1QUMA

Crystal structure of escherichia coli endonuclease iv in complex with damaged dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the DNA repair enzyme endonuclease IV and its DNA complex: double-nucleotide flipping at abasic sites and three-metal-ion catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
molecule keywords 5'-D(*CP*GP*TP*CP*C)-3'
total genus 105
structure length 279
sequence length 279
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 1999-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1qumA00
1TZ9A 1XP3A 4LNCA 1XIDA 2G4JA 2HK1A 2NQHA 3CQKA 3M0HA 3VNIA 1XICA 1XYCA 4QE4A 4QE5A 3IUIA 4K1GA 4QEHA 4XSMA 3BZJA 4YTRA 1O1HA 2GLKA 1XIIA 2J6VA 4E3VA 1BXCA 2NQ9A 4PFHA 4ZB2A 3UXIA 1S5MA 1I60A 1XIJA 4A8LA 3U0HA 3CWHA 3AAMA 2GVEA 9XIMA 4XIMA 1XLEA 1XLLA 3C0QA 2G0WA 3VNJA 1YX1A 3ITYA 4HGXA 5B80A 3IUDA 1K77A 3M0YA 2NQJA 1XLCA 3M0LA 4YTUA 3TVAA 3XINA 2GUBA 6XIMA 5XIAA 1D8WA 1XLFA 3KBMA 4G56A 3ITTA 3KBSA 4QEEA 3JU2A 5EMJA 5AVHA 3KCLA 3QYSA 1QUMA 5XINA 3UU0A 4A8IA 4GQBA 4A8RA 4Q7IA 1XLAA 3BANA 3C0LA 4GJIA 1XLDA 3ITVA 3DBNA 4HHMA 3KBVA 1XINA 4X61A 1XIEA 1A0DA 1XYAA 1XYMA 2XISA 3P6LA 1DIEA 4HHLA 3C0SA 5I7GA 1OADA 3XISA 3M0MA 1A0CA 3KBJA 4XIAA 4ZB0A 3GNXA 4US6A 1XIGA 5TNVA 3UA4A 3DX5A 3CQIA 3UVAA 3QXBA 4ZB5A 2I57A 2QULA 2QUNA 1XIBA 4PGLA 3KBWA 5B7ZA 4QE1A 2ZVRA 3KTCA 2X7VA 2QW5A 3AYTA 3VNMA 4GJJA 1XIMA 3QZAA 3M0VA 4HNOA 3IUHA 4GLEA 4K3ZA 5C9ZA 2GYIA 3AALA 3L23A 1XLBA 4X63A 3CQHA 1XYBA 3NGFA 3QC0A 3AYVA 5AVNA 2XIMA 4QDPA 2OU4A 1XLJA 5EMLA 1QTWA 1XLIA 4X60A 5EMMA 3BWWA 3XIMA 2X7WA 3P14A 4XISA 1XIFA 2HK0A 4XSLA 4A8NA 9XIAA 4YTQA 3KCJA 1DXIA 1MNZA 1MUWA 4OVXA 3CQJA 3BZGA 1I6NA 2Q02A 5XIMA 3VNLA 1A0EA 3OBEA 1CLKA 4YTSA 3TC3A 8XIMA 3LMZA 3M0XA 2HCVA 3VYLA 1DIDA 1XLGA 3ITOA 1XLMA 4YTTA 2QUMA 7XIMA 5B7YA 5EMKA 3BDKA 4J4KA 3ITXA 1GW9A 3KBNA 1XISA 1DE5A 3U3HA 3UA3A 1XLKA 3CNYA 8XIAA 5J8LA 5H6HA 3FVMA 4W4QA 5FA5A 1QT1A 4DVOA 4DUOA 4KW2A 5H1WA 3ITLA 4QDWA 4EACA 3KCOA 4ZBCA 6XIAA 4EAYA 3VNKA 1XLHA 1BXBA 1XYLA 1XIHA 4XKMA 1DE6A 2I56A 2XINA 3N4AA 3WQOA 2ZDSA 3KWSA 1S5NA
chains in the Genus database with same CATH superfamily
4MFEA 1LWIA 3DU0A 3UJ2A 4QE5A 5IHSA 2YGYA 5BYWA 3P0WA 1AW1A 4NXSA 2J9XA 4BZYA 1E9IA 3W7JA 1S2AA 1XDLA 4Q7BA 4DX3A 4HCLA 1K1DA 4UFHA 5A8GA 4GQBA 4X61A 2GDVA 3W28A 3UF9A 5AYYA 1GORA 3BOLA 1WKDA 3PTQA 1QI2A 2D23A 4GCAA 4D9PA 4UOJA 3ABRA 1QNOA 2CIPA 1NOWA 2WWDA 4JN6A 7REQA 1JNEA 1KQZA 4PMDA 5K9XA 4E38A 5LIKX 3DKLA 1C7SA 1TV5A 3AISA 1HP4A 3T9PA 3C2YA 1KBBA 1VRXA 1JGMA 3DYOA 1XPYA 4M5PA 5AC5A 4XSLA 1WXJA 5A6JA 1XDMA 3LG3A 4FX7A 5FF2A 2YSWA 5T26A 3BJTA 4ZXOA 3I6TA 2EPKX 2WMHA 3E38A 1KBJA 1O12A 4EKJA 1LUCB 4CQBA 2ZYFA 1A49A 4HSHA 3CPRA 2ZWZA 2G95A 2JEPA 1R46A 3T0CA 3VGFA 4GZEA 3VU2A 2OYMA 4NAFA 1PWLA 1OFRA 2GGEA 2WLZA 3B0XA 2PLKA 2C16A 1UROA 4LVBA 1SW3A 3FXGA 1BXCA 1UHVA 3H4GA 3W1NA 1CGVA 3TAOA 1ISZA 1UBPC 4M82A 4NILA 4C6PA 2WVVB 1EA9C 4HA4A 1UD5A 1IT8A 5C71A 3BAYA 3KRZA 1H0GA 2A3BA 4GCXA 1PSCA 4JL1A 1T40A 3M44A 1WYIA 4AW7A 2QAFA 4AIUA 3LENA 4BI7A 3R8HA 3B03A 3SUWA 4K2SA 3VMPA 4FSAA 3IUHA 1UWQA 2YOCA 2TAAA 2E5CA 1A3XA 1S3TC 4I6VA 1OGSA 1LCOA 2VCCA 3FJ6A 1MDLA 4MNLA 1FP9A 4XO7A 3ZLFA 3AS1A 3UP8A 3S2NA 4PR4A 5G1YA 3GVRA 3PN8A 3QGKC 4RZ6A 4GUGA 5I02A 4HOWA 3AZSA 2A79A 4B3KA 4LH8A 4I7WA 1DL3A 1VHCA 3WF2A 2EJ1A 1YEYA 1LG2A 3IVTA 3FVMA 3OBAA 4RL3A 3FAXA 1JUKA 4WDUA 1UYQA 3ITLA 2CC0A 2Q71A 3RCMA 1LYXA 3QHMA 4U28A 2BHUA 1PPIA 2FVMA 2EXOA 3VNIA 1ZP4A 1DHKA 4UQCA 1X6UA 1U22A 4TTGA 6ENLA 4IMEA 1ZENA 3R25A 4JX4A 3LA4A 9XIMA 4AIBA 3VXGA 3MO4A 3LV5A 1BRLB 2HTMA 2NQZA 1JL8A 1B30A 3DFOA 2DIJA 5XINA 3SCPA 2EG7A 1Q7MA 1JUEA 1R3YA 1C29A 3K8MA 2EEXA 5JBEA 1DVJA 5CC6A 5BXRA 2PTYA 1MXGA 1EWDA 1HJQA 2RDWA 1NJJA 4LANA 1E4IA 3WKZA 4DWDA 4WGHA 2ZUWA 4Q8VA 4B5VA 3M07A 3VTRA 3DHFA 1OZMA 1V0NA 1M41A 1RD5A 2RDUA 3T2PA 1FWBC 1K9FA 1HJUA 1KTNA 3KDOA 3O06A 5ABHA 4ZOCA 3S2CA 1BAGA 1GK8A 1DXIA 3DG3A 1QHZA 1DBTA 1KM0A 4PUDA 4O14A 3S1WA 2PB1A 4TMBA 2D69A 2PZ0A 3NPXA 1US3A 1QI5A 3V18A 4QRNA 1SO3A 1J96A 1KFKA 1AVAA 3MJYA 2R1NA 1FWFC 3UPBA 1YE6A 5BOFA 3UZYA 3N9RA 2ONEA 3LY0A 3CUIA 1P6CA 2AKZA 2Z28A 5F1UA 4KIEA 1GOQA 4CN1A 1RALA 1QAPA 1IEWA 1SJBA 3CV2A 3GAKA 3KP1A 3DAQA 5C2GA 1ITXA 4XKYA 3K8KA 1XYAA 4IQDA 4HHLA 3XISA 3IJDA 3KBJA 4ZB0A 1XIGA 1JPKA 4IL0A 4KQNA 2BY0A 3Q45A 4GVIA 1GEQA 1KRCC 3F5JA 1CWYA 2PRMA 1HJXA 4HP5A 5D2YA 4IG2B 1TE1A 2VEKA 4K39A 4B15A 1LLWA 4FO4A 2OU4A 5CC5A 3REQA 2YX0A 3DFSA 3LTYA 3V0TA 4LT9A 2YBTA 1Z3NA 2PDKA 3QV8A 4UTTC 4DYEA 3ARVA 3ZQ9A 3EDJA 2QVNA 3HN3A 1HJVA 5CJ5A 4MM1A 4ERGA 4HSOA 2HSAA 4S2CA 1PZ0A 2HE8A 3D6NA 1W6TA 1V03A 2ZZ4A 2V67A 1G1YA 3CL7A 4IL2A 1E6XM 1A50A 1UB3A 2CLIA 3DIPA 4MHBA 3TMQA 2TODA 4I5RA 2WMKA 4QE4A 3KOWA 3L0KA 3N3TA 3O15A 5FF7A 5BOEA 4TUFA 1GVOA 5IBXA 3AU6A 3WYZA 2CZEA 3NIYA 4M19A 4XIMA 1UBSA 1YNPA 4ZMGA 1F6YA 1D8WA 4UTKA 4JTGA 2NSOA 3HPXA 2VI0A 2GFTA 3VOGA 1XINA 3GG7A 4UCGA 3T55A 5F1VA 2NUWA 4H3DA 1VCGA 1K9EA 4KWUA 1ZBCA 5K2ZA 2PLMA 3RX2A 2QS8A 4FLRA 4F0RA 3EB2A 3EMZA 1F8IA 3PBWA 4QE1A 2VGGA 3EOLA 1RJRA 4ASTA 2GQAA 4FALA 1CNVA 4HNVA 4TV6A 2ZE3A 1E1CB 4Y6GA 4B5XA 4QTGA 1H41A 1EUAA 3VPLA 2C1IA 4DM2A 3IIVA 1KRAC 1OC6A 3VUPA 2Y1HA 3VABA 2NQ5A 1K8CA 3OP2A 3W7DA 3W1AA 4ADUA 2ZKMX 5AC8A 1GONA 1HJSA 3DH7A 4LTSA 1YXCA 3P62A 2WAGA 3BAKA 4MAZA 3T44A 3O6CA 1TCDA 3GY1A 1VKFA 2PTDA 3M0HA 2ZZ6A 4PMXA 1EA0A 3R1ZA 3N4FA 3NZPA 1NF7A 3LPFA 4AD0A 3CWHA 2BOGX 2DSUA 4C6NA 2PDJA 3VKKA 2Y89A 3P80A 4HA3A 2WMIB 3PZMA 1WOAA 3BK0A 1FCQA 3GZ3A 3NNTA 3TV8A 3G0UA 4B9ZA 3AUJA 2VOTA 2W5FA 1ZQ5A 3WF0A 1EF3A 2AQOA 4RE4A 5F2MA 4JQ1A 3WH5A 4POCA 1UH3A 3B0YA 5D8ZA 1UZHA 3SUUA 3G1RA 2B7PA 5RUBA 3ABXA 1QW8A 3U9IA 3G18A 2RAGA 2GSJA 1NQ6A 3HF3A 1LROA 3N14A 2JALA 1J11A 4Q4KA 2C0HA 3LSCA 1ZNNA 3WDIA 1AZ2A 1YPXA 3UJSA 2DV0A 2XFWA 2KZHA 1Q4NX 3QQ1A 1L8PA 3NCOA 3E0IA 1FWWA 1XGZA 3AHTA 5I3JA 5FEWA 4DVOA 1LL4A 4QDWA 4KFNA 1DHPA 2ATSA 3D5HA 4HNNA 4AG0A 2FH6A 4V1XA 1WXYA 3WK2A 1GW1A 2D2HA 2G4JA 3GB6A 3AYSA 2DZSA 2PLCA 2IKIA 1UA7A 4MWAD 3BG3A 1CGUA 5G2WA 1S5MA 5A69A 2G96A 5BXSA 1KKOA 1XH1A 4FI4A 1REQA 4WDXA 3IGSA 2PUZA 4AVFA 1DPMA 3LHYA 1EDTA 4L4MA 2J8GA 3VCNA 1ITCA 4CUCA 4KEZA 4QAIA 3H53A 1LLZA 3DCPA 1E43A 4ACZA 4Z1YA 5BNKA 4V1YA 4D6HA 3DGBA 3IVUA 2YFNA 2XFYA 3U5UA 4IICA 4MJMA 3OZOA 2Y4SA 3GVVA 3SB0A 5BZAA 4P8VA 3S2JA 4BWLC 4DPQA 1XJBA 3WD4A 1TSIA 1WB0A 5EYWA 2D0FA 4HZMA 3B8TA 1U1HA 2UV8G 3BMWA 1W56A 2OWCA 3CAKA 1HXJA 5CZKA 4PMYA 4XWUA 3TX9A 2QCLA 1BD0A 1CBGA 2AAAA 5EMYA 4Y8EA 3GUGA 6REQA 2YXGA 1FHVA 4BWLA 4CNOA 4R9XA 1XIDA 1UQYA 1EP1A 1KW1A 2BFGA 2VWTA 5I3FA 4D6JA 3FJNA 3LU2A 4IIFA 5D2VA 3AMKA 4B4HA 3OOQA 3RCNA 1S1RA 5BROA 3TC6A 1TTIA 3E2SA 1AW2A 3B9DA 3PZOA 3NPUA 1QU4A 3T2QA 1DOSA 2FFCA 1DIEA 1FX6A 2ZUVA 4PRTA 2HRWA 2V3EA 2ADAA 4HZ6A 3R89A 3S1GA 2V0TA 1EC7A 2ZADA 4MY9A 1F4HA 3TTSA 5AYBA 2QKFA 4JKMA 3GH7A 3PBVA 1JDFA 2YL5A 1BSIA 2PCEA 3SO7A 3LXBA 3T4CA 1ISVA 4IFOA 1E73M 2J7EA 2P1FA 3ZZ1A 4GUIA 4RJEA 4JD4A 2HS8A 4GNJA 2ZDRA 3A4JA 2XVLA 2YDAA 3STEA 1I2OA 3BGJA 3WLIA 3NJ3A 2PDYA 4P61A 2HISA 5F2LA 4AZHA 5EL1A 2XHYA 2V68A 3ITOA 2PDGA 2NWSA 2YXXA 3WK0A 3AFBA 3D0CA 2JGQA 1K7XA 4US5A 3I3BA 4ZOBA 1GNXA 5L6UA 2YDQA 1I1WA 5C6MA 4DUVA 1CXFA 1EJVC 2Z27A 2A7PA 4A8IA 5I2UA 4MZ1A 1ZBKA 3COTA 5BOOA 4Q8NA 3CV6A 3W1MA 4X0VA 1Z41A 2RHGA 4GI9A 3W7KA 1R5YA 4UTWC 1EOMA 1XLEA 4Y96A 4H9TA 2ZTKA 5K4ZA 1V6VA 2D3LA 5HAOA 2WW5A 1Y5VA 3AI0A 3CV7A 1XLAA 2D20A 3Q67A 1J6OA 3N2MA 4YCPA 5TF0A 1P43A 1OVDA 4HPJA 1UD6A 3GR8A 3WLMA 2O7SA 3GBEA 4L64A 4EWJA 1GG1A 2PDQA 3UR5A 3HURA 1P7TA 2QJNA 4DNHA 1UWTA 2PODA 1U83A 3C3UA 1GJWA 1H5YA 4UNKA 1MZHA 1YTKA 1BGAA 3QRHA 1VP5A 3MSDA 4Q4OA 3FNDA 1H51A 1SMDA 2WKGA 1H5VA 3EX1A 3HBLA 1DORA 1ZTVA 4PTDA 1KCZA 2YCLB 4ZFCA 4W7UA 3NEHA 1TB3A 3STGA 2HZGA 4PUKA 3C2RA 4LAMA 3W7LA 4MY8A 4MJZA 2R9RA 3DG7A 2NZLA 1E1FA 5J8LA 3PZUA 3NDYA 3PZGA 5U4NA 4I9MA 4AZ5A 4CKQA 1NFPA 4LUSB 1EGMA 4AEEA 4WSKA 3HJEA 1XICA 1BSLA 2W0UA 3EWXA 1ADOA 4H19A 1V51A 3KTSA 1DTUA 4V33A 3F1QA 5HMSA 2J25A 4N0RA 5EGRA 4O0ZA 3AUOA 3C2EA 3VX1A 1NF0A 1A5UA 1GVFA 3PP7A 3DKJA 2E3ZA 4L6HA 4QLLA 1H62A 2H9AA 5EMJA 2XYLA 1A0DA 4ZE4A 5E6YA 2ZC1A 1GOOA 4C1LA 3GC4A 4A35A 3A9IA 4HKPA 3L4TA 1ADSA 1TWZA 3PJWA 4RKAA 4DUXA 3H26A 3KTCA 1A3WA 4M81A 4QG6A 3UJRA 1EJWC 1HKJA 1TTJA 1R3VA 2POZA 1VPXA 4IMCA 2WMJA 3DHDA 1XLIA 4V15A 2ZIDA 1Y8BA 4YTQA 3GTHA 3TSDA 1LQ0A 1RQEA 2X40A 4AX6A 2W63A 4XAZA 4E5TA 4PH6A 4BF7A 5MF5A 2RDTA 3UG5A 3RR4A 5J5RA 3CO8A 6CGTA 5J04A 1UR0A 3OLDA 2H8ZA 2NX9A 4Z42C 4E3TA 3UESA 2VR5A 3WH9A 3TJ4A 5A3HA 3LCHA 5GNYA 1DEDA 1BLIA 1I9CB 3P74A 1RVGA 5LXXA 4FOUA 1HKMA 1JCNA 4JFVA 3DXIA 4IPLA 3P81A 4QXIA 1V3IA 1R3QA 4N6EA 2OKTA 4LPCA 5HK4A 1LQAA 1G7UA 3KWSA 1KM3A 2VX6A 1OD8A 4BQ2A 3U4AA 2GK1A 4CQCA 4JTUA 1HUVA 4L9ZA 2WJZA 1BQCA 1XYFA 2YL9A 4R88A 4AYGA 3ONCA 4JCMA 4S39A 5A6SA 2ZICA 5AZ1A 3GIPA 1US2A 2V63A 4O57A 2YW3A 1POJA 3VE9A 1XIEA 1KO0A 4FX6M 8TIMA 1H7OA 4HJWA 4JICA 4DJED 4EPEC 2P76A 3PWIA 3WG6A 4PUMA 1AMKA 1KXQA 3ZR4A 5EMUA 3DX5A 4AZIA 1J0YA 4IJCA 2DT0A 3WH6A 3H2OA 3LBOA 4YHEA 4LNYA 1DJWA 1ELSA 3LCGA 1PKLA 3T78A 1KA9F 1OBAA 4LJ3A 4MAVA 3O1NA 3TW7A 2NVDA 2XU2A 1RD6A 3ARZA 4HTBA 4JN8A 4O0KA 1PX3A 1W54A 4D6CA 3ZSTA 2A3LA 2VC9A 2ZCGA 3RFAA 3TZNA 3HFYA 4XZNX 3WN6A 3LXAA 4UZSA 3SY1A 3L9CA 4ONVA 5E1QA 3URAA 4GIEA 4KERA 5DCEA 5EB8A 4FLSA 4ZTXA 2XM1A 4O52A 1W3LA 1V6XA 2VURA 3MZNA 1FWTA 4GGHA 3RM4A 2VQUA 1RY8A 3OA5A 1UP3A 1AK5A 4L9YA 1M7PA 3QQ0A 5C2CA 1E70M 1CYGA 3OB8A 1SJAA 3NSXA 3SCRA 4E0CA 1ZPTA 1EWEA 5KTLA 3P2VA 1IT0A 2J7HA 1J0HA 1AFSA 5DMLA 3A5FA 1JR1A 2IMRA 2PDLA 3LM3A 1QCWA 1H49A 3MW7A 3D47A 3TR9A 1W31A 3HG2A 2VP8A 4EOUA 1W8SA 4JTIA 3VUSA 5HWNA 4GYPC 3DN5A 1GJUA 1NH6A 1F3XA 1WKEA 1GKRA 4IIHA 4AAJA 1E56A 2QCHA 3OLIA 4HMDA 3CU2A 3LI1A 4F2BA 4Q33A 4RW3A 3FHAA 1XD0A 3DC0A 1D8CA 1FQ0A 1PIGA 3A4WA 3CS2A 3KLLA 4WX2A 2V3FA 1CLVA 1HL8A 1IGWA 1UD8A 1R3TA 3GD6A 3R12A 3BCDA 1TCMA 3M9YA 3BLIA 5CBIA 2WOQA 1FWEC 4C6DA 4LQ1A 1XLKA 2EPNA 3WLOA 4LYPA 3FHQA 4LY8A 3APTA 3T8LA 1LQ2A 4B92A 4QHRA 2Y61A 1Q65A 3ALGA 4XZ9A 3CZGA 3SRFA 2GOUA 1VCVA 1XI3A 4E2BA 2VKZG 4DRSA 4D2JA 1XH0A 4HOXA 3LGGA 4C5ZA 3IPWA 2ZRUA 3M41A 5AHNA 4FNTA 4OBSA 1IXQA 1B9ZA 5K4XA 3TAKA 2UY3A 3GVWA 2WQDA 3HQPA 3S4TA 1QHPA 2V38A 3FKRA 4D6EA 1XG4A 3B8DA 5HMEA 1SSGA 4A3RA 2HBVA 1KCKA 2V5LA 4IMGA 5DELA 3C2FA 1I2QA 1GVEA 4JIIX 4B16A 3RRAA 5A6KA 2ZX5A 4N42A 2Y0FA 3H2FA 4IT1A 1G94A 5KINA 1UC4A 4B90A 3B4UA 4AB4A 2OYKA 4DPPA 2DQWA 3G22A 4PTMA 2WKLA 5F2IA 3P8IA 3B9AA 5EMLA 1EXBA 4J3TA 4JPGA 4C6KA 1OINA 3MZ2A 3TN6A 5LXEA 4TR9A 2PGEA 5G4WA 5FD0A 2BWGA 1WV2A 2UZ9A 5HULA 2ABBA 3AHZA 3LERA 4QG9A 3AXKA 1U2YA 1AQHA 1Y0EA 1YDOA 3AIVA 3PR2A 4KW2A 2F61A 2QQ6A 4J3SA 3VMOA 2PPGA 1BXBA 3OZYA 2PWVA 5HA7A 4HYWA 4O8AA 4R5EA 4GYJA 3BSMA 1ZJBA 2FJUB 3WLRA 1KM6A 1MQRA 3H2CA 1TMQA 2JKAA 3ZT5A 5HATA 2X30A 5D04C 1Q7QA 1UIPA 2Y5EA 3FK4A 1XS2A 3DOPA 3ZJKA 3LHVA 5EKYA 2INEA 4EIVA 5A6BD 3BQ5A 1DTNA 3ITTA 1BWVA 4G5DA 1TA3B 3N19B 3MANA 4GJIA 2IQTA 4O1BA 2DSWA 3RPTA 1E5NA 4QDMA 3S6TA 3VIHA 1M68A 2I16A 4X3ZA 1SO6A 1EJTC 4XAYA 4XVEA 1NDYA 2P5NA 2H8XA 4Q32A 3NO1A 4K3ZA 4IPJA 4FIRA 4XK2A 5LNUA 2QF8A 3HV8A 3G1AA 4HNTA 4UOQA 4GY7A 3BMVA 4WD0A 2RJGA 2X7WA 1F7BA 3OHMB 1JZ5A 4GZJA 1HVQA 2FYMA 3SCVA 1R2TA 5JVLA 3NQVA 2ISSA 3BUVA 3ATZA 4EX4A 1SW0A 2CESA 1UR4A 5CC3A 2QR6A 2PDUA 1UOKA 2BXZA 4QLKA 3PSWA 1KM4A 1E6SM 2W27A 2VEIA 6PTDA 2V5KA 2VO5A 2GDUA 4UTTA 3CTLA 4PTNA 1JVNA 4RV8A 5LKYA 3WNKA 3GW0A 1H11A 2F9RA 4Q4RA 4YVVA 1EYWA 6A3HA 3HPFA 2VVSA 4IMFA 3UWEA 5LZLA 2WJDA 3VGHA 3AOFA 1TZ9A 3RJYA 4CCDA 5LYRA 4M1BA 5I24A 1D2KA 3KL3A 3PY2A 1SR0A 4PCTA 4LWWA 4PTVA 1F3TA 1UKSA 5A2AA 3RPMA 2WVSA 1QOPA 3D3AA 4RNJA 1TUFA 4UTMA 4Y9AA 5D2WA 3KDNA 4DF2A 4AF0A 4DJFD 4YYFA 3GXDA 5IBXC 4K7VA 2W9MA 3S2LA 5DRIA 5JIPA 3I6EA 5CPTA 4XZHA 4JTHA 1M01A 4ZGYA 3GNXA 1W5PA 1A47A 3LLDA 3BSHA 4JHZA 1HN1A 1P0KA 2VEFA 4MLRA 2GYIA 2FVLA 1VEOA 4S38A 5AVNA 3OO2A 3T07A 3OW1A 2ZC8A 2PU0A 4JDYA 3VDCA 5EMMA 4CU7A 3WFLA 4LAOA 2F2HA 2HK0A 4RUBA 2ZZ7A 4OHQA 4RW5A 2WMIA 1XXXA 2FTPA 2WSQA 4PBGA 5FSEC 2PTXA 4P5UA 3AWOA 3IS4A 3W23A 1Z9AA 1JPDX 1GVIA 3QSTA 1ZAIA 1PYFA 4X22A 2CWXA 3W7IA 3CIVA 2OEMA 3WDJA 5MKGA 3NYDA 3BJSA 5E70A 1FRBA 1TWWA 4OWGA 3ITCA 1M9HA 2WNZA 2DFAA 4IH3A 1DJNA 3H23A 3WL1A 3EDKA 1UG6A 4O18A 1TV7A 4Q4SA 4L7ZA 2X05A 1KM2A 2WVVA 3AS2A 3CUGA 3MJMA 3N6QA 5LA1A 1VIZA 1XLDA 3DBNA 5F4WA 1CXEA 4JFUA 4KKXA 4PMZA 3RMJA 3LCXA 4B4FA 1EOKA 3S8HA 2HBXA 3QPYA 1VEPA 3VAVA 3PTMA 4LS0A 3Q94A 2P10A 3VNMA 3E74A 1A5OC 3QQWA 4RV3A 3W37A 3CHCA 3WELA 4FP1A 3L12A 4H9VA 1S2CA 3S5YA 4Q8WA 1OC5A 1LBFA 4ZQOA 3ZT7A 5C2XA 3E2VA 3R94A 4KETA 3FV9A 1Q63A 2AKMA 2ZFAA 2VGFA 4UR9A 3P67A 4C1NB 4GH3A 2PDHA 2DDXA 4EANA 3DFPA 4W8AA 5U7SA 4GXPA 1D7FA 1XR2A 4JIQA 4D8AA 4LFYA 2XH2A 3QVQA 3EOSA 3NL6A 4UQAA 4UNLA 3POHA 4H8VA 1HX0A 4RR4A 1NEYA 3WF1A 1XLHA 2WV8A 4DB7A 1VEMA 2YXOA 1ZB5A 1H7XA 2XFRA 4FF5A 5E9AA 2FZBA 1V02E 3T7VA 4DQWA 1KR0A 1OK6A 1JIBA 4AUBA 4XSMA 3GH4A 1IIHA 3MHGA 4EWND 2E25A 2GLKA 2J6VA 3AMLA 3VIOA 4GRSA 3TW9A 2G4FA 1L6WA 1TR9A 2QDGA 3CYVA 3B0PA 4WKHA 4Q7IA 1NU5A 5TIMA 4ZZ9A 1GKQA 1QWKA 3PJXA 1B3ZA 1ICQA 1QI4A 3LQGA 2JFEX 3T0AA 3CHVA 1BYCA 4ZSUA 1VFMA 2XFFA 2CU0A 3UA4A 4ZENA 2GVJA 3S1VA 1GWJA 1OFQA 1WKYA 3S46A 4RPPA 4AY1A 3L65A 4JY8A 1DJHA 1YPFA 1CGWA 2A7RA 4HMEA 4JX6A 1UH4A 3ZM8A 2V5DA 1PBGA 4XG1A 2G50A 2O9RA 2CBIA 3LHWA 2Q8XA 3G2GA 3LBCA 1SFJA 2C14A 2DZUA 4CU8A 4PUUA 4IMDA 1PDYA 2CYGA 4L1WA 4LCRA 1CLKA 3VE7A 2FIQA 4HNUA 4IP7A 4D8LA 4RDZA 4JTLA 3BC9A 4ICCX 1XFBA 4O15A 1ONWA 3WUEA 2XGIA 3GBDA 4S23A 3S2MA 2MUCA 3M6DA 4H7CA 1ADDA 5C9UA 2JE8A 2EHHA 1JD9A 4F48A 2BLEA 1FHLA 3VMNA 1Q6LA 5GQBA 2J27A 2Y5SA 3CHFA 2YKKA 3WQ8A 3PVFA 1G5AA 5CPSA 1HVXA 1Z8AA 2ZUNA 3U0HA 5CAHA 2GUBA 4WJXA 3GNPA 4NI3A 4XUYA 3UVIA 3ALFA 3U8GA 1H7RA 1TJ2A 3M43A 1ZLPA 4WF7A 2E28A 1UJPA 4ZOAA 4LBUA 1AH0A 2QJJA 4KEUA 4QG8A 4TTUA 2E68A 3ZLHA 3AYTA 1LRQA 5AHLA 1UR8A 4C7GA 3LPPA 4JTJA 3GX9A 1GOKA 1O5QA 3T6CA 4GABA 4M24A 2D24A 5H2ZA 2O9OA 3BTNA 4PL1A 3A64A 2P88A 4PTWA 4UR8A 4A6GA 3TA9A 3TOYA 2OSXA 4MWAC 2FTWA 3A24A 1A0EA 1OFPA 1MMFA 1OFDA 4X9SA 4JFTA 3QW3A 1YIXA 3TTOA 4IOTA 2Q3RA 2XSAA 4LX4A 3AICA 2AQWA 2GJLA 4CNSA 3LN3A 4Q6XA 5CPOA 3BOXA 1O5KA 1IEXA 3BAWA 3WENA 1XF0A 4PE8A 3U7VA 3VGEA 4S3GA 5LGXA 4UMCA 3H4XA 2VD9A 4C65A 1W17A 4GVHA 3RM9A 1VHNA 5T9CE 3L5AA 3HPAA 1W5MA 1BKHA 3RUBL 4HPHA 4ATWA 1FWRA 3Q58A 4V27A 4DJDA 1FA2A 4GNKB 1LRTA 5C0QA 5H8PA 4HVXA 5FJRA 4IGMA 3GH5A 2VFGA 4QQ3A 5GJPA 4XZLX 3TKFA 3TYUA 4HHMA 3ITVA 4UTLA 4AVNA 3CT7A 3RLVA 1OG0A 3GIQA 3VNDA 2QCDA 3F5LA 4W8LA 4N2YA 4FNQA 1V0LA 3DI0A 2ZZ1A 1TVNA 1EGZA 3V3WA 3WLLA 2E1WA 2OZTA 4M3PA 4LB4A 2PSNA 4LAZA 5IRPA 4PMOA 2F6KA 4LBRA 2CBUA 4LUJA 3CUFA 4C6LA 2CWNA 3IANA 1JRCA 1VCFA 3VKBA 1JG9A 3SZ8A 3VCCA 1ONXA 2P0IA 2WZEA 3BLFA 5M1TA 1ICPA 1A5NC 1TREA 2BGQA 1KKRA 3STFA 2Z00A 1WDDA 4H41A 1DP0A 2E1DA 4AVOA 1J2BA 5CQ1A 4JY9A 4JQAA 1PVNA 4FHAA 3S6OA 3PTDA 4ZTYA 1A80A 4AZ6A 1IV8A 3CZJA 1CT5A 4H8UA 3K4AA 3WIJA 4DIAA 1OF8A 4LU0A 1JPHA 1UZ1A 1HGWA 5CZSA 4AZGA 4GK8A 1ZJIA 4H6KA 3PZ9A 2A21A 1TQJA 1Q6RA 1RUSA 3ECQA 2OZ0A 3TVAA 2X0HA 3BG9A 1PO9A 3GM8A 1VFLA 4MLJA 2A5HA 3C61A 4LUTB 5F4XA 4HJFA 3APYA 3SN4A 4Q8MA 2Z24A 2ACQA 4WUIA 3RRXA 4I5XA 1JAKA 4H9UA 3LI0A 3LK6A 4NNCA 4XO6A 4CEUC 1TPUA 1TJPA 5D02A 2G41A 2HS6A 2UY5A 4S3BA 3GHUA 2BG5A 3QY8A 1XG3A 1MNSA 4ORIA 1TQXA 4PTXA 5CXPA 3NQ7A 5M3WA 3DFNA 8RUCA 1V4YA 3S83A 3GAYA 1HL2A 5A95A 1UUMA 5A2BA 4C6CA 3VK5A 4S3JA 4UWMA 4NZ4A 3FYPA 1SZEA 3E2RA 4WSJA 8XIMA 4XBSA 1DIDA 1JZ4A 1S3HA 1GUVA 3WF3A 3JZUA 1SQ7A 2PDMA 5CCZA 3IJIA 2D2GA 1UKQA 3KAOA 5HQMA 1CXKA 5JMUA 4TOQA 2A1YA 4Z0JA 1TRIA 3BARA 4FNSA 1MUCA 3FJLA 1H61A 1RCXB 2C1HA 5IFPA 4AWUA 3TYAA 1YBQA 1EB3A 3T81A 2BY3A 5DXXA 2CZFA 1XHGA 1FHUA 4XAPA 1LF1A 3ELFA 3GXMA 4PCFA 4A29A 1AH4A 2ZA2A 1U30A 2ZRXA 1XRVA 1OFAA 3C8NA 4REQB 3UG3A 1MW0A 1NELA 5LNSA 1E4NA 3KBSA 3CB3A 2NV2A 3TN4A 5AKQA 3EEGA 1NARA 3CQ0A 1W5OA 1B5TA 1HP5A 3WSUA 3NQGA 4O1CA 4DJFA 3IGUA 2X2YA 1IWBA 3MY9A 5A8QA 1GQJA 3THUA 3WJYA 4W87A 4QSHA 3AU2A 4UTUA 3UGRA 3H55A 3UWVA 4OUEA 1VBHA 1U33A 4PBEA 1Q6DA 1U1UA 2OCZA 3G0XA 4IGNA 3THCA 4MNKA 1HFBA 3GLCA 1LWHA 3BZGA 2VDIA 4AX7A 1B2YA 2BODX 4LYKA 4AHQA 2RUSA 1AL7A 5DCBA 1H4PA 1XCFA 2PWGA 1EQPA 4HCDA 3KX6A 1NY1A 3WNLA 3L2IA 2E6AA 4JTTA 3GNNA 4GH1A 1T41A 1ZJHA 4Y8FA 3GXTA 3KS5A 2DZTA 2XWDA 4B9YA 1L9WA 1V3HA 1D3CA 5LGZA 2WM0A 2CLPA 3CAVA 2OFJA 3FFSA 4QNEA 1R38A 1QW9A 4Q8UA 4XD4A 1K03A 3PNUA 5DEZA 4L4LA 4P7QA 3HOJA 3GFZA 3GS6A 5E93A 3USZA 5DANA 3NTYA 1Y5WA 3SCNA 3IGXA 4GXWA 4ATDA 3W26A 2XVGA 2V5CA 3EYPA 1IZJA 1KRMA 4GBDA 3WQ6A 2Z7KA 1EDGA 1F76A 3CWNA 1FCUA 1OFEA 3T09A 2DUAA 4LXFA 2NWRA 3ATYA 1DWAM 4JNYA 5AC7A 2JF7A 3WBEA 3QGVA 3NL3A 4CCCA 1W37A 1U5VA 2ZX9A 1IXNA 2PF0A 4E8GA 3BV4A 3MVTA 4PMNA 1B90A 1PE1A 2NUXA 1GGOA 1EJXC 1FFQA 4MGGA 4NJIA 3UY7A 1HKIA 3MYPA 1CXHA 1EBGA 3SUSA 3K13A 3VA8A 1GZGA 1UP2A 4KRZA 2XZ9A 4MY1A 3RU6A 2QUUA 4W7VA 3LRKA 4HBKA 4R53A 4EACA 4JTFA 2HXTA 4ZBCA 1WZLA 4AEOA 1TR1A 1JCTA 1OX4A 1Q6QA 1K6AA 2GGGA 1DV7A 2H90A 4GY1A 2VEPA 4QEHA 1RBOB 3HQ1A 2NVCA 1FWJC 5LHEA 1JCLA 4GZIA 4LALA 4EVZA 4H7VA 1AL8A 3PPCA 3C6CA 1MXDA 3MB9A 5CGMA 2E40A 3WDRA 3MWCA 3K4WA 4MYAA 3PB2A 3CLWA 2WHMA 4LVDA 3T05A 1OX6A 1BFNA 1X6LA 1BG9A 1MI3A 4K38A 2E77A 1J18A 2DEPA 4PMQA 4H00A 4O4VA 2HNEA 4INFA 4LYQA 4WOZA 4GI4A 3L4WA 1H60A 1NP2A 2OX4A 2DUZA 5DRCA 4MB4A 1GG0A 1HO1A 3WQEA 3WL0A 3KCJA 3GRIA 3ZVHA 2YCLA 2ZUSA 5CSUA 4Q8OA 3MMWA 2HCVA 3V7PA 1KFLA 1J01A 1PCWA 1PAMA 1KM1A 3HPZA 1F2JA 1UWRA 1M65A 5D09A 3TTEA 2VR4A 4P8WA 4U3AA 4JYEA 3RIKA 1G4SA 5HNNA 5IDZA 4Q7NA 4Y90A 4W88A 2JBMA 4O16A 3O8AA 2PWFA 2W6RA 1WNOA 2QCFA 2BMBA 3RN6A 1T0OA 4QISA 1IWPA 4GA8A 4BEQA 1OK4A 2E9LA 4PFHA 3MP5A 3IGHX 3CH9A 4R7OA 5B80A 1XLCA 4UQBA 6XIMA 5CAKA 1KLYA 1GPFA 3FXYA 4JEQA 3TNBA 4DF1A 1YXDA 4EE9A 3QY6A 4GI6A 2A7NA 5HUPA 3WQPA 4UB9A 1UASA 2WPBA 3VM5A 3CT2A 4K7YA 2ZXDA 4LF2A 4DBDA 3O63A 4BQ4A 2C79A 2DW6A 1CZ1A 3UVAA 2V2DA 4OJYA 1X1NA 2GGHA 4G7EA 3F2CA 2FGLA 3H7RA 3RNDA 2VFHA 3SCSA 3W6YA 3V4BA 2OGJA 3BLDA 4MUZA 1K02A 5E0CA 3CJPA 4QNWA 1X7FA 2NX1A 2J47A 1HIZA 1FWGC 3VNYA 4W5ZA 4J3UA 1V3JA 4TU1A 4WR3A 1E51A 3OEXA 1W9XA 4HMNA 2XWEA 3T0DA 2O55A 1QT1A 1NQKA 3PZQA 1QNQA 1ZALA 3ZR6A 3W7RA 4Z1CA 3TYCA 4PB4A 1P1XA 1MW3A 2C0AA 1DWFM 3A12A 1U5JA 4LB3A 4IWWA 2GGJA 4G1NA 2A3CA 3M0ZA 3I7QA 3HQOA 3VIJA 3IEBA 1DIKA 1MQPA 1E0XA 4XV0A 4W86A 1A4LA 3DC8A 1Q3NA 1MVYA 1OT2A 1AD4A 3A22A 3T2OA 4DHGA 3KCLA 3LYEA 2I14A 1UR3M 3CBWA 5EPDA 3WBXA 3FGCB 5DBTA 3KW3A 1H2JA 2FZNA 3TDFA 1O4UA 2OODA 5MKGB 4V28A 4F3HA 5C8BB 4NHVA 1GVRA 1OB0A 4WJ8A 1E0WA 1R85A 2Z1BA 4ZO8A 3S3GA 3GHTA 5HANA 3SQLA 1HNYA 2X41A 5AB3A 1XRFA 3QOKA 3SIMA 4GINA 3E0LA 4YS1A 1XRSA 3MUAA 5CSRA 1ODZA 3F2BA 1WKFA 3ZO9A 5CEWA 4A2SA 1OIMA 3E5PA 4J2MA 5DO8A 3LPOA 1UC5A 3BICA 3EXRA 4NASA 1LP6A 3CNYA 3NM3A 4BJHA 1C93A 4UFLA 3SGUA 3EKZA 5DX7A 4Y9PA 1L2UA 5D05A 4H2HA 2MANA 3F4VA 3FAWA 5HOSA 4WKFA 3D46A 4N9CA 4AF0B 1BVZA 3MO7A 4ACZB 4X2PA 4D6GA 4WIWA 2NT1A 3BW3A 2Y8KA 4E2DA 2TRSA 4YPJA 2PEVA 1UR9A 3GKAA 3C52A 3WJSA 5I03A 4K37A 2B31A 1RQHA 4NNAA 2OKOA 1GTHA 4ILSA 2XISA 3TYBA 2PDPA 3S9YA 5IXEA 1QDSA 1Q66A 4IPIA 4AZCB 4Q6JA 2ZX7A 4US6A 3CIXA 3LPGA 4MDOA 1E6PA 1QWGA 4LY4A 5LA2A 4OFCA 1KXTA 1ZAHA 3PWAA 2R6OA 2NQLA 4LV4A 2BXYA 4PUNA 1RP8A 3R6IA 5G4EA 4HPXA 4D1JA 4JIRA 2Y88A 1ITUA 3W2KA 1O5XA 4WVXA 3BGGA 1FDYA 4I9TA 3LV6A 2D2JA 1HJWA 1UIOA 4R85A 5CG7A 4DO5A 4YTSA 3TC3A 1CGTA 3PS7A 2XIBA 3GDRA 4ZE5A 4E6MA 4JHMA 1MRQA 1BTCA 4QSFA 3LGEA 4EF8A 2PBGA 4DJFC 4O19A 1TG7A 4UCFA 1LOLA 4KEVA 1KFEA 3ZOAA 3EPOA 1OGBA 3MV11 5A8OA 1VFTA 2XUCA 1KC7A 1XQKA 1RBLA 4QFUA 1M7XA 4OOZA 4EK7A 3RXZA 2B7NA 1MFVA 1ZCCA 2RJHA 5HPOA 2Y85A 3QN3A 2I5GA 2PRHA 1OY0A 1LT7A 1TV3A 1Z42A 2OEJA 4GQRA 2NT0A 3RO6A 3MWAA 2X09A 1P6BA 1QBBA 4QJ1A 3GTFA 4KWSA 3C0LA 1W9DM 3UBPC 3GZAA 1OF6A 3HJZA 1CPUA 4LUYA 4QITA 1A0CA 1K7EA 1J0IA 3QHNA 4Z2IA 3HM7A 4F8XA 2YDRA 5I23A 5FESA 3F4DA 3EPMA 3Q4DA 1G7VA 4HSNA 3RHGA 3AYVA 1FWHC 1QPQA 3NGJA 3NOYA 4GY0A 1SGJA 1A5AA 1E55A 2YCEA 4JHOA 2C15A 1I6NA 1UW9A 1EZ2A 1EL3A 1IT7A 3PFRA 1E9ZB 1TIWA 4H8HA 1UCWA 1ECEA 4YYCA 2YFOA 3WD2A 4MNJA 4BY3A 2Y7FA 1JZ7A 3W38A 5B7YA 2VZTA 1EDQA 3MCMA 2FKPA 1X39A 2ALDA 2DIEA 3SUTA 1RK6A 1UOZA 1PKYA 2EF9A 2ALRA 2O4QA 5FEZA 6XIAA 3B4YA 3B0VC 1W1TA 2EBNA 3F03K 1HGYA 1M5WA 1QRQA 3L2MA 3HU7A 1K8XA 1C9DA 5JH2A 4NYYA 1O1HA 2WNQA 3CEUA 4IX2A 3LZ5A 3A47A 4XAFA 2VD8A 5BU6A 2A2IA 3XINA 2CW6A 2GDQA 1TV2A 2WNWA 2HROA 1RJPA 2A85A 3FY1A 2EPOA 5I0DA 3VOJA 1ZL1A 1D9EA 1UD2A 1HF6A 3K8LA 4R9OA 4K36A 3AHVA 1QATA 3OHIA 1W5QA 4F0SA 3O0FA 3M46A 4OBRA 1XX1A 2PLJA 4NAEB 2FVKA 3UY8A 5FI8A 1E0TA 3BJFA 1NSJA 1MW1A 3WF4A 4PSRA 3IJ7A 1GVQA 2GQ3A 4XISA 2V3DA 1EF2A 3ICJA 3CZKA 4K8HA 3W00A 2R1MA 5A94A 3BH4A 3I68A 1VAHA 4N7QA 2HWGA 3CIWA 3W7GA 1JD7A 3ARQA 5FKYA 2HVNA 1R7OA 3U3HA 1XISA 1TA3A 2ZRWA 1GHRA 4UTWA 3A9BA 3VNZA 3LBMA 3GDKA 1CIUA 4UTFA 3THAA 2CEQA 1TPC1 4WDWA 3S0CA 3U2EA 2PC4A 4I5UA 5G2HA 1JQXA 3BQ6A 1JXJA 3GE7A 4H2CA 3G6MA 1YHTA 4IUOA 1O94A 2W4XA 4GVFA 2WZIA 2DT2A 4J3WA 3VZXA 4G9PA 4GBUA 5F7UA 2YR1A 4K6AA 2I5QA 4E2OA 4WY0A 5JU6A 2G0WA 3OA3A 3IUDA 3M0YA 4GUFA 1UUQA 1SPQA 1JCXA 3WMCA 3HPSA 1V0MA 4A8RA 4KWWA 4BHYA 3TQPA 2YB1A 1J5SA 4HHHA 4JX5A 5CPLA 1OGGA 4JZ5A 2Z1KA 2J4GA 4YLWA 4P7RA 3OVRA 1VBRA 5AYIA 4IP5A 1JAEA 3NUKA 1CI1A 3G3DA 3WQ4A 1DQUA 3EMQA 1F3WA 1LBLA 2GSHA 1XDJA 3W7CA 4B5WA 3BXWA 4DO6A 3QW4B 3E96A 1AJZA 2EQDA 3SAZA 4GUJA 3GUWA 5XIMA 3AIUA 3NG3A 1CENA 3WDQA 3GR4A 1ZJAA 4FEZA 1DJQA 2G3FA 3GDLA 3TYDA 2QUTA 3N18A 3BAXA 4RE0A 1X98A 2EO7A 1NIUA 2QUVA 1X96A 1XBYA 1XSJA 2D0GA 2ZTJA 3HB9A 3I6RA 3M5VA 3F2DA 1FH7A 1JEZA 2KX9A 4GQQA 2O4MA 2F7FA 5H1WA 1F5ZA 3TJXA 3Q65A 2CZ5A 5HPCA 1QI0A 4LW7A 1WPCA 1EKOA 4GX8A 3TSMA 2PRLA 5GPRA 4Q8TA 3ABOA 1P5BA 3EPNA 5JH1A 1UP0A 3MYOA 1EXPA 5XIAA 3FEMA 3TFCA 3KBMA 4BEUA 4R34A 4OUIA 2A6NA 3GHSA 3BAIA 1JCJA 2CZVA 4IXXA 2HVOA 3P6LA 3SEPA 2ZRZA 1FFRA 4KMQA 2AOSA 3H2MA 3PBGA 2V6AA 2V2HA 1E40A 2E7FA 2CLOA 4AH7A 2J78A 5BWAA 2PURA 2VEGA 4QIUA 1EEXA 5JBDA 2J8TA 3RDKA 3BAJA 4C6BA 1BVWA 5T91A 3Q37A 1TV4A 5DY3A 1PHWA 2WC7A 1KRBC 3MBFA 3RLUA 2CHOA 3U7BA 1J10A 1TZZA 2Y6ZA 1ZHAA 3B9OA 1J0JA 5D9NA 3WBYA 3N1AA 4EAMA 1FKXA 1F73A 1CXLA 3L0GA 5DF0A 3N17A 5KMYA 2OVLA 1E1CA 1T6MA 4W7WA 2CLHA 4HK5A 1JYWA 2R8WA 3QC3A 3A3WA 4GFIA 4JL2A 1QOXA 3RPDA 2HMCA 1RZMA 2ODOA 3LZ3A 3AMDA 2RKXA 1SUXA 3N6JA 1LJYA 1PZ3A 5EA9A 4RXGA 4O12A 5JBFA 3W76A 3UXIA 1FXQA 3TZFA 4AZCA 3GU2A 3W7OA 2F6XA 3CZEA 4GIRA 2BZNA 5K3VA 4O10A 3VO0A 2ZA3A 3W6LA 3M7SA 4O17A 3BL3A 5ABFA 3BMXA 1OCQA 1W1YA 4FMVA 3PB0A 1TJRA 1FWSA 2QDEA 3RO8A 2XGZA 4MPKA 4OE7A 1QO5A 5A8PA 4ROQA 3ZMRA 3MPGA 1NFGA 1MRAA 4AIEA 5JQ9A 2J7GA 2MNRA 3UJFA 1RR2A 4LEFA 2OLAA 3RLHA 3JS3A 5A8MA 4ZO6A 3B40A 4IFRA 4MZYA 3GDBA 2FB3A 3G6LA 3C56A 5GJNA 3AMCA 1LOQA 1Q45A 3DEQA 3XIMA 2PCQA 4PMRA 5A6BA 3I3EA 4J5NA 3MS8A 3YPIA 5BU9A 1W1A1 1XRTA 3EX2A 2OWXA 7TIMA 1HO4A 2DVXA 1KCLA 3HFTA 4P2VA 3W7MA 1XC6A 2DJLA 5A6MA 1JZ3A 3CMJA 1W1IE 1V79A 3E3HA 3IVSA 3EXSA 1NOUA 2OYLA 4NAFB 3TYEA 4X2RA 4J1OA 4RZ5A 1EX5A 3WLNA 1P4CA 4F9JA 4U10A 1OG6A 5AN7A 4OKDA 3AJ7A 1P48A 1XP3A 3GSMA 1TVLA 2GVYA 1S2VA 1WP6A 3KVLA 5BWFA 3NQDA 4MSSA 4YTRA 2Z1XA 4R3UA 3E5BA 5TBOA 3MHUA 1RQBA 3QM3A 3AXHA 4Z0SA 3LTPA 4I6KA 3GK0A 4N4QA 1MQQA 2VGIA 4PCSA 2Y8VA 2XVKA 4GZ7A 2OXNA 2L5HA 4HU3A 1L6YA 3TU9A 4U2YA 3HGRA 3LNMA 4KS0A 4PL2A 4ZL1A 2RH9A 3GFXA 4PZVA 3SIZA 5AC4A 2EKCA 5CBJA 3LLFA 1R9ZA 4MNMA 4F66A 3SJ3A 2PZNA 2P0OA 2VMFA 3F4WA 1W91A 4DO4A 2WSKA 2XIMA 3PC0A 3NSNA 2WK2A 1H7PA 3W7NA 1M03A 3GYCA 3VCRA 4O1DA 4WSHA 2RGLA 2PWHA 1RVKA 3PBMA 4ES4A 3AQUA 3QFEA 2Z2BA 1FKWA 4GC3A 3SRKA 3OVQA 4TX6A 4BR1A 3KBNA 3UA3A 2E6DA 4ECLA 4PA8A 4AWEA 1KGXA 1AODA 1C8QA 4YJ5A 1DQWA 2VEMA 3IARA 2P3EA 3MUIA 4LS1A 4CVUA 3AYRA 4S3KA 4GQGA 4JTEA 5DFAA 2OJPA 2FMNA 2BY2A 3B05A 3QR0A 1DYSA 1E72M 4JTKA 5DLCA 1XLLA 5DY2A 1IYXA 3U2ZA 3K4DA 1POKA 2Y8UA 4YTUA 3NVDA 5E9XA 2BBFA 1L6GA 1VS1A 3PZIA 4ATLA 1XBXA 4IHCA 4IQJA 1AJ2A 3GDMA 4RDVA 1BHGA 2Y7DA 3M0MA 2RFGA 3FA5A 3OG2A 2WLYA 2BSLA 1SZNA 5JUVA 4NVTA 2BHZA 3WO8A 3MUXA 5LA0A 3MVIA 4UQDA 1VJZA 1E3ZA 3BO9A 3OPSA 4ACYA 1OX5A 3WQ5A 4CU6A 1W0MA 1X8CA 3WH8A 1EIXA 3W1LA 1JDEA 4ERAA 4HQVA 3SR7A 1QOQA 4QJ4B 1X8FA 4U5KA 1TV8A 3W25A 1CEOA 2J9ZA 3WY1A 2EJAA 2FMOA 3KE0A 2XN1A 3QSRA 4DAFA 4O0QA 4ZEPA 3VDGA 3W01A 1XPGA 2XG9A 1W3KA 3APGA 4HZ8A 1KLZA 3RCYA 2E9BA 3WLTA 1PTAA 1W9PA 3U6WA 4IIBA 1MEHA 4UC5A 3G1HA 4Q22A 4P7LA 2XIOA 2ZRVA 3ABZA 1FWIC 4WGXA 3G1FA 1UA3A 2PGFA 1H1NA 1WUEA 2QAPA 3O0KA 1IXOA 1P0NA 3OBKA 1PDZA 1JPIA 4LVGA 4HIBA 2Y24A 1OIFA 4NKCA 2IKHA 3PZTA 3RF9A 3NSMA 3DI1A 4J7RA 3SGZA 1OM0A 3PNZA 2Z4GA 4D6FA 3A5VA 3CXOA 4C90A 4AMAA 4E8CA 3KHDA 4JKLA 4L61A 1ZCOA 1F9CA 5HJXA 3HZ3A 3KLKA 2NV1A 4OV9A 3ZJ8A 3BW4A 3WNNA 3IAQA 4GYKA 1Q6FA 1GQLA 1IEIA 4OQVA 3WLJA 2X1RA 1JCYA 1FHDA 3ITGA 3PAJA 3FW6A 1AH3A 2YZRA 1QPOA 1V6TA 3H54A 2VYOA 2CLMA 3P14A 2E5BA 1P0EA 2OB3A 1LWJA 2E4TA 2I1OA 4KWOA 1UD3A 3FN9A 4PYSA 3W72A 3UQNA 1VRDA 2Q02A 3CPGA 4F0MA 2GWGA 1XH2A 4JBRA 1GOXA 4NJGA 1EP2A 3BPWA 1Q8AA 4Q3MA 3CK5A 4GFSA 5FJOA 5C54A 2Y7EA 1D3GA 4FXSA 4Y2WA 4J3ZA 3IIZA 2PU1A 4CQ8A 2BVDA 2YA1A 3QJAA 2PWEA 2VRJA 4F2TA 4S2BA 3AS0A 1WDPA 5FAJA 1K3UA 1F74A 3CUJA 3E0VA 5KEZA 2CHNA 3LRMA 3TEVA 3I10A 4JR5A 4K68A 3OQ8A 3RX4A 1EJ7L 3W73A 1T96A 1EC8A 2VCBA 4DJEA 1XYZA 3ES8A 1KBIA 1KXHA 4LAUA 1M1BA 3VDAA 5HNUA 3HG4A 5EY5A 2J9YA 1Z7AA 3R7MA 4H9MA 4IF2A 2BNJA 3NQCA 3VIMA 3LMYA 3Q2DA 3EB3A 4OTKA 1R86A 2FGZA 3N04A 2QULA 2QUNA 3OGSA 3IK4A 3UG8A 2J66A 2ZUUA 1GZ1A 1XIMA 3O05A 5ABEA 2QCMA 3DYMA 4JYDA 3GC5A 3TTQA 2HXUA 3FVDA 3N9KA 3W1RA 2WANA 4NZ5A 3ZYZA 1SFLA 4I8DA 4G1KA 3VDHA 2J75A 3RK8A 5CLWA 4AZBA 2ZX6A 4FF7A 4NRSA 5C7HA 1RAKA 2BVWA 1BWLA 4L65A 1ZY9A 2E8ZA 3WLHA 3NO5A 4GO8A 2ASHA 3WQVA 2V5JA 3BLKA 4I7VA 3SCQA 1HG3A 3N73A 3KVJA 4CNPA 2XM2A 4DUWA 1JJKA 3FX4A 5E0FA 3NQFA 4JKKA 1YRRA 3VNKA 3W2LA 2OSWA 3VDBA 4PCNA 2ISVA 1QJWA 3IJ8A 3OVPA 2XGBA 3MDUA 3M0KA 5I6SA 1LUCA 3W27A 1GYMA 2G37A 3S1UA 1NWTA 4R33A 2GUUA 5FAGA 4M6PA 1PS9A 3C0QA 1TWSA 3KZSA 2VFIA 4UQ9A 5FJIA 4CN6A 4OGZA 9CGTA 4EXQA 2WQPA 2BGSA 3MKCA 2CBVA 4J40A 3LUTA 1GYNA 4C6OA 4C6MA 3NPVA 4Z2KA 1O66A 3WFAA 3RX3A 3SM0A 2WC4A 3PG8A 1M04A 1S2TA 4ENLA 1PWMA 4H04A 4KCTA 4L1GA 2QJIA 2X1SA 3A3HA 3HA1A 5C9XA 4QS6A 2BVTA 2VTFA 2EPLX 4GACA 3TN3A 1TJ1A 2FLIA 3N34A 3N25A 5IM51 1BYBA 3FA4A 1DQXA 3GQYA 2ZWYA 1C7TA 5EU9A 3W88A 2VJXA 1K9DA 1QASA 4S3AA 5A6AA 2CLLA 1R3SA 2VELA 2IS7A 3O6AA 4C7DA 4JAWA 1AJ0A 3FSTA 3OJGA 4F0LA 1AMYA 3LMZA 4KFOA 4QROA 1E4MM 3MV01 1SR9A 3ABSA 4M7TA 4KCUA 1MYRA 3UZXA 2H3BA 3INPA 3P84A 4KT2A 2J74A 1J79A 2R1PA 1RXOB 1IZKA 2SFPA 5CZ0A 2WSPA 1OFBA 1KBLA 4FR6A 5DBUA 5HNRA 4JTQA 3QR1A 1OZQA 3UCCA 4QCFA 1C91A 2X42A 4J27A 1OYAA 5CJNA 4MFDA 4CVWA 3QV9A 2AL2B 1BF2A 4QQUA 3PUDA 1M7OA 3R8GA 4D6DA 5H8MA 4S3CA 4LF1A 1CGXA 4NQ1A 3GNDA 1CECA 5HMDA 1TMHA 2QIIA 1FUYA 2Z26A 3FJ4A 3W2JA 1SZGA 4CQDA 2GZXA 1B3VA 4RE3A 2C6QA 3EEZA 4FB7A 3NQMA 4IIDA 1TX2A 3AWNA 2Y70A 3CM4A 1ZAJA 1BWKA 1DJIA 3CZLA 2JK2A 1QVBA 1EP3A 4IXHA 4XZIA 1QTWA 3E2QA 1SZFA 3QMTA 3FOKA 3ERPA 2VRQA 3QZ6A 2G3IA 2REQB 4CQAA 2QDDA 2HVMA 1UD4A 4LS2A 1B3WA 3GG1A 2X0SA 1MSSA 5EMKA 3BDKA 3WUGA 4AZ7A 4J4KA 2ZX8A 3QLLA 2OGYA 1DWIM 1OCBA 5AECA 3DENA 6TAAA 2BOFX 4DBWA 3EDDA 2DY3A 5AYXA 4QS5A 3SRDA 4Q4QA 1GTEA 2QCDB 3A23A 3ARTA 1V0KA 2WYSA 2BX7A 1EJUC 4E8DA 3TQVA 3GVQA 3V35A 1GT8A 4NJHA 3QTGA 4LRSA 1V02A 1RBAA 3W84A 2WCSA 3IV8A 2NQJA 4HA1A 4LGXA 2UY4A 1XLFA 3QLDA 2YIHA 1A5SA 4X9YA 4XX6A 3VOFA 4WXYA 1SZRA 1S1PA 3ZVHB 3NXLA 4YU1A 2D73A 1KGUA 7TAAA 5JXQA 3MHFA 1Q13A 1AG1O 1Z69A 2YDSA 3CAQA 3QXBA 3ZJ7A 1KGWA 1K70A 3KBWA 4JOMA 3OZMA 2ZVRA 3EWUA 5CPQA 4RPQA 3LTSA 3WX7A 4W9TA 3WQCA 2VC7A 1JF6A 3TW6A 3QC0A 1MZRA 4RNHA 2EPHA 3SQSA 4Z1DA 1J93A 1KWKA 4L56A 1WQ5A 4CLMA 4C6FA 4DYKA 3ARYA 3SFWA 4MWAA 1J0ZA 4JTCA 4Y9NA 1BRLA 2W66A 3NQ8A 2DP3A 3V36A 3K1DA 4YCOA 2HPIA 1AUSL 1GVYA 2Z25A 4Z1BA 3NQBA 5D38A 1E15A 2QXWA 1AZ1A 1YXYA 3CLMA 1S2WA 3MKVA 2Q8LA 3QKZA 2O9TA 4XKMA 2XZ7A 4GIAA 3RLGA 4LAKA 4LNCA 3TCSA 3BW2A 1S2UA 1YDYA 4EF9A 4WCJA 4I9AA 2WVTA 2XH7A 3LCWA 3E6EA 4HU8A 1JPMA 3QKEA 4GHRA 4S1FA 1LOSA 4MIMA 2FPTA 3UU0A 4PC8A 3VKCA 2P3ZA 1C8XA 1G01A 3A4AA 5CJMA 4H83A 1V7AA 2BB0A 1XSKA 4DF0A 2GGIA 4JYFA 2CLKA 3NQEA 1A53A 1EPXA 2FQIA 4GG9A 2NVAA 3LNPA 1W3HA 3WD0A 3S1XA 3VIGA 5TD4A 2GQ8A 4UBPC 4DWSA 3GDTA 3NM1A 1K4GA 2Y2WA 3TJLA 4F0KA 3NDZA 4HU4A 1KFWA 2D22A 1H0IA 4BS0A 7ENLA 2QEZA 3JUGA 4GNVA 4NJKA 3RYSA 2ZUMA 3UNDA 5CLTA 1YMYA 3FA3A 3MA8A 4BI5A 3R0KA 2DH2A 4J9JA 3OZPA 3SY5A 2CFFA 1DE5A 8XIAA 4MADA 3W2NA 1RA5A 2XIJA 3GTNA 5FA5A 4UFJA 3UXKA 5D9OA 1X7IA 4AWTA 4ROPA 4TMCA 7PTDA 3RR1A 1Y7VA 4EP8C 1XGEA 4Q4MA 5I06A 4PEEA 5FJTA 3L0NA 2WMGA 3SW6A 4D6IA 2GUYA 5FOOA 3AZRA 3DDMA 2AMGA 1B57A 3GG0A 4JNZA 4YWSA 4O53A 4MJ2A 1QNSA 4LC8A 4EPBC 1E71M 1DWGM 4DXKA 2QJHA 3MSYA 2WKJA 4IP4A 1HW6A 5BRBA 4HOZA 3KS6A 3PTKA 2PGRA 2E8YA 1EHNA 5G1TA 1Y65A 1JXKA 3QPZA 1FBAA 3W74A 2CLFA 4DZAA 5D32A 1NDVA 4RCXA 4L4OA 1LL7A 4C60A 5I00A 3UERA 3N2OA 3QF0A 2IPFA 2OX1A 3GXNA 2Z29A 2X7VA 2EPMX 3K46A 4GMEA 1R0MA 4RNFA 1M7JA 2OQLA 3UYCA 4QBXA 4C1NA 3GXPA 1LDCA 1F6PA 1YKWA 3M5YA 2GPTA 2V30A 4RE2A 5LNRA 1YDVA 1DJYA 4HPGA 1GEHA 4O8RA 1Q8JA 3GU9A 4ZXLA 1KFCA 4Z17A 5ABGA 4E2VA 3J7HA 4F79A 4P7OA 4H6QA 3UXAA 2FHBA 3QGAC 5H8UA 4Q8QA 1S39A 3P60A 1E0VA 2QPSA 3SURA 4HCHA 2AL1A 3SCOA 3EX6A 5M03A 1ML1A 5HBFA 3UZZA 1OABA 2ZDSA 2JKPA 4PRRA 3NZRA 2BXVA 2ANUA 1XBVA 3DGRA 5D30A 3TOPA 2Q6ZA 4MB3A 3GXFA 2ZA1A 1A5LC 2ZXAA 4RNIA 8CGTA 3SN1A 3DFQA 3EKLA 1Q6OA 1TPVA 3EX3A 4C6IA 1DXFA 1XC4A 5D2XA 2YW4A 3EAUA 2PC8A 4OU1A 4C6EA 3C4UA 4PB3A 3ZXWA 3V5OA 3E1F1 1HT6A 2JQXA 4FNPA 3K5XA 3FDGA 1UWUA 2TMDA 3WK1A 3F4NA 1OHLA 3W1PA 4GJJA 3M5XA 1MO0A 4PUWA 2KAUC 4TO8A 3CO4A 3WQGA 1B4KA 4C6QA 1L0PA 2XPKA 3PBYA 1UH2A 4AISA 1UKPA 5AYZA 1X1OA 4HN4A 3R43A 3UW6A 3LDVA 3TIMA 3V0SA 4OVXA 4NP7A 3WJWA 4CN4A 3TLQA 2VUYA 3MP3A 5CKSA 1C8VA 4E4FA 4DBSA 3L4UA 3S5OA 2XVPA 1U5HA 1N8FA 3DBPA 1VR6A 2XSXA 2OEKA 3QZEA 3KUMA 4XAGA 1S38A 3ANYA 1IR2A 3EDFA 2W92A 1DE6A 2W79A 1TRDA 4EXAA 2BTMA 4UTJA 2PDIA 1FWDC 1EUNA 1RJQA 4FX8A 3AIWA 3PANA 4TXEA 1CGYA 3IJ9A 2VGBA 4NYUA 4N6FA 1US0A 3VNJA 4OBTA 4G8TA 4YHGA 1MDRA 4PODA 3S6DA 1NDWA 2YCKX 2VOMA 3QH2A 4PMJA 3FYOA 1E6ZA 3M6YA 1P6WA 2PWUA 1QFEA 4RX0A 3H2NA 4XBJA 2B0MA 1XM3A 4XD3A 1YTEA 1UJQA 4H6EA 1TPDA 2WC3A 4GKLA 4NXKA 4JN7A 5B7ZA 1E4LA 1QNPA 4NAEA 3QY7A 4O28A 3BOFA 1UKTA 2WWCA 4TQTA 5TAOA 3KOYA 4PSPA 4DEFA 1KCXA 1SM9A 3S9IA 1ISWA 1R7AA 4YNGA 1QPNA 2ISFA 4IJRA 1BPLB 3KRBA 5FACA 2IPGA 2XTKA 5FL1A 2IPWA 2O7QA 4NZ1A 3PSVA 4UFIA 4AYSA 2B7OA 2RGMA 5T9BG 3HMJG 4RZ4A 1ZU8A 4E4PA 4QCEA 2PP1A 4I9JA 2BVYA 4O11A 3AIRA 4Z2JA 3L68A 3W0KA 2J8FA 3A3XA 3GW3A 1CB7B 1G4TA 2WPGA 3MP4A 2JF6A 3VFCA 3UR8A 2XIQA 2B4GA 1WE5A 1S5VA 1ISXA 1VJSA 1YNQA 4H8NA 2DSKA 3BZJA 3CUZA 3LHUA 3L66A 5HUOA 3CPUA 3QBUA 1B1YA 2O0TA 3LS9A 1KBKA 5D9MA 3TQ0A 1V3MA 4I90A 4EPDC 2VDHA 4LV9A 3LRLA 3EOOA 3WFZA 2PBOA 3ABQA 2ACSA 1GQIA 2DUXA 3PPGA 1CCWB 4H9ZA 3QMSA 2QPUA 5I7GA 1KV5A 1A4MA 1V8EA 3C2VA 1GVSA 4U5IA 2WHLA 4M6UA 1EEPA 3E0FA 3VD4A 4MB5A 1XD1A 1GCYA 4ZA0A 1KFJA 1XLBA 1J6PA 3NZGA 3NGFA 1RK5A 1YPIA 4H01A 3BWWA 4KGLA 3V16A 3DFTA 3CAWA 2CLEA 1QW7A 3TUUA 3CQJA 2DZBA 3VNLA 3NXFA 1C92A 3KL5A 1X38A 4N02A 1OYCA 2QUMA 1AQFA 2J6XA 2Y62A 4KRTA 8A3HA 1GW9A 2JKEA 3R13A 3CMGA 3QMRA 4K1WA 3W1UA 1XCWA 4O13A 4W85A 4DN1A 4EAYA 5E6ZA 4JTAA 4CNTA 3N29A 3EKGA 1EX1A 1IEQA 4QP0A 3DERA 3BV7A 2VFDA 3CZ8A 3PULA 4IQEA 5HQEA 2ON3A 5M5DA 3CC1A 3C2OA 3CEPA 1F4AA 3ARXA 4OECA 4B5NA 3HO8A 1TPEA 1UR2A 1JDDA 1QUMA 4WEVX 1L8NA 1BYAA 2Q8ZA 1MXSA 2ZOXA 1PTDA 4HZ7A 1UKOA 4GO9A 3GHRA 2PDCA 3PJUA 2I57A 2CXEA 1XIBA 4FOJA 4LCSA 1KTBA 4FXJA 4G7EB 4F0HA 4HNOA 4UIOA 2FPVA 1E9YB 2C3ZA 4Q8PA 4EXBA 3THQA 1DWJM 3G0SA 5D33A 5KSWA 1K6WA 5DXYA 1YDNA 4PMUA 3PFMA 4DO7A 2GJRA 1VH7A 1W3IA 3M0IA 3VD3A 4IUGA 3AIQA 1TO3A 3L67A 4XZWA 3RM8A 3REQB 3B8IA 1L6SA 2FJKA 3CUHA 3N4EA 3RJXA 4I8YA 4XQ6A 5EBUA 3LCIA 3SFKA 1EQCA 1D3HA 2OT0A 2XIIA 3VD7A 3UEQA 4UNIA 1XYLA 4YN5A 4IM4A 3B8UA 1HKWA 2ISWA 1RCOB 1NAL1 3ZT6A 4ZCWA 3SN0A 1LZOA 4BA0A 4H7ZA 1W32A 3QV6A 5DT7A 3MC5A 4ZR8A 3CMFA 1N55A 4DXXA 4C91A 2HQAA 5CZJA 2IUZA 2J7DA 4QEEA 3TA6A 3L21A 3UZJA 1PV8A 3JZEA 1XYMA 1Z48A 3NL5A 3VM7A 3WBAA 1SYTA 3EXTA 3NQAA 3AROA 2X8RA 1FWCC 1H63A 2ZVIA 1GHSA 3FYYA 3WQFA 4TVCA 5HMFA 4FXRA 5AY7A 4ADSA 1JFXA 2GJXA 3W2MA 3ZLGA 4GISA 4IFKA 4GXMA 2R82A 3MSGA 2YCIX 3WMLA 2QCNA 3UWYA 3AMGA 3C0JA 4REQA 3UJEA 3IWPA 2PI6A 3MBDA 4BKNA 5FF0A 5I77A 5ECUA 5DT5A 4W4QA 1I0BA 3FKKA 4UTHA 2JGYA 3KWXA 1NDZA 2ZZ2A 3H8AA 5G5IA 3U48A 4D71A 4LBSA 4A4AA 2YPIA 1PUDA 2DW7A 1O60A 3N2BA 1JI2A 3WQOA 1DIOA 2NLIA 2HK1A 5KZDA 2QJGA 2JIWA 3WLQA 1EIBA 2NQ9A 4ZB2A 3D3FA 1RPKA 1H7NA 4B91A 2O9PA 4MF4A 4UOZA 3T42A 4AD5A 3RGTA 3UXLA 3R4IA 3KVMA 4MWAE 4ICMA 5I07A 2NX3A 5HNTA 4ADTA 1G67A 5JIWA 4MUPA 5ECVA 1XW8A 2BV9A 3W7HA 3WMSA 1JI1A 1VZWA 4GYPA 1UUOA 3H21A 3M4HA 1P0DA 1WDWA 3BLOA 4NSBA 2QW5A 4ZQCA 2ATMA 2HJPA 4X63A 3O2LA 1V93A 1I4NA 2G8ZA 1XLJA 5DCDA 1N8IA 1IEVA 1QPKA 1XQLA 1QK2A 1HKKA 5BCAA 5IHRA 4V2XA 4MB1A 5I5RA 3TWAA 4XVDA 3URNA 4KPLA 3QHOA 3WJZA 2W3ZA 1FWNA 1DJGA 4QJ5B 4H4IA 4AC1X 5H91A 3UNTA 3W4RA 2BHYA 2PWDA 2V9DA 3LSBA 3VC5A 2FZ8A 2VCAA 2BY1A 4LSBA 1T99A 3EDEA 5AHEA 3VVGA 2VL4A 5MHBA 4NF7A 1UPMB 3NVTA 2PP3A 3SY8A 1DKWA 1JF5A 1UZDA 2Y63A 2R24A 1HTIA 3THDA 3SSZA 1DJZA 5BXTA 1XIJA 4A8LA 3UG4A 2WNNA 3H2AA 5KZ6A 2NXIA 3ARRA 1XGDA 3QV7A 1MW2A 1THFD 1JUBA 1O6IA 1VGAA 1PX8A 3ZJ6A 3W29A 1Q4WA 3W1TA 1W3NA 2PD5A 3IJ6A 3IJLA 4FNRA 4PUJA 3B8WA 3G3MA 4PGLA 5DMNA 4WHBA 2A3AA 1GOMA 2OLSA 3OTRA 1GPWA 2QPXA 3MI6A 3W2UA 1ME7A 2E9MA 2WJFA 3KEHA 3UZWA 3N13A 1BG4A 3MDWA 3ARPA 9XIAA 1X1ZA 4TVUA 3TSBA 3I4KA 3QPEA 4L6DA 1FCVA 4N9BA 4GOAA 1OJXA 3OG3A 4IPNB 3AXXA 1WDRA 2F8QA 4FPSA 5C70A 1CB2A 3A6OA 4HHPA 1VENA 1EGVA 2YL8A 3BCJA 1R2RA 3IIOA 3U5YA 1BXNA 2F6UA 3N12A 1QBAA 3VIKA 1IWAA 3UCQA 4JTDA 2VHLA 4DUOA 5EFFA 3H7VA 4A3YA 4JTRA 2DORA 2E0PA 3AC0A 2FHFA 3N6HA 1ZBVA 1XIHA 1Q2SA 3OU8A 2QIWA 4PUEA 5SWUA 3IUIA 3ZFHA 1GKPA 3O6YX 3SUVA 4ZQRA 6REQB 1XIIA 4PN2A 5KZMA 4MWAB 4O4WA 1TYGA 4U4MA 2VFFA 2YYUA 3QFWA 2E09A 3PWGA 3QYSA 1YW1A 4JDBA 3KOFA 2R94A 3HMCA 3VKJA 1W5NA 3SDOA 4CD4A 3EMCA 3TC7A 5LIUX 1EBHA 1JULA 1VLWA 2OPJA 4LOCA 4A3QA 3KP0A 1LT8A 5TQLA 4TIMA 5REQB 3VX0A 4RDYA 2V82A 1A5CA 3S47A 1NOFA 4DZHA 1TE6A 2VQTA 3AO0A 4DM1A 4QDPA 4FR1A 2IQDA 4AU0A 2D2OA 2W61A 5I79A 3OQEA 1XKYA 4HN8A 1VQTA 5G4HC 4GGBA 4AWSA 2QZRA 3LQLA 4LRTA 1TPFA 3KVKA 1ALDA 3T4WA 1TMLA 1B3OA 4CEXC 2OOGA 3R5EA 2EG8A 3EA1A 3EWYA 2E6FA 4UFKA 4D72A 1V7YA 2C1GA 3W24A 5CGTA 2QCCA 4FOKA 3SSJA 2VVNA 4DJDC 1Q7ZA 2Z1VA 3E12A 1YE4A 3P3BA 2GSEA 4WK9A 4DNMA 3GNRA 3II1A 1IXPA 1OWQA 2XH0A 4UMAA 2F2KA 3WD3A 4J35A 1JDAA 3ANVA 4YVXA 3FGCA 1N2VA 3ITYA 4WY0B 1TVPA 5FJUA 2H3DA 3I3DA 4KF1A 2V2CA 2UWFA 3WMBA 4F9DA 3E9AA 2FZMA 4ERIA 1TPH1 1PL9A 4N4PA 4CGTA 3LCLA 2C18A 3V75A 4AY7A 4KRUA 4ZO9A 2G3NA 3CWOX 4NZFA 2I9EA 5IOBA 3NEVA 3VOIA 3BSGA 3VD9A 4ALDA 3LEPA 1V3KA 3WK3A 4GLEA 4W84A 2ZUTA 4AXKA 3GG8A 4D8ZA 2CKRA 2O92A 3HV9A 3SQMA 3UPWA 1OT1A 4N9DA 1R30A 3NZQA 4XKYB 4MKVA 3T40A 4FNUA 3MUCA 4G7FA 4BI6A 3FSUA 4A21A 1V6WA 3F4CA 4M6QA 1VIWA 2CXGA 1W3TA 3TXZA 2R1KA 1GOWA 4TX8A 1X6NA 3RITA 4PRWA 2VWSA 3EB4A 5I3GA 4IG2A 2DJXA 3W02A 4MVAA 2INZA 2R1LA 3VGBA 3NFUA 1OCJA 4FAMA 1IHIA 1I1XA 1PX4A 1S5NA 3UETA 3DHUA 7REQB 3OIXA 1JYNA 4H9YA 4PB5A 1KWGA 1RLCL 4MKNA 1BF6A 1G9HA 2PP0A 3MCOA 3AAMA 4WKAA 5HDRA 3G1VA 1DJXA 4L9XA 4FXFA 4JFSA 4JEJA 3W53A 4NNBA 1MEWA 4XTDA 4JFWA 1WZAA 4J3XA 3S9ZA 1K8ZA 2Z6IA 1IZCA 5HXMA 1PJ9A 3W70A 4L6OA 1F3EA 5HWMA 4KEMA 4U33A 3NOEA 1RSCA 3H4WA 3MI2A 2BS9A 4M80A 4DZ5A 4B5UA 4ZB5A 4QJ3B 5HR7A 3TONA 2PGWA 3N11A 1GOIA 3NO3A 3M5ZA 3L2LA 1YBQB 3M0VA 4Y9MA 5HWJA 1PIIA 3C86A 3IK2A 3ZWSA 1T8QA 5A6TC 2PF8A 3DFYA 3BE7A 1W8GA 1CX9A 1WCGA 2IKJA 4O1AA 2QCGA 2BOEX 4WOQA 4MDPA 3LOTA 7ODCA 2CNCA 4NX0A 5I09A 2YL6A 2E5DA 4PULA 3B9NA 4S3FA 1TJ0A 3BLPX 2QGHA 3V5FA 1S46A 4NZJA 1O1ZA 2WSYA 2BASA 4CCZA 3NYZA 4P8XA 2EG6A 3DESA 2OO0A 3UD6A 2FHCA 3AS3A 5D9PA 4UFMA 3QR3A 5BMXA 2GJPA 2NLYA 4WXZA 1QXLA 2E6YA 2FZDA 3VIIA 2PE4A 2QGYA 1SJDA 2NQHA 1VF8A 2PTWA 1KXVA 3E0WA 5M2FX 1AA1B 1EH9A 3L4VA 2NW0A 4WLCA 1JCMP 4E3VA 2OELA 5J5DA 4A3HA 5I78A 3B3DA 4H1ZA 3TR2A 2VNCA 4J28A 1RA0A 1W1VA 4AY8A 2GL5A 2J88A 4JIHA 4DLFA 5E5CA 1REQB 1TFVA 3KRSA 1VYPX 1QO2A 4F4RA 2POTA 1WAWA 2Z2UA 1ZP3A 4HNLA 3PJTA 5EBAA 1ESWA 3OODA 3ES7A 1VFOA 3UT0A 1I0DA 1JRBA 3HGSA 5C9ZA 4GD0A 2WZTA 1GZJA 3SECA 1I2PA 1BTMA 1KV8A 1UR1A 3FCPA 2XN0A 2VC5A 3MUY1 2OR2A 3M64A 2AAMA 2JIEA 4P8UA 1EJRC 2CZDA 3OBEA 3LB0A 4ZOEA 4RXFA 2VDGA 3R10A 5T8GA 1J12A 5BRQA 1ME8A 3A21A 3DECA 1WOBA 2VXNA 1HZYA 1Y5XA 1LRNA 3W87A 4NJJA 2V3GA 3CL8A 4KWVA 1J9YA 2VZSA 5DMMA 4CNNA 1J2WA 5ABTA 5FSDC 4DI8A 3NL2A 3O3RA 1M3UA 4DLMA 1SW7A 2NXHA 3G8RA 1WBHA 3B8VA 4QX4A 2OMAA 2V81A 1O5RA 3ZIZA 4OZOA 3UR2A 2WBKA 3PBUA 3QYQA 5HR6A 1T5AA 4B5SA 5IDIA 1CLXA 1S5TA 1KTCA 3UZ5A 5LHFA 1JZ8A 4L80A 3PZVA 3TK7A 3HGOA 1V3LA 1T7LA 1ISYA 3MKKA 2J79A 3MI3A 1ECQA 3WBWA 1F8MA 3AHYA 1MWOA 3DUGA 2X1IA 1WA3A 3MMUA 1J0KA 1R2SA 4BF9A 1UMYA 1JYVA 2IXVA 2B7QA 4OT7A 3N3MA 3OVGA 2A3EA 3H6OA 3L4YA 2Z7GA 3VINA 5CSSA 3IRDA 3IACA 1BYDA 1K4HA 1XUZA 1DXEA 4LUIA 4JGDA 4R7JA 4CD8A 1BQGA 1SSDA 1EZWA 5D37A 2Q09A 4JIEA 1FH8A 3HG5A 1EFZA 3CB8A 3WNMA 5GJMA 4Y9OA 1GJPA 3GIYA 3T08A 5AC6A 2PS2A 2WZMA 4JXCA 2DZAA 1V08A 2Q01A 4J3VA 1XLMA 1O95A 4GE8A 1NFBA 3WLKX 2OOFA 4O50A 1NWSA 3BCFA 3ARUA 1UWSA 3ME3A 1BGGA 1LG1A 5I3DA 1NM9A 4US5D 1DWHM 4EPKA 2WMFA 3FDKA 3NWRA 5ENLA 5BRPA 1SMAA 3W82A 1S5WA 3SBFA 4YMZA 3GWQA 1XYCA 2YLLA 1MEIA 2YCJA 1C3FA 2XJ7A 4HTYA 5FIPA 1P0BA 1G69A 3O9NA 2G3JA 1W3JA 1M6JA 1TKKA 4QR6A 2Z6JA 4A05A 5CH9A 3CV1A 1BEUA 4ZQNA 1OADA 3POCA 2J24A 4A2RA 2FDMA 4XIAA 1ZRQA 1E6NA 2FGBA 5LIWX 2C91A 1PTGA 3EWDA 4IGHA 1V5XA 2DT3A 5D2TA 4DWSB 2OT1A 3QZAA 5EFDA 4IIEA 1Z44A 3G1XA 4RDWA 1R47A 1E3XA 3G5EA 2V5BA 2J7FA 4O1EA 4W93A 2H9AB 4DZIA 1WDSA 2F38A 3UR7A 3V1PA 3KXQA 3PM6A 3B97A 1MNZA 3WH7A 2WSRA 3G1DA 3L5MA 5I3KA 3S42A 3WCZA 3AZTA 2ISDA 3NAVA 1E1EA 2AMXA 1A5MC 3W1QA 3ITXA 3CYJA 1RV8A 1UZ4A 3N2XA 3GXIA 1E0UA 4NZCA 1AD1A 1PKNA 3NPWA 4IMAA 2FB2A 6ALDA 4HK6A 2P8BA 3WNOA 4M0XA 1XBZA 2YA2A 3RMEA 1LM1A 4HYRA 4GJ1A 4YIWA 2BDQA 2DIKA 4ZFMA 2ICSA 1V77A 3A13A 4HNCA 3DFHA 3N15A 2QDHA 4BFAA 2PD9A 3IAPA 2GVEA 4QAWA 1H1ZA 4JCLA 3UFYA 3CGTA 5C9WA 4HU0A 3M0JA 3EOEA 2QV4A 1HQTA 3NURA 4WDTA 4YL2A 1NWRA 3CASA 5CBBA 1NTHA 3UPMA 1JFHA 1WX0A 3SADA 3DYPA 3JRKA 1Q2RA 3TFXA 2DU2A 2I5IA 2X1TA 4A3UA 2G3MA 4WQ6A 1FVPA 1XWYA 2HEJA 2I9UA 3E02A 3I7SA 3P5YA 3WLPA 2DH3A 3LHZA 3STPA 3TXVA 3PPFA 3HTWA 1LL6A 2YYTA 2XN2A 3EA2A 4ML4A 4R7WA 3SGGA 3IJQA 1WAUA 4AD2A 3TH6A 2Z1WA 2D1ZA 3ENLA 2OWWA 3MCNA 3RAOA 1JYXA 2DVUA 4LUTA 2AGTA 1F05A 2GJNA 4MJ4A 1AQMA 4XD5A 4AD3A 4L1XA 1W9UA 3UCDA 3IIPA 1RPXA 1VFSA 1C90A 3CH0A 3EA3A 3RILA 1XUUA 3PAOA 5C7VA 1JQVA 4DJEC 1JGIA 2OQYA 4NUWA 1M53A 2CITA 3JR2A 5FL0A 2ZBTA 1H1YA 4K1GA 4ZO7A 3GO2A 1CDGA 1W1B1 3WNPA 2J77A 4IISA 1L2QA 4DXVA 2ZZ5A 3M1ZA 4G6CA 1VPYA 3W71A 2FPYA 4XUGA 4KCWA 1Q6EA 3L7RA 3BANA 1OFOA 3WQDA 2FZ9A 2YLAA 4GC4A 1ZSXA 4DYJA 4BQ3A 2E67A 3A4XA 1TZ7A 1B4EA 4XZMX 2P50A 2X0YA 1QI3A 4YVPA 3C3NA 2WB5A 4TV5A 2B81A 1I8JA 2VC6A 2EKGA 2WJEA 2WBGA 2OLHA 3TLLA 5I3IA 1PYMA 4FZIA 1QNRA 3GTXA 4DJDD 3MMDA 3QOMA 1VYSX 1IIGA 5CZTA 2G5WA 3UWWA 5I3HA 1C8YA 3URBA 1R3WA 1N82A 5A1AA 1OCNA 2YJQA 2HNHA 2AQVA 3AJXA 1YNYA 1R8LA 2DZXA 4MTVA 3M47A 4FLOA 3N2CA 3WD1A 4AFYA 4MG4A 1NWUA 1SVDA 2PFHA 5HQLA 2PDBA 4FA3A 3TTYA 5LSMA 1SO5A 3LLXA 3KFTA 3M0LA 7CGTA 3MMTA 4G56A 4CD6A 3W07A 5CG0A 4KFPA 4E4UA 3IV3A 2OO6A 2V8ZA 3LCFA 4KCVA 1EYEA 3ONBA 2AL2A 3G1YA 3K1GA 3EZ4A 2GK1B 4UQEA 2QHAA 1F61A 3NR0A 4UMBA 3URQA 3O07A 2X1UA 2WCAA 2CCRA 2DVTA 2WO5A 1JDCA 4JQ2A 5ABFB 4IGSA 2WHKA 1OEPA 1FP8A 4URIA 2WM1A 2CBJA 4AC7C 4NU7A 1RCQA 1MUWA 2P53A 1FWAC 5KITA 2DPEA 2OZ3A 3S5NA 1PCKA 3EWCA 3W9ZA 1ME9A 2XVNA 3KOXA 4GX9A 1OSEA 4C6JA 3F7JA 2DZWA 3GNOA 3PZNA 3I4EA 5F4SA 3STCA 2ESCA 1XFCA 4W89A 4UR7A 1JZ2A 3MU7A 1L6FA 1G6CA 2J13A 4O1FA 3N4AA 4LC6A 3TMLA 1X97A 4PCPA 1EC9A 2XH4A 4UUIA 2PA6A 2YZ5A 4NI8A 2QNEA 4AD1A 2WVUA 1B3YA 2CHRA 4FK9A 1R9YA 1W1ZA 3OGVA 4YWIA 1ONEA 2DQXA 3R0UA 4U3CA 3W86A 3LX9A 5FF3A 2J7CA 2DGAA 1KM5A 4MYXA 3AHXA 4M51A 2GQ9A 3C0SA 1C9WA 3W7PA 4DELA 2FTYA 1K9TA 1RP9A 2DT1A 2IQ0A 5AFDA 2BP1A 3TQKA 5F2GA 1FXPA 2UY2A 1VFFA 3CQIA 1TWIA 3OGRA 7A3HA 1WZMA 1OX4B 4AIOA 3WEMA 4PFMA 4IJBA 2QLYA 4I7UA 4RK8A 4B5TA 3R58A 1PKMA 4H9XA 4LEQA 4W8BA 1H7WA 1ICSA 2NSXA 1EPVA 3W85A 1XV8A 2NXGA 2LLEA 1Q85A 1XIFA 4CNUA 5CSYA 3NQ2A 4U31A 5AHMA 3ZWTA 2REQA 2EGZA 4AEFA 2PMQA 3U2CA 5KZEA 1VBJA 3PUOA 3JW7A 3TWBA 2OTDA 3UYIA 1WO2A 2G97A 4S3DA 4LCQA 3WUBA 2QMJA 4Z2LA 3GVGA 2QVHA 1ZZMA 3KRUA 3CQKA 1I2RA 5K9CA 1YQ2A 1UWIA 3WUFA 1A5BA 1D7KA 4K8EA 5PTDA 4GUHA 2A6LA 2VZVA 2A3HA 2A4AA 1E6QM