1QUMA

Crystal structure of escherichia coli endonuclease iv in complex with damaged dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the DNA repair enzyme endonuclease IV and its DNA complex: double-nucleotide flipping at abasic sites and three-metal-ion catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords 5'-D(*CP*GP*TP*CP*C)-3'
total genus 105
structure length 279
sequence length 279
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 1999-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1qumA00
1XIHA 4QEEA 4E3VA 2HCVA 2OU4A 1XIFA 2GLKA 1XISA 3XIMA 1XYMA 3AAMA 2G0WA 1A0CA 1TZ9A 2XIMA 1DIDA 3IUHA 3QZAA 1A0EA 1I6NA 1XIIA 1OADA 9XIAA 5EMMA 5B7ZA 3QXBA 1XYCA 5EMKA 5H6HA 1XLAA 3C0LA 3UXIA 3M0MA 9XIMA 4X63A 4QE5A 3BWWA 5I7GA 4KW2A 2I57A 2GUBA 3KBSA 3QC0A 2XISA 5AVHA 2GVEA 2QULA 4PFHA 5XIMA 4YTQA 1DE5A 4DUOA 4HGXA 1S5MA 4GJJA 2X7VA 4GLEA 3VNJA 1DE6A 3L23A 3ITVA 1XINA 3AALA 4US6A 4QDWA 3JU2A 2ZDSA 3ITYA 3P6LA 4XSMA 4ZBCA 1MNZA 4Q7IA 1XLMA 3KBWA 4LNCA 3U0HA 3VYLA 3QYSA 1XLKA 5B7YA 5EMJA 3ITLA 4X61A 5XIAA 4J4KA 2QW5A 3KTCA 1XLIA 4GJIA 3IUIA 4W4QA 5J8LA 3UA4A 1XIEA 2J6VA 1O1HA 3CNYA 5XINA 3VNKA 3XISA 4YTRA 3AYVA 3P14A 4XIMA 2QUNA 4QDPA 3M0HA 2X7WA 5EMLA 1XIJA 2HK1A 3M0XA 4OVXA 8XIMA 1DXIA 5H1WA 3C0QA 4XISA 1XIDA 1XLEA 3BZGA 4QEHA 3BANA 8XIAA 3ITOA 4YTUA 1XIGA 4X60A 3VNMA 3NGFA 3KCLA 4K3ZA 1A0DA 1XLBA 1XLFA 4ZB2A 2NQJA 3UVAA 4YTTA 1MUWA 1YX1A 4QE1A 4XKMA 4EACA 3GNXA 4YTSA 2NQ9A 1XLGA 3ITXA 5TNVA 1I60A 2XINA 5C9ZA 4A8NA 7XIMA 1GW9A 3KBVA 3UU0A 3KBJA 3U3HA 3DX5A 1BXBA 3TVAA 2Q02A 4XSLA 3CQKA 2HK0A 3BDKA 3N4AA 4HHLA 4PGLA 1XIBA 1S5NA 3WQOA 4EAYA 3M0YA 1XIMA 2GYIA 4A8LA 3VNLA 1DIEA 4ZB0A 3CQIA 3AYTA 3CWHA 3TC3A 4GQBA 1XLCA 4XIAA 1QT1A 1XICA 1XYLA 4G56A 4HNOA 5AVNA 3CQJA 3CQHA 1CLKA 3XINA 3C0SA 6XIMA 3KBMA 3KBNA 4ZB5A 5B80A 4QE4A 4K1GA 1D8WA 1K77A 3IUDA 3M0VA 3ITTA 1XLJA 3UA3A 3KWSA 6XIAA 1XLLA 1XYAA 3M0LA 3DBNA 1XP3A 3KCJA 3KCOA 3LMZA 1QUMA 1XYBA 2I56A 4HHMA 5FA5A 3FVMA 4A8RA 1QTWA 1XLDA 3OBEA 3VNIA 2QUMA 2NQHA 2ZVRA 1BXCA 1XLHA 2G4JA 3BZJA 4A8IA 4DVOA
chains in the Genus database with same CATH superfamily
3NZPA 1UA3A 3RJXA 1R8LA 5HMDA 3R1ZA 2CLLA 4MM1A 4H9MA 1DWJM 3U8GA 2VC9A 1NY1A 2ABAA 3C0JA 2I16A 1H7RA 4JFVA 5K4XA 1Z7AA 3F4WA 5BOEA 1JZ2A 3EDDA 4GUJA 1VBHA 3WDQA 3HIJA 1MI3A 1B3YA 5KMYA 4L7ZA 3T2OA 5LNWA 3QGKC 4H00A 3H23A 1MDLA 3EAUA 4S38A 3PK7A 3TWAA 4DLFA 3N4FA 4IUGA 1SQ7A 2PLKA 2QPSA 4IFKA 2GGGA 3NXLA 1PXGA 3M0KA 2PAJA 4TV6A 3K8MA 4EANA 5C2XA 1FRBA 5AYIA 4JS3A 4UOQA 3W7EA 2BZNA 1E6QM 3L0KA 5HOSA 5D9NA 1YDOA 3ARYA 3W2KA 3WQOA 3W7CA 3UD6A 3E6EA 4PUJA 4WKHA 3KM8A 1D7FA 2BMBA 5DT5A 5DCEA 4DX3A 1EC8A 3BH4A 1W3HA 2R8WA 3GFXA 2X8RA 1H1YA 3OU8A 3W82A 1ISZA 2RHGA 3I6EA 1QNRA 1EJVC 3M0JA 4GIYA 1SJCA 5CGMA 1TVLA 1XIIA 1AL7A 2PWVA 1P6CA 1KM2A 2EPKX 1EP3A 4AZGA 3UXIA 3U5YA 1HXJA 3SQLA 1UR3M 3D6NA 1G69A 5D2YA 1KXVA 5C9WA 1R47A 3TYBA 4KCWA 2V5JA 2PDWA 5JUVA 1Y5XA 3WK1A 3GRIA 4C6FA 3C56A 5H8PA 3MJYA 2OX1A 2E4TA 3F2BA 1PTGA 1UD4A 4CNSA 4UFLA 3LHTA 4V1YA 5E5CA 4S23A 1LLOA 2Y62A 3IWPA 4KWUA 3VD7A 4A6GA 5DMMA 1U5VA 4GC4A 4WSHA 3H7UA 4JZ5A 3URQA 5EKYA 1PDZA 4MWAE 3ITOA 4CD7A 2Q09A 3EYPA 4Z1CA 2QDDA 4GI4A 3DI0A 2F38A 3LI1A 1E6SM 3TSDA 1K8YA 4CN6A 4L5ZA 5FL1A 1EJUC 3KVMA 3C61A 2VEFA 4LT9A 2QS8A 4ZEPA 2J62A 4JEJA 3DHPA 4ZB0A 3QEZA 1JGMA 1QK2A 4MLJA 3GTNA 4FOJA 1RP8A 1W8SA 3AIWA 2ZUMA 5BZAA 3BMWA 3WF4A 3CEUA 2CBUA 4AHOA 1Y0EA 2V8ZA 3M5XA 1JNDA 5JH1A 3FIGA 1FCBA 1TX0A 4J3TA 4HA4A 4JIPA 3TN4A 3VILA 5DEZA 4AZCA 1Y7VA 3S5NA 1VIWA 3G1XA 2OZ8A 2YCJA 4HMCA 1TRDA 3E0VA 1DOSA 2YXGA 2V82A 4RDYA 4CNPA 4Z2JA 5CAKA 4PA8A 4UR7A 4BS0A 4OGZA 4H9YA 2PDUA 3KVKA 1WDRA 4YCOA 3TN5A 4C1LA 4IMGA 5HNRA 4CEXC 4WDTA 1F76A 1FHUA 2E8YA 1OC5A 1FX6A 2V2HA 3THCA 3N2XA 4NJHA 2XTKA 1RSCA 1H7WA 1W1YA 1E5NA 2YLAA 3AYVA 2IPWA 1LDCA 2FIQA 1L8NA 3W1AA 4XX6A 3K8LA 2R94A 2HRWA 1E51A 4LUSA 3RAOA 4Y9PA 1A0DA 1K4GA 1I60A 2ZE3A 3CHVA 4S3FA 4KEVA 3OYZA 2QIIA 1W3IA 3Q58A 5A6MA 1EEPA 2OXNA 1AH0A 1VFUA 4XIAA 3UJRA 4IPPA 4TX9A 3KBNA 1P0BA 3GW3A 4H19A 2WYSA 2OJPA 3BJTA 4Q4SA 3ABOA 2V2DA 2ZVIA 1TPC1 1VPQA 3LENA 1JRBA 3ZWSA 2WB5A 4FHAA 4B4HA 4J3UA 2PLCA 3SIZA 1O60A 1HIZA 3IJLA 3S3GA 3BCDA 1PTDA 2B7NA 2QUUA 2J75A 1GOMA 1F8MA 2VC5A 1UIPA 4A35A 1E6PA 4NASA 1L2UA 3W00A 4XG1A 4A4AA 4I8YA 4AXNA 3UZJA 2QCNA 3G8EA 3MKKA 1LOSA 3KRUA 2ZX5A 2ACRA 3JZEA 4DWSA 1NSJA 5CPTA 2XVGA 3RCNA 2E6AA 3P5ZA 1UJQA 4RE3A 3RPDA 4R53A 2X41A 3ENLA 2B81A 3DC0A 3PN8A 3MUXA 4L64A 3W1QA 2V2CA 3VO0A 4GVGA 2CU0A 3ORWA 3MI2A 2G96A 2BP1A 5CJ5A 4EPBC 5AHIA 4W89A 2Y89A 3MDWA 3SM0A 1VCVA 2I7GA 1JI1A 2NX1A 3CQKA 3T1GA 1K9EA 2VEKA 3S6OA 3AYRA 3U57A 2XH4A 1RQBA 5IHRA 1LM1A 5DRIA 3AUJA 1F4AA 3O6AA 1QI4A 3GNPA 4ROQA 3G77A 3IUDA 3VIHA 3C2VA 1VQTA 5AZ0A 4A3QA 4NYYA 2CHRA 3NQCA 1XX1A 1CI1A 5I02A 1BXCA 1US2A 1QI2A 5K4ZA 3NPVA 5HPOA 1TPUA 4UFHA 2W5FA 1NOWA 4D6FA 1JD9A 3BGAA 4AZ5A 3VINA 1PKMA 1XHGA 2R1LA 1C93A 2R1MA 2OELA 2JBMA 2FKPA 3KFTA 3KLLA 3FW6A 2TMDA 2J7GA 2VQUA 2A3HA 4H6EA 4K1WA 4S1FA 3TZFA 3QYSA 3QOKA 5BRBA 2GVLA 4RNIA 4JTEA 1GZGA 4X2PA 1FCUA 1O1HA 1VLIA 1WAUA 1VEMA 4AZ7A 2WLYA 1T8QA 3GXNA 2BTMA 4ML4A 3OQEA 4QLLA 5IXEA 3DGBA 1BQGA 1QI3A 1E0TA 4XKMA 3AJXA 2HE8A 3C3NA 2YZ5A 5LA0A 4GX9A 1HW6A 2HPMA 5E1QA 4DXKA 5C55A 1LQ0A 3MCOA 2NXIA 2HVNA 4IHCA 2CEQA 3CL8A 3UCQA 4OT7A 4LB4A 4RNJA 2G50A 3NM1A 4ALDA 1HQTA 3NO5A 2WMIA 1R9YA 2DZVA 1K77A 1UB3A 2I17A 3RF9A 2YDRA 4A21A 4C6CA 4MKSA 1XPYA 1QTWA 2HCVA 3WLKX 1TZ9A 3WH8A 3PZGA 2IKJA 2JQXA 3BV4A 4JIRA 4LANA 5DRCA 1A49A 2P0OA 2YGYA 3CAKA 4X2RA 1T0OA 2V3FA 1KQYA 4JTJA 3W1XA 2J8FA 1S2UA 4MTVA 1EDGA 1LLWA 1UQZA 2CBVA 1UWIA 2HQAA 4DAIA 4IL0A 3CAVA 3U7BA 2MANA 2A3AA 4E8CA 5KZMA 5D2VA 3Q2DA 1WV2A 4LNCA 2DVXA 1UW9A 4EPKA 1NFGA 1V7AA 3S1VA 3AIRA 3R0KA 1XFBA 3WDJA 5HK4A 4IIDA 4KEMA 9CGTA 1Z9AA 3ANVA 3MP5A 4JKKA 3POHA 1JYXA 1JRCA 2QCCA 2E6YA 2IKIA 1MNSA 4DWSD 2J13A 4ZB2A 9RUBA 2UY2A 4Y8FA 3LA4A 2D0HA 5F2LA 1Q6OA 4HNNA 5HDRA 3RLVA 5AC7A 5CC3A 5FKYA 3RX3A 3IARA 3MSGA 1U2YA 3SCWA 3W38A 4R5EA 1N82A 2FZBA 3WQVA 4E3TA 2PD9A 2DUXA 4GYPC 1YRRA 1XLCA 2H8ZA 1XICA 4U31A 4OFCA 1OCJA 2REQA 3WNMA 3MV01 1HTIA 3GC4A 4MZ1A 3PPGA 3UR2A 3USZA 2JEPA 2A4AA 1XCXA 3NL6A 4WKAA 3VMNA 1YYAA 5FJRA 2VFHA 4BF7A 3NUKA 3B04A 2AL2A 2I9EA 1Q6EA 1ZCCA 1UKSA 4A05A 2WCAA 2OLAA 1BAGA 5AVHA 2GVEA 4KGJA 2YW3A 4DNMA 4JTGA 4K8EA 4U10A 1KC7A 3MCNA 4DBSA 2ZZ4A 3KP0A 3VK5A 4C1NB 2EPNA 3B8DA 2YBVA 5BOOA 1LCOA 1RY0A 1Z32X 3TW7A 1JGIA 1L6WA 4FPSA 3WKZA 1LQ2A 4XIMA 2J9XA 1VHNA 3L68A 1XIJA 1IXQA 2OT1A 8XIMA 5DX7A 4GXPA 3GNDA 2O9OA 2EG7A 3N1AA 3GNRA 1WOAA 4LEQA 4GD0A 3LQLA 2BBFA 4CNNA 2PU1A 4I3GA 4MLRA 3TWBA 3W2UA 1MUCA 4V27A 3OA5A 4LBUA 4XO6A 2PPGA 2NLIA 3EZ4A 2ZZ7A 3SGGA 4MVAA 2VX4A 4JFSA 1JPDX 4J5NA 3LLFA 4J28A 4PMQA 1G4PA 5IBXA 1DJZA 1T6MA 5FOOA 6XIMA 1DXEA 2PTYA 3CBWA 3GE7A 1R5YA 3ARSA 3FYYA 4LU0A 4ZO9A 4FX6M 4WK9A 5A8NA 5KEZA 3COTA 5F1VA 1SYTA 7TIMA 3C3UA 2NW0A 4IICA 4XUGA 3OG3A 1JNEA 1FDJA 4PULA 2CETA 2FVKA 1H7PA 1Q7QA 3P8JA 2Z24A 4H41A 2AKMA 3NL5A 1KTCA 4F0MA 2W9MA 1SR0A 1FWAC 4NZCA 3H2FA 4J2MA 2HZGA 1X98A 3W72A 3V35A 1GVYA 1I1WA 2PUZA 1ZHAA 4EWND 3WX7A 4JCLA 5BXPA 4MYXA 1BVZA 2P8BA 3FK4A 1R87A 2Z1KA 3QKZA 3CTTA 1HZYA 1XLBA 4R9OA 3GUGA 4DPQA 4RW3A 3TTSA 3WQ6A 3N4AA 4KFNA 1OFBA 3S47A 3VD4A 2P5NA 4FXFA 4WJ8A 4LCSA 1LOQA 1ESWA 1M41A 1XYLA 3GKAA 2INFA 3D47A 2FQIA 4QJ1A 1CT5A 2HPIA 3AHVA 1AG1O 1QBAA 2YZRA 5FCZA 3AI0A 3B06A 5E6ZA 3GM8A 1RCOB 4XUYA 4JTLA 1VKFA 1PYFA 2UY5A 3KHJA 3S2CA 1MZHA 1EP1A 3SQMA 5D02A 4HA0A 4AWSA 3S9IA 4G5DA 4J3SA 3G3MA 1TB3A 3B9NA 4ZVJA 3RO8A 3UPWA 3B0PA 2X05A 2CERA 2X30A 2ZRWA 4F2BA 4FP1A 3F2CA 1XCFA 1GPWA 2A7RA 4X3ZA 2GWNA 3QY7A 2WJFA 5EMJA 3WLRA 4C6PA 4Q7BA 3BLKA 3ERPA 4TMCA 1P48A 2FPVA 2I9UA 2JKEA 1QAPA 1CGUA 4GQGA 4XAGA 1RLDA 2PTWA 3ZLGA 4D6JA 5CBBA 3HOJA 1NDYA 2QNEA 1SMDA 4NP7A 3N6HA 5D9MA 1D2KA 4N9CA 5HUOA 3L4TA 2DGAA 3QHMA 3M5VA 3H4XA 5KZEA 5HNUA 3N15A 3DFNA 4HIBA 1QPNA 2EQDA 4UTTC 4K8GA 3NOYA 1DIEA 4Z42C 4JL1A 3NURA 4BFAA 2PRLA 1SW7A 3WLTA 3OGSA 2CZ5A 1PX3A 3VC5A 4MMWA 4MKVA 3ISIX 4K37A 4JGDA 1SZGA 3OBEA 1FVPA 2BGSA 3URAA 2A3BA 2C19A 1W2VA 3CUHA 3Q67A 3TX9A 3AAMA 4Q8QA 3VIFA 5H2ZA 1BPLB 1NDZA 3AUOA 3BMVA 1MRAA 1REQA 3AIUA 5C0QA 1KQZA 5D33A 3MMTA 3I7RA 5EYWA 4PMUA 4MAVA 4PMXA 1TCMA 4C65A 1WXZA 3VUPA 4J9JA 1UUQA 1MUMA 4J35A 3SCOA 3W86A 3ITVA 3VCNA 3W37A 4GE8A 1O66A 1BGAA 3RR1A 3A5VA 2FMNA 1O5RA 5T8GA 3M6YA 1Q13A 1UZ4A 2WSPA 4KRZA 3VDGA 1SPQA 2VT0A 1DP0A 1O12A 1PX4A 4BEQA 5D05A 4G2DA 2O56A 1JPHA 4CU7A 4DJDA 1BTCA 3GLCA 3K4DA 3FJLA 3T8QA 4XSLA 2BOEX 3F2DA 4PCPA 2DSZA 3EB3A 4KMQA 2G97A 4LFYA 1KD0A 1PL9A 3QR3A 1RCXB 1LT8A 2H9AA 3SURA 2PGEA 3T2PA 2D1ZA 4U5KA 4HTYA 3CT2A 2OZ0A 1RV8A 3LX9A 4RZ5A 3BLLA 1ZAJA 4XKYB 1QPQA 4W8BA 5BXRA 2C0HA 1LT7A 2O55A 4X9YA 4V2XA 3ALFA 4ZE4A 3QYQA 1TTPA 1NARA 1Z89A 1A5AA 1DWHM 1WZAA 1M1BA 2YX0A 2VFDA 4US5D 3L67A 1W9XA 1KR0A 5BMWA 3AZTA 2AMXA 5JBFA 1W1VA 2I57A 2WXDM 3TYZA 2I5IA 1AVAA 5DCDA 4XZWA 4CN4A 1W1IE 1EH9A 1GJWA 3VM5A 1AK5A 4DJFD 1SUXA 3WEOA 1F7BA 2Q6ZA 4GJIA 4EXQA 1N55A 4M51A 3WK3A 1YE6A 2HXUA 2QKFA 1Q6LA 4GFIA 3SCPA 1TWSA 3UERA 4XZIA 3VKDA 3KL0A 4Q4RA 1OC6A 1PDYA 2DIEA 3NQ8A 5ABFB 3G6LA 3VOFA 5A6SA 5A2CA 5IFPA 1X6UA 1IGSA 3E0FA 3VIOA 2PTZA 4HK6A 3AHYA 1QOPA 3LUTA 3GXIA 3VOGA 5A6LA 2RGLA 1YTEA 4WR3A 4NZ1A 1M7JA 3FJ4A 3ZYZA 4Z1YA 2Z7GA 4XZ9A 3P60A 1UD3A 4JTUA 3IRSA 3NO1A 2YCLB 1GWJA 1Q6RA 4MIMA 3CWOX 4R85A 2CESA 3DUGA 4GY7A 4F3HA 3KCOA 3A3HA 4UMBA 3IGHX 2A21A 1NWUA 4UFMA 3REQA 4EF9A 1VF8A 1XSJA 3WD0A 1IXPA 4PCNA 2DIJA 3WMLA 2WBGA 4QGCA 5CPLA 2V6AA 1FFRA 2OQHA 3GVRA 1EGMA 2NVCA 1X8FA 3AIEA 2PP3A 1AA1B 4MB1A 4DAFA 1YXYA 4M7SA 1W3TA 4W84A 3VGEA 3CS2A 3MTWA 5ABGA 5BWAA 4PMRA 3KLKA 3UVIA 3OB8A 3UR7A 2BWGA 3JW7A 5HBFA 3LPPA 1W9VA 2G3FA 3WD3A 3H53A 1R2RA 3BCJA 4JR5A 3S2NA 3RPTA 3TJLA 2VGGA 1WKYA 2H8XA 3S5YA 3QFWA 8TIMA 4ZE5A 4PTWA 4L6OA 2VOMA 5I3FA 1G9HA 4A3RA 4TVUA 5U4NA 5BW6A 4Y8EA 2V63A 4AHQA 2ZUWA 4ERGA 3VU2A 1E1CB 5KITA 3RRXA 1GQLA 4UTFA 1B4EA 3O6CA 1DYSA 3V7PA 4E6MA 2PTXA 4JFWA 5J5RA 1Z42A 2PDIA 1XG4A 4UR9A 4PMDA 4V15A 3MP3A 4PTMA 3H8AA 4GGHA 1B57A 1GKPA 3M0LA 3ZS4A 4N2YA 3KXQA 4U28A 1HKKA 2VEIA 3CLMA 1A50A 1E9LA 4B9YA 3IIZA 5DMNA 1V8EA 1GOQA 1OF8A 4UFJA 2WZTA 2OCZA 3V1HA 2ATMA 3W02A 4JNYA 3ES7A 5C54A 4EK7A 2ZWZA 3ECQA 4PUKA 3QC0A 4JN7A 3N29A 2QULA 5DY3A 3L4XA 3EX2A 3O07A 4GJJA 1R3YA 3T44A 2TAAA 2VWTA 4FO4A 2X16A 4ORMA 3LB0A 3OZYA 3BLEA 1PCWA 3NQDA 4QXIA 1T7LA 5T26A 2E1DA 2IUZA 2J8GA 1E6RA 4H7VA 2GUUA 4AWTA 2E5BA 2D2JA 2R1NA 3F4NA 2AOSA 4Q4KA 2WHKA 3BC9A 4NYUA 1UA7A 4HPHA 4S3EA 5I78A 2NQ9A 2QCGA 3VD9A 3VXGA 4CNUA 3QLLA 1QXLA 3PS7A 1QHPA 3V0SA 2GJRA 1KNWA 1ZENA 4LUJA 1TELA 4QJ3B 2X2GA 2QR6A 2DJLA 1LBFA 3MT1A 1XKJA 2VENA 2OEJA 4QCEA 2ZRUA 1LUCB 1DJHA 3GC5A 1P0DA 1X6LA 3QV6A 5CJNA 3PB2A 4NAEA 4FLOA 5CJMA 1RCQA 2XIIA 2OFJA 5MKGA 2NQHA 5D8ZA 1F6PA 1E4LA 1XXXA 3LCLA 4ACZB 3P5YA 5AHLA 4E3VA 3U4FA 1A5LC 1UYQA 1S2VA 3IUHA 1QCWA 3WLJA 3IRDA 4WXZA 3GAYA 1U1JA 5MHBA 3RMEA 3MKVA 3HQ1A 4BF5A 4GH3A 3FN9A 2A3EA 1MFUA 3A9BA 3CUFA 3NQVA 1KM0A 5HQMA 1EIXA 4WZHA 4IT1A 2NSOA 4DQWA 2YB4A 4BQ3A 4BJHA 4IFKB 5E70A 3GU9A 1HGWA 2EEXA 4PEKA 1SW3A 1GQJA 3T2QA 5HWNA 2Q8LA 1DJQA 1H49A 3GYEA 1KWKA 1JDCA 1VYPX 4KS0A 2FTWA 1GOKA 2XH2A 1FH9A 3CZGA 3C0QA 1CGYA 3IJIA 4X22A 1IZCA 2NX9A 3WQFA 4WF7A 3F5LA 1KM4A 2TPSA 1BRLA 1DJXA 5C9XA 2FGBA 5A8PA 3TP4A 2CW6A 1VFLA 2HK0A 3MW7A 1H7NA 1HJSA 2Z2AA 4EAYA 2G3IA 1JCMP 3VVGA 1A4LA 4DI9A 3TCSA 3B8VA 3EWBX 3CQJA 2ZZ2A 1F74A 4A2SA 2YCIX 3SCRA 3ZFHA 1QATA 4HHMA 2B4GA 1GKRA 2O9RA 2ACSA 1GOXA 3EX4A 5C2GA 1MW1A 4PRRA 2IQTA 4K7VA 4QJ5B 3TE9A 4C7GA 1A80A 3W7IA 5GJMA 3CXOA 4AD2A 4QTGA 2Y0FA 3TYEA 1YEYA 5H6HA 3F03K 4AZHA 3IAQA 2J74A 2YL5A 2D22A 4C91A 2PS2A 5LIUX 4HHPA 5M2FX 3I3BA 1SFSA 2PDYA 5A1AA 1OCQA 3CZJA 3NR0A 3AALA 5K3VA 4L65A 4M0XA 2WMJA 1H50A 1CPUA 4ML9A 1H62A 1YNYA 3FCPA 4NNCA 1QNSA 3KOZA 5REQA 1SZEA 1W2PA 3UWYA 3U9IA 4IMDA 3LPOA 2VFEA 4OVXA 2P1FA 2O0TA 4Q8PA 1AUSL 1ZPTA 2XN2A 3PWAA 4WY0B 2WOQA 2WVTA 3CEPA 4AIUA 3JUGA 4HT3A 4MY8A 2E3ZA 4ZQMA 4NT0A 4AZBA 3FKRA 4HSHA 4N4PA 3C5QA 1EXPA 3NEHA 1US3A 4GZEA 1S38A 4KIEA 3SCTA 2JKAA 1TWZA 2V0TA 4FEZA 5C71A 5M3WA 2OMAA 3OIXA 2WW5A 2XH0A 1GVQA 4PUMA 3BQ5A 5D4YA 5CBIA 3N4EA 4F8XA 5DXXA 4LBRA 3R11A 1KRMA 4O0KA 1FWWA 1V0LA 2WM1A 1RK6A 3AJ7A 2PWUA 3GH5A 1HGYA 3L4ZA 2DZPA 1LWJA 5CZ0A 2XWEA 4JYFA 4O19A 3GHRA 2V30A 3W1RA 2VEPA 4Q8NA 4O57A 1CLVA 3ITCA 3TCEA 3B03A 5C9RA 3NDZA 3TTOA 4H7CA 2DPEA 5AHMA 4TQTA 4WKFA 3H4WA 1Y8BA 3PVFA 1JL8A 1ZBCA 1ALDA 4HQVA 4J3VA 3GSMA 1UBPC 1LRQA 3RR4A 3W23A 3KE0A 2DQWA 1QPOA 3JR2A 1PKLA 3AXMA 5BU9A 4I8DA 1LRNA 3NDYA 3HQPA 5HQEA 4CD8A 2INZA 2XN0A 3UQNA 4FXJA 3O05A 1BFNA 1E56A 4C5ZA 3W7PA 1KFCA 3RM4A 2XINA 5TAOA 2RH9A 1AZ1A 2G95A 3LGGA 2XFYA 2XSBA 1XIBA 3W0KA 1P43A 4TVCA 2W91A 4RXFA 1I2NA 3CQHA 2BXZA 3SY1A 5GNZA 3K46A 4C1KA 1MXDA 2QVHA 5LIWX 4C6OA 3E1F1 4EE9A 1TR1A 4FOKA 1XLLA 3U2EA 3VGFA 2V68A 1QUMA 1VD6A 4LF2A 1WUFA 1KCZA 3FHQA 4QNEA 3BSGA 1TSIA 2NT0A 1R3RA 1XIFA 3O16A 2HVMA 5A94A 1J0HA 1EO5A 1W1PA 3H55A 3T08A 3STGA 3WQ8A 5LNRA 3R5EA 1U1UA 5T9BG 3P8IA 3QFEA 4ONVA 4UTJA 3TTEA 3LBCA 4X63A 4OECA 4KWVA 3AHXA 3K1DA 1C7SA 5AYBA 3GTHA 3MVTA 4YTQA 3TU9A 1VJSA 4B5NA 4ZTYA 3RXZA 1EJRC 3M44A 3ZVIA 4GIAA 1AMYA 2WV8A 3W2MA 1I0DA 1RJPA 3O2LA 5CQ1A 1AJZA 1XQKA 3EOOA 4UTTA 3FJNA 3W7NA 3UA4A 2A2IA 2WJZA 1PO9A 3E0IA 3SSJA 2Z1VA 1VS1A 3G6MA 4GI8A 4GXWA 2NSXA 3WFZA 5G4WA 3CHFA 4L4MA 2DSWA 4PL2A 3ABSA 1H63A 3N19B 1HKJA 1X1ZA 3ZO9A 1HL8A 5DY2A 4NHVA 3VKAA 4E0CA 3R6IA 3SR7A 2WCGA 1ME7A 2WBKA 3UWWA 4INFA 5LIKX 4WDXA 1DXFA 2HV5A 3MJMA 2FDMA 4A22A 3M43A 4ZENA 1TPVA 2BS9A 4ACZA 4HPXA 3PZTA 4DUXA 5CZJA 2PDNA 2FZNA 2YJQA 2ZX6A 4Z17A 4GJ1A 4IGSA 1FTXA 4Y9OA 3IJ7A 3NSNA 4IQJA 2RDWA 3CYVA 3T0AA 1DJNA 1FP9A 3IK4A 1D9EA 3AU2A 2ON3A 2DZSA 3U7VA 3UESA 1JFXA 3P7YA 1UPMB 4HU4A 1B30A 3N3MA 4XQ6A 3GFZA 3GUWA 1MO0A 3KBSA 4DBEA 4JX5A 4PMOA 3GDLA 1OCNA 2ZC8A 1N8WA 1FWFC 3UGRA 3DGRA 4B5SA 4R34A 1MEIA 1ENUA 2FGZA 4UQEA 2QJNA 1V6VA 3UCCA 3CJPA 4XD4A 3PSVA 1R0MA 1MEWA 3H70A 1CGVA 1B3WA 5FSDC 1K7FA 3V1PA 4BCEA 3RGTA 3AIVA 3QJAA 5AYYA 1GZJA 4OBRA 3I6TA 1XJBA 4FF7A 1TWIA 2IMRA 5GVJA 2ZIDA 4DXVA 5HWMA 5FEPA 2UY3A 3WF3A 1NAL1 4I9TA 3EDFA 5DBUA 3WO8A 4GRSA 3TLLA 5FIPA 5E09A 4MZYA 5AOUA 2RGMA 2J7HA 3KW3A 3CWHA 3TOPA 1S5TA 1FWSA 4JTSA 4Z1DA 4GACA 5CZTA 1UR2A 4QJ4B 4A2RA 2O4MA 4A3YA 1FH7A 1NU5A 1F9CA 5D2TA 3VGHA 1AJ2A 3FX4A 1JDFA 2AQVA 3EEZA 4IZGA 4ZOCA 2J47A 3G1VA 2ZKMX 2G0WA 4Q8OA 1M3UA 3QSTA 4ACYA 3O1NA 1OFPA 3E2SA 3S46A 2E77A 1SJDA 1TPFA 1JYWA 4RNHA 3L65A 2ZRXA 4HPNA 4Y7EA 2RJHA 4TTGA 4F66A 3B40A 3U4AA 1J79A 2CNCA 4OV4A 1QMLA 4MSSA 3FVDA 1KV5A 3W70A 4JTCA 4Q8UA 3R8GA 3VIJA 1VCFA 3STEA 1W6TA 2HSAA 3TAOA 1GVEA 2XIOA 1SFJA 1ZQ5A 1TRIA 2RKXA 3WDHA 3EWZA 1JDEA 4X60A 5HMSA 4M8UA 5HATA 2OR2A 1CB7B 4K6AA 1RZMA 4AD3A 1UWSA 2Q01A 4P7RA 4C1NA 4C90A 1JG9A 2EGZA 3AYSA 1RBOB 2CZEA 3EB4A 1XQLA 1EF2A 3LI0A 3OIHA 4ZO6A 1V3MA 1X96A 1UKPA 2DZUA 3RLGA 1V3KA 3G1FA 4ZL1A 5BU6A 1NOFA 4DUWA 3THAA 2P76A 5B80A 4QISA 3V75A 3ANUA 7REQB 2Y70A 3WD1A 3GH4A 1XLHA 4YVXA 2PDMA 4JPGA 2XIMA 1I8JA 3VOCA 3WUEA 3WH6A 3BG5A 3UG5A 3OP2A 2FH8A 4S3KA 4EOUA 4LVDA 2DDXA 2DZAA 2J25A 1C29A 4R27A 1YDYA 3WJZA 4E4UA 3R25A 2ALDA 4MOZA 3E49A 1OY0A 3UWUA 5AC8A 4DI8A 5DT7A 3BARA 4QDWA 2ZDSA 4D1IA 2F2KA 3KBWA 1NELA 1FWJC 3SUTA 2HS8A 4Q4QA 3M5YA 4CEUC 3BJSA 3BLIA 4PH6A 3K8KA 1MFVA 3QMRA 1DHKA 1GOIA 4QS6A 5IRPA 4HA1A 2XIQA 4MJ4A 1J0JA 3HFTA 4GHRA 1J2BA 3VKKA 4WRHA 4E4PA 4D6HA 3RITA 4L80A 3VOJA 3WQDA 3BUVA 2HNEA 4W5ZA 2J78A 3ITGA 1OINA 1DHPA 2CLIA 1R3VA 5I3HA 5LHFA 3V5CA 4F9JA 4BI5A 1E6NA 1VRDA 3QW3A 2ZBTA 2F61A 3WZ0E 1YXCA 1P1XA 1T8XA 4O17A 5LGZA 2BASA 4J40A 4WIWA 1HX0A 4L6HA 2VXNA 4OE7A 1K03A 3LXAA 3DFQA 4DELA 1G4TA 1ITUA 1BTMA 1BKSA 2Y85A 2OVLA 2PD5A 2IPJA 3SRDA 1VYRA 2ATSA 4YHGA 4KEUA 5EMKA 4XAFA 1DKWA 2VFFA 3UWVA 1R7OA 3GZ3A 3SRFA 3ARTA 1V77A 5I7GA 1TQJA 4DZIA 1I45A 4DF1A 3TMLA 3B05A 3VNJA 3GVQA 4NJKA 1FXPA 4GG9A 4M5PA 5DXYA 1U30A 3AWNA 1GVRA 3VC6A 4OIFA 4H9ZA 2NUWA 3QQWA 5FI8A 2P8CA 4IPJA 1W3NA 1X8CA 1ZU8A 4F0RA 3SJNA 1X6NA 3ZIZA 1OB0A 3A13A 4D8AA 4F2UA 5G4HC 5ENLA 2BHYA 3WNKA 2FHCA 4IIGA 4F40A 2XYLA 3TYCA 1PHQA 3W81A 4W7UA 2G41A 4HYVA 4URIA 5GJNA 2PDLA 1RK5A 1Z69A 2R91A 3DCPA 5K9XA 2PCQA 1WKDA 5J04A 3NVDA 1QT1A 4DO6A 3WL1A 4E2BA 3A3XA 3SFKA 4QE4A 4HU3A 3MP4A 5H8UA 1IEQA 3P81A 3M0VA 2UV8G 1NJJA 1XLJA 2WC4A 1GQKA 3GFYA 3W27A 1QU4A 1XYAA 1QOQA 1TMQA 3KS5A 2QGHA 2VUYA 2ZZ3A 5KINA 4EXBA 1H41A 4MDPA 1KRAC 3EOSA 3W6LA 2YYTA 3UZZA 3QPZA 1JF6A 1F8IA 1ZL1A 3GW0A 3MS8A 1TV2A 5CZSA 3N2TA 4KERA 5CLTA 2WZEA 4ATDA 3T0DA 4KW2A 3B8WA 4KETA 2A7NA 2VMFA 1SZFA 1TVNA 1Q6DA 4B90A 4RXGA 2C3ZA 1DTUA 4XSMA 5HNTA 3FXGA 2VCBA 5JH2A 4CQAA 5I3JA 1O5KA 2XGBA 3HO8A 4HCDA 1R7AA 2R82A 4ZO7A 3OEXA 5FESA 2DP3A 2CBJA 1GORA 2H6RA 3NGFA 1H51A 1O95A 3SI9A 3B9DA 4J2PA 1NM9A 4IL2A 4DYKA 1XYFA 4PMZA 3W84A 3EOLA 3GK0A 4J7RA 3VMPA 3TLQA 4E38A 5ECVA 5HWJA 3JS3A 1R30A 3WQCA 4M19A 4YMZA 3GR7A 4NZ3A 3LEPA 3P74A 1PS9A 3P2VA 4PMNA 1EPVA 3AYTA 1W3LA 3PNUA 3FV9A 3PFRA 4IFOA 5HA7A 2FJUB 3ZLFA 5IHSA 2BY3A 4P8WA 1H61A 3QHNA 5DF0A 1V93A 4JYEA 1UWQA 4FXSA 1XD0A 1TA3B 1A5MC 4LNYA 3VAVA 5G1MA 4S3BA 2HVOA 1DIDA 4U2YA 1AQ0A 2CHOA 1WAWA 3PAOA 3AROA 2V81A 4IJBA 4H1ZA 4H01A 1KCXA 3QQ1A 1JXJA 1AL8A 2Y8UA 3CU2A 5EBUA 1DE5A 2WVSA 2ZFAA 3P62A 3MC5A 3L23A 2GJPA 2IPFA 4AD5A 2YBTA 3JU2A 3ABZA 4Q7IA 3MUZ1 3DHDA 3CLWA 3WNPA 3DBPA 5JU6A 3DHUA 1JCYA 3BV7A 1CXLA 2WNZA 3RCYA 1VFFA 2V38A 4GYKA 3G5EA 3BANA 4IXHA 4CU6A 4D6CA 1BYCA 1OGBA 4O12A 1WDDA 2EG6A 6PTDA 3N2BA 4NRSA 2VELA 3GXDA 3N9RA 1E43A 3BO9A 3KDOA 2GJXA 3SN0A 3Q37A 5EBAA 4E5TA 3H4GA 4O28A 3VOHA 1ADDA 4DIAA 8RUCA 2DEPA 3IIOA 2JE8A 1ZZMA 3GXFA 1H3GA 4I7UA 4LSBA 4OUEA 1KCKA 1RQEA 1CGWA 2RDUA 3RNDA 5I3GA 1G7UA 5AN7A 5LZLA 1C91A 1FCVA 2QCEA 1RR2A 3IJ9A 2VP8A 2EO7A 2F6UA 1FWRA 4UTHA 3W24A 4J1OA 2VX6A 1T96A 1N8FA 3LQGA 4JD4A 4LYPA 1RJRA 3GXMA 4NZFA 2X1UA 1S2WA 1KBBA 4WDWA 2NUXA 2XGIA 1XH2A 2ZUNA 4NX5A 5TF0A 2XG9A 3LPGA 3W7RA 1M68A 1ISXA 4BI6A 4H9VA 3UYCA 1Y5WA 3EXTA 3OVGA 4ZR8A 2NVDA 3NQBA 4JDYA 1SZNA 3A5FA 2QAFA 4WGXA 2VFIA 3BMXA 1K8ZA 2ZA2A 1JYVA 1AW1A 4CKQA 1CIUA 2ZYFA 1EIBA 2Z25A 3ME3A 3U5UA 4WGHA 1DWAM 1LL4A 1VEOA 3LHYA 1F2JA 3ANYA 3TYAA 1IEVA 4ICMA 2Y7GA 3UXLA 2XWDA 3QQ0A 2HROA 2VM8A 2VD9A 3ID7A 4HZMA 3O06A 1O4UA 3PPHA 2DH2A 4IQDA 4QX4A 1VFHA 2ISVA 1GOWA 5K7JA 3N9KA 1CLKA 4OZOA 3GVGA 4GZJA 1O5QA 5CGTA 1J0KA 2RJGA 4LX4A 1CDGA 3F4DA 1XDLA 1UR9A 4A8IA 1V6TA 2J79A 2VCCA 4AIOA 2DW6A 2FZ9A 4HZ6A 3THDA 4QG6A 2QXWA 3T0CA 1GPFA 2Z7KA 1XG3A 4W5UA 4DY1A 1HJXA 1OYBA 4K2SA 1UC5A 3KZPA 1YQ2A 2Q71A 1VJIA 4IM4A 3GBDA 2OQYA 4GKLA 1T40A 3TTQA 5EA9A 1RHCA 4B92A 4QCFA 1IXNA 1LG1A 3L5LA 1Q4NX 3W76A 3ATZA 3IGUA 3RILA 1UR1A 3TK7A 3RX2A 3QZ6A 3EWWA 3SUVA 1BF6A 5E0KA 1LL7A 1EHNA 1LJYA 3D46A 4JKMA 1QNVA 1BVNP 1UR0A 2DZXA 3T4WA 1M53A 1J0ZA 2DY3A 2JIEA 3BLPX 5CGQA 4OTKA 2A0NA 7A3HA 2YIHA 4JIQA 1OK4A 3LRKA 3NO3A 3GHTA 3F1QA 2JIWA 4D8LA 3UZXA 3S2JA 3VMOA 1FKXA 3AZSA 4R7WA 1DEDA 4XZMX 4Q8VA 3E2VA 3V5OA 1A3HA 1E9YB 3W25A 4DLMA 1LOLA 1FWNA 3EA1A 5BOFA 2Z6IA 4Z2LA 4BZYA 4CNOA 4NZ5A 3MCMA 4WY0F 2PP0A 2Z2UA 4YU1A 4JHZA 2ANUA 1L9WA 1OX5A 4L9YA 3MMUA 1R2TA 1SZRA 4JX6A 4I7VA 2WAGA 2SFPA 4REQB 1LBLA 2C14A 4M6QA 1Z6KA 4GZ7A 4OUIA 2V67A 4D6IA 2C1HA 1D3CA 4JEQA 1E9ZB 3DYMA 2X40A 4AMCA 3P80A 1WKFA 3R8RA 4IQLA 4GO9A 5XIAA 1W37A 3B9AA 2B7OA 5XINA 5KZ6A 1PJ9A 2A79A 4JOMA 1CGXA 4F0LA 4HPJA 2GJNA 3S5ZA 4CD4A 1OC7A 4MZ8A 2FMOA 3NQ7A 4GIEA 2YFOA 4PMVA 1OFOA 2J7DA 2F9RA 4UTWA 1F5ZA 3QY6A 4KCVA 1JUKA 1BXBA 2F2HA 3PTQA 4G9PA 3DIPA 2GYIA 4IG2A 1OX4B 4GNJA 5FEXA 1GVIA 3FAXA 3B8TA 3GH7A 1CZ1A 1FWGC 3HGSA 3T09A 3QR0A 1QO5A 3VIPA 4UXDA 1TKKA 1TV8A 1S2AA 5G4EA 4RV3A 1Z44A 1V4YA 4MWAA 2Z29A 1GK8A 4IMFA 4M1BA 3ZMRA 4AHPA 1EUNA 2V69A 5CC7A 4W8AA 3S1GA 2ICSA 1K9FA 1C8XA 1MWOA 2VZSA 1DTNA 1PZ2A 4PCTA 4WSKA 3UZWA 3H2CA 4AEEA 1R3QA 2GDQA 3ARUA 1XYZA 3UYIA 5G2HA 4XAZA 5HUPA 1OIMA 2C79A 1EDTA 1BWLA 4H4IA 1U1HA 2XVLA 1SM9A 1GOOA 4K38A 2DIKA 2G3MA 3W1NA 4QROA 5LHEA 4GUIA 1ZB5A 3EX6A 2WMFA 3PFMA 4CGTA 3OPSA 5HAOA 4M81A 1I75A 3BW3A 3N11A 1EBGA 2E25A 4RDWA 3LHZA 3EGJA 4XV0A 4DBUA 3MMDA 3FGCB 5M5DA 2PGRA 1KFEA 2PE4A 3G1RA 3W28A 1DPMA 1S1RA 4GNKB 3WLOA 4F0SA 3AMDA 3UJ2A 4YIWA 1KKOA 1GEHA 3T9PA 1J93A 4PBGA 3L2LA 1VBGA 4I6KA 5U7SA 1R38A 1BKHA 1AFSA 4ZQCA 1M7PA 4KWSA 4QRNA 1YPXA 2XFFA 4LAOA 4LAMA 1V6XA 4LVFA 1NEYA 3BGJA 2DSUA 1RXOB 1LYXA 4UR8A 5CSUA 1PZ3A 3VIIA 1B3XA 1GVSA 4YWIA 3AC0A 5FJOA 2D2OA 3UP8A 3KOXA 3L0NA 3W7QA 1KV8A 4XWUA 3GG0A 1H60A 1UZDA 2PLMA 2ZUSA 3LYEA 4HU0A 2YDSA 2VRKA 8A3HA 3DHFA 7REQA 3NIYA 3HURA 3TOYA 3N73A 1W32A 2CXGA 2NUYA 5A8QA 4R7OA 1DORA 3DERA 4GY1A 4M6PA 2QCMA 3FFSA 1J5TA 1I2QA 4FIQA 5DCBA 1PZ0A 3UVAA 2EXOA 4QE1A 4YTSA 3ZZ1A 5CZKA 1KGUA 5AKQA 1OK6A 3W1MA 1YDVA 4DHGA 3UZ5A 1P6BA 4POCA 2Q02A 4EP8C 2PDJA 3NYZA 3WLIA 2PB1A 4C6BA 4GQBA 5JXQA 4F48A 3WQGA 4N9BA 2J9ZA 4WCJA 3V16A 3HU7A 3CZ8A 4EIVA 4M56A 1H0GA 5FF3A 3W7GA 2NVAA 1C92A 2CZVA 1DQXA 2WSKA 2PP1A 1XISA 3UF9A 5DN1A 3NCOA 1IEWA 4H9TA 3AIBA 4PE8A 5B7ZA 4IGNA 2DQXA 2EF9A 1VFSA 3P82A 2XFRA 2W62A 4DF0A 5C6MA 1X7IA 4PBEA 2YPIA 2X7VA 5M17A 3SN4A 3PPCA 1QOXA 1V02A 2FZ8A 6TIMA 1TIMA 4C6DA 1QNOA 1C3FA 1FXQA 1XLMA 2NLYA 1QI0A 4C7FA 4AC7C 3GU1A 4UNIA 3JZUA 1JCJA 3MUIA 3G0XA 5EMYA 1YDNA 4HB7A 5GQBA 5LYRA 3M0HA 1JZ6A 3V4BA 2GQAA 2O7QA 2OOGA 4NUWA 5A2AA 1H7XA 3BK0A 1GCYA 3ARQA 1P7TB 3S6DA 1XIGA 3GDKA 4FSAA 3EKLA 3NAVA 3MSYA 4XZBA 2QJMA 4TOQA 2X09A 1W5OA 3B0VC 4Z2KA 4O15A 3VNYA 3N6JA 3BOLA 3EEGA 3PY2A 1UOKA 3VE9A 1PZ1A 1ZAIA 4PN2A 4ASTA 3NA8A 1GJPA 3UA3A 4LVGA 3CMFA 3NL3A 3PBYA 1B2YA 4XB3A 2HXTA 3DFHA 2CWXA 3WH5A 3QC3A 5K9CA 1TV7A 3TFXA 3R12A 5A8GA 5DANA 2A85A 3ABRA 1WE5A 2MNRA 1OGSA 3TEVA 3P0XA 3FDKA 3SFWA 3F5KA 3HM7A 9XIAA 4GUHA 2YBUA 4GVHA 3RM8A 4MYAA 1QFEA 1I2OA 1C7TA 4C6LA 3SCVA 1J11A 2RDXA 5ABTA 2CFFA 3TAKA 3TSMA 3S1WA 5F1UA 4DJFA 2QVNA 3MQTA 5D8WA 3ITYA 3LN3A 3SY8A 1G01A 5LA1A 1BGGA 3B0XA 2QCDB 4MDOA 1A5OC 1HJWA 4P2VA 5G1TA 3LZ3A 3TA9A 1PE1A 3GO2A 1EA9C 3PANA 2DVUA 4L6DA 3KL3A 5J5DA 1OWQA 3FSUA 5SWUA 1BF2A 1SO4A 2P53A 2IW0A 4N6EA 3WENA 1DJYA 1UUMA 4CQDA 3N25A 3TC7A 1WBJA 3BJFA 2VRQA 4A8NA 1QDSA 2PBOA 4NXSA 2D24A 4AF0B 4QFUA 4PODA 1KXHA 1UPPA 2Y5EA 3CUIA 3BSHA 2OX4A 3O0KA 3SGUA 3BOFA 3O9NA 5I77A 1VB9A 3SCUA 4GC3A 3KBMA 1A3XA 3M4HA 4LVBA 1VIZA 2QHAA 1NDVA 1XDJA 2FHBA 3CUGA 1C8QA 3S9ZA 1QO2A 3QOMA 2KAUC 5CPNA 1V6UA 4NVTA 3CGTA 3GWQA 1OBAA 4AISA 1ICPA 2QUVA 1FHVA 2PZNA 2E5CA 4IXXA 3OLEA 1AODA 3I68A 4S3AA 1TE1A 1YADA 4O1BA 1XCWA 4Z0JA 3BURA 3KOYA 4GFSA 3DECA 2OEMA 5TIMA 2ADAA 6REQB 1IEXA 3S2MA 4ZQOA 1V3HA 1RP9A 3UETA 3T42A 1PIGA 3EWXA 2QJGA 4DRSA 1P0EA 2BY2A 3P14A 4Q7NA 4XD5A 2WK2A 3OHIA 2PDPA 2Y2WA 1PBGA 4RK8A 3EKZA 1W5MA 3CB3A 4YTUA 1H2JA 4PTNA 3H2OA 3WL0A 4PRWA 1FCQA 1H5VA 2TSYA 1Q2RA 1A5CA 1FWHC 3VGDA 2J8TA 4Z1AA 1GYNA 3HGOA 3R0UA 3EMQA 4LYRA 1SGJA 1UC4A 3GR4A 1KW1A 5F2IA 4MJMA 3DAQA 2JGQA 4H83A 3A22A 4BI7A 4O0QA 3M16A 1UCWA 3A47A 4PTDA 2HISA 3RHGA 3KWSA 5LNSA 4JTHA 3WJWA 2D0GA 5MKGB 2VEGA 1P4CA 1HL9A 1XKYA 1PAMA 2Z1SA 4GK8A 3ARRA 1DV7A 2BOGX 4FNUA 1XGEA 5JIPA 2YL6A 2OLSA 3NFUA 4G1KA 3S0CA 2WM0A 3QBUA 5EFFA 3PJTA 3YPIA 2P3ZA 5C70A 2EJAA 1SR9A 4M80A 2OTDA 4UTIA 4D2JA 2HNHA 1J2WA 1JPKA 5TQLA 4B3KA 5AC6A 2ZWYA 4J3ZA 3OO2A 3CASA 3I7SA 4GXMA 1I2RA 1U5JA 3IGSA 3UBPC 3STPA 2QPUA 1XRSA 3E2RA 1KBJA 4B16A 3MZNA 1PWLA 1YXDA 3BICA 3TN6A 1OT1A 2DUZA 4IP5A 1IXOA 3UY8A 5D04C 2VGBA 3D3FA 3W22A 3UU0A 2OYMA 3NQFA 3PBVA 3WNNA 4YYCA 4X0NA 5E0CA 1VH7A 3HBLA 1J12A 5LNVA 1ISYA 1TV4A 3T6CA 1XBYA 3EWDA 4XZLX 1KFBA 3AZRA 2EPMX 3KCJA 3TDFA 3BAJA 1K6WA 4LC6A 4Y9MA 4QAWA 5CKSA 2QDGA 3EX1A 2OU4A 1QRQA 1IEIA 2NQ5A 4NSBA 1TQXA 1B31A 2ISFA 5M1TA 1E40A 3GIYA 3FLUA 5D03A 1G4SA 1W1ZA 4FAMA 1KA9F 4LV9A 4AF0A 3ZJ8A 2P10A 3UZYA 3PZQA 3FSTA 3AXIA 2JF7A 4QE5A 3MA8A 3GKFA 4XO7A 3SCNA 2GUBA 3WY1A 4RX0A 4DUOA 4H8NA 3E5PA 4RJEA 2VGFA 2Y8VA 1CXKA 2XH7A 2BODX 3KUMA 3WD2A 4L4OA 4GINA 2YCEA 5D2WA 3PG8A 3VD5A 5FSEC 4BQ4A 2NWRA 4RL3A 1R6WA 3LLXA 4R7JA 3W6MA 3FDGA 4EWJA 1KLYA 2PLJA 3MZ2A 2HK1A 2PWEA 3ZJ7A 3NYDA 1UR4A 1XM3A 1KTNA 4K3ZA 4Q4MA 2B7PA 3PPFA 2V5BA 2ZRVA 5ABHA 1V3JA 2G37A 3AXKA 2QCHA 5HNNA 1LZOA 4P61A 3OYXA 1CXFA 1SVDA 5I3IA 4A8LA 2W3ZA 3PBUA 1DWGM 4JQ4A 3ZVHB 2WCSA 4W9TA 1E0VA 3AICA 6XIAA 1FWBC 4F0HA 3DBNA 1L6YA 4FB7A 4BKNA 2VDGA 2QUMA 2AQWA 3W85A 2PRMA 2BX7A 3M47A 2GGIA 3AXXA 3GVVA 3LCGA 1O7AA 1R3TA 1TCDA 3OOQA 3EX3A 3UJFA 3UFYA 2WO5A 3CHEA 1U33A 2YCLA 4WEVX 5CC6A 1BWVA 1K8XA 3DFPA 1NIUA 3VZYA 4ATWA 2VD8A 1E5JA 1XRTA 2BOFX 2PURA 3QTGA 4H2CA 1FWEC 4Z2GA 3EMZA 4TR9A 5EGRA 5EU9A 2XUCA 3FKKA 4HK5A 3L2IA 1CLXA 3C2FA 4C6QA 1A5KC 1J6PA 1W91A 3CHDA 1GEQA 3M0XA 4BY3A 3LOTA 1KTBA 3INPA 2Q8ZA 3KAOA 3WJYA 3Q4DA 2Z27A 5AY7A 4WD0A 1TJ0A 1RBLA 4ZFCA 1MUWA 5F4SA 4ZFMA 2E09A 5DFAA 5HXMA 1QPRA 3URBA 1TA3A 3LMYA 3W7LA 3GG8A 1Z8AA 4UMAA 4DPPA 5FD0A 1YTKA 3QHOA 4TIMA 5FF7A 3TV8A 1JQXA 1M03A 4HNCA 4GMEA 2ZTJA 4JYDA 4DWSC 2CKSA 1HVQA 4TMBA 1A3WA 3WLQA 2D3LA 1Y65A 2CLEA 1J6OA 2ODOA 4NJIA 3SIMA 4C7DA 3C8FA 1FP8A 2V5LA 2XVPA 1E73M 3HJEA 3II1A 1G7VA 1WB0A 1JZ7A 4LUSB 3HJZA 3T4CA 4DM1A 2QV4A 3APYA 1OQFA 4FR6A 1J10A 3SRHA 1NH6A 2PMQA 4F4RA 2C13A 1X39A 4UTKA 1SW0A 2FB3A 1E70M 5IOBA 1QPKA 5HR6A 3R94A 4AG0A 2GGJA 2D3NA 2WC7A 1W56A 5BXTA 3OQ8A 4KQNA 5I0DA 1ZJAA 3G8RA 4ENLA 1UMYA 4JTAA 4K68A 2OYKA 1BSIA 1S39A 2GGEA 1Q8AA 1A53A 2IPGA 3BAKA 5D30A 1KO0A 4XD3A 1DXIA 4IFRA 1W1A1 3ZT7A 4GI9A 4O1AA 4FOUA 1EJ7L 2OYLA 4HN4A 1OCBA 4C6IA 3AHZA 3VPLA 2NQJA 3BCFA 3EPNA 4W93A 1OGGA 4XAPA 4DEFA 2AL2B 1K1DA 1VHCA 3GAKA 1NWTA 3W2LA 2XVNA 3CL6A 1P0NA 1VC4A 2E67A 2GZXA 3FAWA 1E71M 4JICA 4G7EA 4I5UA 1RY8A 1TX2A 2NV9A 4ZB5A 3UJSA 4FNRA 1IHIA 1E15A 3U48A 4KPLA 4YPJA 1VBUA 1ZP3A 3RDKA 3SCSA 2VUNA 1OF6A 3B8IA 2C1IA 1F3EA 4HMEA 3LLDA 1Z41A 4GYJA 2EPHA 3WN6A 1E1FA 3OLDA 3RCMA 1SFTA 2CLHA 3TXVA 1OD8A 3I10A 3P67A 5FAJA 3VZZA 3DYOA 3PR2A 5EFDA 3A4XA 2P88A 2ZADA 2DSVA 1EFZA 5A8MA 4B4FA 3B4UA 5BRPA 2CPUA 1D8CA 1TUXA 4IPNB 2JEQA 1REQB 3P6LA 4F2TA 3VKCA 1WDQA 3C2EA 3WBYA 4ICCX 4YVPA 1EQCA 1M6JA 3EA2A 3MWAA 1GQNA 5C5YA 4NNBA 1K9TA 3PB0A 2ZC1A 3HQNA 4DUVA 1QK0A 2ACQA 3M0IA 2GQ9A 4PTXA 3W71A 3CIVA 3M46A 1XSIA 2BHZA 3LZ5A 4MJZA 4WVXA 2UWFA 1XH1A 1NP2A 5BCAA 2UBPC 1ONWA 2HTMA 4JL2A 3AS0A 5E9AA 4P5UA 4RLIA 2QUTA 2AAAA 2OB3A 1MYRA 3C6CA 2E6FA 4LCQA 1AH3A 1QJWA 2E8ZA 3FOKA 5CCZA 1RALA 2FYMA 3QVQA 3MUY1 3O7UA 1RLCL 3IPWA 3NQ6A 1JI2A 4O1FA 1PPIA 1P0KA 3W6YA 2E5DA 3KRBA 1HL2A 4Q8MA 1OZQA 2WSQA 2E0PA 3VIMA 3PUEA 2W61A 2YFNA 2QQ6A 2CLKA 2CZDA 5E9XA 4GIRA 3T05A 3TQKA 2H3BA 1XF0A 4DYEA 5KSWA 4AD4A 1UWRA 1C9DA 1UZHA 2BY0A 2OWCA 2FZDA 1A47A 3I6RA 5AZ1A 5KTLA 3GDBA 4MJ2A 3VD3A 3I7QA 4NZ4A 2QW5A 1CXIA 3G24A 4H9XA 4AYGA 3W2NA 2CC0A 1VPYA 3VE7A 1ME8A 2QIWA 1PEZA 3TFCA 1J01A 3PSWA 3BW2A 2JFEX 3ZWTA 3G1DA 1TPDA 2C7FA 3IANA 5E0FA 2JKPA 1ONEA 3M5ZA 2GK1B 3M0ZA 3CO8A 2VRJA 3IEBA 1GVFA 4KH2A 1W31A 4FALA 3IV8A 4L4LA 4TXEA 3URNA 2GPTA 2G5WA 3RMJA 3G3DA 1RA5A 4FNPA 3PJWA 1IZJA 1JZ3A 4NKCA 1EO7A 3N17A 1GHRA 1F4HA 1WYIA 4PBFA 1RVGA 5KZDA 4DVOA 3WEMA 1KM5A 2EBNA 1U5HA 1N7KA 1K8CA 1XV8A 4LUTB 5FEWA 5ABFA 2OSYA 2Y63A 3H7RA 1S2CA 4LCRA 1I4NA 3W87A 5BYWA 4FA3A 1E0UA 2PRHA 3DESA 4RZBA 4IP4A 1ZSXA 4HZ8A 5CLWA 1F6KA 2C15A 4DWSB 3XISA 4RE4A 1EHAA 1TMLA 4WJXA 3STCA 1R9ZA 3GNNA 4RCXA 3L12A 4ZZ9A 4O1EA 4IMCA 3PBWA 2ONEA 1XSKA 3CZKA 1UASA 1WDPA 1EBHA 3W7OA 1OX6A 2ZZ6A 1W5NA 4ROPA 1IV8A 2OSWA 3GDTA 1SU5A 3AMKA 1J0YA 2OEKA 3ARXA 4O1DA 2NXHA 3I3DA 3K4WA 1EQPA 3N2CA 2RFGA 3OLGA 2YA2A 2ZCGA 3D5HA 3MO4A 2FVLA 1JCXA 3M7SA 1EEXA 4GWEA 3MY9A 7ODCA 4S2CA 3KHDA 1JF5A 2DT3A 4MWAC 4P8XA 1HFBA 4F9DA 3RM9A 4IGHA 1L6FA 1A4MA 4L1XA 2GJLA 2INEA 2V3EA 4HA3A 4KEZA 2XFWA 4UBPC 1IT8A 1LP6A 1RA0A 1UD2A 4N4QA 5CAHA 3EXRA 2IKGA 4FF5A 2D23A 1UH3A 4G6CA 4PFMA 3AIQA 3KX6A 2QMKA 1WX0A 1GJUA 2GQ8A 2HE5A 2WQPA 3K13A 5L6UA 3DEQA 4UCFA 4QG8A 3S4TA 1DJIA 3R8HA 3M1ZA 1UUOA 1Q7ZA 1XFCA 2LLEA 3CV7A 4Z2HA 2I14A 3BLOA 1XR2A 3BZGA 2WKLA 1J18A 2BY1A 1Q5MA 4HCHA 3PJUA 4GGBA 4IIEA 1RJQA 3GNOA 5DO8A 4O18A 1VFTA 4F0KA 4EAMA 4BWLA 3WNOA 3GIPA 4W7VA 4MHBA 4MKNA 4DJFC 3QM3A 2NZLA 1EZ2A 4US5A 1N8IA 3QN3A 2C71A 3B8UA 1ZP4A 4LY8A 2ZDRA 1NVMA 9XIMA 4Y96A 2EAWA 1UMLA 5IFTA 2OT0A 3CH9A 3W9ZA 2XN1A 5A2BA 3CO4A 3BPWA 5EMMA 3H2EA 4O1CA 1G94A 4OKDA 1FFQA 3Q45A 2WKJA 3SADA 2XJ7A 1CX9A 2YSWA 3BSMA 1Q66A 2OZTA 3WMSA 4E2DA 3SB0A 4KIRA 2YLLA 1TREA 2XSXA 4H8UA 3PP7A 3TTYA 2FZMA 1D7KA 2VZUA 1FDZA 2DV0A 3LHUA 2A3LA 4R9XA 1ZJIA 5IBXC 3G1HA 1V5XA 1S5VA 2GSJA 4NF7A 1FA2A 1O94A 3MWCA 3DFSA 1V08A 4IWWA 3NQMA 5CSSA 1F3XA 1O68A 3SCQA 3ZJ6A 3LBOA 4QEHA 2F8QA 2VL4A 5I6SA 3N6QA 4CNTA 2P50A 4O4VA 1HJVA 1UKTA 2EKGA 3IACA 3T0TA 3LGDA 1MQQA 5FF2A 3FEMA 3EDEA 2CXEA 3NDOA 1FDYA 3SQSA 4Z08A 2E28A 3KDNA 2PWGA 3LHVA 1HO4A 4MNMA 5A95A 3LTSA 3JVAA 1AQMA 2G4JA 4DB7A 4UZSA 1WCGA 3K5XA 4D6DA 1QVBA 1H4PA 3QSRA 3U2ZA 4WX2A 1W3JA 1FWCC 1B5TA 1ODZA 1HP5A 4U4MA 2L5HA 4FZIA 3OBAA 2C18A 2IXUA 2Z00A 3IJ8A 3UNDA 3CIXA 2DT1A 3N3TA 5ABEA 1V6WA 4B5WA 3I4EA 5H8MA 4PZVA 4GO8A 3CPGA 1FQ0A 2ZZ5A 3L4VA 3S1UA 4YJ5A 2VX7A 1AW5A 1HJQA 2ZE0A 1BWKA 1IT7A 3PZUA 3NJ3A 1OZMA 3TR9A 3A4WA 1WPCA 3KRZA 3CAWA 4ZOBA 2XZ7A 3GHSA 1TR9A 4FI4A 3GC2A 4LRSA 4KRUA 1OFEA 2E6DA 3CV1A 3LSCA 3MKCA 2CWNA 2GUYA 3MPGA 2BG5A 3RPMA 4HJFA 4QP0A 1ZBKA 3V3WA 4ERAA 5L9FA 1AZ2A 4GQ0A 1SJAA 1Q85A 4IIHA 5I00A 1B54A 3ZJKA 4DJDC 2WVVB 3F7JA 2HWGA 2VWSA 4UNLA 3IS4A 1KFJA 3KTXA 3WUFA 4M6VA 4AB4A 3HGJA 2R1KA 4UQDA 5DELA 3WBEA 1KWGA 4M1RA 1FBAA 1XC6A 4Q8WA 4AQLA 1VGAA 1NF7A 3CL7A 1RUSA 3HMCA 2FH6A 4NX0A 1EX1A 5B7YA 1P1MA 2C1GA 4HNLA 1Q6QA 1XLIA 2DT0A 3R4IA 2NWSA 5GJPA 3W29A 1GKQA 3HN3A 1EKOA 5EMLA 1KBIA 3SO7A 2BB0A 1LUCA 4ERIA 5EL1A 2BNJA 3SZ8A 1MQRA 4OOZA 4CCDA 2OO0A 1Q2SA 1NFPA 1Q63A 2ZQ0A 3CV2A 3PZVA 1K4HA 4GVIA 3O6DA 4N6FA 3WLLA 1W8GA 5H91A 3C2YA 3GXTA 2ZZ1A 3L2MA 3N14A 2PC8A 3LD5A 3DFOA 1V0MA 3FGCA 3M0YA 4AAJA 1FWIC 5IM51 4QHRA 4MB5A 3LCWA 2TODA 3APTA 4Y90A 1EOKA 3W1PA 4AIEA 1BYDA 3MMWA 4H8VA 4HOXA 2HDJA 4DO7A 3H54A 2R24A 3T0BA 3LMZA 1LG2A 3PM6A 3I65A 1EJXC 3VA8A 3IV3A 3WBXA 5HR7A 3CTLA 1A0CA 3WF2A 4ZODA 2PDKA 1G4EA 3TZNA 2YCKX 3QZAA 3TXZA 5A69A 2WNWA 1POKA 1E6XM 1AQHA 1K7XA 1MMFA 3W4RA 1L0PA 2ISDA 1OVDA 2XHYA 1G1YA 5I3KA 4HBKA 1XPGA 3MO7A 4LQ1A 5BXSA 4LS1A 2OQLA 3NNTA 3EXSA 3LNMA 1THFD 4LOCA 1MXGA 3UG8A 4D71A 1KBLA 4ZSUA 4G1NA 2GK1A 1GVOA 3C8NA 4LS2A 2J7BA 1UZ1A 4P8VA 4LF1A 1SFLA 4GCAA 2DUAA 1M04A 3WMCA 3E02A 4XKYA 2GVGA 3S5SA 4B3LA 1YNQA 1W9BM 2HMCA 5G1YA 4NZJA 3RFAA 8XIAA 3HA1A 2JALA 6REQA 1XLGA 4YWSA 4B91A 1VPXA 4MNLA 2WMIB 2X0HA 4IF2A 4JIHA 4MFDA 5I03A 4IIFA 3BL3A 4WHBA 5A6TC 1JR1A 3KOWA 4DJEC 3MV11 3CWNA 1VFOA 4CQ8A 4C6EA 4LWWA 3A6OA 2D20A 3THQA 3HV8A 1KGXA 3BAYA 2YDQA 1DBTA 4W7WA 4GI6A 3R89A 3BZJA 3IIPA 3QPEA 4EPEC 5A6BA 4RZ6A 1JCLA 1OABA 3MUAA 1PHWA 3OW1A 2OO6A 6CGTA 2DJXA 1EJWC 3SDOA 1MW2A 4GCXA 1UWAA 1W5PA 1PX8A 2AGTA 4GNVA 4ATLA 3R7MA 3PUOA 3SEPA 4DBDA 1F3WA 3L21A 4LAUA 3MHGA 3OVPA 3W7JA 2J88A 3NQAA 1UROA 2QJHA 3OZPA 4I5XA 2EPOA 5HQLA 1JDDA 1LLZA 3ZXWA 1ZBWA 2ZRZA 3L0GA 4E2VA 2PCEA 2D2GA 4C6JA 1CBGA 4J4KA 4QBXA 2IS7A 2QUNA 1GW1A 3BLFA 4AVNA 2V3GA 1XD1A 1V03A 4Q8TA 3BAXA 1KM3A 3ONBA 4JX4A 3IVTA 5TD4A 3KCLA 1G6CA 2XZ9A 5CC5A 5EY5A 4GBDA 2BGNE 1ITCA 1GG1A 1WZMA 4QNWA 1XDMA 3H6OA 3NQEA 4L1GA 4E8GA 1V3IA 3M07A 1ISVA 4AZCB 4NJGA 4RPPA 1CYGA 2CKRA 3B9OA 4FIRA 2J77A 2FHFA 1TJRA 1DL3A 4LPCA 1W3KA 3GD6A 1F3TA 4CVUA 3A9IA 1IIHA 3WJSA 2WLZA 2X2YA 3VDAA 1KXTA 2OSXA 3UXKA 2CIPA 2JF6A 4JXCA 4S3GA 3PF3A 3LM7A 1XH0A 2I5GA 4EX4A 4BHYA 1M7XA 4ADSA 2W63A 2Y4SA 3UWEA 3B3DA 4JY9A 3BAIA 3FHAA 2AGKA 4GX8A 2Z1XA 4GQQA 2PZ0A 1V3LA 4EXAA 4HNUA 1ECEA 3P84A 2MUCA 2RDTA 1W9UA 3DKLA 4Q4OA 5LIXX 3H24A 3TYDA 4ZSTA 3W1LA 2VFGA 2ZUVA 3LXCA 1TV5A 1BYAA 1ITXA 1R2SA 1AW2A 4W88A 4UFIA 1Z3NA 2R6OA 4UWMA 3UG4A 4AC1X 1TTQA 4QG9A 3UPMA 2WMKA 5I06A 3DDMA 1XBZA 4JTRA 4CQCA 3IUIA 2NT1A 3CUXA 4UTLA 4LVAA 3L5MA 3L9CA 4HOZA 2ZA1A 1W9DM 1S5WA 2J27A 1ICQA 4O53A 4J3WA 3SUWA 3ARZA 5I5RA 3N2MA 2VOTA 4MAZA 4YYFA 3LCFA 5CPMA 3HF3A 3N34A 3MHFA 5C9ZA 2YR1A 2Z28A 5RUBA 3H7VA 1YPFA 3E96A 2VC7A 2QDEA 4DBWA 3EWYA 3W1UA 2FPYA 4YN5A 3P61A 4D8ZA 3KZSA 4HD5A 3WEZA 4GYFA 4WLCA 4KF1A 4ZTXA 3OGRA 4XK2A 5G2WA 3LCIA 4FLQA 3GU2A 3TA6A 3VNDA 4R33A 3A64A 1XLDA 3NM3A 1WBHA 3HQOA 2Z1WA 1P5BA 3DC8A 4PMJA 1WDWA 4B5TA 3DOPA 4N9DA 3EPOA 4KGLA 4JTKA 3HV9A 5GNXA 2XISA 3CH0A 3LTYA 3TJ4A 1EA0A 3TQVA 2Y7FA 3P93A 1WZLA 1HKVA 3IVUA 1NWSA 4ZGYA 1QWKA 2YB1A 2W92A 4O8AA 3WFLA 4PC8A 3NQ2A 2JGYA 3O3RA 3WBWA 4XVDA 4AVFA 5D2XA 2FGLA 1CWYA 3RU6A 3WYZA 3RYSA 4PEEA 1J96A 3ELFA 2VVNA 5CBJA 1OIFA 4HSOA 1B9ZA 4H9UA 2BXVA 3H2MA 2D69A 5C7HA 1R3WA 4M29A 1TPWA 3KBJA 2YL8A 4E4FA 5IDZA 2C91A 4M3PA 1ZRQA 1EOMA 3S9YA 4WSJA 2A5HA 4XAYA 2Y7DA 3C0SA 2QCFA 1XS2A 2E9LA 3AISA 3C86A 2DT2A 3ITTA 1EDQA 4UQBA 3J7HA 3EWCA 2I56A 4GQRA 2ABBA 3OVRA 3F4CA 3MYPA 4LUIA 3XIMA 3DENA 4XZHA 2F6KA 4LW7A 2TRSA 4OBSA 3APGA 5A3HA 3QW4B 2J7CA 1XLAA 3A24A 4O0ZA 2PTDA 4ORIA 4DZ5A 2WQDA 5BMXA 3CQ0A 2EJ1A 5LXEA 1RPKA 1LWHA 4PUDA 5IDIA 4GLEA 3PWGA 1EB3A 4JTQA 3F5JA 1F07A 1RAKA 4UTMA 4FXRA 1XGZA 4DF2A 1PWMA 4U3AA 5DQPA 1W9PA 3R2GA 3KEHA 3CNYA 4QLKA 3RO6A 1OT2A 4RR4A 4H7ZA 5AECA 5H1WA 4JCMA 4NAFA 1OJXA 3N12A 1MXSA 5LA2A 3MI3A 3P3BA 5A6JA 2PA6A 4IPLA 1YBQA 3CUZA 1OG6A 4AW7A 4O10A 2QEZA 1VJZA 1TPH1 3S5OA 2DU2A 3LG3A 3GNXA 5D9PA 1KLZA 2FTPA 1VAHA 1F61A 1S46A 3MSRA 4JNMA 2QDHA 2I1OA 1EJSC 3HGRA 4OBTA 3SUUA 3QGVA 3PZMA 2NV1A 3L5AA 1JXKA 4RDVA 4C6MA 2BDQA 5AYXA 1VLWA 1EC7A 4GZIA 2W27A 2CITA 2WANA 1TFVA 3UG3A 3FA5A 5D9OA 1K7EA 3GG7A 3OLIA 1X38A 4JNZA 2Y24A 1MSSA 1E0WA 1WOBA 1JZ4A 4FNQA 1TZ7A 3B4YA 4TX8A 1GG0A 1OM0A 1I6NA 4A3HA 4UIOA 5AFDA 2V5DA 2A1YA 3ZSTA 2P3EA 1UP0A 2QT3A 5A6AA 2BXYA 5HJYA 3TUUA 1SO3A 2R1PA 1B1YA 1JVNA 3EB2A 3ATYA 4CCZA 4IMAA 4JAWA 4QM1A 3MHUA 2CLPA 2W0UA 1PUDA 2CCRA 1JPIA 1CEOA 3PTDA 1ZLPA 1FHLA 5FACA 1S3HA 1VBJA 2ASHA 3KTCA 3L66A 2D73A 2A3CA 1XIEA 1GGOA 4ZCWA 1XBVA 3G18A 2PFHA 3TNOA 1KB3A 1NDWA 4PB4A 1XIDA 4NAEB 4W87A 4HHHA 2VYOA 3PUGA 2QF7A 2W66A 1QW9A 3AWOA 4PSRA 3STFA 3FNDA 4ZQRA 5TNVA 5AB3A 3KP1A 4K36A 4WXYA 2W67A 1GW9A 1R46A 4TV5A 4WDUA 3WLMA 3AS3A 3BDKA 1O5XA 1FHDA 4EPDC 1PV8A 5A6BD 3QV8A 2HS6A 3E38A 1X1OA 4M24A 2YXXA 3OZMA 3FXYA 3S2LA 3R43A 4WJEA 3DG3A 2Y5JA 3LRMA 3GDMA 4YL2A 4W8LA 3FA3A 5I09A 4JDBA 1EF3A 1UWTA 3VNKA 3GIQA 1ICSA 1TIWA 4DO5A 3NPXA 3W88A 2GLKA 4IIBA 4YHEA 1E3XA 1ZUAX 1ODUA 1O1ZA 1CTNA 3WK0A 1CCWB 3CZEA 2Q3RA 3FY1A 1BD0A 4UOZA 3IK2A 1W1B1 2GSEA 3VDHA 2DSKA 7ENLA 2QV5A 1QHZA 4N02A 2GJXB 4MY9A 1VEPA 1DWIM 3LNPA 4TVDA 5HULA 2DW7A 1MEHA 3JRKA 5JBEA 1EYWA 1Q4WA 2E1WA 3USBA 2PEVA 4S3JA 1H1NA 2W4XA 3H22A 3CMGA 1ECQA 1WP6A 2QCDA 4BA0A 4BQ2A 4D72A 3V0UA 3G1AA 3U6WA 1ME9A 2B31A 4XISA 1ZGDA 1XLEA 2VO5A 1TTIA 1ZFJA 4ADUA 4RE0A 3G0UA 2GSHA 3UCDA 2V3DA 3TN3A 1IQ8A 1ONRA 4RDZA 3UT0A 1J4EA 4L4PA 2ZRYA 2V5KA 4MWAB 1G5AA 2ISSA 3WDRA 1QR7A 4HKPA 1PYMA 1SJBA 3IJDA 1NOUA 1RBAA 4HCLA 1HP4A 4O4WA 4AMAA 4NNAA 2POTA 4HNOA 1B4KA 4NJJA 1JZ5A 4V33A 1YPIA 1H11A 1OFQA 2E40A 1E4MM 3DFYA 1E1EA 1LROA 3WK2A 2R9RA 1HKWA 1EZWA 2ZVRA 5FJIA 5CPOA 4LEFA 1EWDA 4AZ6A 1YBQB 2UZ9A 4PB5A 4KT2A 4KKXA 4RUBA 4RZ4A 4DXXA 4LAZA 4UFKA 1OADA 2ZXQA 2J6XA 3N18A 1M7OA 1HKMA 3T55A 3EOUA 2WZHA 3GVWA 3NWRA 3GXPA 2E68A 3ZT6A 4AD0A 2WVUA 3TR2A 4PB3A 2VEMA 2GDUA 1G0CA 4JIIX 2HBVA 4NQ1A 3WG6A 5DMYA 1YKWA 2PU0A 1V0KA 2VURA 3NOEA 4LV4A 2TYSA 5F2GA 1TV3A 4NI8A 1KCLA 1IWPA 1W54A 4ZA0A 3GTIA 4DYJA 1XBXA 2A6NA 4TUFA 3L4WA 4HP5A 1BSLA 1B3OA 3CMJA 3CHCA 4FX8A 3PC0A 4JHOA 4B15A 1TWWA 2CZFA 4MNJA 7XIMA 3UW6A 3R0DA 3U3HA 3DX5A 4H8HA 3EOEA 3O0FA 3W83A 4LUYA 1B3ZA 4W86A 1TG7A 1IYXA 2OWWA 1MZRA 2Y6ZA 2OPJA 3XINA 3BVJA 1TE6A 2VR2A 4XBSA 4N42A 3IIXA 2ZXBA 4JKLA 5BNKA 3NEVA 4HSNA 3ZR5A 4B5XA 1L6GA 3VUSA 3S83A 2BSLA 1OHLA 1BLIA 3M6DA 3W7MA 3WLHA 4B5VA 2AKZA 3SJ3A 4AZIA 2Z0IA 1K70A 1LF1A 3M64A 3QXBA 2WPBA 1XYCA 2J7EA 1IR2A 4LC8A 2Y61A 1OSEA 4ZQNA 4KBXA 1VBRA 4MPQA 1KFKA 5XIMA 3WUGA 1F05A 1VR6A 1DVJA 1Q7MA 4DZAA 1M9HA 4UCGA 5D38A 3W7DA 4JFUA 4IJCA 5F4XA 3NZQA 5J8LA 4I7WA 1Q45A 1HVXA 4PSPA 3C2RA 1TYGA 1JZ8A 3KL5A 3TROA 3QRHA 4GBUA 4I6VA 1WA3A 1ZBVA 5TBOA 5D37A 4S3DA 2NQZA 1HNYA 1YX1A 3IVSA 2VI0A 3KWXA 4AY8A 3RX4A 1C90A 3SSZA 1I2PA 3FEQA 4L61A 4XD6A 3UWQA 4AX6A 3B0YA 5FJTA 1GYLA 3N2OA 3RN6A 1WKEA 3FYOA 3OHMB 4UC5A 5CSYA 2QAPA 3MUCA 4TX6A 4IH3A 2OGYA 1UOZA 4AVOA 3N04A 1UBSA 3QZEA 1IIGA 2GDVA 2FFIA 4N0RA 2WSYA 2QLYA 3VNIA 8CGTA 4RW5A 3BGGA 1BG4A 1Q3NA 1C9WA 3PBGA 3VIGA 2X0SA 5FAGA 3PZOA 4HJWA 3TYUA 1NP0A 4S2BA 3IJQA 3E0WA 2YYUA 4DJED 3ONCA 1OFAA 3PJXA 2OG9A 4JTTA 1YTDA 2ZICA 1UP3A 3V0TA 5A6KA 1B90A 5CSRA 2OOFA 2PC4A 3VGBA 5PTDA 4XBJA 4HNTA 3RLUA 1JJKA 1JIBA 1JD7A 1H09A 1KKRA 4REQA 1XLKA 4O52A 7CGTA 1ZS2A 3OG2A 3H2AA 1IGWA 2DH3A 3MI6A 1GTEA 4NY2A 1Q6FA 1BG9A 3L4YA 3IGXA 4MY1A 2WSRA 1EPXA 3WIJA 1TMHA 4YNGA 2IQDA 3BXWA 4L9ZA 2XGZA 3TVAA 3A12A 3AS2A 4B5UA 4WOQA 3DG6A 3B97A 5F7UA 4K39A 3SECA 3SAZA 2XIBA 3GBEA 1D8WA 1J5SA 2WJDA 3FJ6A 1QW8A 2E7FA 4LYQA 1RD6A 2I5QA 3WDIA 3CAQA 4WQ6A 1U22A 2J9YA 2FB2A 1ZNNA 3DG7A 4PCFA 2CYGA 4QITA 4G8TA 2XM2A 3H21A 2ISWA 2V5CA 4D9PA 1Q65A 4CQBA 2WWDA 1VRXA 2PF0A 1WXJA 3NXFA 4LY4A 3WF0A 4MUZA 2OODA 4PFHA 4CCCA 3PZIA 1H0IA 4BQ5A 4AX7A 2ACUA 2DFAA 3WQEA 2BHUA 1WQ5A 4L9XA 2KX9A 3OJGA 3UR5A 1SSDA 1WO2A 3ABXA 1FOBA 4LYKA 3A23A 4P7NA 1I9CB 3GQYA 3MBFA 2VTFA 4YLWA 3KVJA 2PWDA 1CXEA 2WNNA 4MB4A 2O9TA 4KFPA 4YS1A 1YHTA 3NTYA 5DMLA 4OJYA 4ADTA 2O92A 1AD4A 4AY7A 5LXXA 3PG9A 3ZR6A 1IF2A 3W7KA 4UNKA 1WNOA 3AMLA 5LKYA 2QMJA 3AMCA 3L7RA 1V7YA 2VZVA 2WPGA 5AC5A 1T41A 2QCLA 3TQ0A 2Y1HA 4OV9A 1QI5A 2C0AA 3AO0A 3EWUA 4JTIA 4HN8A 2B7QA 1YMYA 4QIUA 2VC6A 1GUVA 3T81A 2XSAA 4GA8A 3TONA 3QH2A 2VGIA 4F79A 3N13A 4AD1A 1GZ1A 1PCKA 2C16A 1IWBA 3NPUA 1B9BA 4GY0A 4LS0A 5A5WA 2PDHA 4X0VA 1SSGA 3GS6A 2ZTKA 3ZVHA 3AOFA 3NQGA 3UJEA 3LV6A 3DN5A 2YA1A 4K7YA 2A7PA 3ZSSA 1A0EA 2Z2BA 2EHHA 1E4IA 3PNZA 4HOWA 3LGEA 1Y5VA 4CN1A 5HJXA 5G2IA 2JK2A 1TZZA 3WQ4A 4I9MA 3G0SA 1KXQA 5HANA 3BAWA 4KESA 4ZXOA 4RNFA 2PDQA 2BV9A 4CVWA 1LORA 1KM6A 2VR4A 1G67A 1JQVA 1K6AA 3CUJA 3KRSA 3SY5A 3U2CA 3CIWA 2PGWA 1UR8A 3WLNA 3PHAA 1JEZA 1X7FA 1XW8A 1GQIA 3C4UA 3T40A 2J24A 5F2MA 1PVNA 4FS9A 5I2UA 1FKWA 2PWFA 3AU6A 3VNMA 3WQPA 4IOTA 1TO3A 1XLFA 3THUA 2PDXA 3RIKA 1EWEA 1CNVA 3G1SA 5EB8A 1JAEA 3LU2A 5CEWA 1HF6A 2PBGA 2XU2A 4V28A 4DO4A 1A5NC 3F4VA 1LRTA 2GL5A 3U2OA 4EKJA 3VABA 1DWFM 4AIBA 3W01A 3W1TA 3NZ1A 1DJGA 2GWGA 1U83A 5E93A 3QF0A 1DJWA 4A8RA 3OVQA 4I90A 3WD4A 1ZTVA 2O7SA 4PTVA 4PYSA 3PBMA 4FX7A 2J66A 1V6YA 1N2VA 4MWAD 2X1IA 2RAGA 3B8SA 1TJ1A 1LQAA 3KVLA 4MUPA 1AJ0A 2QYGA 3OBKA 2QF8A 5EPDA 1JUBA 5D32A 1UD6A 2ZUUA 3EMCA 4KCUA 3LK6A 4OQVA 3H26A 3EDKA 4Z0SA 1QW7A 2WJEA 4MGGA 2AL1A 3RK8A 3SRKA 3WH7A 1JPMA 1B0IA 3H12A 4H6KA 4Z1BA 1CECA 2D0FA 4N7QA 4O16A 4AYSA 4FNSA 3D3AA 5C2CA 3ZLHA 1BXNA 1TTJA 1E55A 1AD1A 4QDMA 5G5IA 3AXHA 1E0XA 4JIEA 1S1PA 3E0LA 2OWXA 5LNUA 3IIVA 2WNQA 4MADA 3WQ5A 2WWCA 1S5NA 1GONA 4CD6A 4UUIA 4RKAA 4LTSA 3VDCA 3RLHA 1RD5A 2FVMA 4CUCA 2O4QA 4OHQA 3C52A 2VQTA 1VYSX 2XPKA 5I23A 1WZKA 4JQ1A 1A5UA 4ZOEA 7TAAA 4BR1A 5AYZA 4HTBA 3W75A 1UKQA 4P7QA 1W17A 1XL9A 1J0IA 4GVFA 3DKJA 2YKKA 1NWRA 3ZT5A 4WUIA 1JAKA 1UG6A 3LSBA 4R88A 3R10A 2FFCA 1GTHA 3ARWA 2WMHA 4Y9NA 3VZXA 1UWUA 2Q3OA 3EDJA 4OU1A 5M03A 2E9BA 4NU7A 5FJPA 1S5MA 1XWYA 2GOUA 4J3XA 3ZR4A 3N9SA 3DH7A 1AH4A 3GB6A 1TPB1 1XINA 1JFHA 1M65A 3ARPA 3QLDA 4DZHA 2VVSA 4KCTA 1FY6A 5ECUA 1UJPA 4HMNA 2Y8KA 4YTRA 3E74A 4LJ3A 1P7TA 4FR1A 4IISA 1EGVA 2H3DA 1E6ZA 3RG6A 4DM2A 2F84A 4B2DA 4HNVA 1GT8A 2G4FA 2H90A 1ELSA 1MVYA 2VDHA 4Q6JA 3K1GA 5CPQA 1XRFA 4MG4A 1S3TC 4O54A 5C7VA 2WZMA 3CB8A 4NILA 4XTDA 4PUEA 2GVYA 1JULA 5I07A 2DZBA 1TWDA 2W6RA 3CQIA 1O6IA 4Q6XA 4IPIA 4ICNA 1QNQA 2POZA 1PSCA 5JQ9A 1BYBA 2Z6JA 2AAMA 3DU0A 1HKIA 5FF4A 1K9DA 1PKYA 2Y88A 3PWIA 3MVIA 1XYMA 1Q6CA 1GNXA 2J4GA 2OZ3A 2GFTA 4UQAA 2BVDA 1K3UA 2W79A 4JTDA 4PL1A 1XUUA 3M9YA 4H3DA 4FMVA 3M0MA 5DLCA 2VKZG 2ZXDA 4AFYA 4L56A 3SUSA 3TIMA 3EKGA 4ILSA 5AHFA 5T91A 2WMGA 3TMQA 4TTUA 1A5BA 3OTRA 1HJUA 4JQ2A 4QS5A 3LS9A 1S2TA 3BE7A 4GUFA 4ZBCA 1DQWA 5K9DA 3U0HA 4DN1A 4G7FA 1YNPA 4X9SA 2X1SA 4RPQA 1H7OA 3LERA 3HG4A 4QAIA 3GX9A 3LV5A 2X7WA 3W3OA 1OYAA 2Z4GA 3PZ9A 4QSHA 1KFWA 3W74A 2PF8A 1VP5A 1H5YA 3VOIA 5LSMA 2Q8XA 2NXGA 4KWOA 2PDFA 3C2OA 3GY1A 4NG3A 3UY7A 4B9ZA 3EA3A 4FK9A 5JVLA 3ABQA 4AEOA 4PGLA 3LRLA 2J7FA 3WLSA 3PAJA 3S6TA 1AQFA 3QV9A 4CD5A 4LXFA 1V51A 1ISWA 3POCA 4RV8A 4K1GA 3CC1A 1POJA 2H9AB 4O14A 3GTXA 1XI3A 3RJYA 3A4AA 5FA5A 2D2HA 4DJEA 2BGQA 3HG3A 3LBMA 4UTWC 3FYPA 4DNHA 3ALGA 3K30A 3W26A 3NG3A 1IT0A 3VM7A 1CXHA 5E6YA 4PUNA 2X42A 4QR6A 1C8YA 4ZMGA 3M7WA 2BLEA 3DFTA 3WELA 4GKTA 4YCPA 3PTKA 1PTAA 2HBXA 2VHLA 3WMBA 1OD0A 4YVVA 4HGXA 1M5WA 4C60A 3MYOA 2ZX9A 2OKOA 1NF0A 3V36A 4S39A 3VCRA 3QR1A 3TQPA 3MB9A 1BVWA 4UZUA