1QUMA

Crystal structure of escherichia coli endonuclease iv in complex with damaged dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*TP*CP*C)-3'
publication title Structure of the DNA repair enzyme endonuclease IV and its DNA complex: double-nucleotide flipping at abasic sites and three-metal-ion catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 105
structure length 279
sequence length 279
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 1999-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1qumA00
2ZVRA 1YX1A 3M0XA 4K3ZA 3JU2A 3M0YA 3KBJA 4A8LA 4XIMA 1TZ9A 3KCLA 4QDWA 2XISA 4QE5A 1O1HA 3CQHA 2G4JA 3ITVA 1XIIA 2GLKA 1XIGA 3XISA 2NQHA 1S5MA 3GNXA 1XLBA 9XIMA 2Q02A 4X63A 4DVOA 4GJIA 4ZB0A 9XIAA 4X60A 5I7GA 4J4KA 5XINA 3TC3A 5H1WA 2GYIA 1XP3A 3UA4A 2X7WA 3QC0A 1XLDA 3VYLA 5AVHA 4A8RA 3P6LA 4GJJA 4KW2A 1XLCA 4ZBCA 4QEHA 1XIFA 1DIEA 4ZB5A 4XSMA 2OU4A 3AAMA 1GW9A 1DXIA 5AVNA 5EMJA 2XIMA 3IUDA 3VNLA 2I57A 3M0VA 2HCVA 3CWHA 3C0QA 1XIBA 3LMZA 1XYMA 2XINA 3BDKA 4GLEA 1XLHA 2GUBA 3U3HA 7XIMA 1MNZA 3QXBA 3KWSA 3FVMA 3CQJA 3UA3A 8XIAA 1I6NA 5C9ZA 3KBNA 5EMMA 4E3VA 3ITTA 4K1GA 4US6A 4XISA 1XYCA 1QUMA 1XLMA 4ZB2A 2NQ9A 3C0SA 5XIAA 2G0WA 1XIEA 1QT1A 3OBEA 4OVXA 3QZAA 3P14A 4G56A 4XSLA 1XYLA 4HGXA 4QE4A 3BZJA 3IUIA 4X61A 3BANA 3BWWA 1XISA 5J8LA 1QTWA 5FA5A 4Q7IA 1A0CA 1XLKA 3C0LA 3DX5A 1DIDA 5TNVA 3ITLA 3KTCA 3UU0A 1A0DA 3KBSA 3KCOA 4YTSA 3VNKA 3AYVA 4DUOA 4HNOA 2GVEA 5EMLA 8XIMA 2HK0A 4A8IA 3L23A 4YTQA 2ZDSA 1XIMA 1XIJA 2I56A 2QUMA 3WQOA 3M0HA 1BXCA 1XLFA 3CQIA 4XKMA 1K77A 3ITXA 4QEEA 1D8WA 4A8NA 4EAYA 3ITOA 4W4QA 5B7YA 1DE6A 5B7ZA 1XINA 3BZGA 4HHMA 4XIAA 3ITYA 4YTTA 3U0HA 3TVAA 1XLJA 3VNMA 4LNCA 1CLKA 1DE5A 1XLLA 1XLEA 3IUHA 1XYBA 3NGFA 4HHLA 4PFHA 3KCJA 3VNIA 2X7VA 3N4AA 6XIMA 1S5NA 1I60A 3AYTA 1XYAA 1MUWA 2QUNA 5EMKA 3CQKA 4QE1A 4PGLA 3UXIA 3VNJA 1OADA 3M0LA 3AALA 3KBVA 1XLIA 3XIMA 3UVAA 5B80A 1XLGA 5XIMA 1BXBA 1A0EA 6XIAA 2HK1A 1XIDA 3M0MA 4YTRA 4EACA 4GQBA 4QDPA 4YTUA 5H6HA 3XINA 2QULA 2NQJA 3KBMA 1XIHA 3CNYA 3KBWA 1XICA 2J6VA 1XLAA 2QW5A 3DBNA 3QYSA
chains in the Genus database with same CATH superfamily
2GVJA 4AIBA 5HWMA 3M41A 1A49A 4S3BA 1R5YA 4E2OA 5BZAA 3VKBA 3EBVA 3EPMA 3WD4A 1W3KA 4DUWA 3I7RA 4EAMA 1YDNA 3W7HA 2BLEA 1EX5A 2VDGA 2VR4A 3NXLA 4IFKA 4NUWA 2PE4A 2WJFA 2JEPA 3DGRA 3IUDA 5CZJA 3U7VA 3CWHA 3TW9A 3H2FA 3O06A 1R30A 1D9EA 3BOLA 3CHCA 8RUCA 1GQJA 3QW3A 1S1RA 2NT1A 3HGOA 1ISYA 4DO7A 2ZADA 5KZDA 4PRRA 3GVVA 4AD2A 1XISA 1TX0A 1EC7A 1SZGA 3UG4A 1V3MA 4K36A 1UROA 4JICA 4TTGA 4HZ8A 1OK4A 4CCZA 1E6XM 2X1SA 1UWSA 4UOJA 1J01A 4EPDC 1TV2A 3BK0A 4M8UA 3VKJA 1DWAM 4KGJA 3UCQA 3WJSA 4QJ3B 1CGVA 1QU4A 2WCSA 4RE0A 1YIXA 2OJPA 1OM0A 3N4AA 3ANUA 1I60A 2WCGA 5DANA 5I03A 1AQFA 1JD7A 4MM1A 1VCVA 3CPRA 4JIEA 3NZ1A 2PGRA 3WD0A 2QEZA 4KIEA 2QCDA 4ATWA 1UUOA 1EDTA 1XIHA 1JGMA 1H11A 2Z7GA 3SUWA 2J88A 3PZMA 2H6RA 2PD5A 4IHCA 1D3CA 3ECQA 1VRDA 1IEIA 7CGTA 2OQLA 2IQ0A 1RSCA 4GCAA 4KEMA 5JIWA 3XISA 3IJ6A 3KLKA 3FX4A 2OG9A 3GUWA 2WZMA 3EKGA 3MP3A 1QVBA 2QV4A 3W1XA 4ZA0A 3KVLA 1TV8A 2BS9A 4I6VA 4N42A 4PL1A 5G2WA 1OT2A 5CJ5A 2D1ZA 7XIMA 1QATA 3GFZA 2FGLA 3LPGA 2QIWA 1XYCA 4YLWA 3WF1A 3RN6A 2PUZA 1TPVA 3W3OA 3NL2A 1G4PA 4NYYA 3LLXA 2YCKX 1GORA 2GGJA 3WG6A 3HF3A 1Q6CA 3NM1A 4Y9PA 3DDMA 3MMTA 4C6MA 3PG9A 1EXBA 3SSJA 3NR0A 4ADTA 1T41A 3P3BA 1EJXC 2YDRA 1MSSA 3ARXA 1DXEA 4LBRA 1IR2A 3PAOA 1Z9AA 4NZ4A 4A3RA 5A8NA 1YXDA 4QCEA 3GG1A 3VKCA 2J6VA 3BO9A 5BRPA 4HN8A 1YDOA 4LW7A 4Q4PA 2GQAA 3A9BA 1SJBA 1XUZA 2YDSA 1PZ1A 3C6CA 1CB2A 3GC2A 3S1UA 5GNYA 1HKVA 2EQDA 2GVYA 2J9ZA 5LKYA 2DZAA 2FHBA 2FB2A 2Q6ZA 1W6TA 3OHIA 2ACRA 2J6XA 3U2OA 1VFOA 2UWFA 1ONEA 4ZO9A 3ZIZA 5KTLA 1JPDX 4L7ZA 1XD1A 3SSZA 3WLQA 4H9MA 2X1TA 1FCUA 3GHUA 1GOKA 3MU7A 3NQ2A 1ZTVA 3QZAA 5FF4A 1XFBA 3GDBA 1MDLA 2BVTA 3RM8A 2R6OA 4ILSA 1ZALA 1GVFA 3MMWA 3NYZA 4S1FA 4ZQNA 1FTXA 3Q2DA 1B30A 2DW6A 2WWCA 5CGQA 1MZHA 1FWWA 3CUGA 5I77A 7A3HA 4GK8A 4EP8C 1EA9C 3MI6A 4Q22A 5BW6A 4J3VA 1S3TC 3ZS4A 4S3GA 2C91A 4XTIA 1TREA 1VEPA 3GDTA 2VNCA 2INEA 2E40A 4AD1A 1ESWA 3CV2A 2OGYA 5A2BA 4C6NA 5HXMA 3AICA 4E5TA 1MFUA 5E9AA 5LXEA 4IFKB 3W1LA 2XH7A 2FGZA 1H7RA 3BURA 2FIQA 5EGRA 2WZIA 3TWAA 1R8LA 4XAZA 5EFFA 1JZ6A 1V79A 5M03A 1TTPA 3FHAA 3VGGA 1EGZA 1JPHA 3TJ4A 3TLQA 4NP7A 3AIUA 4IIFA 3M6YA 4ZB5A 3EYPA 3DN5A 3RLVA 1S1PA 4EWJA 1UUQA 3AZSA 4X3ZA 2PSNA 3PNZA 3BCJA 2ZQ0A 4PCTA 4ZE5A 4S3DA 1IWAA 4NYUA 5TF0A 1QPRA 2Y1HA 4RJEA 4UTIA 1A5SA 4GO8A 1PPIA 3TEVA 2H8XA 3NJ3A 3M1ZA 4NJKA 4UFMA 3JR2A 3EDKA 3RHGA 1US0A 1KC7A 1RD6A 3N15A 3TJXA 2BHYA 3AXKA 2QCDB 3O16A 2QZRA 4HTBA 4IIHA 3B3DA 4MLRA 3CPUA 3GKFA 2OVLA 2A3AA 2NVDA 3W4RA 4KERA 5DX7A 3RU6A 1GYNA 2XVGA 3UY8A 2QCEA 3CQKA 1EP3A 1VFUA 1QDSA 1NIUA 1SZFA 2DT2A 4HU0A 4PR4A 3NL3A 3UP8A 1TELA 1GOWA 4CNSA 2Q8ZA 2B7PA 5A2AA 1WBHA 4K1WA 1SZNA 2ISWA 4LVDA 2PWDA 2G8ZA 1PDZA 1PWMA 2PD9A 4CGTA 1NVMA 4C7DA 1ICSA 4Z1AA 3R4IA 5CAHA 4S38A 3KRZA 4F4RA 2Z1KA 3O6YX 2AKZA 3KVMA 4FXRA 2WC3A 3AIVA 3SJNA 1N7KA 3L2IA 4K8EA 3OIHA 1FFQA 4EIVA 1G4TA 3HG3A 3CAVA 2E0PA 2DORA 5EFDA 3LLDA 1F74A 1EPVA 2YXOA 3G1FA 8XIMA 4B5XA 4LUSA 1I2QA 3OGVA 2Z26A 3WBAA 4LYQA 3NM3A 4W84A 2Z27A 3ZJ8A 1Q6DA 1AZ2A 4RR4A 3UG5A 2HV5A 3O0KA 3W6MA 5AC7A 5LA0A 3H21A 1VIWA 2W79A 4ZE4A 1VBUA 4GI9A 5H8MA 3VNJA 4U10A 3RCYA 2WJDA 3DAQA 3QH2A 1TPEA 3KTXA 3MKCA 3PUDA 3WK3A 1VYSX 4RNFA 3CNYA 1BEUA 1BYAA 1Y8BA 1CBGA 1L6YA 4F9DA 3P7YA 2WZTA 4QNWA 1FKXA 5JBDA 4AVOA 3W1MA 1OD0A 1WKDA 4KWWA 3KAOA 2XH0A 3BICA 4GJ1A 1NWRA 3CZ8A 3T4CA 5DRIA 3LNPA 1ELSA 3GG8A 3E9AA 3PZIA 5E93A 4NJIA 1OINA 5CZTA 2WCAA 4OBSA 5I23A 2ZZ7A 1VJSA 1O5RA 4D6IA 1HL9A 4EF9A 3V5CA 3W25A 1BGGA 1XUUA 1P4CA 1G1YA 4JTEA 5AHMA 2QCNA 2OQYA 2F6XA 3BCDA 3EOUA 3LBCA 4A3QA 1HJVA 2OLAA 2QT3A 3SGGA 3W53A 2O7SA 4Z17A 3AMCA 1SJCA 2OKTA 5TQLA 3UJ2A 4A8IA 2QUMA 2BHZA 1F6KA 2YDAA 1BYCA 4HVXA 4AHOA 2WMIA 4AD3A 4LF2A 3W7IA 1YQ2A 4PMDA 1OFAA 2E5CA 1WXJA 3Q45A 1KFCA 1LCOA 2PDYA 2Q8XA 4ZOEA 5CG7A 5DBTA 5TBOA 1S2AA 3VNZA 3VPLA 4ACZA 4C1NB 1KFBA 3WK2A 5E6YA 1EZ2A 1JCLA 1SZRA 4HTYA 1W9PA 2J27A 4J2MA 3TR9A 1ADSA 3KCLA 1FWDC 2UBPC 3MI2A 4QR6A 2E9MA 2Z2AA 3GNOA 4WHBA 3MCNA 3OA5A 2W9MA 3VA8A 3F4DA 4EXBA 3PULA 2FB3A 4MJMA 1CNVA 5AZ1A 3KOFA 4J5NA 1H0IA 1SU5A 4M6QA 4FB7A 4LTSA 4MJ2A 4W93A 2E77A 3TONA 1S46A 1VZWA 5TAOA 3LNMA 2W6RA 3ZVIA 3INPA 1FCVA 4UBPC 3OIXA 3F2DA 4JGDA 2Z25A 3T07A 4GYPC 2DZSA 5HOSA 3T09A 1UQYA 3VINA 1VQTA 1V3LA 5KSWA 5G1TA 3PTQA 5M1TA 1X1ZA 3BSHA 3QRHA 2FLIA 1KXVA 1SW0A 1AQ0A 3DC0A 4IXHA 1ZENA 2BY1A 3REQA 3W7GA 3ZWSA 4GE8A 2YDQA 3RJXA 1PBGA 1UMYA 2ZXDA 3W01A 1KFJA 2NX3A 1AL8A 3LXAA 1QI5A 3OLDA 3ZLFA 3QQ1A 1VJZA 4EWND 1FRBA 1HFBA 5G1MA 3M0YA 2J24A 1UKTA 1R3TA 3GSMA 4Q8VA 3GU2A 1G67A 3CQHA 3T6CA 2WMGA 1VBGA 3TZFA 5ABHA 5I09A 1AMKA 4QG9A 5K3VA 2RH9A 1K03A 1IWBA 4NJJA 2GYIA 3F2BA 2AQWA 5DRCA 3DFHA 4PUMA 4MG4A 5CPOA 1YYAA 3ITGA 3TSBA 4L6OA 1DWGM 4ZQRA 2X2YA 2INFA 4IIEA 3TDFA 3KLLA 1XRVA 4UQCA 2W3ZA 5C9ZA 1E3ZA 5FJTA 3H55A 3IV3A 2D0HA 4CCCA 3UJRA 3SCUA 3QPYA 4W9TA 1MEIA 2QCGA 1ZLPA 4OIFA 3VGFA 4NU7A 4NAEB 3LK6A 3AS0A 2J9XA 3BLEA 3H23A 4WRHA 3PFRA 3PBGA 3GXFA 5FI8A 1QWGA 4HJFA 4M7TA 3SQSA 4DI9A 3WQOA 1P0DA 3M0HA 3TMLA 2IKGA 2Y6ZA 3A12A 2ZUSA 3WF3A 1OFRA 4NAFB 1ECEA 3V0UA 4A6GA 3MB9A 1F07A 3LHYA 2EPNA 1OK6A 4ZVJA 4EXAA 2VEFA 4ZZ9A 1EJVC 1WOAA 3VUSA 8TIMA 1EZWA 1DJWA 2HPMA 2QS8A 2CLIA 4NX5A 3GZ3A 3K5XA 4KETA 1W3NA 1KLYA 4RV8A 1PVNA 3Q4DA 3AHYA 2B4GA 4PUKA 1SMAA 2CZDA 2PLKA 3OPSA 4GJIA 5IDZA 2V68A 1E55A 3E2RA 1LWJA 2WNWA 3QW4B 1XH1A 1YE6A 3GX9A 3B8WA 3CUIA 1YPFA 2DH3A 1Q6LA 1XC4A 2DFAA 2RUSA 3FIGA 2PRHA 3E49A 1WKYA 4KPLA 3WQWA 4CN6A 2G96A 3EB4A 2PP0A 4LS1A 2RFGA 2J7HA 2WKGA 4UQAA 3B8DA 3VK5A 2EKCA 3TN5A 5C71A 5T8GA 3B0VC 1TTQA 3CTLA 1EYWA 2QCCA 3L7RA 1WZMA 3L4UA 2CPUA 4AWEA 4TV5A 2QPUA 3D6NA 1J6PA 3SI9A 4AWSA 1TA3A 1GYMA 1Q66A 2C15A 2CBJA 4ACZB 4I7WA 1O6IA 5A5WA 4FAMA 2ZRZA 1ZPTA 3B0YA 4DELA 3GD6A 4GX9A 5IDIA 4K6AA 3VD7A 1OCBA 4I9TA 3WH5A 3UWVA 2CFFA 2V63A 2VDHA 2WMHA 2F7FA 4GI4A 4LOCA 4JTTA 1A5LC 3DFPA 5D30A 1UC5A 2ACUA 1EP2A 3UG8A 1R3SA 1BSIA 1A5UA 5IFPA 2A1YA 2PGEA 1V6YA 5DFAA 3JUGA 4DF1A 3FHQA 4CNPA 3W38A 2V2DA 3GE7A 2EPLX 3MWAA 4E0CA 3NCOA 1OVDA 3BAWA 5CXPA 3FFSA 2W63A 5CPSA 2AKMA 2JIWA 4NJHA 1UC4A 4QITA 1M6JA 3USZA 3MTWA 4IMFA 3EX1A 1C92A 5FCZA 1CPUA 3LCXA 4TMCA 4G7EB 1H0GA 5BU6A 1YNYA 2NXHA 2X16A 3VUPA 5DF0A 2YXGA 3LTYA 2WLZA 3L4VA 2XFWA 3THUA 4FP1A 1QFEA 3VABA 2D2JA 4HGXA 3R89A 4DZHA 3MMUA 1QTWA 5FIPA 3REQB 2PODA 4NSBA 4X2PA 3C0LA 4KESA 1F05A 4KH2A 2R91A 1Q65A 5C55A 3RNDA 2GVEA 3TAOA 4S3EA 3GY1A 5D03A 3VE7A 4F0HA 3RAOA 1F61A 4RK8A 2DT1A 1ME7A 4UTKA 4JFTA 4YTTA 1SFLA 2FZMA 4BWLA 3DKJA 4XB3A 3QHMA 5KZEA 2VZUA 3AMGA 3U6WA 2NVCA 4MYAA 4RE2A 3HIJA 5LNVA 1V6TA 2CKRA 3CL7A 3BLKA 5C6MA 5ABGA 1AQMA 3AS1A 4CD5A 1G69A 3IK4A 3GW0A 1WDSA 1PHWA 1CXFA 3AISA 3NDZA 5GJNA 1TR9A 1CI1A 3QBUA 4FLSA 4MMWA 3W2MA 1PX8A 1YNQA 2JEQA 4CKQA 3M07A 3K30A 4N9EA 2P8BA 4J35A 2XGZA 2JF6A 3BE7A 4I9JA 3VCRA 3RO6A 4YXGA 1DKWA 3TCSA 4B5WA 2ANUA 4XZHA 2JKEA 1R3QA 1Q3NA 4L80A 4O13A 3DCPA 1ZSXA 3A23A 4I5XA 4N6FA 2RGLA 3HZ3A 3CIWA 1KM3A 3IIZA 3ONCA 4Z1CA 1LUCA 3WMSA 1XINA 3GXTA 3TVAA 3VVGA 4BI7A 4E4FA 1B57A 3PC0A 4PTNA 4PTXA 1YRRA 2HMCA 1KM6A 2DT0A 3UXIA 3NXFA 4C65A 4JQ4A 5CC7A 4FOKA 1XPGA 5JH2A 2CCRA 4RPQA 1H62A 1DOSA 2FZDA 2VR5A 4AZGA 4D1IA 3BLIA 1PB0A 4A8LA 3P67A 2PB1A 3S5YA 4KWUA 4C1LA 1IIGA 1KGXA 1EIXA 5DMLA 3VE9A 1EA0A 2WW5A 5FJUA 5BNKA 4NVTA 2CXGA 1RCOB 4H9ZA 2PP1A 5JQ9A 3VNLA 5K4XA 2BVYA 4YVVA 1TA3B 2BX7A 1V0KA 1E5NA 1DWFM 1IQ8A 2VC7A 3ZOAA 1N8WA 2E8YA 5FEWA 1Q8AA 2CHRA 5FOOA 1TQJA 3SDOA 4Y9AA 4FF5A 3WZ0E 3TYEA 2GWNA 4L9ZA 4FA3A 3PZVA 3GKAA 3Q37A 3O0FA 1MUCA 1LG2A 4JKKA 3S5OA 1UHVA 3RLHA 1Z89A 5L9FA 4XUGA 2C7FA 1SW7A 2J7GA 1UASA 5B7YA 1NWSA 3TQ0A 3T42A 3LRLA 4DWDA 3C61A 4UQEA 2DU2A 4HNCA 1OADA 5CGTA 3FS2A 3ID7A 3L4XA 1TFVA 2PWVA 2VZSA 3UWEA 4AY1A 2POZA 3CXOA 3APGA 3PVFA 1POKA 1VEOA 1J6OA 1MUMA 3NQ8A 4O57A 1XM3A 2OX4A 4QE5A 3IAQA 2WANA 3C86A 4W8LA 3WLIA 3KRUA 2NVAA 4HMCA 5CC5A 3EMQA 1TCMA 1D7KA 2NX1A 3OU8A 3RRAA 4W7VA 4RNHA 1XLCA 4X2RA 1NWUA 1YADA 1WOBA 3II1A 2NSXA 4PFMA 5AVNA 2NT0A 4JOMA 3EB2A 3S9YA 3CQ0A 3SCNA 5H91A 1K8XA 1YEYA 5G2IA 4YYFA 3S2LA 1VFLA 3M7WA 5AKQA 1H1ZA 1T6MA 9CGTA 1ZL1A 3FDGA 1W17A 2E5DA 4MNLA 3EKLA 5FSDC 1AW1A 2W92A 2PBOA 5J8LA 2EGZA 5F1VA 3B8UA 4UMBA 2PCEA 4PTDA 2DJXA 3EX3A 3VNKA 3W1NA 5CBJA 3Q67A 2VC9A 4RNJA 3MCMA 3TW6A 3R94A 4QEEA 1D8WA 2NX9A 3GVGA 5CAKA 4FXSA 4GY1A 4JDYA 2E4TA 5A8OA 2QJIA 5CJNA 1M7PA 4MNMA 1BAGA 1P1XA 2GL5A 5KETA 3D5HA 1OY0A 1EO5A 1TUXA 1UKSA 1HIZA 1CGXA 5CJMA 3VX0A 2Y89A 1QOPA 4P8VA 2V3FA 4KFOA 1E6QM 2F2KA 2J78A 2TMDA 4LU0A 3PJWA 4K68A 3S42A 1YDYA 1LWHA 3HOJA 3C2VA 3ARVA 1NELA 5FD0A 2PU1A 2OEKA 5M3WA 2CLPA 5I5RA 4DJFC 2XVKA 4F0RA 2J7CA 4HP5A 2YGYA 4AF0A 1RXOB 3E0LA 3W82A 2BHUA 4TX6A 2PGFA 2VGGA 3CB3A 5U4NA 1Q6EA 1W32A 2BG5A 3ELFA 1US2A 1LOLA 3MQTA 1XFCA 4PMNA 1PCKA 3GZAA 1WE5A 2J74A 3LGEA 3W1TA 1LUCB 3GH7A 3T2OA 4HOZA 1X1OA 2D0FA 5H8PA 3VKKA 2WSQA 1JYXA 4S3FA 1V02A 1Q85A 3NVTA 1RBLA 1NEYA 2J25A 3K46A 1BG9A 2D3LA 1DTNA 3RFAA 1FWAC 3QR0A 2W67A 1E4MM 1NP2A 4DBSA 3GNPA 3UBPC 1RBOB 5B7ZA 4O54A 1DJXA 1POJA 3CO8A 2QUTA 3Q94A 4S3CA 1T40A 3WQGA 4ZTXA 3I7QA 4ATLA 3LQGA 4IIDA 2YOCA 1WKEA 3CO4A 1TPFA 1GOMA 2A7RA 2E8ZA 1G5AA 5CZSA 4CVWA 1L6WA 4QLKA 4DO4A 4NX0A 3BL3A 4JNYA 4P7NA 1V6WA 4UQ9A 3PANA 4BF5A 5A2CA 1XP3A 1KO0A 1QAPA 2PC8A 1Q6GA 1OX4A 3WEMA 4I90A 5IFTA 3HO8A 4QEHA 1AH4A 1O60A 1E9ZB 2WSKA 7PTDA 4F40A 6A3HA 1CENA 2VGFA 4WJEA 4WKAA 4HPNA 1UWIA 1Q7ZA 3VZXA 4WDUA 1ITUA 2V5CA 1DQXA 3R0KA 4LVBA 5FJJA 2E67A 4X0VA 1PCWA 3EDJA 4GZEA 3PTDA 1PZ0A 2ZVIA 2OPJA 4PMJA 5HWJA 1F4AA 3SCPA 3S5SA 3VD3A 2QCMA 3S6OA 2IQDA 3WNOA 4WUIA 3CAWA 4DLMA 2XHYA 3FOKA 3N4FA 4LT9A 4DM1A 1OX6A 2GVGA 1L8PA 2J7BA 4ICCX 2PC4A 1AJ2A 4IMCA 1HKIA 3CZJA 1SSDA 3W1UA 3AXMA 4Q8QA 3VIPA 3W71A 1TTIA 4AISA 1E6RA 3G3MA 3R8GA 4YTRA 2VKZG 2EPOA 1ITQA 5K2ZA 4AVFA 3HG5A 5HMFA 1QPKA 1KBKA 1L8NA 4QLJA 4XIMA 4MOZA 2HEJA 2GPTA 1DXFA 3WD2A 4L65A 1Y7VA 3VMPA 3I3BA 4KRZA 4RPPA 3PBMA 3LCWA 5IM51 2RDWA 1V0LA 4IPIA 1W8SA 4LJ3A 3A13A 3G18A 4DQWA 1EO7A 3SRKA 4C6QA 1IGSA 3G22A 3ALFA 3B06A 3NSXA 3DFYA 4OV4A 1FHDA 3QMSA 5A8PA 3EWUA 1PJ9A 3BG5A 4ECLA 3CQJA 3BV7A 4LUJA 4AEFA 1CX9A 3IVUA 5AYZA 1JDCA 3UF9A 3GHTA 5C7HA 4GABA 2WC7A 3N13A 3VXGA 3O6DA 3RXZA 2V5LA 3QY7A 1LM1A 4RDZA 2YZRA 4XO6A 3T0TA 2CW6A 2FKPA 4QLLA 3CYVA 1C29A 5CPMA 1JF5A 3TC6A 4WKFA 1QASA 1Q2RA 3KRSA 3I68A 1VFHA 3ITYA 2A2IA 5A8GA 1B0IA 5G2HA 1J79A 4AF0B 1SPQA 3BAIA 1FA2A 5DY2A 1V51A 3M44A 1GYLA 3K1GA 5J5RA 1C8YA 1FWHC 3H7UA 4HPHA 1LZOA 1TJ0A 1TJRA 5AHIA 4OE7A 4O19A 3FEQA 4R3UA 5D09A 4JTLA 1XIGA 3G0UA 1JPMA 3ZJ6A 3LHUA 2AMGA 4ES4A 5CC6A 1TJPA 4GZJA 4A35A 4FIQA 4XZBA 1H49A 1KR0A 4IJCA 2FTWA 3IK2A 3LN3A 2HCVA 3SCVA 3THCA 2XWEA 1PYMA 1VCFA 3W87A 3R58A 1EDQA 2WWDA 4HHPA 4MHBA 4K1GA 2HROA 3STPA 1WYIA 3HPSA 3EX6A 4ONVA 4XSLA 2PDGA 2VX5A 4JIRA 4Z1DA 1BWKA 1ZUAX 2J7EA 3FA3A 3DX5A 5C2CA 3FV9A 1VYPX 4HZ7A 1ZCOA 4Z0JA 2VFHA 4DY1A 1BXCA 2UY2A 1JXKA 4HHHA 2WHKA 1JI2A 1XGZA 4C7FA 2V5KA 1XC6A 1MEWA 1JQXA 4PMQA 5AY7A 1QW7A 4QSHA 5D2XA 3ZLGA 4AXNA 5GQBA 3W7JA 1DYSA 3WLPA 2G95A 3G1AA 3VM7A 1Q6OA 1OX4B 2RJHA 4NZ5A 1K9FA 5AYXA 2OMAA 5LIXX 1G01A 4IUOA 5C2GA 4GWEA 1U33A 3K4DA 5CSUA 4DO6A 2GUUA 1ZZMA 2DZTA 1ISVA 1O1HA 1OBAA 1V4YA 3M7SA 1UCWA 3O6AA 4DM2A 4HCHA 5XINA 1D3HA 5LIWX 3A4XA 2V3EA 1T7LA 1T5AA 2GJLA 4ZR8A 4X9SA 2VOMA 3LM7A 1S3HA 1HL2A 3EXRA 4R9XA 4FR1A 4FZIA 2EXOA 3BG3A 2VRJA 4DWSD 4GBUA 2DUZA 1UD8A 4POCA 4LAMA 3WCZA 3MHGA 1M9HA 2VFDA 3PTMA 3Q58A 4MKSA 1S2TA 3QEZA 4UFKA 3K8LA 1OCQA 2FVKA 1QPQA 3FY1A 3BQ6A 4HQVA 4IP5A 2E6AA 3RR1A 3O6CA 2YLAA 2QUUA 4BF9A 2VEIA 4W88A 4GYFA 5JU6A 1VB9A 3LV5A 1H50A 2A4AA 3NFUA 1E6ZA 5MKGA 1QHZA 5AC4A 2GJPA 1OD8A 3A6OA 3QKEA 3PJUA 1ZAIA 2PZNA 2PWGA 4C6IA 5FAJA 2EG6A 3BXWA 4A2SA 4ENLA 2W66A 1M53A 1RVKA 2TYSA 1MXSA 4Q8PA 4LYKA 3GHRA 2TRSA 4B4FA 3A9IA 1AODA 2W27A 1FWFC 1E51A 2J8FA 1V7YA 3VU2A 3WBWA 1B54A 2W5FA 3C3UA 2RDXA 1LBFA 3EWDA 2X30A 4FNSA 5HNNA 4J4KA 1YTEA 3A24A 2Z0IA 3SBFA 1FWCC 4CNUA 3P6LA 2EG8A 3B9EA 3B05A 1K7XA 1E4LA 2YX0A 3SN0A 3V1PA 1GCYA 4MZYA 3UA3A 2ZUWA 1XBYA 4M81A 4MY1A 4GQ0A 1UR8A 2DH2A 3FDKA 3NPWA 3NNTA 3JZUA 1CZ1A 1FFRA 3S9IA 1KM4A 1ZS2A 3E96A 2JF7A 3U2CA 3TSMA 1JCXA 3KBSA 1VCGA 5FF2A 3PBWA 4IQDA 1KWGA 1IXNA 4F0MA 1VKFA 2WV8A 3QQWA 2R1PA 1DV7A 3GC5A 1JYWA 4DWSA 1IZJA 5K9CA 4BY3A 4JPGA 3ZO9A 4EKJA 3E2SA 4ZGYA 3L67A 3E5PA 4JTDA 5KINA 1Z7AA 6XIMA 1GG1A 4HNVA 4ERIA 2ZUVA 4IIGA 3XIMA 3EDDA 1J93A 1NF7A 2QQ6A 4UTWA 3MSRA 1UWRA 2Z6JA 5GPRA 2VJXA 1E15A 4G6CA 3EDFA 4GQBA 4OZOA 3G1YA 2OYKA 3NSNA 4PN2A 4H9VA 4E8GA 4O28A 1LRNA 1VPQA 4LS2A 1DIKA 2IUZA 4WJXA 4GY0A 5A3HA 1A4MA 4GVFA 2P0IA 1OGSA 4LC6A 4IPNB 1ODZA 3MZ2A 4TXEA 5HNTA 1LORA 4XZ9A 4LY8A 4G1KA 3H2AA 4RNIA 3H4WA 4QCFA 4DF0A 3HA1A 1FVPA 1W1TA 4TX9A 3BQ5A 3LMZA 4IICA 3T55A 3TOPA 4GZIA 4LC8A 3MYPA 3TROA 4XVEA 4DJDD 1E1CA 3U8GA 4KRUA 2D0GA 4L9YA 2EO7A 3O15A 5E5CA 1SO6A 4DB7A 1UR0A 4XKYA 4YNGA 4QJ5B 4F8XA 3S6TA 3KP1A 3TYAA 3QHOA 3VC6A 2GQ9A 4PC8A 2FMNA 2FVMA 1FDJA 5BOEA 3CL8A 2HBXA 1X6NA 3EOOA 3N2BA 4M56A 3U0HA 4J3TA 1XSKA 4LNCA 1X39A 2PFHA 3GB6A 2X7VA 3SFKA 4HSNA 4J27A 1BVWA 1EQCA 1HVQA 3BGAA 4AIUA 1W56A 3BJFA 1E73M 4LSBA 2XIBA 3CWNA 4QBXA 4RLIA 3QF0A 3WF2A 2QCHA 2GJXA 2OZ8A 3HB9A 3UGRA 2Y8VA 3V7PA 4F9JA 1H2JA 3PZGA 1KFLA 2QGYA 4PEEA 3MVIA 3GDKA 1SQ7A 2JIEA 2X0YA 3S3GA 2RDUA 2Z4GA 4BKNA 1UH4A 1JPIA 2A3CA 1T8XA 3BSGA 3GO2A 4ALDA 3N73A 2QDHA 3WBEA 1F6PA 5CPLA 1AL7A 3M64A 1F2JA 3LERA 4BJHA 5TD4A 1W9UA 1BRLA 1W37A 5MKGB 3OP2A 1E0TA 2G0WA 1OFQA 4KGLA 2I1OA 4JHOA 1VLWA 4ZEPA 4LGXA 4MZ8A 5FL0A 3SJ3A 1DP0A 3OQEA 5M5DA 4BEUA 4WVXA 5EMLA 2OWCA 1PIFA 1RY0A 3POHA 3ES7A 5D2VA 1TE1A 1BHGA 5T91A 3ITXA 1OX5A 3H4GA 3TR2A 1QMLA 4XZIA 2QPXA 4WLCA 1F9CA 4S3AA 4XIAA 4DJDA 4JCMA 4JS3A 2RHGA 3WLRA 3F2CA 4J7RA 4HNTA 3UWYA 4UTTA 3KL0A 3KEHA 2R14A 2PDHA 5I0DA 2IW0A 2FTYA 1N8IA 4FSAA 1BXBA 2YB1A 3NQ7A 2B7OA 1C9DA 3PZOA 1FQ0A 3NL6A 4BWLC 1GVQA 2HNEA 1XHGA 2BNJA 4AWUA 1MW1A 1KFKA 4JR5A 1XW8A 3WQ8A 1UZ4A 3WQDA 2XVLA 1M7OA 4DXKA 1LT8A 3VYLA 3GR7A 4A8RA 3HGRA 1AW2A 5E09A 4IWWA 3AO0A 1EC9A 3CZLA 3QLDA 4GLEA 1QHPA 2OT1A 4DWSB 4W5ZA 2RGMA 3T9PA 4OGZA 3DGBA 5HJXA 4PCFA 3RCNA 3V0TA 3O8AA 2OQHA 9RUBA 5BCAA 3GXPA 4UUIA 3ALGA 1LRQA 3BLOA 2FVLA 2F61A 3FAWA 3PB2A 1GW1A 2XVPA 5IRPA 3LHTA 2JKAA 3TN6A 5AECA 1MW3A 2PDWA 2DSKA 4QFUA 3VIJA 1XLFA 3AHVA 3B8IA 2WHLA 1TVLA 3URQA 3WD1A 4J3UA 3SECA 3GAYA 4AZ5A 4H6QA 3R13A 1H7PA 5D8ZA 1I45A 4NASA 4WSKA 1E0VA 3SRFA 3VMNA 4A22A 1P0EA 3P8IA 3VCNA 1OFPA 4HMDA 1UZ1A 5A6LA 3BOFA 1L0PA 4FHAA 4W8BA 1HO4A 2PDKA 3UW6A 4F2UA 3ABQA 5CEWA 2D2HA 4RKAA 1UYQA 5ENLA 2QW5A 5GNZA 2V2CA 1US3A 2NSOA 1E6PA 1E1CB 4J9JA 1UH3A 5C9UA 1ZP3A 3H54A 1KKOA 3OO2A 4HOWA 4R53A 2BMBA 3NTYA 2DW7A 3KL5A 1LLZA 3GFXA 4V33A 3BAYA 4L6HA 1VF8A 4PUJA 1HKKA 3H70A 3P60A 3TU9A 3SM0A 2HQAA 4AZ7A 1MVYA 3OBAA 3WMCA 1PTDA 3IVTA 3BCFA 3IJLA 1ZBCA 3GH5A 1R38A 3GNRA 4JYDA 1QW8A 3NQFA 4JTJA 4FLQA 2WSYA 1G4EA 1EP1A 1A0CA 1GVYA 2FYMA 1S2CA 5HANA 4RZ5A 4ZQCA 5CCZA 1U1UA 1XIJA 6TIMA 4LBSA 1XJBA 3R10A 4LUYA 4K7VA 1MRAA 1MRQA 2Y61A 4W4QA 5I6SA 4ZOAA 3CWOX 1BXNA 3R1ZA 4I3GA 5EA9A 1JD9A 1LYXA 1CLKA 2BGSA 4D6FA 1OB0A 4L64A 3F5JA 1RCXB 3MO4A 4R85A 1GVOA 1XLIA 1E6NA 1A50A 1V3KA 4Z2GA 4YN5A 1V02E 3QPZA 3NO5A 5FJOA 1G94A 1PO9A 3LGGA 1KD0A 3GTXA 3L0KA 4KKXA 4IP7A 5E0CA 3QHNA 3WBXA 4EE9A 2C13A 1WZAA 3VIGA 4Y96A 1P0KA 1AMYA 1XIIA 2GLKA 4OHQA 2Y63A 1BRLB 2XYLA 4V15A 1WQ5A 3RR4A 2BGNE 2ZX5A 5HPOA 1GPWA 1R46A 1LQAA 3TN3A 4LYRA 1R86A 4AB4A 2QJHA 2E7FA 4NG3A 1IE7C 3OVQA 1UB3A 1UH2A 3T1GA 4IL2A 3NA8A 2QJJA 3GFYA 2XIMA 3E0IA 4ZO8A 1X8CA 1W1B1 4H8VA 3DHFA 4BK9A 3U3HA 3G1VA 4UXDA 3HQPA 2JKPA 2P1FA 3WDIA 4G56A 4XBKA 4B5UA 4FX8A 1MO0A 3F5KA 4BI5A 4EPEC 1R0MA 1PIIA 4GC3A 2VQTA 2VRKA 2ZX8A 3H2NA 1R47A 1W3IA 3SB0A 1E56A 3RK8A 3A3WA 4IPLA 2RAGA 4HYRA 1L2QA 4DN1A 4LH8A 4Z2LA 4PB4A 4X0NA 2VC5A 1HJWA 1XYZA 2BY0A 2PCQA 5IHSA 4U2ZA 4DAFA 3DFNA 3KOYA 3N12A 2WK2A 2G3NA 2YZ5A 3AYSA 4TV6A 1ML1A 1DPMA 3R43A 3WQ5A 3W07A 1WA3A 1PTGA 4GH1A 4K39A 3GXIA 1WCGA 2VEKA 3C2FA 2EPMX 5C54A 4E2DA 2ZTJA 3MT1A 3KHDA 3CHEA 5GVJA 3D46A 4LPCA 3T08A 1F3TA 3A64A 3SW6A 1UP2A 1X6LA 1NQKA 3JW7A 4MUZA 1O4UA 3E38A 1VENA 4QHRA 3WF0A 3HFYA 3M0VA 1RQEA 3OGSA 2V3GA 1B4KA 1UUMA 4UFLA 4LB3A 3B9NA 3AHTA 2HJPA 3T8LA 4K8GA 3KBNA 5EMMA 3RMEA 2PGWA 5EPDA 4A3HA 1B2YA 3I3DA 1XYLA 4DX3A 3APTA 3IUIA 4B9YA 2TPSA 2J7DA 1BWVA 5IBXA 3PBVA 4JYFA 3ZWTA 1SR9A 1YW1A 4V28A 1I75A 1V3JA 1S38A 3E1F1 3L9CA 4R9OA 2OZTA 5AN7A 1FWEC 3UWWA 3EA2A 5A69A 3UR2A 4OUEA 2A6NA 4MIMA 1YLVA 3WFAA 3WQVA 2HVOA 3ZZ1A 3LY0A 4Q3MA 4IQLA 1C8XA 1SW3A 4HCLA 1A0EA 1I0DA 4V2XA 3G77A 4YIWA 4H8UA 2ZBTA 4WIWA 5AZ0A 3LSCA 4UFIA 2WMFA 2XGIA 4AEOA 2FGBA 1UR4A 1U5JA 2EEXA 1FX6A 3IJDA 3TK7A 1DJHA 1TWIA 5JXQA 4LAKA 3FSTA 1KFWA 4O17A 2TSYA 1YMYA 2D3NA 2NV1A 3L2LA 4GZ7A 2XTKA 2VVNA 2OU4A 3AAMA 4YU1A 2CBIA 4CD4A 2Y5JA 3CMGA 3TJLA 5CGMA 4P2VA 1TVPA 1UPPA 3SCTA 4O18A 3VM5A 3WH9A 3C2OA 1RLDA 2BASA 1BGAA 3RCMA 3UXDA 3BUVA 4FF7A 5J5DA 2FFIA 1YPXA 1QT1A 3IGSA 3LBOA 4UTJA 3UFYA 1JG9A 4B5VA 5I78A 3VIHA 4HK6A 2YCLA 3S2MA 3AIWA 3HJZA 5LIKX 1U83A 3QV9A 1DIDA 1JZ4A 1SSGA 5LNSA 1G9HA 3EEGA 2NQLA 3AXIA 1FHLA 1O12A 3DYOA 1RBAA 2PDNA 4AW7A 4IMEA 2J4GA 3MI3A 3SCQA 4MB5A 3OW1A 4H41A 1XLJA 3ITCA 4QTGA 2IQTA 4H1ZA 1QR7A 3E12A 1UG6A 3V18A 4GPNA 3I4EA 1JL8A 4H6RA 4D71A 1KTBA 5FAGA 1JCTA 4MNKA 4I8DA 1S39A 3VKDA 1MQQA 1BWLA 1LWIA 4G9PA 1PYFA 3EWCA 4ZQOA 3A3HA 1ZAHA 1Q6RA 1P43A 7REQA 3TC3A 3QN3A 4PTMA 1W9BM 1Q8JA 4I7VA 1EDGA 2J77A 1UR9A 1Y65A 2DQXA 4PUEA 1ISWA 5EMJA 1FP9A 3PZTA 2HSAA 1S2VA 2PWUA 1JDDA 1B9BA 4ZENA 1EB3A 2CNCA 4GXPA 3P0WA 1FDZA 3MUAA 3RG6A 3M0KA 3I6RA 1XS2A 2GOUA 1FBAA 1EEXA 2E6FA 3P5ZA 1TPH1 3CHFA 1W5NA 1JNEA 3ITLA 3UVIA 3CC1A 1GVSA 3AC0A 3KFTA 5BXPA 3QV6A 1FWGC 1EHNA 1NFGA 5D9PA 3HV8A 1YNPA 4PUWA 1KTNA 2V2HA 2CEQA 2XZ7A 1TWDA 4WY0A 3ZYZA 1O68A 3VOJA 2WQPA 5D2TA 1DJNA 3MMDA 3TOYA 4Q8TA 1F5ZA 3AYTA 5HNRA 3W76A 3TP4A 1G7UA 4UFJA 3M9YA 3FLUA 3PNUA 3S1XA 3W7RA 1A80A 4YTUA 1P6BA 3WJWA 3SRDA 2NXGA 2ZVRA 4YVXA 2W61A 1A5BA 3HPZA 4S23A 2AMXA 4PTWA 2DQWA 2D22A 2R24A 4ZFCA 3BAXA 5CLWA 3PSVA 2IMRA 2CKSA 2ISFA 2O55A 4O1AA 4FNPA 4AZBA 1H09A 4HU8A 3M5YA 1O94A 4G7FA 1B31A 4BFAA 2VURA 5DN1A 3NZRA 4XSMA 3T0AA 5I3DA 1DWJM 2OCZA 4HZMA 2B81A 4CD8A 2ZZ1A 3P5YA 3SN1A 1B3ZA 4ZSTA 5AHNA 3SRHA 4GI8A 2D73A 2FJKA 1ZRQA 4GVIA 4AMCA 3FJ4A 4IT1A 4D6EA 4DUXA 1UIPA 5D2WA 3NEVA 4Q7IA 3RPMA 1NAL1 1ZNNA 3NQ6A 2PLCA 4NZFA 2R1KA 2ABAA 4OFCA 2R8WA 4CNOA 4CUCA 2ZA1A 1C7TA 3DESA 3MKVA 4NL1A 4O8RA 3CH0A 4Q4OA 2VDIA 3S2CA 1P0BA 3BMVA 2WNZA 4WD0A 3FJNA 2YR1A 3VFLA 5HMEA 5CG0A 4NZ3A 1ENUA 1EPXA 3MSGA 2I14A 4QISA 5LHEA 4WDWA 4IX0A 3TWBA 4LVGA 4W89A 3NL5A 2C71A 1UIOA 8A3HA 3U7BA 3ZJKA 4M19A 5G4WA 4ZB0A 3AWOA 4P7QA 3BW2A 4LRSA 4A2RA 3EXSA 1K6WA 1I8JA 2FQIA 3W70A 3UA4A 1XDMA 3MC5A 2YCLB 1XX1A 2CIPA 4S2BA 1VBJA 4KBXA 3G24A 4LANA 1RZMA 3VOGA 2WM0A 4P5UA 3QXBA 3LRMA 2WZEA 4LF1A 3UR7A 4DYJA 3T8QA 4QM1A 1H1YA 4YL2A 3UJFA 1EYEA 4JN7A 4UCFA 4IMDA 4RUBA 3B8VA 3R6IA 2V8ZA 2VFIA 3U4FA 4ZODA 2O4QA 2O9PA 1IEXA 3C52A 1PZ3A 1K7EA 4E8DA 4XVDA 3G5EA 3QGAC 4O52A 4QAIA 1XF0A 3ZMRA 4DJEC 1LJYA 2V67A 3LCLA 3TA6A 4YHGA 1FWJC 2W91A 3TYBA 3HQNA 4O4WA 1V0MA 2X1UA 1E5JA 3OVPA 1M65A 1J10A 3HTWA 5AYIA 4J3ZA 3VNIA 1R2SA 4HNNA 3GDMA 3VFCA 3RLUA 2WPGA 7REQB 3E6EA 3GYEA 2R94A 3GDRA 4GIAA 3IWPA 3LPOA 3G1SA 2ZKMX 3QVQA 1H60A 2EAWA 1RJQA 5CSYA 3DYPA 2QIIA 2X8RA 4YVPA 5CC3A 2GDVA 2QF8A 3WQ4A 1BD0A 1NOWA 5FJPA 3IARA 1JCJA 1QNPA 4O0KA 4M7SA 1IXOA 2WLYA 3M6DA 1BKHA 1M1BA 1LL4A 3H7RA 2VOTA 2Y5EA 1H63A 4AIEA 5I3FA 3SGZA 1Q7QA 4FEZA 5HNUA 4GI6A 1QOQA 1M5WA 4UNKA 1EIBA 1DVJA 2G3MA 2YW3A 3RU8X 3T0DA 3U5UA 2PDMA 4L6DA 4OBRA 3BW3A 1UD6A 2MUCA 3EOEA 3S5ZA 5C9XA 1M68A 2IS7A 4NIRA 3QZ6A 3IIPA 3OLGA 2CZFA 3ES8A 3FJLA 3O63A 2G4FA 3C0SA 4WY0B 3DBPA 3RX2A 1AH3A 3MW7A 1R85A 4O53A 3OEXA 4C1KA 3WF4A 4NNBA 2C14A 3WENA 1XIMA 3QMRA 3I6EA 2ZICA 1NARA 4ZL1A 5LA1A 4M6UA 3PWGA 3P80A 3P62A 5D05A 3VMOA 1W1PA 4Q7BA 3HMCA 4HHMA 2XDFA 4OBTA 3G8RA 1IXPA 3LB0A 1P48A 3F4VA 1VBRA 1JI1A 2NV2A 1JF6A 2DP3A 4PGLA 1GPFA 4DWSC 2BGQA 2Z7KA 4EACA 2QULA 2FZNA 3THQA 3EXTA 4C1NA 3PBUA 3SZ8A 4L4LA 1VFFA 5M2FX 1K7FA 5EL1A 3C2RA 1SJAA 1GTEA 2VYOA 3QGKC 1EHAA 2R1NA 2OLHA 3NOEA 5D4YA 5HDRA 4UTWC 2IPGA 3QTPA 3V35A 1VS1A 4OV9A 5K9XA 5CSRA 3N2TA 4CN1A 3CL6A 3W2JA 4KCWA 1CXLA 3PTKA 3KTSA 1S5TA 4YS1A 1K8YA 2C3ZA 2ACQA 1K4HA 4PBFA 1BPLB 3GTFA 1XIBA 1HKJA 4P61A 5T26A 2OEJA 5I24A 1P6WA 3WYZA 1QNVA 2A3BA 3MUCA 2HE8A 3WLLA 4CQBA 4K7YA 3A22A 4C6OA 3N6HA 3EWBX 2PDLA 3E0WA 3HURA 1LTDA 3ZT6A 3PB0A 3KXQA 4W85A 3E2VA 3IEBA 1CGTA 5FF3A 2V81A 2V0TA 3THAA 4MDPA 3FGCB 4JTIA 1S5VA 3NG3A 1NOFA 1LQ0A 2BOGX 3L4WA 4KCTA 3NDOA 3FA4A 5IOBA 1BF6A 4CU6A 1EOKA 3KBVA 1V6XA 1BKSA 1R87A 3U9IA 1HT6A 4C7GA 3OODA 2NW0A 2X1IA 3L4ZA 2Z1VA 2OYMA 1NDWA 5KZ6A 1Z44A 1ZB5A 1JUBA 3H4XA 1I4NA 2ZX9A 4IX2A 1ZBKA 5LNUA 5L6UA 5JVLA 2G4JA 1UD5A 1W9VA 1H7WA 1BTMA 3NZPA 3BMWA 3DFQA 3R79A 1C93A 4R7WA 3UR5A 3DKLA 2ASHA 3OYZA 5G5IA 2Z28A 3B97A 4IFRA 2C1IA 2Y5SA 4JQ1A 1GVIA 3H7VA 5FJRA 3OTRA 3ARZA 4D1JA 1WKFA 4G8TA 1EJ7L 2ZUNA 4GUGA 4C5ZA 3WNNA 1VLIA 3C2EA 3CK5A 2CBVA 1XYFA 3EZ4A 2D24A 2GVLA 4O0QA 1L6GA 2HXUA 4F0KA 1DJZA 5BYWA 2BODX 4HA1A 3GIPA 1UR1A 4GVHA 2W4XA 1K9DA 4GRSA 4NAEA 5D9MA 4WEVX 1LOQA 4IGMA 4QIUA 1RAKA 3SO7A 3GWQA 4GNVA 4YCOA 2WSPA 4NAFA 1VIZA 4CQCA 1JAKA 2FH8A 3AXXA 1FXQA 4ZO6A 4C6PA 1VBHA 1XYAA 2EG7A 2Z29A 3AALA 4XQ6A 4D9PA 1R7OA 4FXJA 2R1MA 5D9OA 3K8KA 4UZUA 5BU9A 4DJDC 5HWNA 2JBMA 4MPKA 4UTTC 2Y2WA 3PZ9A 2XU2A 2ZCGA 3GXNA 2MNRA 2EF9A 2OX1A 3WLJA 1Z42A 2PWFA 3SURA 3RMJA 4LCRA 2A21A 4IPJA 4HPGA 4OJYA 3WMLA 1QW9A 3WLSA 1M7XA 5DCBA 1R9XA 2BXZA 3ZSTA 1VAHA 3IRSA 1TPUA 1E9YB 3B03A 4M51A 4CQ9A 2Y8KA 2DDXA 3EOLA 4WQ6A 4IH3A 3L0NA 4ZB2A 2J8TA 5DQPA 4I7UA 3WQCA 4UMAA 1S2UA 4M80A 1AK5A 4LUIA 3TJIA 3K13A 2GGEA 2IXVA 2XZ9A 3KTCA 2X42A 3CB8A 3HPXA 1MQRA 4YTQA 3F1QA 1XBZA 4O8AA 3SUUA 1CGYA 2F2HA 2V30A 4TVUA 4TVDA 3T44A 4HZ6A 3QV7A 5JIPA 4B16A 1GKRA 1GKQA 1XLEA 3ABZA 4ACYA 1MMFA 2VWTA 3F4NA 4FOUA 3QC3A 1E4IA 1VFSA 3TQKA 1NF0A 3OZOA 2NWSA 4NI8A 4RZ6A 1GQNA 3EMCA 2CLEA 3P84A 4D6CA 4LX4A 5DCEA 2WVUA 2CYGA 3STGA 3VOHA 3MHFA 2E9LA 2ZC8A 3IANA 3VZYA 1A5CA 4UOQA 2OWWA 4IOTA 3EX2A 2X1RA 3TXZA 4WOZA 1FH9A 1HKMA 4G7EA 4N6EA 4JDBA 3ARYA 4LY4A 2FDSA 3DOPA 3PAJA 2DVUA 4QP0A 2P50A 5D8WA 1MXGA 4AHQA 4PMOA 5BRQA 3W02A 3OBEA 5HAOA 2VR2A 1HJUA 1EUNA 1IEVA 1H7NA 3LCGA 2OXNA 2YBUA 3EWYA 3PWIA 1H5YA 1BFNA 3KCOA 3LCHA 4ICNA 1W3TA 2WVTA 5A8QA 3T0CA 1QHOA 3RGTA 1CB7B 4Y8EA 3L12A 1J0IA 4FR6A 3W29A 1ECQA 3OG2A 3RM4A 4GYJA 1TMHA 1UKOA 1Y0EA 3O07A 4J1OA 4QAWA 2VT0A 1FCBA 1C91A 5FACA 2WAGA 1TZZA 3CT2A 1HJXA 1HF6A 3CUZA 3I3EA 2Z1SA 3W1QA 4B5SA 3PK7A 2QJGA 3W7OA 1WDRA 3HGSA 5LZLA 4NKCA 1O5QA 2YL8A 5PTDA 4Z0SA 2DZPA 3G3DA 3KWXA 1XLAA 1OFEA 5DXXA 3VIFA 2QVHA 2ZA3A 1UWTA 2CLOA 1VR6A 5CPTA 4X63A 2DVXA 5FF7A 4B4HA 4GXWA 1B3XA 3URAA 2X7WA 3MJMA 4K2SA 4Z1YA 4ZFMA 2CLHA 2WZHA 3SADA 2F38A 3ARPA 3QPEA 3R12A 1FWNA 1RQHA 4LB4A 3L21A 3DH7A 5JMUA 1N2VA 4Y6GA 4US6A 3MDWA 3W6LA 4WK9A 1CEOA 4MWAD 4OVXA 4AYSA 3DENA 4Z2HA 4O15A 4XZWA 3RX3A 3TAKA 2IKHA 3C8NA 1GT8A 4O12A 3ANVA 1UKPA 4ZOCA 2IPWA 5DCDA 1T99A 4DYKA 1QPNA 2XG9A 1SFSA 1Z3NA 1ZGDA 1VPYA 4JTSA 2OLSA 1W5QA 1GGOA 5E1QA 2WBKA 3IJQA 4L1WA 1EGMA 4QGCA 4DBWA 2NQ5A 5EBAA 3FK4A 3KE0A 2I7GA 1KNWA 2WB5A 3IIXA 4D8AA 2PDFA 2NV9A 3H2CA 5C70A 1NM9A 3W7DA 3LGDA 4LAZA 1YX1A 2WHJA 1VRXA 1WXZA 2TODA 2J62A 1EBGA 1NSJA 3QOKA 2GZXA 1TV5A 3UG3A 4JEJA 5T9BG 3IPWA 3WJZA 2P8CA 4Q32A 2E09A 2QF7A 3N11A 1RP8A 4F66A 4P7OA 1G6CA 1UWAA 1LBLA 1J4EA 4GVGA 1DHPA 2ZDRA 3M5VA 2IXUA 4JAWA 4I8YA 2OT0A 3GW3A 1AJ0A 4GYKA 3MBFA 1IF2A 3PBYA 1XGDA 4W7UA 3IACA 1VHNA 3BWWA 5LNWA 3GRIA 5ECVA 3N6QA 1P0NA 2IKJA 3GM8A 5C8BB 4KT2A 2B31A 2POTA 6ALDA 4GGHA 3AIRA 4PZVA 4DZ5A 1K77A 3WNKA 3SN4A 1OT1A 5F4XA 1XKJA 1XKYA 3MZNA 3V36A 5D02A 3W83A 5IBXC 1QI3A 3PSWA 3LG3A 2DZUA 2O56A 3IUHA 4HHLA 4MWAA 1PEZA 3LI0A 2YFNA 1UPMB 2YCJA 1E70M 4AXKA 2VWSA 3KHJA 6PTDA 1RV8A 3EWWA 3O9NA 3UVAA 1O7AA 1X38A 4MDOA 1ZHAA 1M01A 1RLCL 2C1GA 4JQAA 4DLFA 1E4NA 3NPVA 1G4SA 2BB0A 1V7AA 1FY6A 2Y7GA 4UIOA 4KEUA 4WKHA 2YXXA 1YPIA 3C8FA 1E72M 2B7NA 1D7FA 1WBJA 4ZOBA 1W1YA 1JDFA 1R7AA 4EF8A 1B5TA 5A6SA 2JGYA 3EGJA 2BY2A 3STFA 2EPKX 3LEPA 4OWGA 2QYGA 3IJIA 4N4PA 3KS5A 3MA8A 2ADAA 3K2GA 4YHEA 3RITA 2WJEA 4WX2A 4UTUA 4HMNA 1WUEA 2ZZ5A 2OEMA 3CLMA 5IHRA 3VOFA 3DG6A 5H2ZA 5CZKA 1NP0A 1Z6KA 3QGVA 2TAAA 4ORMA 3W22A 2VVSA 3WH8A 3VDHA 1A5OC 4H8NA 4UQBA 7TIMA 1W0MA 2BXVA 4UB9A 2VRQA 2QDGA 4LV9A 4G2DA 4PFHA 2P3EA 4IZGA 2HPIA 2PP3A 4D72A 2CXEA 4R88A 1JUEA 1JAEA 2ZRVA 5M17A 4HMEA 4PCPA 2E68A 2E3ZA 1HG3A 5H6HA 4PMVA 1HP4A 2BDQA 3N04A 1O5XA 3CV7A 1HVXA 1JZ7A 4Q7NA 5CKSA 3CASA 4MKNA 1V77A 2ZXQA 4NZJA 1KFEA 2XJ7A 2ABBA 1RPKA 3JS3A 4DVOA 3M5ZA 2BWGA 3ZT5A 2ZX7A 1F8IA 4TQTA 3R2GA 4XTDA 3IIVA 2FZ8A 4CN4A 4HNLA 4IF2A 4BS0A 1XIFA 1QI0A 4DNMA 4MSSA 3TTOA 4O11A 3MUIA 2YA2A 3WLTA 2GUBA 2WXDM 3L4TA 4KQNA 3BG9A 3R11A 4KIRA 4C6EA 1MDRA 2BY3A 4JTKA 1XDLA 5F2MA 4UFHA 4GGBA 2PLMA 4OU1A 2MANA 1W9DM 4B90A 2ONEA 3SR7A 3WUGA 4UTLA 1DJGA 1W91A 3A4AA 2Q3RA 2A79A 4Q8WA 4OT7A 2Q01A 4MADA 2BVDA 4HK5A 4M5PA 1J0JA 2A3HA 2ZWYA 3EWZA 2YBVA 3WK1A 5A6JA 4DJFD 1PTAA 4DBEA 4R5EA 3OOQA 2O0TA 1MFVA 3M0LA 1UZDA 5I06A 1TB3A 4B5NA 2XM1A 3MSYA 4JIHA 1B3OA 2VP8A 4GQQA 1D3GA 3M0XA 4RDWA 1M3UA 4DAIA 2UV8G 3N9KA 1TZ9A 2V6AA 3UNDA 1X8FA 4BA0A 3GR8A 4FIRA 2D23A 3EOSA 3QV8A 3BPWA 2DSUA 4GNJA 2Y70A 3FKKA 4Q4RA 4AAJA 3M46A 2JQXA 3LQLA 4UTHA 4I6KA 1OGGA 4Q6JA 4DEFA 2V5DA 3LCFA 1HQTA 1EWDA 1KR1A 3MY9A 1FDYA 4MB1A 2HVMA 3DYMA 7ODCA 1XLMA 4GA8A 3SQLA 3S2JA 1NFBA 2GSEA 1R3VA 3LOTA 4NRSA 4I5UA 3F4WA 4MWAB 1KQYA 2FDMA 1GVEA 1F73A 4AYGA 1WXYA 2FZBA 1I2OA 3AU6A 1U1HA 1ONRA 4EPBC 2VELA 4GUIA 1TV7A 3SQMA 1CYGA 4DNHA 3WNMA 3CQIA 1LLWA 2UY4A 2XIQA 2OSWA 1KBBA 1A3XA 1TUFA 1GJPA 4N9BA 3DC8A 4F0LA 4CU7A 5A94A 1X96A 3U2ZA 2R1LA 4BHYA 1CXKA 4IMAA 2VFGA 3WH7A 3KRBA 5EMKA 1KA9F 3N2OA 3T2QA 1SO4A 4CCDA 4DF2A 3NUKA 1JYNA 3TCEA 4GXMA 4JQ3A 3GNNA 3SUVA 3SIZA 3TLLA 4R27A 3ARUA 1J0ZA 1K9TA 5LGXA 4IGSA 3PN8A 3STCA 4UTFA 1TMLA 2VD8A 1CTNA 4DJFA 2ZRXA 4GC4A 1UKQA 5H1WA 3BLFA 2QKFA 2X0SA 2OSXA 4KW2A 3WL0A 2WSRA 1A5AA 4HJWA 1DQUA 1CLVA 2WVVA 4TIMA 2YW4A 4L1GA 1EQPA 1MNZA 4WGXA 4DBDA 4BCEA 3N3MA 3N2XA 3L66A 4WDXA 1W2VA 3MANA 3QLLA 3C4UA 1R2TA 4Y9NA 3NQGA 3TC7A 4DUVA 1HX0A 1T96A 4FS9A 4JD4A 4QG6A 4HBKA 2BOFX 2Y24A 2PWHA 2Y0FA 4TO8A 3FYPA 4Y9OA 3W72A 3AHXA 1B3WA 3SUSA 1FHUA 2DV0A 2DUAA 2DEPA 1OGBA 3RYSA 3S2NA 3VNDA 1JEZA 1JDEA 1PE1A 1TPB1 4NXKA 3T40A 3MS8A 3WNPA 3LENA 3RDKA 1XSJA 4O14A 5DT7A 3IJ7A 5I3JA 4JIIX 2PLJA 3VCCA 4KEVA 1MW2A 1OSEA 1ZCCA 4JFVA 3I4KA 2Z1WA 2QXWA 3TNOA 3FVDA 1BSLA 1SO5A 1KRBC 1UP0A 4PCSA 1E43A 1IR1A 1TMQA 4JYEA 3GG7A 1JQVA 2ACSA 2GOKA 2BXYA 5AYYA 4I5RA 5BMWA 4KS0A 1REQA 3RM9A 5BMXA 1CXIA 3RRXA 4JL1A 1TIMA 3GU9A 3MVTA 1FWTA 1U5HA 1JZ2A 2AAAA 7ENLA 3M16A 2R9RA 2VFFA 4YWSA 3KVKA 5A6AA 3TNBA 2FJUB 1NJJA 2WKJA 1LRTA 2R82A 3S83A 1LF1A 3ARTA 4JTAA 3WO8A 2QDDA 4Z2KA 3UU0A 3B40A 3UERA 2PTXA 3AUOA 3BJSA 2VFEA 2FHCA 2VXNA 1GZJA 3W75A 2HVNA 3QKZA 4ERGA 4NJGA 1TE6A 3PHAA 4WXZA 3WLMA 3GIQA 4O1EA 1CGWA 1GHRA 1OC7A 4Q4MA 3VKAA 1GWJA 1JR1A 1KBIA 3J7HA 2ZZ2A 1FH8A 3F5LA 4CU8A 3V0SA 3CHVA 2VQUA 1UW9A 3WDQA 3E2QA 5MHBA 2HK1A 2XIIA 1YKWA 1XIDA 1DIOA 3H22A 5I3KA 3W2KA 3XINA 2WM1A 4LUTA 1P7TA 1VFTA 1Z69A 1XXXA 1GZGA 3JRKA 4XD5A 1C90A 1RY8A 4LV4A 3UZXA 3UGVA 4CQAA 1TSIA 2WQDA 2YL6A 3GDLA 2ALRA 4U5KA 1KV8A 3E3HA 4E4UA 5HMDA 3UYIA 5D38A 4JEQA 1U1JA 3MP4A 3WFLA 4IGNA 5F4SA 3W81A 2PF0A 4JY8A 2DUXA 3PWAA 4C6KA 1JNDA 2YJQA 3DHUA 2WOQA 2PPGA 2A5HA 1ALDA 1XLHA 3FXYA 4RW3A 3UXKA 3MO7A 3ITTA 3W85A 2QNEA 3N34A 4ADSA 1SUXA 2VZTA 4MF4A 4DYEA 2PDIA 1IT8A 4IXXA 4LCSA 4P8WA 4WZHA 2V3DA 4Y7EA 3EAUA 3ZJ7A 4IUGA 2X2GA 2O7QA 3NAVA 4JFSA 3H53A 1UD4A 4M1BA 3G6LA 4XZNX 1L6FA 3DIPA 3FA5A 3CMJA 1HUVA 2CBUA 1ZP4A 3WQFA 3DFTA 4B3ZA 4Q33A 1H51A 3BAJA 1WDWA 1ITCA 1DJQA 2VX7A 4HA4A 4HA3A 2J75A 3TH6A 1NWTA 1KV5A 2E9BA 3B9OA 3L5MA 1F3WA 1CXHA 4U3AA 3S0CA 1XRSA 1B4EA 1RA0A 3GVQA 3RX4A 2OOGA 1AVAA 2YL5A 1VD6A 1IYXA 3U5YA 4ORIA 2WVVB 5I3GA 4DPPA 5AB3A 4MVAA 4YJ5A 4UCGA 1UA3A 1UBSA 1VP5A 1E0XA 1V6UA 4H00A 1KXHA 1WDDA 2G3FA 4Q4QA 1P5BA 4H9UA 1ZU8A 1DTUA 1XLDA 1UP3A 5AVHA 3AS3A 1F8MA 3W26A 5LNRA 3W00A 3E0FA 4GBDA 3OZMA 1C8VA 3Q65A 3I6TA 1OC5A 3TFCA 2XINA 4V27A 4JL2A 3UZYA 3UJEA 4F0SA 2P3ZA 2DIKA 1DEDA 3TN4A 5BOOA 4MB3A 4L4PA 4NNAA 3UD6A 3S9ZA 2G3IA 1V8EA 3E74A 1SFJA 4PUUA 2DSWA 1QNQA 3AUJA 5REQA 4O1BA 2WYSA 4HYWA 4TU1A 1IT7A 1WX0A 1JZ3A 3G1XA 3L5LA 2VCAA 3UJSA 4F48A 2I5IA 4AZHA 2V5JA 2VD9A 5DT5A 3H24A 1TO3A 1J8VA 2QUNA 2E25A 1GZ1A 1JPKA 1ZJBA 3SGUA 2F9RA 1L9WA 1REQB 4OTKA 5BXRA 4M6VA 5GJMA 1N82A 4B15A 2NQZA 1XICA 3DBNA 1EJWC 4B92A 1XLBA 1XWYA 1SGJA 3RF9A 4N2YA 4O1CA 3LMYA 4GKTA 4S2CA 3UQNA 4LAUA 3ZR4A 4JFUA 3TIMA 3WKZA 3TE9A 3V3WA 5CLTA 1GOXA 4BQ2A 5I3HA 3NZGA 2ZFAA 1HJQA 4H6KA 4AZCA 4PBEA 2NZLA 2JFEX 4E3TA 1V6VA 2G50A 1E0UA 1I1XA 4XV0A 4FK9A 3KWSA 1I6NA 3EX4A 5E6ZA 1ISZA 2WMKA 2VTFA 3KOZA 1BVNP 3AJXA 4O1DA 6REQA 4JTRA 4N0RA 1D2KA 4O16A 5DELA 4RCXA 4GHRA 1E0WA 1ME9A 1QNOA 3WD3A 3LM3A 1XCWA 2IKIA 3AYVA 2Q8LA 2CZEA 2C1HA 2Q71A 5C9RA 2Z1XA 4LUTB 2DVTA 1P7TB 4UR8A 4AH7A 3GU1A 4WOQA 3S4TA 3UPWA 1W3JA 3VIKA 2ZXBA 4W5UA 1X7IA 2DZWA 4Q8UA 5C9WA 2PDBA 1KCXA 5DBUA 3KZSA 4L4MA 1DJYA 5HJLA 3TXVA 3ZVHA 3P61A 2NQJA 3HG4A 1ITXA 3NQVA 3BARA 2VCCA 2ZUMA 1WPCA 1P6CA 1AJZA 2ZIDA 1OZMA 1B1YA 4V1XA 3GLCA 2J7FA 3QR3A 3R0DA 5I07A 3WQ6A 2QLYA 2BFGA 4QQUA 4C6BA 2CESA 1TWWA 3W74A 3DECA 4Z2JA 2JALA 2NUWA 2WBGA 2HNHA 3LV6A 2ZWZA 2DIEA 1W1A1 2XVNA 3QTGA 5A6MA 1R2RA 3R5EA 3MUXA 1XBVA 4AD4A 1DJIA 4LFYA 4ATDA 3GAKA 3E02A 4GCXA 5HQMA 1IT0A 1OYAA 2QCLA 3AROA 3U57A 4ZO7A 3MUY1 1E9IA 1BF2A 1XQLA 3ONBA 4JHZA 1CGUA 3NOYA 3UZ5A 2BSLA 4HT3A 2CERA 3KL3A 1J2WA 1I2NA 4LUSB 3DFOA 3ZR5A 4PTVA 3T2PA 4B9ZA 5C2XA 3BLLA 3VOIA 5HJYA 1SO3A 4L9XA 3CTTA 3SCSA 3R7MA 4Q8MA 2G3JA 2A0NA 3MV11 4HN4A 4M6PA 1CWYA 3PFMA 1G0CA 1JVNA 3NYDA 3BJTA 3MHUA 1RK6A 5LA2A 4DI8A 2C8NA 1OG6A 3LUTA 5DO8A 4GG9A 2J13A 1RR2A 4W8AA 4CQ8A 1BVZA 2GDUA 1I2RA 1CIUA 1H7OA 3ITVA 4U5IA 5G1YA 2Q02A 2DIJA 1CDGA 3W7LA 2ODOA 4IGHA 4CLMA 4KCVA 5BRBA 3WLOA 1ZJHA 1M03A 4MWAE 4C60A 2HBVA 3CZEA 3QM3A 3N4EA 3NQAA 1DXIA 4U33A 5REQB 4M0XA 1QO5A 4QS6A 3VAVA 1T8QA 3VTRA 3V16A 5FKYA 2INZA 3ABSA 1I1WA 1KXTA 1IIHA 4A4AA 1OCJA 1UOZA 1MZRA 4PEKA 3CUXA 4FO4A 1NDZA 5A95A 4ASTA 4BF7A 4M82A 3DHDA 3LHVA 1IGWA 1OWQA 1RUSA 3CGTA 2WMIB 4HKPA 2RDTA 1QWKA 4MUPA 1UMLA 4C5YA 1EUAA 3N9RA 2FPVA 1XRTA 1W1IE 4HYVA 3VNMA 3UY7A 3W2LA 4PB3A 1JUKA 4AZ6A 3SEPA 1OHLA 1XI3A 3AWNA 3VNYA 2YYUA 4KWVA 4MJZA 2VZVA 3P0XA 3B0UX 4AZCB 2D2OA 4HCDA 2HDJA 3PS7A 2PDUA 4I9MA 5FESA 4LEQA 4F3HA 4EOUA 5HK4A 1S2WA 4WY0F 5DXYA 2GGGA 3GNXA 1RJRA 3LTSA 2ZTKA 2DPEA 5C7VA 3D3AA 3WDPP 1GK8A 4PRWA 5BWAA 6REQB 3F4CA 1FOBA 4WXYA 3VDBA 3I10A 4MKVA 1ZY9A 4JKMA 4JX4A 3AIEA 3VIIA 3AQUA 1GOIA 2YBTA 4A21A 3W28A 5CBIA 1UOKA 3PY2A 3W7KA 1ZFJA 4AC7C 3U48A 2VX4A 1J0HA 3N2CA 4R34A 3FYYA 1TV3A 1VH7A 1AA1B 4AQLA 5LXXA 5FF0A 2YSWA 4XD4A 3KUMA 1YDVA 3CU2A 5TNVA 3W2NA 1TIWA 2GK1A 3VD5A 1NDYA 3UCCA 3CM4A 3ZVHB 4CEXC 2OGJA 4GIRA 4KFNA 4MY8A 1U30A 1Q13A 3MDUA 4ZTYA 4JTHA 4UOZA 3BVJA 1Y5XA 1XG3A 3CV6A 5HPCA 4PULA 3DHPA 1XPYA 1MUWA 2YL9A 3OG3A 1EKOA 3AMDA 5J04A 4J3WA 1MQPA 3VIOA 4AX7A 3N2MA 3GBDA 5HR6A 1R6WA 4XK2A 1DWHM 1KQZA 2X05A 2X40A 3KBWA 1QI4A 2OKOA 3D0CA 4H8HA 1VFMA 4MWAC 2XPKA 4EX4A 3H2OA 4UZSA 4AEEA 3VILA 3SAZA 1ZBVA 3WIJA 4DO5A 4K38A 3A4JA 5EBUA 3LHWA 2WNQA 5EU9A 3PR2A 1TTJA 1KCLA 3W1PA 2O9RA 5A6BD 3VDAA 1AW5A 3ISIX 4REQA 1EJUC 3TV8A 1GW9A 3E5BA 4M1RA 1JRBA 4TOQA 3WBYA 4TTUA 4ZQMA 5EYWA 3VDGA 4MNJA 3S5NA 3RIKA 3N18A 3MPGA 4QX4A 3BOXA 4JQ2A 4GMEA 1NY1A 3NQMA 2CZVA 2FFCA 3OGRA 1CLXA 3DU0A 1F7BA 2HWGA 1Y5VA 3L4YA 2YA1A 4A3UA 3B8SA 4F79A 1LLOA 2HISA 4CVUA 3OZYA 4Q4SA 4C6FA 2NWRA 4JTCA 1RVGA 3CHDA 3NQCA 2C18A 2OODA 1DE6A 4N4QA 3ANYA 3WY1A 2PS2A 1V3HA 2PMQA 1A47A 2XN1A 1JJKA 1V3IA 3C0JA 1YBQA 1A3WA 4XZMX 4C6JA 1WZKA 1Z32X 2BTMA 3BV4A 1EGVA 3ZLHA 4AG0A 3L0GA 1IWPA 3DERA 1H41A 3M0MA 3K8MA 4O50A 1WAWA 3M0ZA 1KGUA 5AFDA 1SFTA 2G37A 3QY6A 3MWCA 4PL2A 1J5TA 4NZ1A 1RP9A 1J11A 4RXGA 4LXFA 4U31A 2A7PA 1SMDA 9XIMA 4JIPA 2J79A 2P88A 2Y7EA 4MFDA 4QJ4B 5I7GA 1WO2A 3F03K 3M47A 4WSHA 4UNLA 3SIMA 3MCOA 2LLEA 3OLEA 3LZ3A 2QMJA 1I0BA 4R7JA 4P7LA 3TA9A 3TUUA 4PMZA 1U22A 2PDXA 2XH4A 2FZ9A 4R7OA 3KM8A 3W73A 3H26A 4PUNA 2QPSA 1V0NA 4EXQA 1RJPA 4H7CA 2D20A 3C3NA 3RPTA 3URBA 3T7VA 2WMJA 4QROA 3AZRA 2HXTA 4G1NA 3BAKA 4JTFA 3UESA 5A6BA 4YTSA 1X1NA 1PWLA 4H6EA 3W1AA 1GQLA 3VC5A 2CU0A 4JHMA 1J5SA 4ML9A 1U5VA 1N8FA 4XAYA 4JXCA 3CH9A 3NURA 4EAYA 3OZPA 3THDA 2VX6A 1RQBA 1JCNA 1UJQA 1HW6A 3G0SA 2NUXA 4XG1A 5E0KA 2CLMA 4H9YA 3TYCA 4LCQA 1XYBA 3PPGA 3EWXA 2CETA 1SM9A 2ZRWA 1HKWA 3CAQA 4FALA 1ZBWA 4E38A 3T05A 3LHZA 1TQXA 3CZGA 2FHFA 4B3KA 2YFOA 4H7VA 3CV1A 2ZE0A 1OYBA 1Z41A 3LPPA 3CMFA 4GKLA 1GOQA 4CQDA 4GUHA 2ALDA 2QAFA 3S46A 1Q63A 1Q2SA 3L65A 2XIJA 3DXIA 3PUEA 2VMFA 2REQA 1I9CB 4IQEA 3B04A 3UPBA 3RPDA 5FSEC 3S47A 5T9CE 3FXGA 5JUVA 1H5VA 3IJ8A 3CUFA 4MB4A 2GK1B 5G4HC 3V4BA 2CHNA 2W62A 2VENA 1Q4WA 1BG4A 1TYGA 4J40A 3GQYA 3IGXA 2XM2A 2ISVA 1AD1A 3EA3A 2NQ9A 4M3PA 1K6AA 5FEXA 1NDVA 2AQVA 1OF6A 4U3CA 3P74A 1HP5A 1XG4A 1A0DA 3HPAA 3S6DA 3CLWA 3FKRA 4IPPA 4LVFA 4XKMA 4HNUA 2EJ1A 2UY5A 2GGHA 3OYXA 4J3SA 3PUOA 4JX6A 4H83A 4NXSA 2YA0A 4YYCA 3M43A 4QDMA 3KCJA 2PTDA 1C3FA 4UMCA 1KTCA 3V1HA 1NTHA 3GXMA 1TR1A 4REQB 4S3KA 3KBMA 2D69A 1A5MC 4Y8FA 1UBPC 1AD4A 3CUJA 4PE8A 3VGDA 4QXIA 3L5AA 3ZT7A 1EF3A 1IHIA 2ATSA 4J2PA 5HINA 1F3EA 5C5YA 1G7VA 3BMXA 5EMYA 1GKPA 2YLLA 4IP4A 1WB0A 1TRIA 2ZXAA 6CGTA 2XH2A 1J18A 4MTVA 5BXSA 2QCFA 1MWOA 1KXQA 4EVZA 1F76A 4GINA 2HE5A 3W7CA 3G2GA 5HUPA 3TSDA 2P5NA 1AFSA 3K1DA 5F2IA 3OHMB 4B91A 5JH1A 1LROA 1B3YA 2X0HA 1JFHA 1T0OA 4HD5A 3P8JA 1PKMA 1WUFA 1YBQB 1GJUA 4Z08A 3MUZ1 1XCXA 4CD6A 2ISDA 4DRSA 2E1DA 3CT7A 3QOMA 4GD0A 3ITOA 1O95A 3BGGA 1GQKA 3B9AA 1FH7A 3LYEA 1H7XA 2PDQA 1NQ6A 2XFYA 3SFWA 4RDVA 4QS5A 3WQEA 2F6UA 1THFD 2IPJA 2QAPA 3S1GA 3NDYA 1C9WA 2V5BA 5LYRA 2PAJA 2QUVA 1WV2A 5BOFA 1V5XA 3PPCA 4AMAA 3JVAA 2BVWA 4RE3A 4XX6A 1PUDA 4DBUA 4JTGA 3F7JA 2G97A 1LG1A 3B8TA 5GJPA 1FHVA 1TPC1 2FPYA 3LXBA 1QXLA 2EJAA 4HK7A 3O05A 1UR3M 2OSYA 5CPNA 4XD3A 3G8EA 1TVNA 5HR7A 4JTUA 4LYPA 2C6QA 4D2JA 3BLPX 3L2MA 4TUFA 3CEPA 4QJ1A 1ONWA 4S39A 4ZXLA 1R3YA 4XBSA 1HXJA 1PAMA 3NSMA 4ZSUA 1W9XA 2GQ8A 3W88A 4JCLA 3KS6A 2V9DA 3NIYA 3KDOA 1EFZA 1PX4A 1O66A 3V75A 3EDEA 3ARSA 3HV9A 5CPQA 3O2LA 2CZ5A 3W27A 2QR6A 2XFFA 3AMKA 1QBAA 4WR3A 3PZUA 4GUJA 4H01A 4M29A 2VEMA 1GQIA 3LA4A 3NGFA 1X97A 2ZRYA 5E0FA 2REQB 3WUEA 5BROA 3GH4A 3MKKA 4QE1A 1IEWA 4GUFA 1JXJA 3ERPA 3NGJA 3G0XA 3CYJA 1W8GA 3PG8A 4OUIA 2ZA2A 3CEUA 4HU4A 3HN3A 1H61A 2ZUTA 5ABTA 1OF8A 1BQCA 4PMYA 3VGHA 1ME8A 3EA1A 1F4HA 3A5VA 4FNTA 1ADDA 3APYA 2CLKA 3BSMA 8CGTA 2DJLA 1R3WA 2OO6A 3ZSSA 1JDAA 3LSBA 5IXEA 1GEHA 3QFEA 4ICMA 2VO5A 5BXTA 2BOEX 1DIEA 2I9EA 1TPDA 2JGQA 4FLRA 1XH0A 3GVWA 1KRCC 5F2LA 3STEA 3TYUA 3WUBA 4LALA 5F1UA 3TYDA 3UR8A 2W0UA 4Y9MA 1EJRC 5I00A 4JBRA 3HQ1A 1ICPA 2PA6A 3KOXA 4FNRA 4HU3A 4U4MA 4PSPA 4DHGA 4MJ4A 1LP6A 1YHTA 2HS8A 4RX0A 3CS2A 4B2DD 5FA5A 4CCEA 2DY3A 1K9EA 2OZ3A 3D47A 1H3GA 1KM2A 3IS4A 1XSIA 4MLJA 4ZCWA 4GIYA 4E8CA 3DG7A 3WUFA 4ML4A 4PCNA 2HTMA 4XZLX 4LBUA 3W84A 1Q5MA 1MXDA 1BLIA 3AJ7A 3BZGA 2GDQA 5KITA 1KBJA 4Z2IA 4TMBA 2P10A 4GACA 4GX8A 1EEPA 3ZQ9A 1JYVA 4AD5A 1PKYA 5CSSA 4AC1X 1RALA 1SJDA 4GIEA 4K37A 4U2YA 4E6MA 3EEZA 3FN9A 2ZUUA 3FAXA 4H4IA 5KZMA 2ISSA 1UZHA 4E4PA 1EJSC 2A85A 1WDQA 4RDYA 1KRMA 2PU0A 1R9YA 1E71M 2PTYA 1OIFA 4C91A 4AWTA 5CQ1A 3DG3A 3S1VA 4GY7A 3SY8A 1XQKA 2Y85A 1XL9A 1UA7A 2OO0A 3T78A 2Z24A 3BC9A 3H2MA 3C0QA 3R8RA 3UEQA 3A4WA 2VM8A 3HBLA 4FMVA 1ICQA 4BZYA 5DMYA 3AZTA 4DJED 3HPFA 2OR2A 1B3VA 1UWUA 3HQOA 2DT3A 1QBBA 2BV9A 1UD3A 5CBBA 1VC4A 3BANA 3QSRA 3WEOA 1BYBA 4JZ5A 1QCWA 2FMOA 1LL6A 2ATMA 1OEPA 3IGHX 1KRAC 1AG1O 4BR1A 4KMQA 4Q8NA 3HM7A 3N3TA 4GOAA 4DIAA 5AC8A 4HSHA 4DXVA 3GNDA 3H8AA 4H19A 5DEZA 3GIYA 4NHVA 3UNTA 3UETA 4NILA 4LQ1A 4PYSA 2Z6IA 2WC4A 2F8QA 4OQVA 3DI1A 3VI2A 3ATZA 1XR2A 3P2VA 4B2DA 3AYRA 1TCDA 1P1MA 4JFWA 4O0ZA 4IM4A 1PKLA 2QHAA 3N19B 3QY8A 4UR7A 2HS6A 1GUVA 2AQOA 1S5MA 3KVJA 3HG2A 2QV5A 3W1RA 1TWSA 3WQPA 2Z2BA 4D6DA 3FSUA 1VPXA 3LRKA 3N6JA 7TAAA 4L1XA 2Z00A 3OB8A 4EANA 1HL8A 4P8XA 3UPMA 3VIMA 5I3IA 4Q8OA 4AUBA 2KAUC 1EWEA 1W5MA 4E3VA 1OJXA 1EC8A 4O1FA 1K3UA 4N02A 4BQ5A 3AI0A 3P14A 3W0KA 4UTMA 1PX3A 3WDHA 3G1RA 3TX9A 1E9LA 4CNTA 3UZWA 2PURA 1Q6QA 1TG7A 2HK0A 1KKRA 5A1AA 3KX6A 4LRTA 2PTZA 4PRTA 4BQ3A 3FGCA 4RXFA 1N55A 4IJRA 1UQZA 4H7ZA 3GVRA 3UWQA 4X9YA 3ARQA 2BZNA 4DJEA 3OBKA 3GHSA 1E1FA 2OB3A 1QNRA 1FWIC 3HGJA 4A29A 1LL7A 2OZ0A 3IRDA 1K70A 3IJ9A 1CW2A 4C90A 2Y7FA 2BP1A 2XIOA 3AOFA 3FW6A 3GS6A 3DUGA 3B0PA 4WJ8A 4H9XA 1DL3A 3MJYA 4LS0A 3SCOA 1BYDA 1HO1A 3W9ZA 1X6UA 1M04A 4FX7A 4U28A 2VGIA 4NQ1A 4X60A 2ZC1A 1XCFA 4L5ZA 1HTIA 1SYTA 1XV8A 2A7NA 3LZ5A 3N17A 2E6DA 1GHSA 1LDCA 1YE4A 3ARWA 5I02A 1GVRA 1VYRA 4CNNA 3E0VA 3PF3A 1ZJAA 2F84A 1NU5A 4KF1A 3W7QA 3BDKA 2A6LA 3EKZA 2WNNA 1FWBC 4XO7A 4AZIA 1A53A 2FTPA 1PXGA 3FVMA 5E9XA 4US5D 2I5GA 1MI3A 3N1AA 1IZKA 4XISA 3WN6A 3H6OA 3W7MA 4A05A 1DHKA 3FNDA 5FEPA 4EK7A 3GC4A 4PBGA 1J0YA 4PSRA 3GUGA 3CAKA 3COTA 1GTHA 2JK2A 2OELA 3LX9A 1OYCA 1AZ1A 3O1NA 1B9ZA 1Q45A 3M0JA 2X41A 2BBFA 2ZDSA 3PZQA 1NFPA 3LCIA 4CD7A 3EPOA 1BQGA 2E6YA 1K02A 3CBWA 3B9DA 4HPJA 2CWXA 4NZCA 1PZ2A 3BTNA 4AHPA 1KB3A 3AS2A 2WVSA 3VDCA 3TTSA 1OIMA 2DSZA 3VGBA 5AOUA 1UR2A 2I5QA 4GQRA 2PRMA 5ECUA 3FCPA 5TIMA 5LHFA 3NQBA 2WPBA 4H04A 2C0HA 1KCZA 3W37A 4RV3A 4CEUC 2QJMA 3ABOA 1EOMA 1U2YA 3WK0A 2GJNA 4INFA 1TX2A 3V5OA 3T4WA 2F6KA 5DMMA 1TPWA 2GGIA 1AH0A 1MYRA 3P93A 4R33A 1KBLA 2PWEA 5C0QA 3O7UA 2QDEA 4W7WA 4GH3A 5BWFA 2B7QA 3QC0A 3KOWA 3W7NA 2ZZ6A 4ZBCA 1Y5WA 1FWSA 3ME3A 4Y2WA 4J3XA 4TR9A 2VEGA 3PP7A 1CCWB 5K7JA 3UCDA 1NH6A 2EPHA 5D2YA 1OZQA 1MNSA 1PHQA 1OC6A 2A3LA 1LOSA 5A8MA 4WF7A 2VC6A 3AFBA 1KM0A 1JIBA 1V03A 4OECA 1E6SM 4IFOA 3VX1A 2OYLA 5EB8A 1KCKA 1R9ZA 2NUYA 3SY5A 3MBDA 1DBTA 4D6HA 2PF8A 4XUYA 4LAOA 4XAPA 2VHLA 2H9AA 3MV01 4US5A 5K4ZA 4XAFA 3WJYA 1H4PA 1ONXA 3TKFA 1M7JA 3G1HA 4MYXA 4KFPA 2P53A 2AOSA 2Y88A 4KWOA 2ESCA 3TMQA 2UZ9A 4QDPA 4O4VA 2XSXA 4W87A 2DZBA 1Q4NX 1C7SA 4ADUA 2J66A 3G1DA 3IIOA 2UY3A 3KP0A 4XAGA 5CZ0A 2L5HA 4OOZA 1HGYA 2XISA 2ZRUA 4N9DA 4UR9A 4F2TA 1W3HA 1IXQA 2G5WA 1WNOA 5FEZA 2DZVA 3IAPA 4RL3A 2ICSA 2PI6A 3SY1A 5HQLA 4B5TA 3S1WA 2VUYA 4GFSA 3IV8A 1RA5A 1B90A 1AQHA 2Y4SA 1HNYA 4PB5A 3NVDA 3MYOA 3TQPA 4E2VA 4HSOA 1VGAA 3U2EA 2Z1BA 4RE4A 3TTEA 3RLGA 2NLYA 3W23A 3I7SA 1L2UA 3OJGA 4YPJA 2XGBA 1ODUA 2GQ3A 4UC5A 2O92A 1J96A 1QK0A 4FXFA 3EPNA 3LI1A 1CXEA