L8PA 2QCGA 5TBOA 3TX9A 3G1SA 2WZIA 4NZ1A 1LQ0A 2W27A 1E0TA 3M7WA 2DUZA 3L0NA 1UD8A 2H9AB 4C6KA 4BQ3A 1J0KA 1M65A 1J0JA 1SZFA 4J3UA 3R6IA 3WBXA 4GD0A 3M0ZA 2VEGA 3UYCA 1VJIA 3RIKA 1LBLA 3A21A 3W00A 1W5NA 4CU7A 3UVIA 2QF7A 3AMKA 3LPOA 2Q8XA 5GNYA 1ODZA 1GVSA 5HQLA 1NWUA 2FTPA 4XAYA 1SM9A 2TAAA 2XHYA 1F9CA 2VRKA 3G18A 1P1MA 1V03A 3FKRA 4WLCA 3KLLA 3ZO9A 2INZA 2ZX5A 1A53A 3N3MA 5BXTA 4DUOA 2A21A 3VOFA 3OW1A 1FRBA 2HK1A 1L6YA 3MP3A 3SO7A 3WUBA 5G2HA 2VDGA 2Y6ZA 4JEJA 4UMBA 1XIEA 3BW2A 5IBXC 3EMQA 2R24A 3KEHA 2C13A 4WVXA 3MI6A 4FB7A 2XIIA 3T7VA 4H6KA 3M16A 3ONCA 1Q85A 5F4XA 3NL5A 4MLRA 4WGXA 4OU1A 3SB0A 4B5UA 3LMZA 2GUBA 4D1IA 1B90A 1YPIA 4Z08A 4AD3A 1A3XA 5CPTA 1EEPA 4JCLA 4ATLA 2Y7EA 4ZCWA 1XYLA 2RDUA 1ZP4A 1SZRA 3MZ2A 4QE5A 1RVKA 3UR2A 4O1EA 2PWDA 4UTTA 5C8BB 5A8GA 3B8DA 3ECQA 2OSYA 1C91A 1VB9A 2VC7A 4HQVA 1EL3A 2CLIA 4JTRA 1E6ZA 1LJYA 1I9CB 5EKYA 1PPIA 1I0BA 4AZIA 3W84A 5M2FX 3DKLA 3B97A 1ESWA 1BF2A 4Z17A 1NELA 1TRIA 2VX7A 4RJEA 3SJNA 4EE9A 4W8LA 4J1OA 4DJFD 2IPJA 3LLDA 1EZWA 3GXDA 3KS5A 3ZYZA 1AFSA 3N1AA 3COTA 3GRIA 5MF5A 1MQRA 4HMNA 3TMQA 2J47A 4O0QA 2GJNA 3CL7A 5CLWA 2P3EA 1EA0A 3VKJA 3UQNA 4NG3A 4REQA 1KGUA 3MSYA 1K4HA 2VZVA 4A35A 1NFPA 3R0KA 1VHNA 4M19A 4XWUA 3BOXA 3G3DA 3UG5A 3KBJA 1XYAA 1Y5XA 1TPEA 2YKKA 4MPQA 3REQB 3CEPA 2PGRA 5DELA 3W7NA 3WQWA 4XSLA 4L65A 4S23A 1NEYA 3SZ8A 4QFUA 3A24A 5C71A 3N9SA 4YTSA 3MVIA 2CLLA 3U4FA 1BYBA 4ROQA 4AD2A 3I4EA 2YPIA 4MLJA 1H7WA 3LRKA 3N13A 3G0SA 2R1NA 5LYRA 2BGNE 2R1KA 4RCXA 1NIUA 3W0KA 2HROA 4FOUA 3I6TA 2G41A 3VNLA 3W2JA 3LI1A 4L1WA 4AZGA 3MY9A 2ZRUA 1ZBVA 4XB3A 3NNTA 4GYFA 3AUJA 1UZ4A 3S6TA 4IIHA 2ZVIA 2FFIA 3I6EA 4Q7NA 3VOIA 3CT2A 5J5DA 3S4TA 4KH2A 4GCAA 1IGSA 1S2UA 2WPGA 2E09A 4B3LA 2YW4A 1Z69A 3E2QA 1R30A 4MB1A 1YDVA 3B3DA 1NFGA 2WCSA 1G4EA 3GFYA 2DZWA 2O55A 3PNUA 1EPVA 3KCJA 4UQBA 2ISDA 3SCTA 1DIOA 3M44A 1J4EA 3RITA 3A4AA 4UTJA 1H5YA 4DRSA 2A1YA 2OU4A 2F84A 5E5CA 4GKLA 1UH3A 1WDQA 3FSUA 4QE4A 3LX9A 2F8QA 5E0FA 5C2CA 3RO8A 3TSDA 3ANVA 1D3GA 1GQJA 1YQ2A 3LRLA 1JEZA 4H1ZA 1LF1A 3WH6A 1GHSA 4QDMA 2Y89A 3KRZA 3SN0A 2XH7A 3DAQA 3WK0A 1NSJA 2F38A 2G3MA 4WGHA 5AHLA 2D3NA 4GNJA 3NQFA 4XZMX 4QISA 3G8RA 3WX7A 3N11A 4ADTA 1XH0A 3UD6A 4C6JA 3TTQA 2CBJA 4K8HA 4GISA 3M1ZA 3ONBA 4POCA 3QC3A 3MV11 4LX4A 4WRHA 3HPXA 5HWNA 4GG9A 3O2LA 3PUOA 4MAZA 3MCNA 2VDHA 1DXFA 1I45A 4C6PA 5AN7A 3TAKA 4MFEA 1GPFA 1YMYA 3BAYA 5CPMA 3LBOA 3WD1A 1TFVA 2Z27A 2OWXA 3HPFA 3FVMA 1UUOA 4IOTA 1YNYA 3NPXA 5BRQA 5E1QA 3T0TA 1UJQA 3L65A 4Q7BA 4LF1A 3IJ7A 4HPJA 1AZ2A 3D3AA 4R7JA 3DYOA 4DO4A 1XIJA 2VZUA 2Z00A 5IRPA 2CBVA 4MY8A 4TUFA 2WMJA 3F4DA 1IXOA 1LQAA 3BVJA 3OHIA 3S2LA 1V3HA 5ECVA 3B8IA 4GA8A 2PRHA 1RHCA 3ISIX 3O9NA 1OG6A 1OT1A 3UZ5A 1V4YA 3M0IA 3L4WA 1XLKA 1HJWA 3BC9A 2D23A 2XISA 3TTSA 3QV9A 3IJ8A 1HP5A 3L5MA 2H8ZA 2BVDA 2OLAA 3FKKA 4XBKA 3CZEA 3I68A 1X6UA 5CJMA 2EBNA 3L23A 1ZJBA 1VYSX 4PL2A 4MVAA 4DYJA 1VCFA 2QAFA 2X2GA 4W7UA 1UBSA 2V68A 3PFMA 2PTXA 4C6QA 1KM4A 2FPTA 3GVWA 3SIMA 1LRTA 4D8LA 2YL9A 3UJFA 1JCLA 2WVTA 3STEA 1FWCC 1BKSA 3M46A 4YL2A 1IIGA 5M5DA 1TREA 5LXEA 4GY1A 1OFPA 1T8QA 1BGAA 5DY3A 2Z25A 2DZBA 1K3UA 1DWAM 2X0HA 4P61A 3DHUA 3NCOA 1OWQA 4CN4A 3OU8A 3CZLA 2QCNA 1FHLA 5D2WA 4GZJA 4UCFA 2ZA2A 3IGXA 4L64A 2PF0A 1B3ZA 1SJAA 3QLLA 3TQKA 1O5KA 2WO5A 3ABSA 4HSHA 3MUAA 3UG4A 3WBEA 1XLDA 3GE7A 4KS0A 3MMUA 1EWEA 3K46A 3VNMA 3STFA 4BFAA 2GWNA 3ITOA 2FHFA 4O8AA 3R25A 5M17A 3I7RA 5E6ZA 2E25A 4TV5A 3ZJKA 5GJPA 1F3XA 6REQB 1UJPA 2YA0A 4FS9A 3U5YA 6REQA 1DHPA 4I7UA 1AD1A 3P61A 1ZBWA 1U1HA 2OLHA 3L4TA 2B81A 1U5HA 4NZCA 4NNCA 4K1WA 3WL1A 4JXCA 1XLMA 3LHZA 5G1TA 4HU0A 4PCFA 1QUMA 3MU7A 3WLRA 1LQ2A 5EBUA 2A85A 1M53A 2GYIA 2EKGA 5I6SA 4D6CA 1HTIA 1IEWA 1K4GA 1JR1A 5DBUA 4LQ1A 1ZQ5A 4IG2A 3GHUA 4D8AA 1KLZA 2J7BA 1C92A 4GQBA 3PTQA 3WD4A 2GJXA 2NQZA 5AC6A 1OT2A 1F74A 2R1LA 3K4DA 1TSIA 3W7PA 1OFOA 2QZRA 3APTA 1SSDA 2WHJA 3LGEA 3ES7A 5KINA 3M5VA 5BWFA 5LIWX 2FKPA 1JI1A 2OPJA 2RH9A 1YBQA 4YTUA 4NXKA 3BE7A 2PSNA 4G7FA 2NV9A 8RUCA 1JFHA 4ZFMA 2VURA 1D3HA 3PS7A 2FPYA 1KB3A 4IFKA 2YL5A 3A5FA 5EGRA 1YNPA 3TYDA 4DAFA 2HS6A 3CUGA 1E72M 2C18A 2PF8A 2PDGA 1R3VA 2C0AA 1GNXA 3TQ0A 3B9DA 5G1MA 4ZSTA 1QW7A 4LS1A 1L6SA 1TWZA 1I0DA 1KBKA 3OLEA 1ZUAX 1CGTA 1NDZA 4AIOA 4G9PA 4KRTA 4RZ6A 1EFZA 4PMJA 5EMYA 3LCWA 4A8LA 5JQ9A 4D6JA 2NT0A 4NIRA 2C0HA 2RAGA 1ENUA 3DBPA 1MEIA 3UVAA 1CCWB 4DHGA 1KM5A 1NAL1 3KBSA 3T2QA 3GNNA 2DZUA 2ATSA 5ABHA 5D2TA 3UG3A 3P2VA 2E8YA 4XUGA 2NQHA 3EKLA 4C7FA 3WIJA 1XLFA 1F3EA 1AQFA 2XM2A 5LHFA 4L9ZA 3ALFA 4GQRA 3VD3A 1SJDA 3KOWA 4TX8A 4P2VA 1PIFA 4ZVJA 2Y88A 2JEPA 1XISA 2AOSA 3IJDA 1C9WA 2D2JA 1I1WA 3VCRA 4X9YA 4XAGA 4IM4A 4RV8A 1JD7A 3QY7A 3DIPA 5AZ1A 4GI8A 4US5A 3IIVA 1XGDA 4HMEA 2V5BA 3QGVA 3RM8A 1PCKA 5C9XA 2QUNA 1E1CA 4IMGA 2ZDSA 4LAMA 7REQB 3RF9A 2OODA 3ZJ7A 3QRHA 2ACUA 4HHMA 3U2CA 2E5CA 4KFPA 4KEMA 4CVWA 2CW6A 3G3MA 3RLVA 1M68A 2YBTA 3EPOA 3VC6A 4HZ8A 4FOKA 3WH8A 3R0UA 3NEHA 3TMLA 2UZ9A 1IQ8A 1QHPA 5E0KA 1EXPA 1XYMA 3WQ5A 2AGKA 3N4AA 4IFRA 4L6OA 1X7IA 4IT1A 5MKGB 5CPQA 4ZTXA 1YDOA 2OYMA 1NWRA 3GR4A 3II1A 3W7DA 1IEIA 3FSTA 3UZYA 2OOGA 2Z1KA 1C90A 3S3GA 1B57A 2QPUA 4H9ZA 1QVBA 3LHTA 3TZFA 1PIIA 5GJMA 3W2NA 1B3YA 2CXGA 1EHNA 1Q6DA 4CQCA 1AQMA 1JAEA 3WDHA 4AQLA 5C6MA 1BPLB 2GVYA 1B0IA 1CXKA 2R82A 2FB3A 3BJTA 3LCHA 2WMIA 3CHEA 7ODCA 1JYVA 2C14A 4W86A 1H0IA 4H83A 4UNIA 2FJKA 1TYGA 1BSLA 4MWAB 1EA9C 2XVLA 1RJRA 1US3A 3CAQA 1IF2A 3B8VA 1NOWA 1OK6A 3GXNA 3PUGA 1G4TA 5BXRA 3RJXA 4CCZA 1VQTA 5FIPA 6TAAA 1A50A 4GKTA 3HQ1A 5HWJA 2ANUA 4PR4A 2XVNA 3U6WA 1P0BA 3F5LA 3W75A 1I60A 2C8NA 2XN1A 3TYZA 2GVGA 1DTUA 1MNSA 2PUZA 2D2GA 3BLEA 4U3AA 3ERPA 2XH2A 1IYXA 2QMKA 2GJPA 3WKZA 2F9RA 1E4NA 1J5TA 3TLLA 3V7PA 1WZAA 1W8GA 5ABTA 4U10A 3IJ6A 4G2DA 3BV7A 4DUVA 2ISVA 1HZYA 1LUCA 4ZOBA 1AVAA 4LGXA 3VDAA 3AXHA 3RMEA 3H2CA 3H54A 1JF6A 5CG7A 1FFRA 4Q8UA 3UR8A 1WE5A 1C3FA 4YMZA 3SUWA 2P1FA 1N8IA 4HA1A 4GVFA 2W61A 3CK5A 5F1UA 1C8XA 4LUSB 5DX7A 1V0LA 2P76A 4KKXA 2EEXA 3W1PA 4RNIA 3KXQA 2OELA 1V6WA 4LUIA 4AVNA 4O57A 4M51A 1XINA 1OABA 2BWGA 1W91A 5CGMA 2TYSA 3GTXA 5EBAA 3LHYA 3GTHA 3S1VA 1E0UA 3MMWA 3BJSA 1E40A 3TN4A 4PMUA 3UP8A 2POZA 2ZRYA 4GMEA 1HL9A 3IIXA 2O92A 3A3XA 8XIMA 2Y5EA 3U48A 4BEUA 4AY7A 2BY3A 1FP8A 3GX9A 1XC4A 2AGTA 1MZHA 2VWSA 1Q4NX 4F8XA 4O10A 3Q94A 2QULA 1QFEA 5ENLA 4HNCA 3OVGA 2NSOA 3FA4A 3ZVHB 4QQ3A 3DECA 2OQLA 2PDWA 4HTBA 1AA1B 3C8FA 5JH2A 3W71A 1DQWA 4H00A 3RPDA 1T41A 3T4CA 2V0TA 2HK0A 3FHAA 4MZ1A 1GJWA 4ZB0A 4O52A 3WQVA 1VBUA 2DFAA 5LKYA 3AYVA 1J0ZA 3L21A 4ML9A 1CDGA 1XHGA 1OC7A 1P6BA 1BVNP 1Q6OA 1POKA 4GIAA 2YB1A 2DT1A 1SFSA 1GVFA 3EXSA 3SGGA 2E6YA 5K2ZA 1V51A 4CU6A 2QEZA 3LD5A 3MT1A 4P7NA 2PLCA 4LSBA 2JFEX 3DENA 3MVTA 1KRMA 2WMIB 1SO3A 4I5RA 2PP0A 4Z1CA 4YJ5A 4CNPA 4RE3A 4A3RA 1IHIA 2ZZ2A 3PM6A 2J13A 4QQUA 2CLFA 4DO7A 2Z0IA 1M7JA 3VMNA 3LCXA 3O63A 4F48A 1O1ZA 1H1ZA 4J3ZA 3UXDA 1ADOA 2J9XA 3MSRA 3P60A 1ELSA 1E3ZA 2NQ9A 1FWTA 3UPWA 2G3JA 1K6WA 4NILA 2XIOA 3M0KA 3R8GA 4WDWA 4A2SA 3CYJA 3CGTA 1BEUA 4DWSC 3L4VA 4TX9A 2Z6JA 4IHCA 2BOEX 1BQCA 4B9ZA 5IOBA 4ZENA 1MI3A 1MQQA 1PYMA 3K4AA 3M64A 4XAFA 1XIIA 1SW3A 4ICCX 5D37A 3WMBA 1TPWA 5BOOA 4UTWA 3CV1A 2X1IA 4UXDA 4RNJA 1K8ZA 1XRSA 2DVUA 3G0XA 3PZIA 1HUVA 2VP8A 3CH0A 1BWVA 2ZADA 2GQ8A 4JTJA 3DHPA 2ZX9A 3WLHA 2HBVA 3RO6A 1UR4A 3SRDA 1DBTA 1F8MA 8TIMA 3VFLA 1QOPA 2CIPA 1ISZA 1ME9A 2ZRWA 1CNVA 1GW1A 4JX6A 2ON3A 2CYGA 3Q58A 2J66A 1N8FA 1RCOB 4F9DA 1WKEA 3E49A 1KFBA 3VAVA 3GO2A 3MP4A 3GH5A 4WCJA 2J77A 1XYCA 4ROPA 3CAKA 3BANA 1A3WA 1OM0A 4PCTA 3C3NA 4GLEA 5F4SA 3UNTA 5A6KA 3MUY1 4R3UA 5LNUA 1XUZA 1JZ2A 2VWTA 1RJQA 4FF7A 4MB5A 1RA5A 4RE4A 4YPJA 4HYVA 2PBGA 2P8BA 1UZDA 1V7YA 2WLZA 3CQJA 1JF5A 3WLMA 1FQ0A 1P4CA 3C6CA 4JTCA 1IR1A 1LRQA 2PU0A 1TA3A 4FX8A 3SSZA 4JY8A 2GWGA 5FSEC 3RPMA 2QJMA 4U4MA 3RX4A 4AMAA 4W5ZA 2DSKA 5I79A 1FA2A 1TUFA 1NH6A 2E5BA 3BAKA 1UWAA 4WKFA 1WX0A 1OFBA 4H9XA 2ONEA 1LM1A 3QVQA 4HNUA 3WMLA 3OVQA 1P7TB 2B7OA 2XINA 1KFEA 2HMCA 4L4MA 4Q4MA 2Y2WA 2G4FA 2OYLA 1VD6A 2QS8A 4WKAA 1GOQA 5FI8A 1RP9A 4PMYA 5CZ0A 3V5OA 3DHFA 2H3DA 1BD0A 3WLLA 3BGJA 1Q6CA 1EJRC 4AZBA 3FJ4A 2J7FA 2Q02A 2Y7DA 3BLOA 1O7AA 1FY6A 1KCXA 2ZZ5A 4IZGA 4YNGA 2X16A 3GU9A 2CXEA 1A4LA 2W4XA 4JL1A 4L4LA 4R33A 1SR9A 3CUIA 1SQ7A 1S5NA 1YRRA 4HMDA 3FOKA 2BVYA 1M01A 4A6GA 3PF3A 4NUWA 1NP2A 4ZXOA 1XWYA 5FA5A 3O6CA 4XZBA 2WSRA 5H91A 3F4WA 2V6AA 4E8CA 4AY8A 3BAXA 3AHVA 1VFOA 1PKYA 1I1XA 4PTVA 2PRLA 4CQ9A 3LCIA 1KRCC 1ICPA 3LCLA 4IFOA 2JIWA 1EIXA 2QCLA 1RBOB 3CUHA 4S3CA 5CAKA 1TO3A 3NQEA 3TXVA 3R89A 1DJHA 2HSAA 2ZE0A 3SCVA 2F2HA 4PSRA 4XVDA 4IIEA 1VFUA 4RK8A 1D8CA 3GUWA 1O5RA 2NSXA 1EJ7L 1H0GA 2XTKA 3EWWA 3EXRA 4B5XA 4MADA 3KRUA 3M0LA 4GQGA 5MHBA 1A5CA 4MZ8A 1L2UA 2QCDA 2INFA 3IAPA 1QI4A 2GUYA 4HU3A 2HEJA 5IHRA 3BLDA 4DJDA 3H23A 3SCNA 3TP4A 3S2NA 3EEGA 5I3HA 2ZXAA 5BZAA 4X2RA 3AHYA 1S5MA 1YPXA 1B30A 3HGRA 4GUFA 2EF9A 1XUUA 3HFTA 2QIIA 3UJRA 5JIWA 4QG6A 1H7RA 3O6YX 1PAMA 5BROA 2HVMA 5GPRA 4A21A 4BWLA 3B0YA 3MV01 1BVZA 3QQ0A 4C6OA 3IWPA 1VBGA 4K7VA 4UR9A 3UNDA 1X1NA 3VUSA 4AD0A 4EAMA 4HKPA 2DW7A 2WMGA 1X38A 1R9ZA 5PTDA 3IRSA 4PE8A 2W0UA 3B03A 3WQ8A 1Y8BA 3W7EA 1R85A 2IPWA 3BDKA 4EIVA 3D5HA 4LY8A 3WLQA 5FEXA 1Z3NA 2CHNA 1OGSA 2RKXA 1ZL1A 1UKQA 2DU2A 3W7MA 1D7FA 1PHWA 1YPFA 2V2CA 2GK1A 2P0OA 3HTWA 5KITA 1F2JA 4KEVA 4J3WA 4BCEA 3QOMA 2WVVA 3EPMA 5E70A 1FWSA 2A2IA 3C52A 2XGBA 2X09A 4S38A 4DJED 4LB4A 2V8ZA 5CC5A 3B4UA 4XBJA 4C6BA 1DXIA 3LHVA 4HK6A 2ABAA 1FOBA 4C1KA 1V0NA 3OZYA 2JGYA 3L68A 2P5NA 3CPUA 1RPKA 5FJUA 3SQSA 4XKYB 3ZZ1A 2DZVA 1E0VA 4G1NA 4ZOAA 3C8NA 4QCEA 1XIMA 2PDHA 3P0XA 3G1AA 1WKYA 1LT8A 2GOKA 3ARVA 3UF9A 2ZUWA 2VR5A 4ZFCA 4ZB2A 2D0FA 3ITTA 2UBPC 2H3BA 4US6A 3CYVA 4A8IA 1OYBA 4CNUA 1PKNA 1QPOA 2GQ3A 4Z2KA 1R7AA 4FP1A 3BW3A 4QNEA 1RD5A 4UZSA 1V6VA 5A5WA 2I14A 4QCFA 3UXKA 4GBDA 2FYMA 5D38A 1Z48A 3CZKA 3SCUA 2ZKMX 1Z44A 2QPXA 2QPSA 1LL7A 3AISA 1GJUA 1DJGA 1YNQA 4L61A 1JDEA 1KQYA 1UOZA 4M56A 4KIEA 3W7GA 4JFTA 2VO5A 2CWNA 1N2VA 2WSPA 3ABOA 3SJ3A 4QNWA 2X42A 2OMAA 2EPLX 3WQCA 2Z2UA 4OVXA 4GK8A 4K7YA 1QBBA 3R58A 3M5XA 1FCQA 4RE0A 1SFTA 4P8UA 3FA3A 4H3DA 4XBSA 2B7PA 3ZR4A 4IPJA 3U2EA 1HL2A 3W25A 1QDSA 3GYCA 3KL3A 3LA4A 4Q3MA 1GVQA 2DSWA 3R10A 2W63A 4J3XA 3M41A 4H9TA 2FQIA 5AOUA 3V35A 4TXEA 3EB3A 1U5VA 3WLKX 4B5SA 2Y8VA 1K02A 3DX5A 3DUGA 2ZC8A 4KCVA 1W1TA 2B4GA 1RY0A 1WOBA 3W1QA 1QXLA 1N82A 3AOFA 2JEQA 1L6GA 1VFLA 3P7YA 3L2LA 2VCCA 5IBXA 2CLPA 3WH5A 1J6PA 2ZZ1A 4QTGA 3EA3A 3N34A 2VD8A 3S9ZA 1CGUA 4C1NA 3H53A 3UESA 2NLIA 1IEQA 2OG9A 4FO4A 4XIAA 4MDPA 4LV4A 3MDWA 3PJUA 5AECA 3LG3A 3NPUA 4LAOA 3VOJA 3AZTA 2DDXA 2H90A 4EXQA 2PGWA 3K4WA 4IIDA 4F2BA 4PZVA 5AYBA 2XVGA 5FL1A 4Q8NA 1R3YA 3QHOA 2VVSA 3VDHA 4IQEA 1QPKA 3VUPA 3RLHA 2G96A 2WZEA 4CNOA 2O0TA 4FXSA 3OJGA 1TCMA 3U2OA 2EKCA 1EJTC 3W26A 4HOWA 1OFDA 1Z42A 1MXDA 4TTUA 2MUCA 2EO7A 4B4HA 4ORMA 4JX5A 4M1RA 3VIGA 2VFGA 4HD5A 3QZ6A 2JKPA 1SZEA 3UGRA 1JYNA 1QNPA 3PBWA 2Z1XA 4C6FA 2BOFX 5REQA 5FACA 3AMLA 2ESCA 2NVDA 2BHZA 3T08A 1HJVA 1E70M 3GVGA 1XQLA 4K37A 4GJJA 4AMCA 3E2RA 4MNMA 1X8FA 3APYA 3HGJA 2VOTA 9XIMA 4IMFA 1A5BA 3UETA 1CGYA 4S2CA 1J12A 4U5IA 1OZMA 3BQ6A 1QRQA 5C2GA 3JRKA 1TWWA 5KZEA 3N2BA 3OVRA 4BR1A 3THAA 1TR9A 4HGXA 1YDNA 1WBHA 3CMFA 2DY3A 4UMAA 4GINA 2DZTA 4J3SA 4DWDA 1R2SA 2E9BA 3TYEA 3BJFA 3H2EA 5D8ZA 3P74A 4HIBA 3WLNA 3SRHA 4ZQMA 5IHSA 5HUOA 4TX6A 1HJSA 4DF0A 5CC3A 2Y70A 1CI1A 4BHYA 2NWSA 4V1XA 4AWEA 4JIIX 3VD4A 1J11A 3Q4DA 3U2ZA 1VJZA 2YCEA 4TQTA 3EYPA 4V33A 2YX0A 4NRSA 1YTDA 3FNDA 3M0JA 3WLJA 1JCYA 3HMCA 1DTNA 1V3MA 3MC5A 1PBGA 3THCA 3BQ5A 2GUUA 3AIQA 4PMRA 2ZX8A 1EHAA 3KZSA 2FDMA 5IFPA 4Q4KA 1HKVA 3G1HA 5C2XA 2PEVA 4AY1A 3NQ8A 3RX2A 5AYXA 2FZ9A 3LCGA 1GOWA 4IQLA 3LN3A 4BY3A 2VEKA 4KEUA 1ZJIA 1QW8A 1ISWA 4DX3A 1Q2RA 3QR1A 4AD4A 2YBVA 3L2MA 4TIMA 2O9OA 1JVNA 3W74A 4DELA 3A9IA 4PUJA 2J7EA 1XLAA 4MWAC 5G2WA 4LAUA 1NWTA 4MGGA 3LERA 3WQOA 3UGVA 1XH2A 3I7SA 5D4YA 4UQ9A 1AW2A 3MTWA 4IQDA 1YE4A 4MY1A 3K1DA 2AKMA 1I2OA 1W1YA 1CXIA 4H6EA 3Q37A 3WNLA 2PCQA 4O13A 3W37A 3M7SA 3IEBA 1VPYA 3OG3A 2XJ7A 3PVFA 3W1XA 3N15A 1WOAA 4GVHA 1JIBA 3FDGA 3PWAA 3S5ZA 4TVCA 1E6RA 1PYFA 3JZUA 1VHCA 1SMDA 4EXAA 5TIMA 3CC1A 5H8MA 1LLWA 1V6YA 5I03A 2UY3A 2VEIA 3NIYA 2Z7KA 4M6PA 1FWHC 3FEQA 2ATMA 1AG1O 1DWFM 1BXNA 1WPCA 4C90A 5FF2A 4LWWA 2ZICA 1P0DA 1YXCA 3F03K 4WSJA 3EEZA 2J9YA 2QAPA 1XLJA 4ACZB 3E3HA 1MYRA 4CCEA 3NQ2A 4JYFA 3HQPA 3QSTA 2QF8A 2KAUC 3DOPA 2ZE3A 4HK7A 4L56A 2GPTA 2XU2A 4IPPA 1DP0A 1K9FA 3E5PA 4LH8A 2Z1SA 2GFTA 1KNWA 3IJ9A 3ZJ6A 4YHEA 5HPOA 1FXPA 4MFDA 1KBJA 3QSRA 3EOOA 4KW2A 2JIEA 3VDGA 2Y61A 3B8TA 2E5DA 3QZEA 4W4QA 1XD0A 3HV9A 2YCJA 3BCDA 3DERA 3ARSA 2ACSA 1BYAA 3LZ3A 3QKZA 1WQ5A 5HJLA 2NVCA 3CUXA 3C86A 4DYEA 4IFKB 5D09A 2PDIA 3L4XA 2A79A 2YBUA 1C9DA 4JGDA 3VINA 1OK4A 3KCLA 3GTIA 3WUEA 1SO4A 3VU2A 4LUSA 1KD0A 2VKZG 3ITYA 4RZ5A 2J8GA 3D46A 3RPTA 2HE5A 1PZ3A 1J9YA 4W88A 1ME7A 3GC2A 2ZRXA 4PBGA 4E0CA 3BV4A 4O1CA 1BXBA 4IMCA 3QEZA 3PUEA 4REQB 4EAYA 2QHAA 3TQVA 1Y65A 2WWDA 1S5VA 2BY2A 3CNYA 4O12A 3ANYA 3GVQA 1JZ3A 2XFRA 5HQMA 3QTGA 4OECA 3KRBA 1YXDA 4O1DA 1QPNA 2C1GA 1F5ZA 2V67A 4Y9NA 3EKGA 1BWLA 2V5JA 4YVPA 4PA8A 3GBDA 4AEEA 4KIRA 5I3DA 3WNKA 5CEWA 3LU2A 4NHVA 4ERIA 3E5BA 5A6BD 4FR1A 3S1XA 2PAJA 3NYDA 1G6CA 3NAVA 3EB2A 4UFKA 2NUYA 1M3UA 1PJ9A 1KBLA 2A7RA 2PWUA 4ZGYA 3LB0A 3LXAA 1OQFA 5CKSA 5A6MA 1J0YA 3ITLA 2OWWA 3DH7A 2CZFA 3IJQA 3PANA 1SU5A 1EYEA 5C5YA 3LS9A 1I75A 3WN6A 4UWMA 4NZFA 4GYKA 4XVEA 4KGLA 3ZLHA 1DOSA 3WJZA 1HJUA 1H1YA 3PN8A 3XINA 4DLMA 2EG6A 3VIMA 3WEOA 3NZPA 4IF2A 3L12A 1XYBA 1TJ1A 4JEQA 1QCWA 2ACQA 5B7YA 3NEVA 3EX3A 2V69A 4PUEA 4ZE5A 2GDUA 3W1UA 4O1FA 1VCVA 3PZNA 4W8BA 4QSFA 4C91A 3AWOA 4N4QA 3H4XA 3AMGA 4O8RA 2IKHA 3WCZA 3LZ5A 2MANA 1HKMA 3VIHA 2GSEA 1EC7A 1JRBA 3K1GA 3GLCA 3QGAC 2ZRVA 3O0KA 4GIEA 4Q4SA 3UCQA 3PTMA 4RPQA 4CNNA 1XYFA 2XFFA 4UFHA 3N2CA 2Y5SA 3SBFA 2F6KA 4Y7EA 4AXKA 4LUJA 3SM0A 3R4IA 1J79A 4IX2A 2QJJA 3PHAA 2P0IA 2ZWZA 1QI3A 3WDQA 3BMXA 2DT3A 2FIQA 3PZQA 4W9TA 4D6IA 1QMLA 3HG4A 2YCKX 3NR0A 3EA2A 3EXTA 1Q13A 3GS6A 3AIUA 3U3HA 3F1QA 1NJJA 4W5UA 5CSYA 3IACA 3BSHA 3IK2A 4QGCA 1L6WA 1ZBKA 3AJXA 5H8UA 2DVXA 4PULA 4YCOA 2ZX7A 4GBUA 1BLIA 5I5RA 1UKSA 3ZWTA 1I8JA 2RGMA 3SRKA 1W6TA 2CU0A 2J7HA 4WDXA 4EF9A 2I9EA 4NL1A 1G69A 2DUXA 1E4LA 1JCMP 4AD5A 1UD6A 2Y1HA 1DEDA 2R1PA 2VXNA 4LOCA 2FGBA 1FWAC 2BNJA 4GOAA 5JIPA 4UQCA 1MDRA 5H1WA 4I7VA 1UASA 3CHCA 2VR4A 1MW0A 1KRAC 1ZALA 4K8EA 2WM1A 1XS2A 3WBYA 3NXLA 5CGQA 1ZZMA 1BRLA 1E5NA 2F7FA 1NQKA 4CGTA 3B05A 1DWHM 4PCPA 3HJEA 1ALDA 3NA8A 5BU9A 4J7RA 3LSCA 4B3ZA 4UTMA 3HB9A 2XM1A 3RYSA 3NQGA 2INEA 2OO6A 3DGBA 1SZNA 4JTKA 3R7MA 1OJXA 3CZGA 4L80A 3HMJG 4CD7A 3CIVA 3EWUA 4QR6A 1KCLA 3GDRA 5AHEA 1S46A 2V2DA 4YVXA 1JXJA 1HN1A 1QHOA 5JVLA 4JQ3A 1JZ6A 4D6HA 3ZWSA 1RQEA 3DXIA 1TG7A 4AISA 2WANA 2CZ5A 4GH1A 3FHQA 3GAYA 3ABZA 3G6MA 3NURA 1T8XA 1AZ1A 4NX0A 5BWAA 1W54A 3C0QA 3GNOA 3VYLA 2PWFA 1H11A 1CYGA 4RDZA 1X1OA 3H2FA 3HV8A 4JIHA 4TVUA 3IRDA 5F2IA 4XAPA 5AFDA 3KP0A 3B0PA 1P48A 2PFHA 3WJXA 2WKJA 4OWGA 2VGBA 4I9JA 4EPEC 3BMWA 1CXLA 3Q45A 1VEOA 3BCFA 3EWBX 3O05A 2A6LA 2CLOA 1I6NA 2BHUA 2J24A 4B91A 3BGGA 2G37A 3ANUA 1Z32X 3T1GA 3GDTA 2G95A 5FF4A 2YDSA 4QIUA 3B0XA 3MJYA 3WBAA 3I7QA 4EWJA 1E6NA 1C7SA 2DZAA 4JTDA 4WUIA 3OG2A 3HQNA 4XZNX 3L9CA 1MDLA 3RRAA 5BNKA 4U2ZA 9XIAA 3B0VC 4G5DA 2WSQA 3VO0A 1XG3A 2C79A 2WBKA 4TO8A 4DI9A 3CZJA 4N9BA 2Y4SA 2GL5A 3TAOA 2ZUMA 5TNVA 1P0KA 4Q8TA 1NWSA 1GZGA 1A5LC 4JDYA 1W0MA 2R1MA 2WW5A 2ZUTA 4CD8A 1AODA 2R8WA 4CU8A 4A3HA 1MW3A 4HN8A 2NXHA 4D2JA 3UWVA 2G0WA 3ZS4A 4WX2A 3DFPA 3CM4A 1PE1A 5H2ZA 1IV8A 4PEKA 1VRXA 1UR0A 3QMTA 4LRTA 5ABFA 5LZLA 2QV5A 2O9RA 1PZ2A 3SRFA 5I3FA 2VVNA 4DN1A 3PTDA 3WENA 1U1JA 4ERGA 1ME8A 1TZ9A 2G97A 4Z2JA 2WMHA 4P8VA 4E6MA 4XKMA 2WWCA 3AUOA 1GHRA 1VP5A 5HMEA 2W5FA 3VNIA 1WXJA 4FI4A 1CZ1A 2B0MA 1PV8A 3W28A 3SCWA 3WQDA 1TWSA 4WJEA 4XZ9A 3AROA 3GD6A 1MFVA 2V9DA 3T42A 1GVYA 4MNKA 4AZCA 4M7TA 2DZXA 1PKMA 2WCAA 3C2EA 1FH7A 3NWRA 3NZQA 1MW1A 2PGEA 2IUZA 3AS1A 3L2IA 4O16A 1WZKA 3QYQA 4BJHA 4ERAA 4AU0A 2QYGA 3DN5A 2NX1A 4V1YA 5L9FA 5DT5A 5EA9A 1G01A 1XL9A 1T0OA 3CXOA 4F79A 4GNVA 4EPDC 1PO9A 2AQWA 2EPHA 2ZCGA 2Z1WA 5FJPA 1GVIA 1EX1A 1TB3A 3VPLA 1L9WA 3LXBA 1AQHA 2ZXBA 1MNZA 2EHHA 1XSJA 3HZ3A 1JYXA 2QUUA 3VVGA 3M0HA 5DXXA 3QF0A 1H5VA 4ATDA 3P6LA 3K8KA 3MHGA 3TW9A 4RE2A 1WYIA 3QV8A 4B90A 1RBLA 3S0CA 3WLSA 4W89A 5FJRA 5CSSA 2NZLA 2CPUA 3UZXA 1EC8A 1O5XA 4JD4A 5CJNA 2WMFA 3K8MA 5DMYA 4MUPA 1F3WA 2VC5A 4RKAA 1VAHA 1VFHA 1F7BA 1XYZA 2JE8A 4RV3A 3E6EA 4G1KA 3STPA 3TUUA 1TKKA 4ADSA 4GYPC 1W31A 2QCCA 3P80A 5BOFA 2DW6A 3NPVA 4MYXA 4G56A 1ITCA 4FNUA 3CH9A 3NJ3A 4MJZA 2FPVA 4RR4A 1US0A 1CX9A 3VD9A 3WDJA 4EK7A 5C7HA 2Z28A 2VR2A 4ZO9A 3TLQA 4QJ3B 5B80A 2CLMA 2R94A 3OO2A 4GI6A 2O9PA 1QNRA 1RBAA 5FOOA 4GX9A 1S1PA 4MNLA 4RDVA 1OFRA 3CPRA 1E6PA 3EDDA 2TRSA 2J62A 2WJZA 3C3UA 3AS3A 3VK5A 4IJRA 4C1NB 2HE8A 4UR8A 1MVYA 5CPSA 3S1UA 3N29A 4ZXLA 1DJQA 5TF0A 4ZO8A 3UWWA 1G0CA 1XP3A 3SI9A 2FDSA 4H6QA 1IXNA 3T4WA 1H7PA 3WSUA 4I9AA 2I16A 1UZHA 4MMWA 4D72A 3POHA 2GOUA 5CSRA 3WJSA 5XIAA 4A29A 4DZAA 1UMYA 4GIRA 4YN5A 1W3LA 2VX6A 4AHQA 1HIZA 1KBIA 4MY9A 5CBIA 1P6CA 4LV9A 4P8WA 4YHGA 5E0CA 1JDCA 3I3DA 2QDEA 4WQ6A 3ITVA 5LHEA 3H6OA 3BO9A 4NYYA 5H6HA 5A1AA 5GQBA 3R11A 1A0CA 4QJ5B 5U7SA 1C29A 1TPDA 1LBFA 1JRCA 1ZAJA 1FTXA 2PE4A 3H2NA 3LEPA 3MWCA 2J27A 3GHSA 3F4NA 2BODX 1J2WA 1OINA 3B8UA 1UC5A 1WZLA 2ZDRA 3JZEA 2PCEA 2UV8G 1LWIA 3V0SA 1M7XA 3MI2A 4Z1AA 3URQA 3ARXA 1MUWA 1H7OA 2VD9A 3MBFA 4KBXA 1XIFA 3BICA 1YXYA 4L9YA 1JUKA 1T7LA 4DEFA 1VZWA 3JU2A 4I7WA 3VNZA 4BK9A 5ECUA 3TCEA 3FCPA 3P14A 5A3HA 2YFNA 3GVRA 2VFHA 1O66A 4RDWA 1U33A 2VGGA 3A6OA 2QJGA 2A3CA 3TYAA 4RNFA 1ZJAA 1JCXA 4J2PA 3FV9A 1B9ZA 1WXYA 3WD2A 2DJXA 3VIJA 4Z1DA 1FXQA 3IIOA 4LUTA 4B15A 5DRCA 1JUEA 5IXEA 1TCDA 4V28A 4EANA 1FWBC 3GG8A 3PZVA 3LHUA 2FHCA 3GAKA 1XQKA 2DGAA 4JQ1A 4DBWA 1Q7MA 1TMLA 4DF1A 2FFCA 2F6XA 4KCTA 2WKLA 2L5HA 2WAGA 1QOQA 2AL1A 1K8XA 3LDVA 1QK2A 2LLEA 4GIYA 5AC8A 3QYSA 4ZQCA 3TNOA 1K7EA 5C9RA 1WO2A 1DYSA 5HMDA 2QNEA 4JHMA 4YCPA 2TMDA 1F07A 4QG9A 4AXNA 5DO8A 5XINA 2YR1A 2QJNA 1SO5A 2TSYA 3ARQA 4OTKA 1UHVA 4MG4A 4V2XA 4B3KA 5A6SA 2PZ0A 1MO0A 3GVVA 2JQXA 5EMJA 5A6JA 5FF3A 1LDCA 3WQFA 3AZSA 4UZUA 1UUQA 3SW6A 4V15A 4GFIA 1O60A 1UR2A 3EX1A 3GNRA 3MO4A 1VEPA 2VQUA 9RUBA 1YW1A 4F66A 4DY1A 2Q3OA 3AICA 1V02E 3OEXA 1AQ0A 1SO6A 4C1LA 3C4UA 3NO3A 3BMVA 3CHFA 6ALDA 4I3GA 1IZJA 3OPSA 4H7CA 4K39A 4ZZ9A 2HXTA 2PC4A 7TIMA 3Q65A 5E9AA 1PXGA 3G8EA 3NG3A 4IMAA 1W9VA 4JOMA 3SDOA 3WY1A 3T40A 2E68A 1SFJA 3MYOA 2ADAA 4NZ5A 1GGOA 3WO8A 4Q6JA 1P1XA 3O7UA 5AHFA 1ZU8A 3NQAA 3G1YA 4TTGA 3TOPA 2RDWA 5I2UA 4GI4A 2R91A 4JTFA 1H2JA 4WDTA 1FCUA 2XSBA 3E0LA 1XW8A 2E1DA 2YFOA 2IQ0A 2WV8A 4L7ZA 3OGRA 2QDGA 2E4TA 1VENA 4AZHA 4E3TA 3WLIA 3OZPA 2H6RA 1B54A 3LYEA 1XG4A 2D2OA 3W7HA 3L4ZA 3E1F1 4A3UA 1KM2A 3LTPA 3FLUA 1B1YA 1JCJA 1OFEA 2ISSA 4BZYA 5HINA 2WVSA 2QJHA 3QY8A 2C19A 5HWMA 2WSYA 4FLQA 3WJWA 3W27A 3EWYA 1B2YA 3INPA 2QUTA 2GVEA 4GCXA 2ZUUA 1M9HA 4WOZA 1O6IA 1ZY9A 2ZXDA 4HTYA 4JIQA 1JI2A 4R27A 4FSAA 3WQGA 3MYPA 2CZEA 4J4KA 4ZSUA 4Z2GA 4Q33A 3N14A 5F2LA 3I4KA 1EF2A 1M1BA 1ICQA 3BAJA 2HISA 1H49A 4ZO7A 1GWJA 1W9DM 1HGWA 5CC7A 1CECA 2Y7GA 2DQWA 1KV5A 1N8WA 3KTCA 3TCSA 4HCLA 2Q09A 3B0UX 1YEYA 4DZHA 3O16A 4IICA 4NSBA 2CESA 3UWYA 1UD2A 4L4OA 4HPXA 3CZ8A 3T2OA 4NAFA 4UFMA 4C6DA 4N6FA 1ADSA 1SGJA 1EDTA 3TN6A 2O7SA 5DMLA 3GNDA 5FEWA 3ABQA 4JFVA 1LOLA 5F4WA 4DZIA 3UA4A 1E73M 2FGZA 5KZDA 5IDIA 3KUMA 1E6QM 3DG3A 1R86A 4NX5A 4XO6A 3VZYA 2QLYA 5A94A 5F1VA 3UZWA 1EIBA 1DJWA 4GUIA 5J04A 3LGGA 4H19A 1R7OA 4I8YA 1LZOA 3O6DA 4QBXA 4ZE4A 5IM51 2VYOA 5FAJA 2VNCA 3V0UA 4F2UA 2GGGA 1OG0A 5BU6A 4F0LA 5U4NA 1EQPA 1RP8A 3NOYA 1WP6A 3CMJA 4U5KA 3NDYA 2WC4A 3SECA 3GNXA 1LG2A 2QVNA 1UOKA 4OJYA 1MMFA 1AW1A 1EBHA 2EGZA 4I90A 4FXRA 1QWGA 4DLFA 4WZHA 3L7RA 3S5YA 3ITXA 2X1UA 4RPPA 4C5ZA 1W1VA 2PDLA 3AZRA 2V81A 3OODA 3PZ9A 2BY1A 3GG1A 4AX7A 4IMEA 5FD0A 4O50A 2I7GA 4Y9MA 3B8SA 4M6VA 3BW4A 1QNVA 3KTXA 3LPPA 3V16A 4PC8A 4K38A 4UR7A 4AIEA 3IGUA 4XZHA 3U57A 3BLLA 5EL1A 4F0HA 1KKRA 1KFLA 2WM0A 4CNTA 1KR0A 4I8DA 2C3ZA 1KR1A 2NV1A 2J9ZA 1VBJA 3PG8A 4PUKA 3LNPA 2IMRA 4URIA 3OQEA 3IARA 4K8GA 1HVXA 2X40A 4CD6A 1BQGA 1M7OA 1XV8A 5JBFA 3W23A 2JK2A 3DDMA 2SFPA 4NNBA 3MBDA 4OE7A 3T0BA 3NM1A 3EKZA 3TN5A 1AMKA 3HF3A 1XFCA 3C61A 2QCHA 4FIQA 2PWEA 1GOMA 1CLVA 3WF2A 3EGJA 1DJIA 2XUCA 1MSSA 3PSWA 3M47A 3T0CA 3UXLA 1AMYA 3QLDA 2BXZA 4JR5A 1KBBA 4M5PA 1RLCL 3MKVA 2E28A 3ZT6A 4BF5A 1TUXA 2FLIA 1TPH1 3C0LA 5DY2A 4M0XA 3U4AA 2BVWA 1TJ2A 1V02A 4NJGA 3TJIA 3S6DA 4NQ1A 4JAWA 2E0PA 4ZBCA 3ARRA 1BTMA 4W7WA 5D33A 3W82A 4D6EA 1K7FA 4QRNA 1QI0A 2VFFA 3CQIA 4R5EA 4IJCA 5A8MA 3CBWA 1Q45A 1W9BM 2D20A 4Q8OA 3W22A 1JPKA 3DFNA 2B31A 1E9LA 3TONA 4W7VA 2CLEA 1QR7A 1F73A 1QO5A 4ZL1A 4N42A 3DC0A 4UUIA 1IR2A 4LYQA 3GNPA 4AFYA 2OGYA 3TC6A 1G5AA 2EPMX 2ASHA 4TOQA 3CUFA 2FVMA 2A7PA 4PN2A 2XG9A 2ABBA 1XLCA 4PFHA 4ZB5A 1PX8A 2OR2A 3QGKC 4H6RA 1C93A 1LWJA 1GK8A 1M7PA 3SGUA 3GFXA 4PL1A 2OGJA 5C9UA 5FL0A 1W3TA 2WLYA 3VMOA 3ARYA 3IVUA 3KX6A 1YYAA 1SW0A 4Q8QA 2QVHA 7XIMA 2CFFA 4R9XA 5M1TA 4OKDA 3HQOA 2ZWYA 4ZOEA 4FALA 4B92A 5AYZA 5EMLA 4AH7A 1ZCOA 3B9OA 2WQPA 3PPHA 2YW3A 1KTCA 3DFSA 3TYBA 5HMFA 3TW6A 1CLXA 3PBMA 1VFFA 3M43A 4IUGA 3B9NA 5D04C 2E67A 4W85A 4DUWA 3O06A 3A4WA 2J7GA 3VD5A 3GB6A 2G3IA 4UNLA 1DJZA 4GFSA 3R1ZA 4HNOA 2Q71A 4LRSA 1EB3A 1JD9A 1FWJC 4X22A 3EMZA 1HG3A 4G7EB 1AK5A 3S2JA 3F4VA 1HKWA 3NPWA 3KVLA 3KOFA 2QGHA 1S5WA 2Z24A 2YL6A 1F4AA 2YOCA 2QUMA 3OQ8A 3VX1A 3SUSA 4O4WA 4AWTA 4LC6A 4LS2A 3W1NA 4N9CA 3AIEA 2FB2A 4PRTA 4A3QA 1HFBA 4E4FA 5AC5A 4RX0A 2D0HA 4ACYA 4AHPA 3PPGA 2VRQA 5HNUA 3VDCA 1XDLA 1IIHA 1X8CA 1BWKA 2PGFA 2XZ7A 3ZR6A 1LL4A 1E71M 1WXZA 1D9EA 2CNCA 2ZUNA 3KL5A 3RLUA 4WXZA 1OD0A 1S2AA 3KOZA 1WAWA 1NFBA 3GYEA 3C2VA 4Y90A 4HZMA 4LVAA 1OB0A 1NDYA 2IPGA 1EOMA 1N7KA 4FLRA 3S42A 3ZR5A 1TE1A 1KO0A 1SW7A 3VGGA 1HKKA 1L2QA 1GKQA 1TX0A 1CXHA 1W1PA 1KXTA 5D9PA 3MO7A 3YPIA 3TDFA 4W84A 4B9YA 4IIFA 4O11A 4QS6A 3SADA 1WKDA 4C6CA 4FNRA 4KCWA 4FIRA 3VNYA 4MF4A 4UMCA 1OIFA 1L6FA 4O1AA 1UPMB 4MAVA 1YHTA 2FVLA 1E56A 1V0MA 4RW3A 3RRXA 1UWIA 3E0IA 2PZNA 4KRZA 3QH2A 2J79A 2XZ9A 3JR2A 5DFAA 1UIPA 1TTIA 4Z1YA 2E77A 3W7CA 3OBEA 4EXBA 3P82A 3WZ0E 3AIWA 3H7VA 1TPB1 2X7WA 3ARZA 4N0RA 1J18A 3M6DA 5C9WA 4WY0B 3HG5A 4YXGA 4GGBA 4K6AA 1JQXA 2OFJA 1W5OA 3N25A 3ORWA 2YXOA 2OT1A 1KWGA 2V63A 3MKKA 4ICMA 2OTDA 1QU4A 3EB4A 1UROA 1FWEC 3E0WA 2NLYA 4J9JA 4ECLA 1DJXA 3WFAA 3T05A 1IWBA 2F6UA 4XIMA 3W87A 2DZSA 3LV6A 1MQPA 2VZTA 2JGQA 3PC0A 3PK7A 1K8YA 4UTIA 1GKRA 2VEFA 1GVOA 1DQXA 4O54A 4LYPA 2ALRA 4AIUA 1W1ZA 2OYKA 4LVBA 2PS2A 5HNTA 4FNTA 1H51A 1NQ6A 2ZXQA 3W7IA 4YYCA 3N17A 4JQAA 1E3XA 4ZQOA 4KGJA 3RU6A 1KKOA 4AF0A 3LLXA 2EJ1A 1D2KA 1E9IA 4LVFA 4JTAA 3TIMA 1UR1A 4DB7A 1QT1A 4MZYA 4Q4RA 3MZNA 1XLHA 4L6DA 1AJ0A 4G8TA 2E6AA 2YDRA 1A5OC 3UJEA 3L5AA 3BSMA 3MMTA 1E6SM 5A6LA 4PCSA 2KZHA 4H2CA 4YYFA 1Q8AA 4LT9A 1ZNNA 3PJWA 1WDDA 3O15A 2VGIA 2Q01A 1MXSA 3BLFA 4S3FA 2BVTA 3IJIA 3CQ0A 3P67A 5CG0A 1KC7A 2HCVA 1XC6A 4DM2A 1K1DA 2QIWA 1XR2A 3H2MA 1S38A 2D1ZA 5HBFA 4J2MA 7PTDA 1G4PA 1RPXA 4I5XA 3WK3A 1RAKA 1DVJA 3A64A 5A8NA 4GH3A 2I1OA 1HNYA 3W02A 3MANA 3TSMA 1Q5MA 2OEJA 2DSUA 2CLKA 3W6MA 2Z1BA 2A3EA 1MEHA 3KWSA 4CQAA 4KWOA 5FJJA 1OIMA 4GX8A 2HNEA 3TFCA 4NVTA 4M29A 3VOHA 1IZKA 4C60A 1W9UA 7CGTA 4J35A 2OJPA 1ECQA 2BB0A 2GGJA 1B3VA 2Z7GA 2BGSA 4GYJA 3FN9A 1FKWA 1N55A 1PX4A 3VNJA 3PJXA 4IGSA 4R34A 1A5NC 1RCXB 4ZQPA 3KOYA 4M6QA 2GJLA 5AB3A 4Z2LA 4OUEA 2Z1VA 4HJWA 4LEFA 4AEOA 3CS2A 3CMGA 3UW6A 3VI2A 3PBUA 5AHIA 1WB0A 3MKCA 3E0VA 4R88A 2PWVA 2ISFA 2PDNA 1J01A 3ARWA 4CQ8A 4CD5A 1VH7A 1IEVA 4JL2A 2IKGA 5D9MA 2VENA 5CZSA 3OA5A 4BF9A 4MUZA 4J40A 1F6KA 2GSHA 3P8JA 1WA3A 3M4HA 4NAEB 4NAEA 5AVHA 1CPUA 2XIBA 1B4KA 3AJ7A 3VX0A 2VT0A 1J0IA 3TU9A 1H4PA 3PG9A 1BXCA 4S3BA 1OX5A 4PRRA 5T26A 2C7FA 4EOUA 4Y9PA 3TWAA 4PTNA 1O1HA 4ILSA 3WLOA 2QUVA 4AAJA 1VF8A 3RX3A 3GU2A 3W76A 4UTFA 1XDMA 4FLSA 1DWJM 3DHDA 5AYYA 1AH3A 1PTGA 1VFMA 3CT7A 3KVKA 3IUHA 3G5EA 3BZGA 3HPSA 4LB3A 2E9LA 1TV7A 3UZJA 3ATZA 2VDIA 4PGLA 1KTNA 2I9UA 4O14A 5DCEA 3UWZA 2Y24A 4OV4A 1IXQA 4W8AA 4LY4A 4XX6A 4BQ2A 2YDQA 3F5KA 3E2VA 3AXMA 2PDJA 3FDKA 4PTWA 4DWSB 1P0NA 5CQ1A 2AQOA 5CCZA 1V3IA 1TIMA 1Q7QA 4XAZA 5G4EA 1RQBA 3MSGA 4JNYA 2E6DA 2WVVB 3ZVIA 2OEMA 3QV7A 3LGDA 1H7XA 2Y85A 2WC7A 1L0PA 3T44A 3NDOA 3VE7A 4JY9A 3DI1A 3OHMB 4H9MA 2CEQA 2E6FA 3OIHA 1OCNA 4AZ7A 3N6HA 4OOUA 2OLSA 3LQGA 3UFYA 2VX4A 2W62A 4OZOA 3HGSA 2Z6IA 3LOTA 1O12A 4GABA 3HGOA 1AUSL 1XLLA 3BL3A 3EBVA 4J5NA 1QK0A 4AEFA 4LEQA 5BCAA 1MRAA 4LW7A 4BF7A 3H22A 3MUXA 1DWGM 3PJTA 1KWKA 5JBDA 2Y0FA 3FJ6A 4BWLC 3E12A 2YB4A 1XLBA 4WJXA 2PU1A 4ZR8A 3MW7A 1DJYA 3W7RA 4HSNA 3VABA 1XSIA 1V6TA 3G0UA 3QMSA 3AU6A 2IXVA 2PTDA 4LU0A 2XFYA 3GR7A 2OT0A 1KM1A 5BMXA 3VA8A 2BFGA 1VLWA 3UT0A 5HR7A 4JTHA 3WDIA 4OUIA 4O0KA 1NM9A 4AVFA 4X60A 4DVOA 2OSXA 2CERA 5LIKX 1EQCA 1C8QA 4GXPA 5SWUA 4H9YA 3MB9A 1CGVA 3ENLA 3E9AA 5FJIA 4EWND 2BTMA 4AC7C 4HN4A 3DEQA 4QLKA 2YYTA 1W1A1 2VOMA 3AHXA 5CGTA 1QTWA 2W67A 3WEZA 2VELA 4MKNA 2XIMA 4GI9A 3H21A 4A05A 1SSGA 1XD1A 1OGGA 4UFIA 3QPYA 3SCQA 3MHFA 1PIGA 2RJGA 2QGYA 1R2TA 2YA2A 3RDKA 3HURA 3CLWA 1Q63A 2JKAA 3TC7A 3KS6A 4F0SA 2WZMA 1J5SA 1WZMA 2Y5JA 1H7NA 2VL4A 4KWUA 3LTYA 5EYWA 2Z4GA 5BMWA 1HXJA 2P8CA 2XYLA 1S2WA 3WNNA 1M03A 5I07A 3GC5A 3A3HA 4R7OA 7A3HA 4JFUA 2PDFA 1JZ7A 3H7UA 1TE6A 1DWIM 3TTOA 4F3HA 1LUCB 2AKZA 3S5NA 4GUGA 1R6WA 1PWLA 1MUMA 3LV5A 2DSVA 4N6EA 3KBNA 3VIOA 3T81A 1JJKA 1KM6A 5JUVA 3VCCA 4C6EA 3PP7A 1WDWA 3VNDA 5A8PA 5I02A 3GTNA 4FLOA 5C0QA 1TTPA 3WNOA 4NI3A 2QW5A 1REQB 4OQVA 5F2GA 1G1YA 1LCOA 5DT7A 3ZSTA 4LTSA 1S5TA 2JF7A 4LCQA 1I2QA 4XG1A 1UWQA 3FX4A 1SR0A 4RXFA 3C2FA 1EJWC 1R3RA 2OX1A 4S2BA 1RUSA 3P0WA 4Y9AA 1ZCCA 4F40A 1KGXA 2PDXA 3QQ1A 3NSNA 1B9BA 3UBPC 4CCCA 1TRDA 3IVSA 4PTMA 1R2RA 3L0KA 1OYAA 4M7SA 1YLVA 2W79A 5I77A 3STGA 1G7VA 3SCPA 3U0HA 4EACA 1OC5A 3FEMA 2QQ6A 3W70A 2BV9A 1R3TA 3G1XA 2PDKA 2VFDA 3O1NA 5DN1A 4QJ4B 1A0DA 4JTLA 4C65A 5K7JA 3AXXA 3B9AA 3LQLA 3NZ1A 1SJCA 4KFNA 2ZRZA 4ENLA 2XIQA 4G7EA 5JH1A 3ID7A 3TC3A 1OYCA 4GJIA 5DANA 1A3HA 4IIBA 5D02A 4S3EA 4HBKA 1UP0A 5LNRA 4V27A 1ITQA 3U9IA 2WKGA 2A0NA 4FEZA 5LIYX 1KCKA 1XSKA 2WC3A 2V5LA 1Z41A 3PPCA 4GQ0A 2AMGA 3GH4A 5KMYA 5CJ5A 1K7XA 1PEZA 2E9MA 6XIAA 2X30A 3P3BA 4Q4PA 3QQWA 1JQVA 1L8NA 4PRWA 3MCMA 1VBRA 3CL6A 3SURA 4JYEA 3TVAA 3AC0A 3M0VA 1QW9A 2EG8A 1I2RA 5HJXA 4JIRA 3JS3A 1R3SA 5TAOA 3O3RA 4OBRA 4UQDA 3MQTA 4GZ7A 5AKQA 3NSMA 3SSJA 4E2OA 4RNHA 1FFQA 4LAKA 1VRDA 1E0WA 4E3VA 1HGYA 4QM1A 2FH6A 2ZVRA 4PEEA 1LP6A 3ARPA 3HA1A 1W37A 3MUCA 3WNMA 1W2PA 2PP3A 2VCBA 4A4AA 4Y8FA 1GQLA 1FX6A 2V82A 2A5HA 2V3GA 4PMVA 4XSMA 4PYSA 4E8GA 4RDYA 3MI3A 2GGIA 1QJWA 3IAQA 3W9ZA 3CPGA 1Q4WA 3UXIA 3W4RA 4BQ4A 2P50A 2WPBA 3IUIA 1HW6A 2DV0A 4O19A 1V0KA 1X98A 1JPDX 3N04A 4B2DA 4U2YA 1EOKA 2Q6ZA 3NYZA 1RR2A 2QCMA 3WJYA 4PMXA 4FA3A 3TOYA 1YDYA 3T8QA 4BQ5A 5EMUA 3RLGA 4LCSA 3AQUA 5HMSA 1W3IA 1LOSA 4F0RA 1WUEA 3WL0A 4JFSA 1V7AA 1FHUA 4D6FA 1TPVA 2OVLA 4QEHA 4S3KA 2R6OA 3GH7A 3LNMA 3ZT5A 4WY0F 4G6CA 3NZGA 3CO4A 2XPKA 1BHGA 3QW3A 3PB2A 4I6VA 4IXHA 3I10A 2X1TA 4MPKA 3TE9A 4E2VA 3W7JA 2EJAA 2YSWA 1UQYA 1YADA 1R0MA 2BHYA 1XXXA 3GUGA 2NXIA 4GRSA 2ZZ7A 1UYQA 4PUDA 3VM7A 3NGJA 1V77A 4Z0SA 2J7DA 3RCNA 2Y62A 3KTSA 3D47A 2X1RA 3A13A 1TX2A 3G22A 3T07A 3BG3A 4DBSA 2OXNA 4S1FA 1F8IA 5JMUA 3RK8A 1X39A 3VC5A 1GYLA 4RZ4A 3N6JA 1NF0A 3A12A 3JUGA 3QFWA 2FMNA 5A95A 2XH0A 2PLMA 5G4HC 2IQTA 4LAZA 5LA2A 5D9OA 1V79A 2DIKA 3Q2DA 4AC1X 1PSCA 1JPIA 2YCIX 4DQWA 5J5RA 4IX0A 2BMBA 5M03A 4U33A 1XCFA 3VGHA 3LTSA 1UZ1A 3PBGA 4UQEA 4F4RA 2XWEA 4BI5A 1W32A 1EWDA 3GHRA 2BY0A 3W1MA 1PDYA 4R53A 2NUWA 1H62A 4KEZA 5DBTA 1MUCA 3W73A 4DBUA 3VFCA 1TPFA 1D3CA 2J88A 1ONEA 4I9TA 4CEUC 1P5BA 2A3LA 2C6QA 1V5XA 4YVVA 3ZLGA 3CWOX 1V6UA 1SVDA 1TMQA 4FR6A 2FTYA 1T5AA 2WNNA 4HNTA 5D03A 1HJQA 4HA4A 3IPWA 4JTGA 2RGLA 3OB8A 1CWYA 4NJHA 3RMJA 2VUYA 2QJIA 4JICA 2PDYA 1PUDA 3N9KA 1K9TA 5G2IA 4PUUA 2NVAA 1LBMA 3UWUA 1BF6A 3KL0A 3G1VA 2ZYFA 4AUBA 1GOKA 2NW0A 3W1RA 1QATA 1AH0A 1I2PA 3UA3A 2YGYA 4TV6A 3R79A 3CAWA 1POJA 3H4WA 1DIEA 1QBAA 2J6XA 1Q8JA 1VPXA 4NNAA 1VYRA 2DVTA 3OVPA 2I57A 1EJXC 3OA3A 5A2CA 2Z2BA 1TQXA 3NM3A 3WQPA 3PBVA 4DUXA 1NF7A 1VS1A 1QOXA 2E1WA 2DH3A 1IZCA 1W1IE 1XBVA 2WQDA 3G77A 1XLIA 5A2BA 4QHRA 2RUSA 4XO7A 3W38A 4MWAA 2ZBTA 4LANA 1QHZA 2C1HA 3P84A 1LLOA 2O4QA 3IS4A 4Q8PA 5FF7A 2HPIA 3OOQA 4FNQA 5EU9A 1FWRA 2G5WA 3CV2A 1QNOA 3RILA 5HOSA 2QT3A 1Q3NA 3DFQA 5C55A 2VX5A 1WDPA 1XPGA 3DFYA 4J28A 4IXXA 1W3KA 3ZM8A 3FA5A 5K9CA 4AG0A 5MKGA 3G1DA 1CIUA 5IFTA 2V3EA 3U7VA 3WF0A 3PUDA 4JIEA 2QKFA 3IV3A 2W6RA 4E4UA 4H2HA 2YL8A 3APGA 3MUZ1 4C6IA 3S9IA 4WIWA 3EDJA 3LRMA 3TN3A 3WMCA 1BKHA 1R9XA 3SQLA 4UTWC 1BSIA 2GVLA 5C70A 1W5QA 4FNSA 3W1AA 3IJLA 4WY0A 1DPMA 4P7LA 3PZOA 3EOSA 2AL2B 4LXFA 2NX3A 3KBWA 4KWVA 3R8RA 1ITXA 1GVRA 5D05A 2FTWA 1A5MC 5HPCA 3ME3A 1ONWA 2PLKA 4AHOA 1XDJA 1DV7A 3F2BA 4UTTC 3UEQA 2XSXA 2X0SA 3HPAA 1MEWA 1S39A 4RZBA 3FJLA 3THQA 3H70A 1GOOA 4I5UA 2E40A 1QNQA 4M6UA 2CHRA 4KF1A 5AHNA 1IE7C 2HZGA 4LFYA 2CCRA 3ZIZA 3S9YA 4Q4QA 3PZMA 5D2YA 4Q6XA 3AHZA 4AIBA 5AC4A 3QKEA 3ES8A 2OX4A 4L1XA 2CETA 2VZOA 1UCWA 1BRLB 3NVTA 3K13A 1ISXA 3PWIA 2HRWA 5K9DA 3SN4A 1HKJA 5A8QA 4BI7A 3WK2A 5CAHA 1LLZA 4AYGA 4N4PA 3GIQA 2OQHA 4UFJA 1IEXA 4PMQA 4R85A 5HUPA 2DQXA 4HPGA 1U5JA 1HF6A 2D2HA 2EG7A 1UP3A 2PA6A 1W9PA 3QFEA 3H24A 4HHPA 5LIXX 1GONA 3V5CA 4UOQA 4NT0A 3GR8A 3W85A 2DIEA 5C54A 1E55A 3AIVA 3K8LA 3ABXA 3HOJA 2OKTA 5EPDA 4WDUA 4RL3A 3BURA 5J8LA 1OCJA 1UR9A 1UW9A 2F61A 5I23A 4DJFA 3QBUA 3L0GA 1CLKA 4O15A 3USBA 3NQCA 4GPNA 2C71A 3GXMA 5GNXA 4FZIA 3SUUA 3W7QA 1KA9F 1I2NA 2QV4A 2VFIA 4JS3A 5AHMA 1V3KA 3NGFA 1JULA 4KESA 4MB3A 1U2YA 4Y8EA 4HNNA 2Z29A 3M0YA 1J2BA 2G3FA 2QDHA 3H8AA 2PMQA 3BOLA 1P7TA 2NT1A 1V08A 2NUXA 5T91A 5BYWA 1UA7A 3V18A 4NF7A 4JIPA 1NU5A 4MJ2A 3A3WA 3S1GA 1UWRA 1AJ2A 4HMCA 3P5YA 4IGHA 2Z2AA 5XIMA 2YLAA 1WDSA 5C7VA 1CXEA 4JHZA 4WJ8A 2W92A 5EMKA 3L67A 3N12A 2REQB 4WHBA 4CUCA 2CZVA 1VGAA 1RCQA 2VUNA 2FZDA 3KLKA 3XIMA 4L4PA 3UY8A 1JG9A 5KZMA 1BAGA 4CQBA 1NARA 1TVPA 2BLEA 1VC4A 4A22A 1TMHA 2BASA 1EBGA 4XQ6A 1TPUA 3CTLA 3HIJA 3MHUA 3AI0A 2VEMA 3QN3A 4C7DA 1GVEA 1RV8A 3LCFA 3NUKA 1ZAIA 4HCHA 4KETA 2PPGA 4RLIA 1JZ8A 3QZAA 4GUHA 3BAWA 4XZLX 3ZFHA 2BXYA 4UTLA 5F2MA 1U83A 1XIBA 3NL3A 1Z6KA 4UTUA 3AO0A 1EGMA 6TIMA 1F76A 3MJMA 1OSEA 2H8XA 3V5FA 4K68A 3FS2A 3RCYA 3AFBA 3WYZA 2GJXB 3XISA 1K03A 1KRBC 3DC8A 3FJNA 2BGQA 5HK4A 1GZ1A 1E1FA 3FGCB 1WV2A 3MPGA 4QXIA 2DEPA 3FGCA 3IV8A 3OGSA 2B7NA 1CT5A 1V3LA 4GXMA 3FW6A 3QPZA 2JBMA 3WBWA 4PUMA 3QC0A 3M07A 1KTBA 3T9PA 3BLIA 3UJ2A 1FWDC 4S3GA 3NFUA 3W24A 3OTRA 2QCEA 5FAGA 1ONRA 1XCWA 2Y7FA 3GW0A 3PPFA 1GT8A 5LGXA 3FVDA 3WMSA 2DT0A 1D7KA 1UD3A 3V1HA 3K30A 1OX4A 1R87A 2I5QA 3ARUA 1R8LA 4X61A 5LA0A 2ODOA 5T9CE 1FDJA 4CEXC 1O94A 4XD5A 2DPEA 4H8HA 4Z2HA 1C7TA 3W01A 4DZ5A 4W93A 3GKAA 4GQQA 4QAIA 2GJRA 5E6YA 2G50A 2VI0A 3DFTA 1RH9A 3DGRA 2O4MA 2CHOA 2HVOA 4FXJA 3N2OA 4F2TA 1S2TA 1S2CA 1J96A 1R3QA 3K5XA 1M6JA 3ZT7A 3EOEA 4OGZA 3QJAA 3W2KA 1B3OA 2XFWA 4CD4A 1HL8A 3M9YA 3VMPA 3CIWA 3FIGA 1PX3A 1UWSA 1ZRQA 3V75A 3DFOA 2DSZA 4IP4A 2BOGX 1Y5WA 3SN1A 2VGFA 4NY2A 1LROA 1JUBA 3F5JA 4QE1A 3FFSA 2PDMA 4ZQNA 2QCFA 4E2DA 4OOZA 3QM3A 3DYPA 1MW2A 3P8IA 4H8NA 1VYPX 1TA3B 5DRIA 1IWPA 1O5QA 1GYNA 3HJZA 4C7GA 3VZXA 2REQA 2POTA 4HHHA 1GEHA 3R0DA 1OADA 1E9YB 3HBLA 1XIGA 5G1YA 3LK6A 3VIKA 3OYZA 1RVGA 4LNCA 3R2GA 3LBCA 1U1UA 2DJLA 2WZHA 7TAAA 4Q7IA 5A6AA 1KM0A 4A8NA 2HPMA 2YXXA 3GDBA 1KGWA 2PURA 1Q6RA 3EWDA 4J3VA 5DF0A 1PL9A 4FMVA 1XGZA 4BI6A 2Q8ZA 1O68A 4H8UA 2IKIA 4QITA 5LNWA 3BZJA 1EDGA 3FYPA 3ATYA 2BBFA 3TJ4A 1GQKA 2P3ZA 1XKJA 3URNA 2NQLA 1GQNA 3OZOA 1KXQA 3N2MA 4YTRA 2IXUA 2ZIDA 1ISVA 3EMCA 2P88A 4PUWA 4UOZA 3DI0A 1X6LA 1ODUA 4NKCA 2GLKA 3LENA 5I09A 4LYRA 3R8HA 3CWHA 4HK5A 4FAMA 4NJKA 3GG0A 1E5JA 3M0XA 4A8RA 1E4MM 3GG7A 3C56A 2OZ8A 2RDTA 4WOQA 3WH9A 1EH9A 4UTKA 3MP5A 3GWQA 3N9RA 1MZRA 1LT7A 3NQVA 2V38A 1K6AA 1RSCA 4KWSA 3VOGA 3H7RA 4UBPC 3BXWA 1US2A 1A5UA 1KV8A 1TZZA 2NWRA 3W86A 3VGEA 3CJPA 1FH9A 4GZIA 5KSWA 2XGIA 3RG6A 3S5SA 5EFDA 1JGMA 3DU0A 4X63A 3K2GA 3WUFA 1VIZA 1A4MA 3TR9A 1ZS2A 2P10A 2WB5A 3B40A 5HXMA 2VJXA 3A47A 1TV8A 3L5LA 4QLLA 5KEZA 2VRJA 3ELFA 5HATA 3WEMA 4XD4A 3VGBA 3VIFA 1KXHA 2C15A 5LNSA 4JQ2A 1GOXA 1TVNA 4JKLA 3ZSSA 4ATWA 2PDUA 3PWGA 1TWDA 3NL6A 1QI2A 1QWKA 3PAOA 1W2VA 3N4FA 1NOFA 4LUTB 5AZ0A 5D2VA 5BRPA 3TTEA 3JW7A 4WD0A 1PHQA 5DCDA 4HU4A 1YX1A 2UY5A 4MKVA 5CZJA 4Q4OA 3PB0A 1W5PA 4MDOA 4JTEA 1Z8AA 2VC6A 2WZTA 1BG4A 1TV3A 3LXCA 3BK0A 5G5IA 5ABEA 3EA1A 1FWGC 3N73A 1RA0A 3CAVA 5I3GA 3EDFA 1O4UA 3QHNA 3OP2A 1WKFA 4PBEA 1RALA 1FCVA 1XRTA 3KHDA 1OX4B 4OV9A 4LCRA 1JGIA 5CBBA 4XKYA 8CGTA 1FDYA 1ZPTA 4QP0A 7REQA 4ZOCA 3OBAA 4MWAE 4X0VA 4LYKA 3FYOA 3BGAA 1K9DA 3IGSA 1KCZA 4PTDA 5BXPA 4DO6A 1S1RA 1H09A 2FH8A 4PCNA 3R43A 3VCNA 1HT6A 1JYWA 5I3KA 2BDQA 1JNDA 1K77A 3W3OA 4BEQA 3BPWA 4WK9A 1EF3A 3VIPA 1QNSA 3C2YA 3QR3A 1S3TC 4XK2A 1BYDA 1SFLA 5I0DA 7ENLA 1JAKA 4KERA 2KX9A 3WK1A 3E0FA 6PTDA 1XRFA 3RCMA 4DPQA 4MTVA 1RLDA 4KCUA 4XZWA 3KBVA 2HVNA 4AX6A 5GJNA 2R9RA 3AIBA 1QASA 4J3TA 2F2KA 4X9SA 3CUJA 1FWWA 4LJ3A 3NQ7A 1ZGDA 3GM8A 5M3WA 3VKKA 2OEKA 3WF3A 4JX4A 1PS9A 2V5DA 2A4AA 1TWIA 3AMCA 1R46A 4GVIA 2Y8UA 1TELA 4IWWA 2YCLA 5CBJA 3UWQA 3T78A 3W1LA 1UP2A 2OZ3A 2ZUSA 4UIOA 3BCJA 4JCMA 2BS9A 2X1SA 3W2MA 1FHVA 4JTTA 1OC6A 2I56A 3LY0A 3LUTA 3TWBA 1RY8A 3L4UA 3BH4A 4LUYA 2WHLA 1DJNA 2UY4A 8A3HA 2AL2A 5HAOA 4H4IA 3UYIA 3DBNA 4DNMA 1GW9A 3SR7A 2OSWA 1EX5A 2CC0A 4ZA0A 1V93A 3I6RA 4IGMA 3S1WA 4GACA 3IIPA 2G8ZA 3KHJA 1EDQA 5K3VA 3W07A 1CGWA 1VLIA 2TPSA 4C6LA 4CKQA 1H63A 2HNHA 1WNOA 3EX6A 1ONXA 1Q6GA 3GZAA 2WOQA 3NO5A 1R9YA 1FBAA 4H7ZA 3KRSA 3RAOA 1M41A 5EMMA 1MFUA 3FK4A 4ICNA 3LMYA 3A22A 1M04A 4HJFA 5LNVA 3M5ZA 4IG2B 2XN0A 4U3CA 3HPZA 1TJPA 6A3HA 1W17A 2CBIA 4EP8C 4HCDA 3TA9A 2VMFA 2WSKA 1EGZA 2J6VA 1ZBCA 4NASA 2PI6A 3MS8A 3TJXA 1WAUA 4Q32A 4XD3A 1F3TA 4HHLA 1UR3M 3PULA 3RN6A 3E2SA 3KDOA 3LHWA 4IP5A 3OLIA 3WDPP 4D6DA 1ZP3A 1VIWA 3THDA 3HO8A 2DORA 4MB4A 1ZB5A 3LM3A 4IP7A 5FCZA 1SYTA 2YJQA 3PY2A 1GKPA 5EY5A 4I6KA 1W3HA 4L9XA 4NAFB 1TV2A 4OT7A 3AYSA 1EJSC 2WK2A 4UB9A 1XH1A 3N2XA 2QXWA 4FNPA 4O18A 3TH6A 4FOJA 4Q8MA 4PB4A 3UZZA 3QHMA 2XN2A 3S8HA 2E8ZA 4IPIA 2OZTA 2FJUB 3W7OA 3HFYA 1E9ZB 3ITGA 4EX4A 4M1BA 1SUXA 3GXPA 1LYXA 1VJSA 1ZENA 4ZQRA 2BG5A 4DJDC 4CVUA 5K4XA 1M5WA 2ALDA 3M6YA 4E5TA 1SZGA 3GQYA 2X2YA 1I4NA 3KCOA 1ZJHA 2WHMA 4LALA 5C9ZA 2B7QA 3PZUA 1JZ4A 3OLGA 3Q67A 2HJPA 6XIMA 1ECEA 2YXGA 4IISA 5HR6A 2PBOA 4FXFA 3CQKA 5E09A 2Q3RA 4IIGA 4D6GA 5EFFA 2WNWA 4EPBC 4UQAA 1EYWA 3ALGA 3DCPA 4E8DA 1PVNA 2HTMA 3BUVA 3UWEA 4S3JA 3IGHX 4Q8WA 3TQPA 1A80A 1ICSA 1DIDA 1P0EA 4GXWA 5LIUX 3H2AA 5D30A 5HJYA 4O4VA 3G1RA 1TTQA 1NY1A 3W2UA 3ITCA 1A49A 2OKOA 4HOZA 1UWUA 3SCSA 3T8LA 2PDQA 3S2MA 2WJEA 3E74A 2PRMA 3H12A 2WNQA 3CO8A 1WCGA 1W3NA 2O7QA 2PP1A 1A5SA 4ONVA 3AYRA 4AVOA 5CZKA 1J0HA 4NZ3A 4R7WA 3WQ4A 2ZZ6A 2WJDA 5BRBA 2YCLB 3RM4A 2GQ9A 5FESA 3RR1A 3WFZA 3W29A 3G24A 4NI8A 2I5IA 4ZTYA 3O6AA 4AB4A 2BZNA 3C2RA 1ITUA 3NVDA 4DWSD 1TR1A 2D0GA 5ABFB 2UY2A 1KFCA 5DEZA 5FF0A 1R38A 1EUNA 3AYTA 2Z26A 2ZZ3A 2J74A 4LS0A 2O9TA 3PSVA 1JXKA 5AYIA 4Q8VA 3EDKA 3N19B 1F4HA 2QDDA 2J8FA 1UIOA 3AXIA 2WBGA 1RZMA 3G2GA 1EP1A 3KZPA 5GVJA 1XIHA 3UU0A 1QO2A 3CTTA 4DF2A 1Q7ZA 4DNHA 1KFWA 4JPGA 4WKHA 3VKDA 2PB1A 5K9XA 4YWSA 1KLYA 3N6QA 2NQJA 2PLJA 1FWIC 4N02A 4ZMGA 3A4JA 4GO9A 4O28A 3W1TA 4DYKA 3UPBA 5TD4A 4LF2A 3E96A 1TQJA 1QPRA 3S2CA 5BXSA 1W5MA 3CU2A 3R12A 1XCXA 1OFQA 3PBYA 1K8CA 4HOXA 5A2AA 4ZEPA 1REQA 3BLKA 4RW5A 4B2DD 1GZJA 4UC5A 1WBJA 2V5CA 1WUFA 2WYSA 4IH3A 4BKNA 3ZXWA 1BYCA 1PKLA 1XBYA 3IK4A 1GG1A 1EP2A 3NXFA 3CQHA 2VQTA 2ZA1A 4LVDA 2X0YA 2YZ5A 1OX6A 4HYWA 3GK0A 4N2YA 3OIXA 4OBSA 3VXGA 3NQBA 2V30A 4TMCA 1Q6EA 4LBUA 3REQA 4ES4A 3MDUA 3N2TA 4ALDA 5D9NA 1A47A 3OGVA 3LM7A 1X7FA 3T09A 1Q6LA 3RFAA 4UCGA 1ISYA 1JZ5A 3WQ6A 5DMMA 3C0JA 3P5ZA 4A3YA 4YIWA 3MA8A 1RD6A 1WDRA 3HG2A 5D2XA 3RM9A 3UY7A 1H1NA 3L4YA 2PC8A 3WDRA 2FZBA 2VC9A 4K1GA 4UFLA 5JXQA 2DP3A 2YIHA 3GIYA 3PFRA 1H3GA 3WFLA 3CV7A 4H41A