1QUMA

Crystal structure of escherichia coli endonuclease iv in complex with damaged dna
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
279
structure length
279
Chain Sequence
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTIDEFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQGSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTFADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQDDRFDGIPLILETINPDIWAEEIAWLKAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*TP*CP*C)-3'
publication title Structure of the DNA repair enzyme endonuclease IV and its DNA complex: double-nucleotide flipping at abasic sites and three-metal-ion catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 105
structure length 279
sequence length 279
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date 1999-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1qumA00
4ZBCA 4K3ZA 3KWSA 2ZVRA 1DIDA 1XISA 3BWWA 3KBSA 4YTUA 4QE1A 3N4AA 3CQHA 5I7GA 4DVOA 5B7YA 4HHLA 2XINA 3IUDA 3DX5A 3VYLA 3TVAA 1XLDA 4LNCA 5H6HA 1MUWA 5H1WA 4GQBA 5XIMA 1XIHA 4DUOA 5AVNA 4A8RA 1DE6A 3BZJA 1XP3A 4A8NA 4X63A 3KBVA 8XIMA 4HHMA 2QW5A 4PGLA 4US6A 1XLCA 1BXBA 2X7WA 3AALA 1XIJA 3M0VA 2NQJA 9XIMA 3ITVA 3BDKA 1XLGA 2J6VA 1QTWA 1QUMA 3VNKA 4KW2A 1A0DA 1XLAA 1I60A 4GLEA 4EACA 2G4JA 3AYTA 1I6NA 1A0CA 3WQOA 3BZGA 5TNVA 4W4QA 4X60A 3M0HA 3C0LA 4G56A 2GUBA 1DE5A 1XIFA 5XINA 4OVXA 3VNMA 1GW9A 5B7ZA 3XIMA 4QE5A 2GLKA 1TZ9A 3KCOA 4PFHA 1K77A 3GNXA 3ITLA 4QDWA 2XISA 2QULA 3CQJA 3KCJA 4XIAA 3TC3A 3U0HA 3KBWA 3ITXA 4XKMA 3ITOA 4X61A 5B80A 4QEEA 4HNOA 6XIMA 1XLIA 3P14A 3XISA 1XLBA 2HK0A 5C9ZA 5AVHA 1MNZA 1XLMA 2X7VA 3ITTA 4GJIA 3M0LA 1XIIA 3JU2A 4XIMA 4K1GA 4YTRA 2I56A 1S5NA 3AYVA 1A0EA 5EMKA 3C0QA 1BXCA 4GJJA 4HGXA 3CQIA 4YTSA 3IUIA 2GYIA 4QEHA 1QT1A 3NGFA 4XSLA 4A8IA 1XLKA 2HK1A 2Q02A 3C0SA 4ZB5A 2G0WA 3KTCA 1XIEA 3KCLA 2OU4A 3DBNA 7XIMA 3CQKA 4XISA 4E3VA 4EAYA 1XYCA 3IUHA 5EMLA 1XIBA 1XYBA 3QXBA 1DIEA 1XINA 1S5MA 1YX1A 1CLKA 3KBJA 1D8WA 1XYLA 1XYMA 3M0XA 3UXIA 1XLHA 3KBMA 1XYAA 1XICA 4XSMA 3KBNA 3M0MA 1XLFA 4J4KA 1XLJA 3L23A 5EMMA 5XIAA 3VNJA 3VNIA 1XIGA 2XIMA 3BANA 1XIMA 3LMZA 3AAMA 3VNLA 1DXIA 3ITYA 2NQ9A 3QYSA 3U3HA 3UVAA 4QDPA 4QE4A 5FA5A 3QZAA 2I57A 5J8LA 3XINA 3CWHA 4YTQA 6XIAA 3UU0A 1XLLA 2HCVA 3QC0A 3P6LA 2QUMA 1OADA 4ZB2A 2ZDSA 3UA4A 3UA3A 4A8LA 8XIAA 9XIAA 2GVEA 3OBEA 3M0YA 5EMJA 1XLEA 1O1HA 4YTTA 4Q7IA 2QUNA 3FVMA 3CNYA 2NQHA 1XIDA 4ZB0A
chains in the Genus database with same CATH superfamily
1R3VA 2KX9A 4V15A 1Q4NX 3BLIA 3MBFA 3PANA 2O7QA 4OOUA 4FNPA 3KS5A 3KZSA 2HZGA 1QNVA 5A6MA 5A6TC 3U9IA 4Y2WA 4AIEA 5AB3A 1JNEA 2V2DA 2ZQ0A 3EA1A 3WQ5A 3L0NA 4N42A 2X42A 2PDNA 3MHUA 3W25A 1OB0A 1KTNA 3LD5A 1HT6A 4W85A 3LPOA 1IWAA 2IQTA 3LLFA 4TMBA 1XGDA 2A5HA 5A2AA 1QW8A 7ODCA 1BFNA 4ZQCA 2PEVA 4LCQA 1IWBA 1TRIA 5AHIA 4FOJA 3N34A 3CB8A 4N02A 2GDVA 4NNBA 2PLCA 2QEZA 1YKWA 3G1FA 4GJJA 4F3HA 4FOKA 2ANUA 1XWYA 4H00A 2INZA 1HX0A 3VIOA 4L6OA 1OJXA 2W63A 2XWDA 4J40A 2FVLA 1Z8AA 1LUCA 2VENA 4YXGA 3ZVHB 1LQ2A 5D4YA 3HM7A 3OODA 4IWWA 1EJRC 1FWBC 1AFSA 1T96A 2R9RA 3IJ7A 3NCOA 5CZTA 4WKFA 3S2JA 2IUZA 2I7GA 3RX2A 1JRBA 1DXEA 1FWGC 3UZXA 1PXGA 1G67A 2XFFA 3NO1A 3W27A 4DWSC 5A3HA 3AO0A 1XM3A 3DX5A 4GO9A 3ATYA 3RLGA 3LX9A 4PSPA 2W61A 3AXKA 3CL8A 4QSHA 2XFWA 1WDPA 3LTPA 4ROQA 2BVYA 2CXGA 3W0KA 5E6ZA 4JHMA 2RDUA 3NOEA 4AEFA 4C6CA 1ICPA 4XTDA 1X1OA 1X1ZA 1FWFC 1BWLA 5AOUA 4NAFB 4BY3A 3QC3A 4AMAA 1R3QA 4FPSA 4O4WA 3TTSA 2VURA 3KL5A 1K7FA 2PA6A 1H4PA 1AD1A 3BAKA 1OT1A 1A5MC 4PUDA 4JEJA 1GJWA 1EJXC 2G3JA 4LUJA 1CLVA 3BSGA 4LVBA 2NT1A 3CUIA 2WVTA 4WSHA 3PZVA 4B3KA 1OBAA 4A35A 4XSLA 1LLWA 4NP7A 4S3DA 3BV4A 1AW2A 3P8JA 4H83A 1DJZA 1BYAA 4WDTA 1EPXA 1DWHM 4XD6A 5HAOA 1UW9A 3R94A 3N6HA 2MUCA 1V6YA 3ALFA 4GHRA 1NFBA 4QJ1A 4IXHA 2QUTA 3LGGA 3GNOA 4PH6A 2DZWA 3RM8A 2ZXDA 3G3MA 4GFSA 5DRIA 2WMIB 3NXLA 4ZQOA 2Z2AA 5ABTA 3QV6A 1S2WA 3FK4A 4GFIA 3N2XA 4DUOA 3FA3A 1H7OA 4HPJA 2WQDA 3IVSA 3VUSA 1CW2A 4FX8A 3AOFA 5JMUA 2UY2A 3NDZA 3P67A 4LUSB 2X40A 1UBSA 2HDJA 5I3JA 2PDJA 2OYLA 1BYBA 2IXVA 3E49A 4E8DA 4LRSA 1TVPA 3G5EA 2RUSA 4H9XA 3RNDA 2VDGA 4IPIA 4Y96A 3H4GA 5F2GA 3DYOA 3QF0A 3W37A 3CQJA 3WBEA 4UC5A 4L9XA 6ENLA 4L1GA 1K8CA 2VWTA 2BVWA 3GSMA 2VKZG 2E77A 4J7RA 2A79A 4IFRA 4XAZA 1QBAA 3RRXA 1CXIA 1NSJA 3KCLA 1VFTA 4JYFA 5FEZA 3B9NA 3TW9A 3GDLA 4XG1A 3GXFA 1PWLA 3RM9A 4PUJA 2TPSA 4V33A 2Q8LA 5IOBA 5EMMA 1R3YA 5A6LA 5C6MA 4JD4A 1PSCA 3F1QA 3SCTA 3TXVA 1Y65A 1OFBA 4NNAA 1TR1A 4Y9MA 4MZYA 1ZZMA 2VI0A 4WRHA 4Q7IA 5C2CA 2W27A 1GOIA 4WR3A 4FI4A 1XBXA 3TA6A 3DENA 3I6RA 5D8ZA 4QLJA 1TA3B 4N2YA 5I0DA 3W00A 1K8ZA 2XUCA 2QDHA 2YDSA 4Y7EA 3T8QA 1KNWA 4AF0B 5HNNA 3UXDA 2DT1A 2ZTJA 3HO8A 4IMEA 3W7EA 1GOMA 2YL6A 2PE4A 3PSVA 4GVIA 2F8QA 4A4AA 4B9YA 5XINA 3PWIA 4S3GA 5TQLA 4DJED 1G7VA 2PDLA 3A3WA 5JVLA 1XFCA 4R33A 1PB0A 4UQEA 1B2YA 2BXZA 4FLRA 3G1HA 2WNQA 1H3GA 3VIJA 3UXLA 3OGVA 2I5GA 2GK1A 4JXCA 2PTZA 3H55A 2VEGA 3W71A 3BAJA 1WPCA 2QGHA 1TWSA 2ZUVA 4K8GA 1ZRQA 1RCOB 3UJEA 3B4YA 1KQZA 1P4CA 4F0MA 1K6WA 4MAVA 4DYKA 3O6YX 4HNVA 4IH3A 1GTEA 2WMKA 1JZ6A 3T4WA 5HNTA 1OGGA 2QMKA 3CH0A 1PCKA 2BGQA 3VD9A 5IDIA 3LYEA 2TODA 2VYOA 4QE4A 3ZT6A 4AD2A 4ZFMA 1PKLA 4AG0A 4KEZA 4ORIA 4UTKA 3S6OA 1H60A 1WCGA 2Y89A 1KGUA 3DUGA 2E68A 4AXKA 1VJSA 1KM5A 2HWGA 3IGHX 4V27A 3IGXA 1X8FA 1KA9F 5I7GA 4OECA 4H2HA 3NJ3A 4HOXA 2G37A 1RJQA 1TQJA 4DUWA 3I65A 5E9AA 4HMEA 1WUEA 1JYVA 2DSKA 5DN1A 4IJRA 3W1NA 2PRMA 1RPXA 4KIEA 1WOAA 4R3UA 1UWRA 3HMCA 3LB0A 5AHNA 1DP0A 4HN8A 4IISA 4D6CA 1WOBA 3IARA 5H2ZA 1GZJA 3VNMA 4D6FA 1TZ9A 1JZ5A 3PBMA 1H5YA 4O15A 1QCWA 1E15A 1TV2A 1B3YA 1EQPA 4JDBA 3KOYA 2HPIA 3VAVA 5GNXA 4UOJA 1J01A 4LVDA 3OG2A 1BQCA 3WQ8A 1U30A 5LXEA 5T8GA 5M03A 1LL4A 3CMGA 5H8PA 3A4XA 4B3ZA 2WVVA 1S38A 1DTNA 3E6EA 5EMLA 3W76A 2HS8A 1H11A 4P5UA 4U28A 2PTWA 1TPWA 1W54A 1ZU8A 1CCWB 5ENLA 2XN0A 5JBFA 1VHCA 4YL2A 3W22A 3TP4A 1VC4A 2ODOA 3WBYA 4CD6A 5HMFA 3UNDA 3R8HA 2BXVA 4ZXLA 2E8YA 1UOKA 4QITA 3RJYA 4UFHA 2D2GA 1ZTVA 4CNOA 5BW6A 5HA7A 2D69A 4FXSA 1HJXA 1GKRA 1R7AA 3TZNA 1LCOA 4LNCA 3DYPA 1K1DA 2CKSA 4LSBA 5D09A 1BF6A 5D32A 2VR2A 3IRDA 4H6KA 1JCNA 3GNDA 2NW0A 4FNUA 1QWGA 2PDQA 5F2MA 1UMYA 1RAKA 1DQWA 1E4NA 3LHUA 1V51A 2FMNA 2PI6A 3RDKA 2H90A 4LAMA 4KETA 1F05A 2JIWA 3CQ0A 2YLLA 5D2XA 4B4HA 2VQTA 5DY2A 2X1TA 1L0PA 1N2VA 4RZ6A 1NWTA 2VFDA 4JICA 3ZIZA 4ENLA 3W4RA 3CZKA 1LOSA 5BXTA 4YTRA 3NA8A 3V36A 2QUVA 2E1DA 3WNPA 3WL0A 5BMWA 3MUZ1 4ZOEA 1E6SM 1T8XA 1DHPA 2QCMA 4K1WA 4B5SA 1T99A 3FCPA 3G1XA 2YX0A 1YE4A 2ALRA 3HPSA 2Y5JA 3WDIA 3Q2DA 4DO4A 1V93A 3LEPA 4MHBA 1BVWA 1AG1O 1JRCA 4QDMA 3COTA 3MO4A 1W1TA 1J2WA 3CYJA 1E9ZB 7ENLA 3OLDA 4HCDA 4NI8A 3H54A 3L65A 4L9ZA 4ZOAA 3H2AA 2IQ0A 3V0SA 5JH1A 2J62A 4BF9A 4RW3A 4GACA 4CQ8A 3B97A 5H6HA 1IIGA 3DFQA 4XAFA 4KWOA 3E12A 3NL5A 1N8IA 1RZMA 4JTAA 1VPQA 1E0VA 4MJ4A 1QK0A 2D1ZA 1XLCA 2X7WA 1GOWA 2FVMA 4EPKA 4OTKA 3T78A 3FEMA 3MI3A 8A3HA 1ODZA 4QTGA 4H8VA 3L4TA 3P5YA 1EIBA 4UFMA 1LQ0A 1QOPA 3HPZA 1FWIC 1IIHA 1BD0A 2JE8A 2O92A 5U7SA 3ZJKA 4DUVA 3CEPA 4PZVA 2JKAA 2YFOA 3FJNA 4BA0A 4ZVJA 4HNNA 4G7EB 2IQDA 3ZOAA 2DIJA 2J8FA 3ZSTA 1W17A 3LHWA 4JFUA 3VMNA 2Z1BA 5FIPA 2WSYA 3DYMA 1UJQA 1GTHA 3CGTA 4PEEA 2YL8A 1TQXA 3PVFA 3TA9A 1IZCA 2HSAA 3LPFA 4Q33A 1J4EA 4HOZA 3W53A 3RHGA 4LAZA 1THFD 3GH5A 3ITYA 3W2MA 3CAWA 3NURA 1VR6A 1KGWA 4HA3A 5KSWA 4J27A 1HJSA 1MI3A 1BKSA 1DORA 4EE9A 3NZRA 2E9BA 3HG5A 1G0CA 4QHRA 2J9YA 3DESA 3AYSA 2VELA 3FGCA 4HB7A 2WXDM 4PUEA 5XIMA 4ZQNA 4US5A 4MY1A 3STGA 3T0AA 2JKEA 2XDFA 1AJZA 4GPNA 1QDSA 2CBIA 3AALA 3GR7A 1HZYA 4LNYA 1KGXA 1FA2A 3A47A 4UQBA 1RQBA 4QISA 2CZFA 4EACA 3WUGA 1BG4A 1QI5A 2INFA 2FZDA 2VEFA 2AL2A 3EOOA 3W1UA 4Z1CA 2ZUWA 4AY7A 2FTPA 3TDFA 5A5WA 3WQPA 2QIWA 3SQMA 4Z2IA 3N04A 3F4WA 1B9ZA 3W84A 1QOXA 3NYDA 3GDMA 3DFYA 2WSKA 3OGSA 2O9PA 2BV9A 1QXLA 2VX7A 1UKOA 1Q66A 1WYIA 3MVIA 3WLRA 1R85A 2XN1A 4NZ1A 4TTUA 4KQNA 1FBAA 3WNOA 2V3DA 4BZYA 4CD8A 2ZXAA 2ZCGA 4ICCX 4UUIA 3G0SA 2D20A 4XZIA 4LYRA 2XSXA 2QAPA 3PBUA 2XVPA 4NRSA 2CLFA 4KWSA 3S9YA 3PJUA 3WUBA 5FJIA 1V3LA 1UZ1A 2RKXA 4YIWA 2ZC1A 3B8VA 3L5MA 3D3AA 2C15A 4BEUA 3A9IA 3B0PA 3PBGA 4IMDA 5EMYA 3WLQA 1JCYA 4RZ5A 4UTTC 1W5PA 2VC7A 1Y0EA 4J1OA 4U2YA 5G4EA 3B0XA 3B0UX 5D03A 2PDWA 1K77A 1FXQA 1ZENA 1J0HA 2ZRUA 3GFXA 1FWNA 1VS1A 5B80A 4QEEA 3VM7A 4REQA 4ERIA 4KFOA 1W0MA 3IV8A 1OQFA 4PUKA 3JZUA 1OGSA 1H1NA 3C0QA 1VZWA 5CPTA 3CQIA 1RQEA 5CC3A 1AVAA 5GJMA 3UWVA 2PDBA 5E1QA 3DBNA 1Q8JA 2DEPA 2DVTA 4HP5A 3EGJA 5REQB 3IS4A 2CBUA 1PJ9A 4YVPA 1ONWA 4O12A 2OQLA 4B5NA 5EA9A 1XDJA 3BLLA 3UW6A 3P74A 3KWXA 1FCVA 4LF1A 1WB0A 1KFWA 1OYAA 1HG3A 1OT2A 3NQBA 1RBAA 2NV2A 4X9SA 3U7BA 4WF7A 3WJWA 2W3ZA 4GYFA 3UQNA 4L4PA 4LB3A 5T9CE 2X09A 1CNVA 3OYXA 2J66A 3D0CA 3R1ZA 5D9OA 5E93A 1E1CB 3KL0A 2ABAA 4NY2A 2PDKA 1EP1A 1R9YA 5CZSA 5MKGA 4ADUA 5E0FA 2Y1HA 5HULA 1R87A 4B90A 3PUGA 4W5UA 4E2DA 3BCJA 5CGTA 2D73A 2YGYA 4Z0SA 5A8OA 2WANA 2JEPA 3M16A 1J0ZA 2DSWA 5HUOA 1DIOA 3I3BA 3PR2A 4Q8TA 3MMTA 2PCQA 3TQVA 2ZRWA 4DBSA 3B9AA 4A3RA 4JR5A 2G97A 4YJ5A 2Z00A 3URAA 3MANA 4J3VA 1R9ZA 1WKDA 2VZOA 3FSTA 3NAVA 4MMWA 3PAJA 5DANA 1A5UA 1UCWA 4H6EA 3SN0A 1LG2A 1TE6A 4QDPA 2PWVA 3CWHA 4A8LA 2REQB 3LBOA 4DJFC 4V1YA 4UFLA 2OYMA 1LROA 3VOIA 3BCFA 2IKHA 3BOLA 4FX6M 4BI7A 1Q6LA 2ZZ2A 4I5XA 2YXGA 4W89A 5HK4A 3QR3A 3W02A 3DFTA 3LY0A 2ZX5A 3ARPA 1N7KA 2B7NA 1NF0A 3UZJA 3REQA 2NV9A 4B9ZA 5FJOA 1MQPA 4IX2A 4MLRA 4GIAA 4NJIA 1ZGDA 2FHCA 1R38A 1N8WA 4QP0A 1MUCA 3DI1A 2WZMA 3PWGA 2VCAA 3TV8A 5FEXA 1OFRA 2POTA 2Q01A 2WMGA 1ZBKA 4ATWA 4XKYA 2UV8G 4XD4A 3KRZA 3INPA 5C9XA 1ONXA 3KRBA 3MHGA 2ISVA 2QKFA 4A2SA 5T91A 2Z26A 3TJXA 3FA5A 3GR8A 1XYBA 1UR0A 5D33A 3UEQA 3VIGA 3QFWA 1XYMA 3E38A 3UZ5A 1V6VA 4GVGA 4AB4A 1OZMA 4FF5A 4JQ3A 5DEZA 1V0KA 1VKFA 1D3CA 1W37A 1XPYA 4PR4A 2VFFA 3P3BA 1FP9A 1YLVA 3CWOX 3TYAA 2NQHA 3VINA 4HA1A 2OO0A 3S5ZA 4FAMA 3SRDA 3LCHA 1DQUA 2EJAA 3CC1A 1OYCA 2J79A 4NAEA 1JF6A 2PLMA 2BOGX 2PCEA 3GFZA 3PB2A 2WHLA 3W7KA 1TWWA 1P1XA 4MFEA 4DHGA 2JF6A 1UR1A 3AIBA 3EX2A 4R88A 3GHTA 4MJZA 4WVXA 1D7KA 3RCYA 4F40A 4TO8A 3DHPA 2PODA 1DJWA 2GSJA 2W67A 4WY0B 4CQAA 1KC7A 1Y8BA 2XVGA 2PDMA 5HBFA 4KRUA 4NZ5A 4YVVA 5FJUA 1ML1A 3OZOA 1QJWA 2Q3OA 3POHA 3P82A 4C6OA 3NYZA 3NFUA 1LLOA 5C9ZA 5HNRA 4XTIA 4B16A 5CGMA 1L2UA 5AHEA 2NXGA 1TPB1 1YRRA 2D24A 3SFKA 1BAGA 2OU4A 3O9NA 5LHFA 7XIMA 3W7DA 3H26A 3EPOA 4G6CA 3G3DA 1R0MA 4YS1A 5EKYA 4LS0A 4JKLA 3ABQA 1RJRA 2C13A 3LBCA 1W32A 2DSVA 3H53A 3IPWA 4M81A 3A24A 1ME7A 2C1GA 2WHKA 4W93A 4D1JA 1FP8A 3C2RA 5H8MA 4J3TA 3WQCA 1Q6FA 1QHOA 4PE8A 3BCDA 3NQFA 4NZCA 4DXKA 2XH7A 3TEVA 3CAQA 3T2PA 1S2TA 2D3LA 2I9EA 4C5ZA 3PF3A 5IHRA 3BE7A 3EEGA 5CSYA 1KBLA 2CXEA 2I1OA 1OC7A 1PX3A 5HPCA 2ZZ1A 3PBVA 4RV3A 2DZXA 3C2YA 4O0QA 3A64A 4YYCA 4FA3A 2RDTA 1HF6A 1HJVA 1VFFA 4EAMA 3HG4A 3K30A 5BYWA 1SR0A 1P0NA 3PZUA 3AYVA 5D8WA 3EKZA 1TV7A 3GNPA 4XZNX 3CUGA 4ZO6A 4I5RA 3MA8A 1V08A 3G8RA 4PBGA 3L4XA 1AL7A 1SJAA 2PWDA 4UZUA 2YCKX 2X2GA 4LUTB 2XM2A 1KCLA 3DFSA 3B8SA 3AS2A 1DXIA 1B3WA 3M41A 4DELA 1RXOB 1GG1A 1R3TA 1PV8A 3N4EA 3KHJA 4IMFA 4K6AA 4PRWA 3GRIA 1GOXA 4OKDA 3GM8A 3DH7A 4XV0A 3CHCA 1W9VA 3GNNA 4CCDA 1DE6A 1FDYA 3SR7A 2PP1A 4ZFCA 3LM7A 3IAQA 2A3CA 4HHMA 4DAIA 1IEVA 4LS2A 5C71A 4LXFA 2HS6A 4GZIA 3LI0A 4LALA 3E5PA 2DFAA 3B8TA 3LI1A 2WCGA 5LZLA 3ITCA 9CGTA 1H7RA 1W5QA 5LIUX 5MHBA 2VFHA 4AZCB 3GYEA 1DKWA 3VA8A 1HO4A 3CEUA 4PUWA 1CT5A 4R7JA 1GOOA 4AFYA 4MPQA 4JX5A 4KESA 1X39A 3KRUA 2WJFA 1ZBCA 2YXOA 2XH0A 5HJXA 1U2YA 1JL8A 2YCEA 1A4LA 3DGRA 3WF4A 1U1UA 4JYEA 2WV8A 1F4HA 5M2FX 4J4KA 3ARZA 2OFJA 5D9PA 4NIRA 2XIJA 1EP2A 3RO6A 4IM4A 3L2MA 2GJLA 1TKKA 2Z1VA 5D30A 2FFIA 1G6CA 3AMGA 3AMDA 4I9TA 3O6DA 4ZOBA 4HNTA 4H8NA 2Z27A 2FTWA 2Z4GA 4PMNA 1QVBA 1PYMA 3NSNA 1AJ2A 2VEKA 2OB3A 2YZRA 4AHQA 2IPGA 1MZRA 3E0FA 5JU6A 2WM0A 2HE5A 3L4VA 1MWOA 1E6RA 3PG8A 4P8WA 2YZ5A 4BQ2A 3T81A 4FK9A 4GLEA 1RJPA 5F4WA 3KVKA 2VFGA 4LBRA 3VIFA 4QLLA 5I06A 1TR9A 2DZPA 3M0HA 2WOQA 2FGBA 3EA2A 3KCJA 2C3ZA 2Q8XA 3KDNA 4WJ8A 1F5ZA 2C79A 5HANA 3S5OA 1AH4A 1BTCA 3BARA 4HYVA 3VI2A 1LDCA 2R1LA 1A5SA 1FH8A 3BW4A 2XH4A 3IVUA 1C8QA 3WDRA 3L4YA 3QPEA 1SU5A 1B54A 1W6TA 3C2FA 3MSDA 5TIMA 2RFGA 1BKHA 3B8DA 1OFOA 1XINA 5GJPA 3WD2A 4S3KA 1XYLA 3LQLA 4CNPA 1XRFA 4DM2A 3QQ1A 3V0UA 2DW6A 1GQNA 4AZ7A 3N6QA 3FAWA 1YPFA 3QGAC 3CPRA 4S3BA 4E2OA 4CU8A 4JGDA 1K9TA 1O1HA 3QLDA 3WIJA 1QHZA 3A21A 1GT8A 4L7ZA 4W9TA 3LZ5A 5JIPA 3UFYA 3ONCA 4G1NA 3KHDA 1LL7A 1ONRA 1H0GA 2CWNA 4UTMA 4O18A 4KFPA 1UH4A 1SO4A 4HMNA 1H5VA 4KRTA 4IP5A 1B4EA 3N12A 2BOFX 5T9BG 3OLGA 3VMOA 3WNKA 2BHZA 4WUIA 3VGFA 4UIOA 1CXLA 4LC8A 1D7FA 4I9JA 2OT0A 3BG3A 1IZKA 2H6RA 3W6LA 1IE7C 2HEJA 4QCEA 2OOFA 3CU2A 3AIQA 3GUWA 3O06A 1IT0A 4PUMA 3FV9A 1XYZA 2DZAA 3BXWA 2C14A 5I23A 2V0TA 1HFBA 4G8TA 5I5RA 4MYXA 4NX5A 1RCXB 1GQKA 1NM9A 4QFUA 3QMSA 4Q7BA 3VKDA 2QCGA 4O1CA 2X0YA 2QVHA 3ELFA 3JU2A 7CGTA 4XUYA 5DT5A 4M6QA 1CECA 2GPTA 2BHYA 5A8MA 4DWSB 4IG2A 5CG7A 4ZB5A 1XR2A 2DSUA 8RUCA 3UCQA 4DBWA 2GGHA 4NUWA 1YDOA 3D6NA 2NXHA 1MDLA 7REQA 3GD6A 2V67A 2I16A 3WD1A 2PGFA 4GCAA 3UWWA 3V3WA 3WF3A 2OSWA 4HK5A 3MMWA 2D0HA 2PDYA 4ZL1A 4ZMGA 1FOBA 1QPOA 3GBDA 2JF7A 5BXSA 1TTIA 4IFKB 2R24A 3GC5A 3N2MA 1T8QA 4RUBA 1KW1A 3NQ6A 3UPBA 3VU2A 4GY0A 3TNBA 2E25A 2PP0A 1QO5A 4UMAA 1A3HA 3LCGA 4F48A 3FDGA 3KBVA 5DMLA 1F6PA 2P3ZA 2WWCA 2VQUA 5BWFA 4C6FA 3R0KA 3TXZA 4ALDA 1JQXA 1PBGA 2WNNA 2HE8A 5AFDA 2D23A 5CBJA 1NARA 2C0AA 4CCZA 3NQEA 2WAGA 3H2NA 1PAMA 1Q85A 4YLWA 3LCIA 3QTGA 1SYTA 4H6QA 3P14A 4O17A 1VBGA 4ADSA 3VD4A 3TYEA 2X7VA 3GX9A 1W1VA 2CZEA 3CZGA 4JL1A 2Y6ZA 4DLMA 5BWAA 3SCNA 4BF7A 3MHFA 4A22A 2CZVA 3ARVA 4XISA 2Y7DA 4JQ1A 3ARSA 4KBXA 4M0XA 1HNYA 3I7RA 5FF3A 5CPMA 4MFDA 5G2IA 3BQ6A 4GUFA 4L65A 3AXMA 1OX5A 1XG4A 1P7TB 3VOCA 2NZLA 2QPSA 5I79A 4AX7A 3LRKA 1TTPA 3TQKA 5BU6A 4EIVA 1IEIA 4NJHA 3W6YA 3II1A 4INFA 3TX9A 4GZJA 1FFRA 4DJDA 3TQPA 1J9YA 4ROPA 3DN5A 1OC6A 4G7EA 3QJAA 3A5FA 1VBJA 3KLKA 4AWUA 4ECLA 4ML9A 1A5CA 1XJBA 4N0RA 4US6A 3W7LA 2QVNA 1NOUA 1I60A 4IL0A 2J88A 5HR7A 1IHIA 4PCTA 3UPMA 3WDHA 2CBVA 1EZWA 1WBJA 2QQ6A 5FSDC 4PCFA 1TX0A 3R0DA 3MSGA 1H51A 2GLKA 1OABA 2CFFA 3TC3A 2BY1A 5CEWA 3L7RA 4FSAA 4NSBA 1M68A 2CLHA 2PSNA 1JDEA 4Z0JA 3VD7A 1V79A 1AK5A 3QY7A 5TD4A 4CD7A 1VJIA 2R91A 4UTWA 4DBUA 3WNMA 2JK2A 3WK2A 1E43A 2R1MA 1KXTA 3VDAA 3W1AA 3KOWA 2BB0A 5DRCA 4UTUA 3MU7A 3LPGA 3AUOA 1HKWA 1V3HA 3RILA 4X2PA 4DBDA 4N7QA 2A7PA 4HYRA 3N4FA 4UR9A 2E3ZA 3KTSA 2WJDA 1JIBA 3QHOA 2CIPA 3POCA 2QJGA 3N73A 2GQ3A 4NZJA 5HUPA 3KWSA 2NWRA 1SJDA 2VD8A 2W4XA 1BVZA 1RSCA 4NVTA 2OWWA 2IPJA 1R8LA 4LJ3A 4Z2JA 4GUIA 5FSEC 3VTRA 3I3EA 3TMLA 4CNTA 3TNOA 2ZWZA 5CJNA 1O5XA 4OU1A 3QBUA 1FWRA 1VFHA 3EX6A 1SW0A 4MNKA 1ITQA 1W1YA 1R30A 2FDSA 1UR8A 1SSGA 3QMTA 4W4QA 3VC6A 3ZJ7A 3BMVA 1KTBA 5EPDA 3W26A 1WA3A 2ABBA 4LBUA 2YB4A 2C6QA 3P93A 2WVUA 1LJYA 1PS9A 3IGUA 1JGMA 1UC5A 2YDQA 1FDJA 2AMXA 4B5WA 4PFMA 3TOYA 3M5YA 5C55A 1Q8AA 1N55A 1S5NA 4QLKA 1E51A 1QT1A 1EGZA 2EKCA 1SFJA 2CKRA 5I78A 3SY1A 3B4UA 5PTDA 5I09A 1B9BA 2VUYA 2QHAA 1H09A 2ZA2A 1UP3A 5BROA 4CEXC 2WZTA 2GJPA 1R46A 4D6IA 1ZP4A 1ECQA 5DT7A 2WKLA 2E40A 1B5TA 3E0WA 4TVUA 3G6MA 5FA5A 3E0IA 3WEOA 5FAGA 4EPEC 3V5OA 5HWNA 2PTDA 1BXNA 2B7PA 3OW1A 4F0HA 3VGHA 1JCMP 3S9IA 3QGKC 3CQHA 2BVTA 3MT1A 1KFLA 4KEMA 2VM8A 4DY1A 2PD9A 1A47A 2ASHA 2IS7A 4AAJA 1E6ZA 4P7RA 4J28A 1V02A 4EX4A 4FF7A 3AZRA 1OSEA 2ISWA 1W5NA 1M53A 3NXFA 4QS6A 5D9MA 3QSTA 1AMYA 3TN4A 2YDAA 3H23A 5LA0A 3KAOA 3HG2A 3ABOA 3Q67A 2CLPA 6TAAA 5L6UA 3AU6A 1V3MA 2OKTA 2ZE0A 3QYQA 1REQB 4FR6A 4U5KA 3EAUA 4M82A 3W75A 4S23A 3HOJA 3A4JA 3RU6A 2W91A 3BGJA 3N9KA 3W7OA 4N9BA 4K39A 5BRQA 1S39A 2XIOA 4PCSA 1YNPA 2IXUA 3ARQA 3W82A 1SW7A 2YLAA 2A3BA 1YPXA 4J9JA 2FJKA 2A21A 1J5SA 1VQTA 3DG6A 1F61A 1E73M 3TN3A 1RVGA 3ABZA 3PHAA 3VZZA 1ZL1A 3F4DA 4Q8NA 1WKFA 1ZPTA 4HCLA 5F7UA 4D1IA 4XSMA 1ZUAX 1QR7A 4DI8A 3D47A 3HN3A 4BQ4A 2QCDB 2A1YA 5DMNA 3JR2A 1SM9A 5FF7A 3JW7A 3W3OA 3ABXA 1UWSA 1Q7MA 3GKFA 1WAWA 1VB9A 5C2GA 3AMKA 3ARYA 4K3ZA 3K4DA 1DQXA 1Q63A 3NQMA 1NP2A 1UR3M 3ENLA 1TFVA 2G3NA 2XU2A 4OBSA 1OINA 2AKZA 2V2CA 1ADDA 2V5JA 3PTMA 4D2JA 4QG8A 5C2XA 3AZSA 2A2IA 3R12A 3KX6A 4UQDA 2HNEA 2VGFA 3LM3A 4I7VA 2XIQA 3VILA 1XC4A 2V2HA 1V3IA 3CUZA 1W9PA 2AAAA 4Q8PA 4J3WA 6CGTA 3K4WA 4XD3A 3DKLA 3BQ5A 1P1MA 1EBHA 4D8LA 4XZHA 3F4CA 3TSDA 2AGTA 2PZNA 4GKLA 1EOKA 3U4FA 2E9LA 3ZQ9A 4LV4A 3WLNA 2DH2A 1ISWA 3H8AA 3SCPA 4H9ZA 2QCCA 1E1FA 1C7SA 1FWDC 3HZ3A 3KBJA 4GY7A 1SFLA 4IPNB 1QW9A 4OHQA 4Q7NA 3PB0A 4L5ZA 3SRHA 4GX8A 1L6WA 1AH3A 1TPEA 4KRZA 4EF8A 2I17A 5EMUA 4M7TA 2YYUA 4FNQA 3TE9A 1FUYA 2WYSA 3B9DA 2W79A 1RLCL 1VIZA 5ABFA 2OWXA 4M1RA 4A21A 4C7FA 3M0JA 5GQBA 2WB5A 3GBEA 1XLDA 2PDXA 1YADA 3I7QA 2R1PA 5A6JA 1MEWA 4GJ1A 1XV8A 4DZIA 4HQVA 2PWHA 4XZWA 3AXHA 1HN1A 3DKJA 5D2YA 1XCFA 2GQ9A 3HQPA 1GCYA 5EB8A 1PX8A 1QW7A 3SUUA 1O7AA 3R58A 1RK5A 4A3HA 1LOLA 2G4FA 3C61A 4NKCA 5I07A 1GZ1A 3LCFA 3SCVA 1QNSA 1XL9A 1KV8A 4TV5A 2WMJA 3AJ7A 5DXXA 1IXPA 3CWNA 3TC6A 3UD6A 3TYZA 2J6XA 3W81A 3UXKA 3LV6A 4HCHA 4PA8A 4JBRA 3ABRA 5E09A 5LHEA 2Z6IA 3PZ9A 4OBTA 2X0HA 1GJUA 2OEJA 2WVSA 1CGWA 4DIAA 5C7HA 1OIMA 1IR2A 2ZFAA 3VK5A 4D72A 2P10A 4O8RA 3V5CA 3HURA 5AYZA 3AHYA 4AMCA 1L8NA 1Z7AA 3H4WA 1HKVA 1YBQA 2QYGA 4KCWA 5HDRA 2P76A 1ALDA 1NFPA 3VPLA 3XINA 5CSRA 5HQMA 3UERA 4ZR8A 4WOZA 4ZGYA 3VKKA 4QNEA 2A85A 4RNJA 2R6OA 1Z9AA 2VZUA 3M0ZA 4OUEA 3UWYA 3WFZA 1XQKA 5A8PA 4LB4A 3VKJA 4NJKA 4O8AA 2J9XA 4IICA 1LTDA 3P5ZA 4HA4A 3SN1A 2CC0A 1US2A 1C3FA 4UQ9A 4XB3A 1D3GA 5HJLA 4DWSD 4IUGA 4N9DA 1GKPA 3CV7A 5LGXA 2XTKA 3VDCA 1TMQA 2BZNA 3TK7A 4KWVA 1EYWA 4PBEA 4PL1A 4AX6A 3OHIA 5CH9A 4OVXA 3WUEA 3WJXA 2OGYA 5D05A 1IV8A 4H7VA 1KM0A 4K2SA 3QN3A 3OTRA 4WQ6A 3XISA 3WD3A 1BRLB 1ADOA 2PWEA 3PN8A 3TLQA 1EWDA 4NQ1A 4MWAA 1GG0A 2FFCA 4O1EA 5GNYA 4Q8WA 4QEHA 4S2BA 4LPCA 3VZYA 1FWHC 2XG9A 3WFAA 4WIWA 4PL2A 3A23A 4BQ3A 3WLPA 2Z1KA 3KXQA 3LQGA 1J12A 3H21A 1M1BA 1RP8A 2VVSA 2ICSA 1SZGA 3H70A 1O6IA 3UY7A 4OJYA 3WSUA 5E6YA 2CHNA 1JUKA 2DUXA 4QAWA 2PLKA 1FTXA 4MB3A 1K4HA 2I5QA 2A3HA 3WH5A 5LKYA 1LBFA 3IVTA 3V35A 1BGAA 1F3WA 4QAIA 4S3FA 4QG6A 5HJYA 4AZHA 3B40A 4GX9A 4U10A 1VRDA 2C91A 2O55A 2PF8A 3LCLA 1FDZA 4FMVA 3U6WA 4JCLA 4NX0A 1T41A 2OLHA 2YW3A 4RV8A 1U5VA 4X61A 3M43A 1E0WA 3M5XA 1WXYA 1BYDA 1E4MM 3VOJA 2XVKA 1V0NA 4J3SA 2QJHA 5LNSA 3CJPA 4YN5A 1BF2A 1P0EA 4C91A 2E8ZA 3NO5A 3VOHA 5FCZA 4Y9NA 1A49A 4ZEPA 1IGSA 2VD9A 3S42A 1ITCA 3LRLA 5JUVA 1SW3A 2WO5A 2BY2A 1FXPA 4HPHA 4Q4OA 4GK8A 4PMUA 3LHYA 3TJ4A 4PN2A 3VD5A 2IPFA 4OWGA 3CHEA 1G4EA 1BWVA 3AI0A 3A22A 4C6KA 3EX4A 3UJ2A 2ZZ5A 3NR0A 3FW6A 2BHUA 3EWZA 1E6NA 3W7NA 1OX4B 2J9ZA 1EOMA 1CIUA 4RX0A 1KCZA 5CC6A 1QI3A 2J7BA 4AD3A 3GU1A 3ZXWA 3GYCA 2PU1A 1RBOB 2B7QA 4XX6A 3EMQA 5HMDA 2WJEA 1IQ8A 4IIEA 2CZ5A 3C2OA 3TWAA 1P48A 4AY1A 4JN6A 2ZYFA 3D46A 2G4JA 4NJGA 3WEMA 4XBKA 3TONA 5RUBA 5A2CA 4LF2A 3EA3A 3WLTA 5DMMA 2V38A 1F4AA 2ZA3A 3APTA 4HD5A 3L0GA 4GUGA 4I8YA 4PUNA 3QQ0A 4L56A 2Y62A 3GU9A 5T26A 2OTDA 1J2BA 4HZMA 3RCNA 1W56A 2XGIA 1T40A 3HIJA 5K9DA 2Y0FA 2QLYA 2ZWYA 3L4ZA 3L2IA 2WNZA 5HOSA 1Y7VA 4YVXA 1GYNA 4HPGA 2NQ5A 4MB1A 3PTQA 2UY3A 1XYAA 3QRHA 4GZEA 3DG7A 4B5VA 1FCUA 1T0OA 3L2LA 3DOPA 1OX6A 3E0VA 2WZEA 1B3VA 2ZUUA 1BQGA 3HV8A 2FVKA 2YFNA 3EWUA 4O11A 4ZXOA 1TVNA 3VGEA 1F6YA 3TROA 1KQYA 1ENUA 1UOZA 2VRQA 1VYSX 5M5DA 1UR2A 1WUFA 3W7RA 3S9ZA 4DVOA 2PD5A 2HXUA 4E4UA 1JJKA 1ZAJA 3B03A 3W7HA 3IGSA 5K4ZA 2ZE3A 3L9CA 2BXYA 3BW2A 4AD0A 1MDRA 3VIPA 1HJWA 5CSSA 1HIZA 5ABGA 4PSRA 2NVAA 2V63A 4RDWA 3SY5A 3QKEA 3W1MA 2HMCA 1DVJA 3S1UA 3SB0A 1WDDA 1EJTC 4XBSA 1QK2A 3ITOA 1CGUA 1OYBA 2EQDA 2G3IA 1AJ0A 1RA0A 2P1FA 2VGIA 4GJIA 1LZOA 4ZO9A 3QKZA 3P0XA 4FALA 1W1A1 1RR2A 1DWIM 3H2FA 1MVYA 1VRXA 1TUXA 5A8NA 2DZBA 1KRAC 1TIMA 4JIIX 1K7XA 4Q8VA 2MNRA 2D0GA 3P2VA 4ICNA 1Q6EA 1EDGA 3CIVA 3VXGA 3VFCA 5FJTA 2V5BA 1UBPC 3CM4A 3RAOA 2H9AA 2V5CA 2A3EA 2V69A 1X38A 4NU7A 3OA3A 4CEUC 2ACSA 2YA1A 4Z1AA 2Y5SA 2PGRA 3K8MA 4AWSA 2YSWA 4M6UA 4GWEA 5BXPA 2ZUNA 3WNNA 2DORA 2Z0IA 3IV3A 4TX9A 3TFCA 3PNUA 2ZDRA 1OK6A 1MQQA 4C6LA 2P5NA 3MB9A 2OZ8A 1WP6A 3UWEA 1CB2A 4YCPA 3BG5A 4CQBA 2XN2A 2F6KA 1B3ZA 5AC7A 3S6DA 1E70M 4H9MA 1I8JA 1EUNA 1C90A 3VE9A 3NZQA 2YCJA 4HIBA 1CGXA 1UB3A 4GOAA 1JG9A 4M19A 3EOSA 2WC7A 1W3NA 5J5RA 2FGLA 4IQEA 1XLIA 2QR6A 4LY8A 2Y61A 4P8VA 3O1NA 5BCAA 3ID7A 4IFKA 4V2XA 4ZA0A 3DERA 3OG3A 2CERA 3W2KA 4B2DD 1NDVA 2J7HA 4JY9A 4MTVA 2BBFA 4LWWA 4GABA 4TTGA 4DZAA 1QU4A 4LCRA 3WQEA 1POKA 4POCA 3WK1A 4GYKA 3MUXA 4JKMA 1QBBA 1GHSA 2HQAA 2VDIA 2TAAA 4P2VA 1H7WA 2GGIA 2HPMA 5D38A 3SGUA 2VC6A 1Q45A 4JTIA 1XIDA 3NVDA 1FWCC 2X1IA 3DAQA 5CBIA 1B3OA 3BV7A 1PKYA 3QZEA 1YDYA 4E4FA 4PC8A 2NUWA 1PIIA 4JFSA 1MYRA 3VYLA 4RE4A 3MC5A 3EWBX 1WZLA 3KL3A 4JTFA 3S1VA 2OVLA 2QCNA 1EEXA 1PO9A 3G1YA 3MDWA 4EVZA 3WF1A 4DF2A 3MVTA 3FEQA 1M03A 4NXSA 1ISZA 1AZ2A 3VE7A 1V5XA 3TW6A 2FDMA 5TNVA 1P6BA 2DUZA 4IIBA 4TV6A 3THDA 3TC7A 3VIIA 1LL6A 3ABSA 1O95A 4UQCA 1TYGA 3UG4A 3SIZA 1AW5A 3CZ8A 4C5YA 5LGZA 1JAKA 1XX1A 2CESA 4E8CA 4H3DA 2FB2A 1U1HA 2DZSA 2GJRA 3TR2A 3PAOA 2OLSA 3UG5A 3PJTA 1TJ2A 3C0JA 3G1AA 3EPMA 3AWNA 4UB9A 3TN6A 4PUUA 4Y8FA 1O68A 3ONBA 5FL0A 1VD6A 3GH7A 2R14A 3Q45A 4YNGA 1XLFA 1WQ5A 4IP7A 2E6YA 4AIOA 5F4SA 4B15A 1R7OA 1FHUA 1MXDA 1J96A 3BPWA 4JTQA 3MS8A 1SR9A 4Z17A 1X7IA 2ZC8A 2D2HA 2POZA 2AKMA 3W87A 3G24A 1GVIA 2CPUA 3P80A 3NL2A 4MPKA 4O1AA 5KZDA 3U4AA 3VX1A 4HOWA 2R8WA 4YYFA 5HWJA 3GXPA 1J0IA 1GQIA 4Q4RA 1VCFA 2OWCA 3DDMA 1X96A 3IIPA 2HXTA 3N1AA 2OOGA 2PWUA 4RJEA 1W9DM 3C52A 3URBA 2NT0A 5ABHA 1SO3A 3B8WA 1SFSA 1HUVA 4FHAA 2C7FA 4GIYA 2PWGA 3BMXA 1O60A 1QI2A 4XKMA 4HU0A 4BJHA 3SEPA 3KDOA 4ATLA 2X30A 2NWSA 2XZ9A 1H50A 3FXYA 4JCMA 1J18A 3BAWA 1EGVA 3T6CA 1OEPA 1SJBA 4UMCA 5F2LA 4W88A 3VDHA 4HK6A 1IGWA 3RK8A 4KGJA 3HBLA 4C6BA 4FXRA 4D6GA 2VOTA 3NL3A 5HQEA 4AQLA 3CMFA 1HVQA 1TCMA 4M51A 1S3TC 4M8UA 2QZRA 1KBBA 1TWIA 3M0IA 3PS7A 2JGQA 4NZ4A 3O0FA 1ICSA 3RXZA 5I03A 3ORWA 4KCVA 1MSSA 3GHRA 4IZGA 1XBVA 2X0SA 1ZJIA 3SUVA 4MJ2A 3NDOA 2WMFA 4PMYA 4R7WA 1V0MA 4IIDA 1Q6DA 2KAUC 1UR9A 4MYAA 3RG6A 4DJDC 4O53A 3W85A 1D9EA 1UJPA 4IHCA 1S5TA 3C86A 4WK9A 4UOZA 4F4RA 4DXVA 3O8AA 1EO5A 2E0PA 3SIMA 5J5DA 1TO3A 1TG7A 3QFEA 5BNKA 4AZGA 4EANA 3V4BA 3ES7A 4EWND 4IIFA 4DZHA 3HGOA 1RV8A 3ZM8A 4QE5A 1ZNNA 4WDWA 4AH7A 3AYRA 1F76A 1H1ZA 3D5HA 2CETA 3OP2A 1S5VA 1UKQA 3FYPA 4JQ4A 4IMAA 2VFIA 1B3XA 3AS3A 3EDFA 3LTSA 4CQ9A 1UPMB 2NUYA 4U33A 1BPLB 4HHPA 5LA2A 4G1KA 5HXMA 5LIWX 1EXBA 4UTWC 5JH2A 3WQGA 1Q5MA 3VABA 1KBJA 3BGAA 4GISA 5H8UA 4CUCA 3CZJA 5K9CA 2WKJA 2PPGA 4TQTA 1LG1A 2Y63A 3CAVA 1Z44A 1KXVA 2QJNA 3V1PA 3ZMRA 2VGGA 2WJZA 3AXXA 5A6BD 1PTGA 3MP4A 3UG8A 2VMFA 4TIMA 3AAMA 3LGDA 4MF4A 4AUBA 3PC0A 4MUPA 3PTKA 1XISA 3PUOA 1JYWA 1EF3A 4C6PA 1JFHA 5H1WA 1B57A 4AYGA 2TYSA 4HN4A 3OZMA 1BVNP 4MOZA 2RDWA 3AJXA 3W83A 4FLQA 3OB8A 4NZ3A 2YBVA 1BHGA 3V16A 3N19B 1KFEA 3ECQA 4K68A 4NILA 1K9DA 1NJJA 2J7DA 1DYSA 1JYNA 2QCDA 3GNXA 2HBVA 1IXNA 2Z28A 4AD1A 3T09A 4TVCA 1UA7A 5AZ1A 3SURA 4BF5A 1ZY9A 3W1XA 1L6SA 2Y85A 3UXAA 1LT7A 3IJ6A 1SSDA 1E9LA 3WY1A 1R3RA 3KOFA 4FO4A 1A53A 1JI2A 5E0KA 4H6RA 3AIEA 1XIEA 3E2SA 1JF5A 4HSNA 4TR9A 3WENA 1S5MA 3KM8A 2GOKA 1VLWA 3M0XA 4UTFA 2MANA 2VVNA 4IQJA 1PZ1A 3N17A 3KFTA 4BKNA 1XRVA 2HVOA 1FWSA 1O66A 3HPAA 2QF7A 3OEXA 3HJEA 5G2WA 1IEWA 1P0KA 3PBWA 3W2NA 1VFOA 3T9PA 3LK6A 1C8VA 1BLIA 4KGLA 3ZJ6A 1ZJHA 2F7FA 4KKXA 4H9TA 2GWNA 1Q3NA 3GZ3A 4GC3A 2OQHA 3FVDA 2WC4A 4W84A 4LUIA 4DJFD 3NL6A 3AIVA 3TZFA 3UJRA 1I2RA 3BZJA 3LXCA 2BASA 2BY0A 1XP3A 2CZDA 1E0UA 2PC8A 5HNUA 1NWSA 2VGBA 3L4WA 3RO8A 3FHQA 4OUIA 1BWKA 3A12A 5I3KA 3UP8A 3GIYA 3ZZ1A 1GKQA 3AHTA 5JIWA 5G2HA 1S46A 4BWLA 2PDCA 1E1EA 2Q8ZA 2PZ0A 1E3ZA 3OVRA 3I6TA 2GUBA 2WVVB 4FLOA 3IIXA 1ODUA 3M7SA 4Q4MA 4O0ZA 2Y8VA 1S2CA 1E6PA 3E2VA 1JNDA 3WUFA 1FKWA 3NVTA 1O94A 1CXEA 4FS9A 3F2BA 1JUBA 2Z6JA 4H04A 5MF5A 1WDWA 3QPZA 4YWIA 4GNVA 2WHMA 2P8CA 5F4XA 3NGFA 1J8VA 2Q02A 1WXJA 3N2TA 3W38A 1JEZA 2ZZ6A 1JCXA 4L4LA 4L4MA 2BFGA 1J6PA 4CD4A 4ICMA 3PZMA 3DI0A 2G8ZA 4MZ8A 4PMDA 5F1UA 1OG0A 4Y90A 3SW6A 3VNIA 4FNRA 3SQLA 4Q32A 3GO2A 5DCBA 1GUVA 1S5WA 3A3XA 1XLEA 4DLFA 4JTUA 1K7EA 1UC4A 3HGRA 3KW3A 2QPXA 3WCZA 4LW7A 1I4NA 1W1B1 3GXIA 3MO7A 4JX4A 4CGTA 4GIRA 4GQQA 3AROA 4AISA 4KIRA 1UG6A 3MTWA 1V0LA 3EDDA 1R9XA 4S3EA 1NAL1 2QNEA 1QUMA 4CCCA 4M80A 5I3HA 3TTYA 1XSKA 1IR1A 3WF0A 4AVOA 4HNUA 1W3IA 4DM1A 3ZT5A 4UNLA 1F3EA 2EPOA 3GXDA 1O1ZA 3B9EA 3LA4A 3RJXA 3ATZA 4Y8EA 3RPDA 3HJZA 5C9RA 1ICQA 1K70A 1MFUA 3KS6A 3ZLFA 2PS2A 6XIMA 5I3IA 1ADSA 1EWEA 3VOFA 3H24A 4XWUA 3TYDA 1EJSC 1TTQA 1AQ0A 4HGXA 1ZAHA 5KINA 5KETA 2VT0A 3NM3A 3P84A 1IWPA 2HK1A 1VBRA 4UNIA 4L6DA 1KCKA 3O7UA 1XIBA 3C2VA 4DNMA 1YDVA 3VKAA 3VNZA 3NG3A 3UXIA 7PTDA 4Z2GA 3IJ9A 1VENA 1DV7A 1K03A 2PGEA 3B8UA 2ATSA 2FPVA 3PZGA 2EPKX 3P0WA 4TU1A 3WJZA 1YXDA 2Q71A 4UBPC 2OMAA 4GRSA 4TXEA 4C7DA 3DC8A 1XQLA 4HZ8A 4AIBA 4HT3A 4ZO7A 1NEYA 3ZO9A 1XC6A 1CGVA 3Q58A 4PMVA 5AYXA 2ACRA 3TCEA 4WSJA 3ARXA 1UA3A 3T1GA 4GH3A 3R13A 4CQCA 3M6YA 1ZAIA 3GLCA 3FSUA 1E6QM 1R2TA 4P7QA 2IMRA 4QGCA 2ZZ7A 1ZB5A 5FACA 1E71M 1XYFA 3MP5A 1CXFA 2Z24A 3VUPA 2PTXA 3KCOA 2J7GA 4JAWA 4D6EA 4PULA 1QRQA 3EWWA 1SMDA 5G5IA 5C7VA 3BLPX 5AC8A 3ITTA 3PK7A 4ILSA 2RH9A 3NIYA 3BH4A 2NUXA 1KXQA 1JGIA 1X6UA 2X2YA 5D37A 5I02A 2VX4A 1BSIA 4O10A 1CB7B 5HPOA 4LVGA 4F0KA 1N8FA 2QS8A 1CYGA 4KEVA 3ES8A 3IACA 4I5UA 2G3MA 4HZ6A 1EGMA 3FGCB 1HO1A 1S2VA 4ES4A 1P0DA 4I90A 4EXAA 2EG6A 1Q6RA 1XIMA 1L8PA 3QZAA 2HTMA 1NWRA 3DC0A 4QNWA 2J77A 3M9YA 2FPYA 1DHKA 3KOXA 2ZDSA 3ZVIA 3ZR6A 1TMHA 4XK2A 3W1RA 3MSRA 1M04A 4WY0F 3ZWTA 4A3UA 3P61A 3U2EA 2AL2B 2JEQA 1H49A 2NSXA 2VZTA 3N4AA 1DJGA 3NM1A 4JTHA 3WMLA 4OV4A 4OZOA 1X8CA 2OPJA 2X05A 4DJEA 5KZEA 1AQFA 3W70A 4UWMA 1E9YB 1LM1A 1KM3A 2AQOA 1BXBA 2GL5A 3OIXA 3IJDA 1EHAA 1JPHA 4I3GA 4GI4A 5F2IA 3L5AA 3TKFA 2DUAA 5GNZA 5U4NA 4E0CA 1JZ8A 3C8FA 2BNJA 4J3ZA 3ARRA 4QR6A 4GH1A 3HV9A 2DJXA 3UR2A 4WDXA 3QY6A 2HNHA 2D22A 3TSBA 1OX4A 1A0EA 1AUSL 2HBXA 4X9YA 3TSMA 1M7JA 2ZIDA 3ZS4A 3SAZA 4C1NA 1JD9A 1SZFA 3CMJA 3VX0A 3DU0A 4MWAC 3P60A 1GOQA 2XZ7A 3AUJA 2YJQA 4HBKA 4MAZA 2H3DA 3I10A 4LU0A 2VC5A 4RE0A 5JBDA 1F9CA 3CZLA 4ONVA 4W87A 1M5WA 1XLLA 4B5TA 4CU7A 3L12A 2GVEA 2C0HA 2WSQA 3OBEA 4NG3A 1MEHA 1SVDA 1FRBA 4JIHA 3ANYA 1DWJM 4HPXA 4IQDA 5CZJA 1DIDA 2F2KA 4GUHA 4Q4SA 4GZ7A 2E4TA 3M7WA 3MYPA 1QPKA 4S3AA 3EOEA 5K9XA 5AVNA 3UR7A 1CI1A 2OEKA 3RN6A 2BDQA 4REQB 2GFTA 3BGGA 4IOTA 5EGRA 3SFWA 3PPFA 1XHGA 5H91A 1WXZA 3DHDA 3RX4A 3C2EA 4GXPA 1ZFJA 4LS1A 2AQVA 3B9OA 4JL2A 4AC7C 2GVYA 2WQPA 1Q6QA 4BS0A 1DE5A 3H2EA 3M46A 1KR0A 4H9VA 1GPWA 1O5QA 4DO6A 2BODX 3C56A 3W1TA 3OLEA 1YTEA 3UZYA 3LUTA 1XH2A 4ZCWA 2W5FA 4G5DA 5DF0A 1WAUA 1VEMA 2BS9A 3QV7A 3BAIA 2Z7KA 1RP9A 1EC8A 1M7PA 1V8EA 3MUCA 1VF8A 3MW7A 3SUWA 1P43A 2ZBTA 4QJ5B 2BTMA 3W1LA 4G2DA 3A5VA 4UTJA 2DY3A 2I9UA 1ITUA 3SJNA 1Q6OA 2Y2WA 1NWUA 1TVLA 4W5ZA 3PZQA 3ANVA 4PTVA 4R5EA 3U3HA 3R2GA 6XIAA 3QOKA 9XIAA 2G50A 3A9BA 4J3XA 3THUA 3T40A 4IJCA 4O28A 3N2CA 5MKGB 1PEZA 2DZVA 4AZIA 3W73A 4WEVX 1BSLA 1WZMA 2ZZ3A 4MB5A 3DGBA 1AL8A 4IIHA 4JTGA 3W01A 5CZKA 2WSPA 2W6RA 5DELA 1GEQA 3M5VA 6TIMA 4GY1A 2FZMA 4IMCA 4ACZA 3V7PA 2V3GA 1GYMA 1XRSA 2J7EA 4XAGA 3L0KA 3GS6A 3NGJA 3F5KA 5GPRA 3C3UA 5FD0A 4FIQA 5AHMA 3VIMA 4RXFA 4R7OA 3UPWA 1TCDA 3LN3A 2AQWA 4HJWA 4JTJA 3CUXA 3ITLA 3RFAA 4XIAA 2VP8A 4H19A 4W7WA 1J93A 3BJSA 2QCLA 1CDGA 4O1FA 5E0CA 3MY9A 1HL9A 1VCGA 3GW0A 4A6GA 3PP7A 4IX0A 4PMQA 1HKMA 4I7WA 1Q13A 3MZNA 1MW0A 4PBFA 1VFLA 1H7XA 2VDHA 3RRAA 3B0YA 4YCOA 5AZ0A 3WH7A 6REQA 4EPDC 4LBSA 4AZBA 3GVQA 4QQ3A 3NQDA 3MV11 2E6FA 3CL6A 4DQWA 3AIRA 1MEIA 4ZZ9A 3REQB 4AC1X 1Z6KA 3K8KA 3CTTA 4E8GA 4HSOA 4HU3A 3PFMA 4IF2A 5I3GA 1LQAA 2Q6ZA 3VGDA 3ALGA 3QVQA 4OV9A 2CLMA 3B05A 5EBAA 4AEOA 5HATA 2AAMA 3G1DA 4PCNA 1KB3A 3ZSSA 3FNDA 4NNCA 4ERAA 1EC7A 2CITA 1UP2A 4UXDA 4L6HA 4H01A 1AW1A 3L4UA 3H2OA 1LBLA 4C6MA 4GCXA 4PB3A 4XKYB 4A8RA 4JNMA 4OFCA 1OFAA 2VUNA 2BP1A 3T0TA 1OD0A 2OXNA 3EKGA 3WG6A 4ADTA 4Z2LA 1MW3A 4XAPA 4H9YA 4O13A 5LIYX 3O6AA 4PCPA 5D2WA 1GW9A 4GGBA 3GDBA 1PHQA 1JAEA 3AS1A 4I6VA 3RGTA 5TF0A 1FHDA 3TJLA 2E28A 1AQMA 4UCFA 3HG3A 4M3PA 4C7GA 4O50A 1I2PA 2QPUA 2OELA 3CUFA 3HGSA 4PODA 4KWWA 2TMDA 1WZKA 4GINA 2V8ZA 3Q65A 1SJCA 2WMHA 4TX6A 4QJ4B 2ZXBA 3GTXA 4E38A 1XH0A 1I2NA 4A3YA 2CW6A 1D8WA 4C1KA 2DT0A 1S2AA 2GGGA 2A3AA 4NAEB 5CZ0A 3WLLA 5DFAA 1VPXA 2O9TA 3Q94A 4O54A 1KKRA 2J4GA 4WSKA 1Y5WA 3K1DA 1DJQA 1RD6A 3OBKA 3VCCA 1K3UA 4JS3A 4F66A 4H41A 1AZ1A 2R1NA 3BL3A 4UCGA 3GZAA 1U83A 2QDEA 1JXJA 3ZVHA 1OF6A 4MNJA 4OT7A 3CS2A 2NX1A 3EDJA 4GQBA 1NH6A 5A6KA 1A5KC 1XUZA 5LIKX 2JFEX 3SQSA 3LG3A 1C8YA 1CTNA 4BHYA 3JZEA 3B0VC 3T0CA 3WMBA 3GUGA 5DX7A 4S3CA 1LYXA 2X1SA 1TPVA 1XH1A 2VJXA 2YDRA 4MKSA 2OEMA 4RNFA 2ZVIA 2VWSA 2EPNA 5DXYA 4URIA 4KERA 4Q3MA 3W2JA 4GMEA 2Y4SA 4UNKA 4AIUA 3CO8A 1Q6GA 1W31A 1W1ZA 3M0LA 1VBHA 3MUAA 5CPNA 1Z89A 2W62A 2EPHA 1ELSA 1F6KA 5LIXX 4WJXA 3GDKA 4NAFA 3QM3A 4M56A 1TZZA 5AYIA 1SO5A 1PDZA 2XSBA 1JFXA 1ZS2A 2X16A 3W7MA 3WN6A 4HZ7A 4Z42C 3RUBL 1I9CB 4H8UA 3GY1A 1ZJBA 1GVRA 1Y5VA 1UHVA 2PP3A 5L9FA 3EDEA 3APYA 3LV5A 1HW6A 4K36A 4ORMA 4GC4A 3CO4A 4Q8QA 2HCVA 3BJFA 2XH2A 1MFVA 1VFSA 5CGQA 3GR4A 2IKJA 3GAYA 4ZE5A 2ACUA 1G4SA 3RLUA 4RCXA 2QMJA 1GK8A 1W3KA 5C0QA 3DG3A 2NVCA 1MUWA 4PTWA 3UJSA 2OQYA 3E2RA 3L21A 3K1GA 3T7VA 5I6SA 2CYGA 3VKBA 5TAOA 3QHNA 3CXOA 1DJIA 3QR1A 1J11A 2J6VA 3G1RA 1VLIA 4CNUA 4DPQA 1TMLA 3F5LA 5AC5A 1NU5A 4F2UA 3QTPA 3HQ1A 1WKEA 2WMIA 3C0LA 1XIFA 1XUUA 3SCOA 3UBPC 1C8XA 2INEA 3MI6A 3O15A 5HINA 5A69A 1DWAM 3M1ZA 2D3NA 5EY5A 2PBOA 3ZLHA 4DN1A 2DIKA 4LUSA 2RJHA 3C8NA 1V02E 1O4UA 3GG8A 1PWMA 4AVNA 3WELA 2WK2A 1EDTA 1IZJA 3PZIA 5FESA 4Z1DA 3WQWA 3ZFHA 1TPC1 4IFOA 3IUHA 1OM0A 3QXBA 3CAKA 5DCEA 1CWYA 3GIQA 2DVXA 1R3WA 4M6VA 1AH0A 1F74A 4Q8MA 3WFLA 1LRTA 4YTQA 4UTLA 2X8RA 4YPJA 2JGYA 3THCA 2OYKA 3DIPA 5IDZA 2CBJA 3NSMA 4KEUA 3W7JA 5I77A 3GG0A 3NEVA 1OCJA 2QJMA 5AECA 2V5KA 3E9AA 2YB1A 3MMUA 3W7IA 1EPVA 2PRHA 1SUXA 1EP3A 3WDPP 4D71A 1H1YA 4WXYA 1ZCCA 1TJRA 3HF3A 4XUGA 1WDRA 2Z29A 2EPLX 3SRKA 3UR5A 2ZXQA 2YYTA 3U48A 5BU9A 1JDAA 2ZA1A 4WKAA 1WX0A 2PMQA 3TQ0A 4M7SA 1I1WA 2GJNA 4LGXA 3PM6A 3BZGA 4OBRA 4DF0A 1C7TA 3EEZA 4O57A 1X97A 4YHEA 2P3EA 3MDUA 4US5D 3ITGA 4MNLA 1TA3A 3TWBA 3WNLA 4X0VA 5AYBA 3T8LA 3EOLA 4DUXA 4C6JA 3S1WA 2FMOA 3AZTA 1PYFA 3K13A 4F9JA 2VEPA 1MNSA 4GO8A 4AF0A 1H2JA 4HMDA 1QFEA 1VBUA 1XPGA 1CX9A 1R3SA 1YPIA 4PB4A 5FF2A 3DCPA 1GYLA 2E9MA 1CXKA 3FHAA 2UBPC 4ZODA 3RLHA 3MCMA 3N15A 5CC7A 1EUAA 3VNJA 5DY3A 1GVEA 1KBIA 3AQUA 3A4WA 3K5XA 3WDQA 1DWFM 2BVDA 3QC0A 7A3HA 1QPQA 4MNMA 2VR5A 4S38A 1JXKA 3I4EA 4RDYA 3TFXA 4Q4QA 1NDZA 1YQ2A 3B06A 4WLCA 4M1BA 5EFFA 2GGJA 2Y8KA 1CBGA 1XGZA 3BOFA 1JDDA 3TIMA 3UCDA 1G69A 4R9OA 1UD2A 1GEHA 4JEQA 2EPMX 2RAGA 2AL1A 1KKOA 2OX1A 3CIXA 1YIXA 1P6CA 1K8XA 1MXGA 4BEQA 3N6JA 1E4LA 1DBTA 1EQCA 3OU8A 3VVGA 3BW3A 3EWXA 3A4AA 1EO7A 4ZSTA 3NNTA 1MW1A 5D9NA 3PJXA 1MNZA 4BI5A 4H8HA 4IGNA 1Q7ZA 3ZLGA 1R47A 3FDKA 3SCQA 3WQ4A 1V6WA 3WK3A 2HROA 4IGMA 3B04A 3AXIA 3SGZA 3E96A 2WC3A 4RDZA 5I00A 3ARWA 3V5FA 1PX4A 2VOMA 3SADA 2FJUB 3O07A 3AMLA 1H0IA 1RBLA 1V6TA 3H12A 3U7VA 1K02A 1TJ0A 4GNJA 4QXIA 3APGA 3G6LA 5AYYA 3UA3A 3WH9A 3MBDA 4DYJA 2AOSA 4HTYA 3CIWA 4IPLA 1EX5A 2DGAA 4XQ6A 2GGEA 2ZVRA 4LX4A 4IIGA 2GSEA 4WZHA 3U5YA 4RKAA 4JZ5A 3VDGA 2G5WA 4MB4A 1ZBWA 1W3LA 3VCRA 1W8SA 3MUY1 3W1PA 5FJPA 9RUBA 3GXTA 3ITVA 4MDPA 2PU0A 1QOQA 3KE0A 4AYSA 1T5AA 4IG2B 1YE6A 2ZRYA 5D04C 1RQHA 7REQB 3LLDA 2DZUA 2XFRA 1VFMA 4LEFA 2Q09A 3NDYA 3G1SA 4U4MA 5DBUA 4DO5A 1E4IA 3J7HA 4MKNA 1HKKA 4MM1A 1KV5A 2DV0A 3FJLA 3FIGA 3RR1A 4H7CA 1TJPA 1UUQA 4IP4A 1YXCA 1UZ4A 5A8GA 3EXTA 1QMLA 3PY2A 2W9MA 4N9CA 1HGYA 5AC6A 3QV8A 1SGJA 3VNLA 3R43A 3MI2A 3UVAA 1RH9A 1CENA 1V77A 4PMZA 2V68A 4MWAE 4ZOCA 1WKYA 1ECEA 2QUNA 1J6OA 4CKQA 3LMYA 1TPUA 4MSSA 4KT2A 3URNA 1YTKA 4DZ5A 3RIKA 3CB3A 3IUDA 2XVNA 5D02A 3OJGA 3KLLA 3P62A 4R27A 3TOPA 1J5TA 1EL3A 2NV1A 4NL1A 3EOUA 1ZBVA 3NQGA 3NZ1A 2OX4A 3MCNA 1ME9A 1QASA 3FLUA 3T4CA 4HSHA 1RVKA 3F4NA 2FZBA 1WE5A 3PULA 5B7ZA 4AD4A 3BG9A 4QDWA 3W28A 4EWJA 3NQAA 4EK7A 1C9DA 4BWLC 5IFTA 1UWTA 2DJLA 2V5LA 2G95A 1V3KA 5CXPA 1J0KA 1KR1A 4EKJA 5FEWA 3T05A 3UNTA 5BRPA 3U2ZA 3R10A 1R86A 2NXIA 2XYLA 5I3FA 2L5HA 1TUFA 4XZ9A 3URQA 2ISFA 4FNTA 3GVRA 4HYWA 5FAJA 3DXIA 3S8HA 4EXQA 4FOUA 1BEUA 3W74A 3EXSA 1TJ1A 4GA8A 2IKGA 1C91A 4Q6XA 3TAKA 4F0RA 3GK0A 1YYAA 1G1YA 1T6MA 4QIUA 5CAHA 3HPXA 3F5JA 1A5AA 1GOKA 3GXNA 2FLIA 1OADA 3QH2A 4G9PA 3GC4A 3W9ZA 3GW3A 4PRRA 3CNYA 2DT2A 3AU2A 4HPNA 4HMCA 4DWDA 4DYEA 4K7YA 1M3UA 2PDPA 3C4UA 5CKSA 4QQUA 3MYOA 4FZIA 3IWPA 2E6DA 5C9UA 1W1PA 2PC4A 4BR1A 1FVPA 4LYKA 4QBXA 1C29A 1X6LA 4O52A 1XBYA 2QGYA 1TV3A 2E5BA 3OA5A 1FFQA 1ESWA 1L6GA 1Q2RA 1WBHA 2YL9A 2ZX6A 3O6CA 3NPXA 2OSYA 2Z25A 1GW1A 6ALDA 4CVUA 3EMZA 3GC2A 2P0OA 2B31A 1XKYA 2H3BA 2WW5A 4LTSA 2Z1XA 2Y5EA 2V81A 1XF0A 3AIWA 2E09A 1Z32X 4AHOA 5LNRA 1FCBA 1LBMA 2G41A 4K38A 3S0CA 1ZLPA 3PJWA 4ASTA 1ZP3A 1OF8A 2FIQA 2GQAA 2IPWA 4PMJA 4JTRA 2PRLA 3FY1A 3GVGA 1Q6CA 4HKPA 2PGWA 2ZRZA 2A0NA 1MRQA 3NZGA 3QOMA 4QSFA 3WYZA 3DFHA 4LRTA 7TIMA 4W7VA 4EXBA 1EKOA 1O5RA 4Z2KA 1VPYA 5IBXA 2V3FA 3SCUA 3UCCA 3SY8A 3N3MA 2FHFA 1A3WA 3QYSA 1K4GA 4LQ1A 3STPA 1ISYA 4XZBA 3H7UA 1E55A 3BVJA 4R53A 2P0IA 2E7FA 2YA2A 1EA0A 2WPBA 4OE7A 1MXSA 3GAKA 3N11A 5C70A 3ARTA 4D6DA 3LCWA 3UZWA 4JTSA 4HHLA 2GJXB 2YXXA 2PBGA 3BLDA 5E5CA 2ISDA 3W2UA 1X6NA 1P6WA 1XDLA 4NYUA 3DFNA 3CV6A 1Z42A 1EJ7L 3L5LA 2J27A 3BAXA 4Z2HA 1S2UA 3MKVA 3AHXA 4IGSA 4XO7A 1QNOA 4Y9PA 1VJZA 4GD0A 3UVIA 4DEFA 2F84A 1G4TA 4JQAA 1E3XA 2HK0A 3DFPA 5K4XA 3MKCA 4DBEA 3KP0A 1KRCC 5A8QA 3ARUA 3GVVA 2O4MA 3UR8A 1PL9A 1QO2A 2FKPA 3SZ8A 2AMGA 3KVJA 3RCMA 2VZSA 3EWCA 2OCZA 1QPNA 3RLVA 2CLOA 3CHVA 3VIHA 3PUDA 3VD3A 2B0MA 1PTAA 3W2LA 1Z41A 5G4WA 1X7FA 1WZAA 4S1FA 1YW1A 4HK7A 1KO0A 4JDYA 1ISVA 1TV8A 1ZHAA 1PKNA 4GI8A 2ZX7A 3GTNA 3GG7A 5J8LA 2ONEA 3LNMA 4AD5A 3WMCA 1ZCOA 1UH3A 3T44A 5I2UA 4YTTA 4JHOA 3OOQA 1S1PA 3WLHA 2BGNE 4V28A 3S5SA 5REQA 4Q4KA 4E4PA 4BFAA 5KMYA 4GYJA 3WJYA 3TVAA 2VEIA 1CGYA 2PURA 3BLFA 1W9BM 2OR2A 4NI3A 2HV5A 3M0VA 4J5NA 3R6IA 3MP3A 1XW8A 4QROA 3LGEA 1OG6A 4DJEC 1XLAA 3AHVA 1TX2A 3CLWA 1PKMA 1UKTA 3KVMA 1U33A 2QJJA 5C54A 4I6KA 5KITA 1US0A 2NX9A 1QHPA 3FJ6A 3PWAA 4K37A 4NYYA 2C18A 1YEYA 3ME3A 4JIPA 2PFHA 2HVNA 3FA4A 3OVPA 5CBBA 4F79A 2F6XA 3R79A 1MRAA 1J10A 4L1XA 1E1CA 1C93A 2VRKA 3BO9A 1QPRA 4JIQA 4C6EA 3JVAA 1QNRA 3UGVA 3AFBA 4A8IA 3PPGA 3N9RA 3CQKA 3N3TA 1AD4A 3TUUA 1HJQA 1QI4A 3EWYA 4F2BA 2C1IA 3LPPA 3SRFA 1YDNA 3GXMA 1FQ0A 2ON3A 5BXRA 2PDUA 3KEHA 1E6XM 2XM1A 1L6FA 4RE3A 1M7XA 2PDFA 3BWWA 3BLKA 3S5YA 3W88A 3T07A 1UH2A 1US3A 3EMCA 2FQIA 1KM2A 1GVSA 2DQXA 2YW4A 3N9SA 4BK9A 3HQOA 2YCLB 2REQA 2CLEA 3R89A 1ITXA 2ZX8A 1IF2A 3VGBA 1WO2A 2CHOA 2ZUSA 4IPPA 2OT1A 1KWKA 1UWQA 1GQJA 2DU2A 2V9DA 3H2CA 3RITA 1XLBA 4IMGA 3VKCA 4C90A 2YBUA 4LUYA 1M65A 1A5OC 1XG3A 3N14A 1UWIA 1M6JA 1EX1A 2BLEA 1M7OA 4D8AA 5EYWA 2GSHA 2GVLA 3K4AA 2VCBA 1EJUC 5ABFB 2XGBA 3WD4A 3NZPA 3T0BA 2F2HA 1OZQA 4E2VA 3KBNA 3EDKA 3NQ8A 4KS0A 1SPQA 4YMZA 3E2QA 2BGSA 2QCFA 2WCSA 1UROA 1UUOA 3EYPA 3D3FA 3TW7A 1W2VA 1WDQA 3NUKA 4PEKA 1TREA 3L67A 1UR4A 4PMRA 1GGOA 5LXXA 3KP1A 1M9HA 1KXHA 1LWIA 1FWTA 4KFNA 2O56A 3THAA 2WBKA 5BRBA 4MLJA 1D2KA 3OVGA 3U2OA 4QRNA 3AIUA 2TSYA 4ZQRA 4AY8A 3EZ4A 1A0DA 3UY8A 5I24A 3U2CA 3RU8X 3USZA 5AHFA 3M44A 3PBYA 1L9WA 2H8XA 3C5QA 4RZBA 3BAYA 3UJFA 4IPJA 3EPNA 1LORA 1OCNA 1XFBA 1HL2A 3QPYA 1GPFA 4AZ6A 1R5YA 1EJVC 1XKJA 3TYBA 2PB1A 3PG9A 4J2MA 2X1RA 3L66A 1YBQB 2J24A 1ME8A 3I7SA 4XIMA 3U8GA 5CLTA 1BXCA 3IUIA 2OG9A 4WY0A 3AS0A 3LZ3A 2VNCA 4LAKA 4JOMA 1KRMA 4TMCA 4O0KA 1GZGA 4MGGA 4M5PA 5CG0A 2QUUA 4MKVA 1DTUA 3RMEA 3I68A 1UP0A 2WCAA 5C9WA 2WWDA 3ZJ8A 3H2MA 2EO7A 3PZTA 3USBA 5EMJA 1EXPA 1JPMA 1JCLA 3SSJA 4TOQA 3FYYA 1TV4A 1LRNA 1VEOA 3SDOA 4NASA 2FGZA 1G7UA 4JKKA 3IK4A 1ZJAA 4MADA 1FH9A 4L9YA 3CTLA 4F0SA 2Y7EA 1Z69A 3WQVA 2QDGA 4MWAB 1EJWC 3T2QA 4FP1A 4TVDA 1DIKA 1KWGA 5ECUA 3R4IA 4WOQA 2NQLA 3SCRA 4KWUA 3MPGA 1VIWA 3NPVA 2CEQA 3OQ8A 2X1UA 3QR0A 1KCXA 3B8IA 4L1WA 1CLXA 1FWWA 2A7RA 4ZE4A 1IT7A 3EKLA 4GYPA 1NIUA 1GVQA 5IM51 1LT8A 2V82A 5G1TA 1PVNA 3YPIA 3B3DA 3N2BA 2XWEA 2XPKA 3E5BA 3HGJA 2RJGA 4NXKA 4E3VA 4EAYA 3HTWA 3OBAA 4MY8A 5TBOA 3NQVA 1BYCA 3M5ZA 1DJXA 1MUMA 2RGMA 3M6DA 3K2GA 4JIRA 3S2CA 1AODA 4UOQA 4XZLX 4UR8A 2W66A 4NHVA 3PSWA 4L4OA 3T42A 4LVAA 2ZRVA 2RHGA 1Q4WA 3IJ8A 2R1KA 4B5UA 4B91A 3R7MA 1CPUA 1OVDA 4UTHA 3VIKA 3ISIX 3GNRA 3F03K 3LDVA 1YMYA 4LUTA 5DO8A 4F9DA 3N13A 3VNDA 3OLIA 3MMDA 3UG3A 2YR1A 5CSUA 1E0XA 3GTIA 4PGLA 3UWUA 2J74A 2UZ9A 4WDUA 3MV01 5K7JA 5FF0A 2D2OA 4QJ3B 5K2ZA 4LOCA 3S1XA 1A0CA 4OIFA 4DJDD 3H6OA 4YWSA 1EEPA 4PTXA 1HQTA 3LS9A 4GBDA 3LXAA 3DHUA 1L6YA 1ZSXA 2W0UA 4ACYA 1RPKA 4HNOA 3PUEA 1FWJC 3OZPA 3GTHA 2EJ1A 1XLMA 1Q65A 3WH6A 2O9OA 3C6CA 5IRPA 3P8IA 1E9IA 3WLSA 1UZHA 2JIEA 4IJBA 4GQRA 3KUMA 4CN6A 3LNPA 4IXXA 4LEQA 3O16A 4AZCA 4ZSUA 3BSMA 2F38A 4U5IA 1NTHA 4I9MA 3LTYA 3E1F1 5HMSA 1W8GA 2E1WA 1H41A 3A3HA 3UU0A 5K3VA 5FOOA 1EZ2A 5JQ9A 2QAFA 3FJ4A 2VEMA 1TPFA 2V5DA 1DXFA 4MJMA 5HWMA 3RPTA 6PTDA 3K8LA 2E6AA 4FR1A 1XS2A 5B7YA 3M07A 4AEEA 1DJHA 3NSXA 4X3ZA 2R82A 2GZXA 3S2NA 3QW3A 2D0FA 5BOFA 3M64A 2J8GA 2VO5A 3HQNA 3ZR5A 1E40A 4D6JA 2E5DA 4GVFA 1A3XA 2ATMA 4U3CA 2A3LA 1JI1A 4ZENA 2WLZA 4CD5A 1RD5A 4XO6A 2HJPA 2QULA 1UZDA 3TTEA 3KBWA 3G0UA 4C6IA 1V03A 3UETA 3KZPA 4R9XA 1C9WA 5LNUA 2ADAA 1F8MA 5AVHA 1DL3A 1LOQA 3WX7A 1PCWA 2PF0A 2DT3A 1XIIA 3WLOA 3AICA 3VMPA 5E70A 3O0KA 1R2RA 5CPQA 3PZNA 2DH3A 2CHRA 5FEPA 3BLOA 5CLWA 1RK6A 5LSMA 1UD3A 3KBMA 3IIVA 2DQWA 3WD0A 1OFEA 1KFBA 4UFIA 3KVLA 4AVFA 4DX3A 2C16A 1RA5A 2I57A 3THQA 4FIRA 2VX5A 2WSRA 2CU0A 4QX4A 3G2GA 1UASA 2OZ3A 3TR9A 1TWDA 3H22A 3CPUA 1TTJA 4DF1A 5BOOA 1DJNA 5CJ5A 1SO6A 4FX7A 1OFQA 4XZMX 1HKJA 4TUFA 3VNKA 1JDFA 1Q7QA 3ICJA 1EH9A 4N9EA 2VX6A 1UD5A 2GOUA 5GJNA 3TN5A 2GVGA 1CZ1A 4DAFA 4L64A 3WLJA 2BSLA 4KF1A 4PFHA 3PPCA 1NY1A 3U0HA 3I4KA 1W5OA 1X1NA 4AHPA 4W8LA 1UWAA 2H9AB 4NRRA 2Y88A 2J78A 3VDBA 3CZEA 1P5BA 1A80A 1JZ2A 3DECA 1IT8A 1TZ7A 4HNCA 2RDXA 3JUGA 4HNLA 5DLCA 1W9UA 4C6NA 5CJMA 4MIMA 4W8BA 1DIEA 4PYSA 2NLYA 1F07A 4O1BA 2QDDA 1XLHA 2XIBA 1IEQA 4ML4A 1L2QA 5CQ1A 3SM0A 1JCJA 3Q4DA 3WQDA 2O9RA 1QAPA 4N4PA 3S46A 5M17A 1F2JA 4DWSA 3QV9A 4I8DA 2J8TA 3U5UA 2J75A 4LVFA 5M3WA 2ESCA 1V7YA 1V6UA 1HXJA 3K46A 2YCIX 1XBZA 4IL2A 5C5YA 3LHTA 3GWQA 4D8ZA 3WEZA 4PMXA 2WM1A 1GNXA 3EXRA 3I6EA 3SUTA 3FXGA 1NQ6A 1GORA 4LAOA 4S2CA 1P0BA 4OGZA 3W24A 4JNZA 2JALA 4CNSA 1QTWA 2CCRA 3HB9A 3GVWA 3SGGA 3VOGA 1KD0A 5DBTA 3WLMA 3TTOA 1R2SA 1SQ7A 4W7UA 3G1VA 2A6NA 2GUUA 4X60A 3HU7A 3T55A 1E56A 3VO0A 5D2VA 3SCWA 3CT2A 1OD8A 3SCSA 4XAYA 2Y24A 1JYXA 3ZYZA 2DSZA 4PTMA 1I2OA 2VHLA 4K1GA 4FNSA 1NDYA 3VFLA 3QZ6A 5HMEA 3EWDA 1G5AA 3E0LA 4WD0A 5C8BB 2ZICA 2OLAA 3EX1A 2V30A 1XSIA 1JZ7A 3SN4A 2WBGA 1ZALA 3V18A 4F2TA 2WKGA 3IJLA 1XICA 2FPTA 1K9FA 3MCOA 2JKPA 1GONA 1FY6A 3W07A 3WMSA 4JYDA 3RPMA 1HL8A 2Z7GA 3G22A 1JPDX 2O4QA 4HA0A 5J04A 1FX6A 1GQLA 4E6MA 4LANA 4ZB0A 2FZ8A 1HP5A 2YOCA 4IQLA 1KLYA 1KM6A 1YNYA 2EXOA 3LSCA 3UWQA 4P8UA 3U57A 4LH8A 4PTNA 1SFTA 4UR7A 3WLIA 2PAJA 1VGAA 1PE1A 3RM4A 1LUCB 2NSOA 2XJ7A 3GG1A 1E5JA 1P7TA 2OSXA 1AA1B 3F4VA 4RPQA 1T7LA 4GKTA 5BZAA 1XIJA 4QG9A 4PB5A 4RDVA 4E2BA 4HU4A 2O0TA 3STEA 1C92A 3E74A 3CH9A 1KRBC 1UD8A 4UFKA 2EBNA 1MMFA 4J2PA 2UWFA 1JVNA 2NQZA 1HKIA 3F7JA 5A6SA 2ZADA 1U5HA 4DO7A 4NT0A 2FB3A 3TYUA 3OIHA 2B81A 1UWUA 2GYIA 3R11A 2YA0A 4GQ0A 3O2LA 4JY8A 5AN7A 2PUZA 3KTCA 3WDJA 4C6QA 4P7OA 4RR4A 2J13A 2ZX9A 1UYQA 1FCQA 1XD1A 4S3JA 1YX1A 1MZHA 1TSIA 2UY4A 2FHBA 4YHGA 1F8IA 3NWRA 3KRSA 3C3NA 4MY9A 2Z1SA 4RE2A 4X0NA 3S2MA 2BMBA 3S1GA 3AC0A 1J79A 1YHTA 3F2CA 4NZFA 2QJIA 3NQCA 4JX6A 2NLIA 3BICA 3P7YA 7TAAA 4UQAA 1NOFA 3IIZA 1EF2A 2ISSA 4YTUA 3PTDA 3GHUA 1I0BA 4WHBA 5FJJA 3W1QA 3AWOA 1XGEA 1EIXA 2GUYA 2E5CA 4S39A 2XVLA 2WHJA 4JPGA 3GKAA 4WXZA 1TB3A 2B4GA 3FAXA 3M4HA 3BDKA 3OO2A 1FHLA 1UIOA 1VFUA 3OPSA 3AYTA 1V7AA 5A94A 1JDCA 3MQTA 1TPDA 4WX2A 4CN4A 1B30A 2NX3A 3G8EA 2XISA 3EB2A 2J47A 3TTQA 5ECVA 4QCFA 3G77A 1OFPA 3WF2A 4C65A 3DZ1A 4Q4PA 3UESA 1TWZA 2EG7A 4O19A 1AQHA 2J7CA 4CCEA 4I9AA 3QMRA 3C0SA 4A3QA 3BSHA 1N82A 2GJXA 4CVWA 2VCCA 3HA1A 3GFYA 3FS2A 4PRTA 2QF8A 5CCZA 1PZ0A 1XXXA 3GTFA 1H63A 2FYMA 1VCVA 1G01A 4MWAD 3OQEA 1IXQA 2Y7GA 4U31A 4GE8A 3W6MA 4W86A 3ANUA 3S3GA 1YXYA 2DW7A 3R0UA 4ZBCA 1UD6A 1XD0A 2GVJA 3W72A 3W7CA 1JPIA 4IGHA 3RYSA 2B7OA 2C8NA 4O16A 3VCNA 3WBWA 1QWKA 4JFTA 1PIGA 2BOEX 1HJUA 3DEQA 3WQ6A 4Z1YA 4P8XA 2A7NA 3CK5A 4A29A 4H2CA 1W3JA 4KW2A 5SWUA 1HVXA 4H1ZA 5LNVA 2YL5A 3WQOA 3KOZA 1PPIA 3WKZA 2YBTA 4P61A 4XBJA 5KTLA 1X98A 2OO6A 2O7SA 4WCJA 4GG9A 3VGGA 2HRWA 3FYOA 3ITXA 1EDQA 2AGKA 4HHHA 4K8EA 1UQYA 2XFYA 3P81A 3WBAA 1UMLA 1E72M 4JN7A 2W92A 3MJYA 3FOKA 3AHZA 5KZ6A 4D6HA 3OHMB 4RXGA 3QY8A 2I56A 3WZ0E 2TRSA 3WBXA 1SZRA 3LLXA 4LCSA 2Z2BA 4AZ5A 1WV2A 1XI3A 2ZRXA 1REQA 4OQVA 3H7RA 3SBFA 4X22A 3CLMA 4UFJA 3Q37A 4JTLA 1W5MA 4LV9A 3TMQA 4QM1A 4HTBA 3QGVA 1U22A 1KFJA 5EFDA 1SZEA 2ALDA 4WGHA 1UKPA 3RX3A 3BJTA 3NOYA 5M1TA 3MJMA 2OGJA 4J35A 5IBXC 3UA4A 4OOZA 4O4VA 3SUSA 4AWEA 4IUOA 4ZQMA 1HTIA 3QW4B 2GK1B 3KBSA 3SO7A 4B5XA 2FZNA 5FF4A 3ERPA 4F8XA 1BGGA 3EX3A 3W7QA 2XINA 4P7LA 2CLLA 3GB6A 3NPWA 5F1VA 1FWEC 4I7UA 4RLIA 1O12A 3OGRA 8XIMA 5XIAA 1J0YA 4GXWA 1J0JA 4MDOA