1QUSA

1.7 a resolution structure of the soluble lytic transglycosylase slt35 from escherichia coli
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Escherichia coli lytic transglycosylase Slt35 reveals a lysozyme-like catalytic domain with an EF-hand.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
total genus 110
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qusA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qusA02
4PRQA 5KXPA 1ZMYL 4H8ZA 1REXA 3WUNA 1GAZA 1B7QA 2CWIA 5HMVA 1QQYA 3B72A 4GLAA 1CJ9A 4OWBA 2W1XA 1IP7A 4DDAA 1LJKA 1QDTA 1B5UA 1UCOA 4H92A 4YENA 5APEA 132LA 4H94A 3M3UA 2BQOA 4OWAA 1C46A 1LHIA 1LSAA 1WQMA 3TXEA 1HMKA 3CSRA 3QNGA 5APFA 4H9AA 1GB9A 1NDMC 1IP5A 2LZ2A 2DQDY 4H8XA 4M6DA 2N5ZA 3M18B 3OK0A 1GFAA 3WU7A 2HU1A 3RZ4A 4B49A 4WM6A 1LSDA 1GB2A 4GCEA 4NFVA 4WLXA 1VDSA 1GBXA 1LMCA 5FCPA 3BKHA 1DKJA 4WM3A 3ATNA 4B4JA 4XJIA 5I53A 4NSHA 5FDJA 5DLAA 4CGEA 5FELA 2DQEY 1EQEA 4GLVA 5LIOA 3W6DA 3AZ5A 3CB7A 1GB5A 4P2EA 4PPOA 2Z2FA 4MSTA 5C6LA 3CQLA 4OOOA 5KXOA 3WMKA 2BPUA 1LJIA 5KXKA 1HF4A 1V7SA 4GCBA 5II3A 2EPEA 3AGHA 1HHLA 1LKRA 4HTNA 1BB3A 5T3FA 1LJHA 4G4BA 2FBDA 2G4PA 5FHWA 3W6CA 2D6BA 1F10A 1HFZA 3LYMA 5DN4A 1LHJA 1GF5A 1LZ9A 1I20A 2B5ZA 1BGIA 1GFUA 2LYOA 4ETEA 1FLWA 1C45A 2ZQ3A 1D0KA 5LXWA 4Z3MA 1GBSA 4H90A 1IWUA 1DPWA 4G9SA 5KJ9A 5EBHA 2DKVA 4WLYA 4DC4A 2F30A 1GHLA 1LSFA 4GN5C 1VDPA 6LYZA 5LA8A 2XJWA 5LAFA 8LYZA 1GFRA 1LMOA 1IR7A 5HMJA 1LMQA 2YBMA 3VWOA 4ZFPA 3G3BB 4R6CA 2HEFA 1FLQA 3WVYA 1GF9A 5IHGA 1GDXA 1LHHA 3TMVA 1LMNA 1AKIA 3A34A 4RDSA 5APCA 1UIEA 4B4EA 5LVKA 1LMAA 1LZSA 3WPJA 4TWSA 2LYZA 3J4GA 5DM9A 4EOFA 1C08C 1NHEA 2D4KA 4NHQA 4DDCA 1B2KA 1IC5Y 1BQLY 4ML7A 1TCYA 1OUIA 3P68A 4XN6A 5KXNA 1HELA 3IJVA 1D0MA 4DD2A 1CNSA 1GFEA 1LZCA 1LYSA 3P4ZA 1CKCA 3AZ4A 3A95A 4RW1A 4LFXA 4LZTA 3WW5A 2Y8PA 3WH1A 5D5CA 1OUDA 2BQNA 1LZDA 1VAUA 1IC7Y 4N5RA 3T36A 2I6ZA 7LYZA 5ILCA 1LJEA 1QTKA 1V7TA 1N4FA 4NGKA 3EMSA 4KPMA 3AB6A 4XYYA 4HPEA 5LYZA 2YVBA 1LZRA 1XSFA 4DD3A 1YL0X 1HC0A 3QE8A 1MLCE 1JSEA 4C5FA 1JSFA 1LYYA 2HEBA 3WVXA 2YBNA 2H9JA 1KIPC 4GCCA 3TXIA 1IP3A 1DXJA 4EMNA 1GEZA 4H9FA 1A2YC 1AT5A 193LA 1LSNA 4LYMA 1NBYC 2AUBA 1XEKA 1NF5A 2RSCA 1LSEA 3LN2A 1MELL 4ET8A 3GXRA 5AMYA 3LYOA 4OOTA 1BWHA 4HSFA 4E3UA 4UWNA 1GXXA 3GXKA 1B7SA 2DQHY 3TXHA 3HBDA 1LMPA 4N8ZA 1INUA 1LTMA 1JKDA 4N1EI 1BVKC 1XEJA 3WYHA 5KXWA 4LYBA 1UA6Y 1LZ4A 2ZIJA 1GEVA 4GN3A 3CT0A 4DDBA 4N9RA 3N9CA 1LCNA 153LA 3TMWA 1IOTA 4LYOA 5LVIA 1REYA 4Z98A 4MR1A 5K7OA 1JKCA 1LZ8A 5KXXA 1JTOL 2F2NA 4XADA 4YM8A 1JWRA 5B05A 1UACY 1GWDA 1D6QA 1HNLA 3A6CY 4RLMA 1E8LA 1D0LA 2D4IA 1AZFA 3D9AC 1J1XY 1YILA 2GV0A 2MEEA 2ZIKA 1DPXA 3AJNA 1YKZX 1I1ZA 2BQKA 5F9XA 1G7MC 4PJ2C 1JJ3A 3QY4A 2H5ZA 1EQ5A 2ZNWY 2BLYA 5LA5A 1GD6A 3HFMY 1LZAA 1IOSA 3AZ6A 2YBJA 1BB7A 5APDA 3TXDA 1LYZA 3HBHA 3LYTA 3WPKA 1YKYX 3W6FA 1LZTA 1IY4A 4DD9A 3HBEX 1OUCA 1OUJA 1QSAA 1UICA 2EIZC 1HMLA 1IWXA 1GFGA 1B7OA 1HEPA 1JJ0A 5B59A 1HEWA 1G7JC 1HENA 1QIOA 5LVJA 1XGQC 1T6VL 1NWGA 2BQFA 3RNXA 3A8ZA 4J1BA 1JHLA 5DL9A 5C6JA 9LYZA 4WO9A 5B07A 2DBTA 1JUGA 2BQMA 4J0LA 3TXGA 3ZVQA 1EL1A 1XEIA 2C8PA 1XGPC 5KXLA 1HSXA 2EQLA 2D4JA 1FBIX 3EBAB 4LFPA 4TTDA 5LAGA 1UIDA 1B7LA 4DD0A 4NGZA 1HFXA 4LGKA 1WQNA 1IWZA 1IP1A 1GFKA 1G7HC 2BQAA 2CDSA 1YAQA 3RW8A 4ANRA 3D3DA 1GFVA 3CSZA 5LVGA 1LKSA 4NGVA 3P65A 4CFOA 1LAAA 1IWWA 4NGIA 3A91A 2MEDA 2BQJA 3A90A 4B0DA 1KXXA 4MCKA 1F0WA 4G4CA 3AW7A 1BB5A 3OJPA 2Z18A 1LSYA 4HJVA 5ILFA 2LHMA 4LYCA 4UWUA 2LZTA 1UIHA 4QDNA 1IEEA 4R0FA 5I5QA 5C6IA 1GBOA 1A4VA 1C43A 1JKAA 5LYTA 1NKHA 3CT5A 1IR9A 5J7CA 1HSWA 3WULA 2BQBA 3F6ZA 4LT2A 3A92A 2HU3A 3T6UA 208LA 3A3QA 4HTQA 4HJZA 1I56A 4L41A 2WARA 2DQJY 4I8SA 4WM1A 5FEKA 1CKHA 1J1PY 4LT0A 4ET9A 2YBIA 2BQIA 1GB0A 1GB3A 1LSPA 1LZGA 3ATOA 4PHIA 3IWRA 1XGRC 4TUNA 5KXZA 1GF6A 1AT6A 5F16A 3AZ7A 4NGOA 1LSZA 4LYTA 2A7FA 2MEAA 4WL7A 1CKDA 2BLXA 2F4GA 4BS7A 4ZIXA 1OQMA 1ZV5L 2IFFY 5I4YA 3A94A 1IWTA 4NGJA 4XJGA 4NG1A 2DQAA 1ZVYB 1B5VA 1UUZC 1LZ5A 1WQOA 1VEDA 5E9RA 1LJ3A 4H9EA 1RFPA 3SP3A 1IWYA 4J1AA 2ZYCA 1FKVA 3FE0A 1OP9B 1BB4A 3E3DA 2BQDA 1J1OY 4OWCA 1GF8A 1OUHA 4OWEA 4BADA 3EO5A 2MECA 3RT5X 1XGTC 1FN5A 1ALCA 2NWDX 3K3TA 2HEEA 1WQRA 2MEBA 1T3PA 4X3BA 3WXTA 3EXDA 4YF2A 1C10A 134LA 3CT1A 4WO6A 1IX0A 4KL7A 4C3WA 1LHKA 2YSSC 2W1YA 1NBZC 1CKGA 2HECA 1EQ4A 4NHSA 4GCDA 1LPIA 3B6LA 1DI4A 4NIJA 4NY5A 4IASA 1DZBX 1WVVA 5L3IA 4NWEA 3A6BY 3WXUA 3A96A 2HUBA 1LZYA 4FDYA 4BAFA 1UIGA 1O23A 4WOAA 5IELA 135LA 1B7MA 2Q0MX 4W94A 1B7NA 1CJ6A 1PS5A 1TBYA 2FYDA 2Z19A 3RU5A 3IJUA 4WLTA 3W6AA 1GDWA 5I4WA 4HJYA 2PC2A 5LINA 3B0IA 2EKSC 1IP2A 5KXMA 1HFYA 3J6KA 1OUFA 1GF3A 5LVHA 1JIYA 1IY3A 2XBRA 3AGGG 4AGAA 1FKQA 4HTKA 4NHPA 4CHXA 4DWXA 3LHMA 4M4OA 4WLDA 1B5ZA 1LZ6A 1IO5A 1GE3A 1IC4Y 2W1MA 1YIKA 2YBHA 4NGYA 2ZILA 5F9UA 4ETAA 3WW6A 4I0CA 4IATA 1GFJA 1IIZA 1YANA 2MEIA 5KXTA 1GF4A 1B7RA 1KXWA 1QTEA 1QDRA 4NSIA 3B0OA 5L9JA 1KIRC 1UBZA 4G49A 1LJFA 3G3AB 1GE0A 5E4PA 1JITA 1LJGA 1BHZA 1JPOA 3W3EA 1IR8A 3TXBA 1FDLY 4NWHA 3MGWA 3N9AA 1JISA 4H93A 3WUAA 4NSJA 1LSGA 1JTPL 1LZ1A 2XTHA 1GFHA 3A3RX 4GCFA 3W6BA 1HEMA 1QUSA 2YBLA 3WU9A 1OUAA 5KXSA 3TMXA 1H87A 1LSMA 1W6ZA 1TAYA 1LJ4A 4XJHA 5B06A 2Z38A 2MEGA 5KKIA 1TDYA 1F6SA 2G4NA 4G4HA 4WG1A 2ZYPA 2YDGA 4WM4A 3FI7A 4WM5A 4OW1A 4D9ZA 1HEOA 2BQHA 3A93A 2I25L 4XJDA 3W6EA 4CJ2A 3P66A 1XGUC 4PRUA 1GXV2 1IORA 4HV2A 1DKKA 1GBWA 1RE2A 3ZEKA 4U3XB 5A3ZA 6LYTA 1TEWA 1WTMA 4KXIA 1SQ2L 2HEDA 4TSBA 1GF7A 1NDGC 1QSWA 2A7DA 1JEFA 2H9KA 3N9EA 4WG7A 3CSQA 3WL2A 5M1YA 4IJ4A 1HEQA 4WL6A 3TXFA 4H9HA 1VATA 5DN5A 5IDDA 2ZNXY 2X0AA 2Z12A 4XENA 4WMGA 4UWVA 4ETCA 4GN4A 4HPIA 3AW6A 4A7DA 4Z46A 4HP0A 1C7PA 1CJ7A 2Z37A 3KAMA 3AGIA 4FJRA 5F14A 2FBBA 1Z55A 2C8OA 1JJ1A 1LZBA 2CJLA 4QEQA 1VDQA 1IOCA 4H9BA 1IVMA 1JTTL 1IWVA 1UIBA 2Z2EA 1NMMA 4YEMA 5KY1A 1LMTA 3LYZA 1YL1X 4B1AA 1GE4A 4YOPA 1SLYA 4H1PA 1YAOA 4NHIA 1GBZA 2LYMA 2BQEA 5HNLA 3TXKA 1WQQA 1B9OA 4II8A 1GPQC 1GF0A 1FLUA 1OUBA 5D5FA 194LA 1ZVHL 4HV1A 4CFPA 5F81A 3AYQA 1REZA 4H9IA 5JENB 1LSCA 2W1LA 2XBSA 1BB6A 1BWJA 1GB8A 1LJJA 4XJBA 1YKXX 4H91A 1GFTA 4J7VA 5LYMA 4YEOA 4BAPA 1WTNA 4Z41A 1BWIA 1UIAA 2FYCA 1GB6A 4LT1A 4NGWA 4OWHA 2F4AA 4W96A 1W08A 1WQPA 5I4XA 4NEBA 1GE2A 2IHLA 1F6RA 1G7IC 1RJCB 3LZTA 4N0JA 2BAAA 1YQVY 4NG8A 3WU8A 1GE1A 154LA 1RI8B 2VB1A 1GAYA 2DQIY 1LYOA 1UIFA 2DQFC 1CJ8A 1LJNA 4QGZA 1D9UA 2DQGY 1XFPL 1PZYA 4TSCA 1GBYA 2BQLA 1B5WA 1LSBA 1VDTA 1VFBC 4AXTA 4TX7A 1NQIA 1YAPA 3ULRA 133LA 1B5YA 1B5XA 2MEFA 1BVXA 4KT3A 3P64A 4H9CA 1KIQC 4DYGA 1B7PA 4LT3A 4ETBA 2HTXA 3TXJA 1CKFA 1LZEA 5A3EA 1GB7A 2Z39A 5B1GA 1G7LC 4NSGA 4ZEEA 1OUEA 4WM2A 1HERA 5L3HA 5KKJA 1UC0A 1B0DA 2CGIA 1LZNA 1YAMA 3LZ2A 2HEAA 5B1FA 4NHTA 3WUMA 5HQ1A 3B0KA 1AM7A 1IOQA 4N1CC 1OUGA 1H6MA 4XJFA 1JKBA 4NGLA 1D6PA 2BQCA 2G4QA 1REMA 4RLNA 4O34A 4H8YA 4RW2A 4QY9A 207LA 1LOZA 4ETDA 5KXYA 5HNCA 1KXYA 2ZWBA 4DD1A 1IP6A 1YROA 1DQJC 1LHMA 4PGJB 3TMUA 1IP4A 3ZVQB 2I26L 1FLYA 1RCMA 1DI5A 1P2CC 1DI3A 4LYZA 3WPLA 5HLLA 1LHLA 1WVUA 3A67Y 5I54A 5KXRA 3BKVA 2ZQ4A 1QUTA 5FSTA 2MEHA 4DT3A 2DQCY 2BQGA 4B4IA 4DD7A 2D91A
chains in the Genus database with same CATH superfamily
4PRQA 2BWBA 2L4FA 2X8AA 1REXA 3KP0E 1SSWA 3PXGA 1QQYA 3B72A 2M60A 5ITXE 3NY8A 1IP7A 1DYBA 1QDTA 1B5UA 1LJKA 5APEA 2HWJA 2BQOA 1QYRA 5KQ8A 3TXEA 1L95A 3CSRA 5APFA 5ITTA 4H9AA 4GEWA 1GB9A 2LZ2A 4H8XA 1L55A 4B49A 2LCBA 4WM6A 1GB2A 1L64A 1QUHA 3CDOA 1VDSA 4Z6YA 1WJ7A 1LMCA 1SSYA 4LY6A 156LA 4B4JA 1CX7A 1LI2A 4NSHA 1NSFA 5FDJA 4LF6M 2DQEY 1GB5A 2Z2FA 1VQ1A 4OOOA 1OVKA 3DMXA 2ZTDA 4B7FA 3AGHA 1LKRA 4HTNA 5T3FA 1E9SA 2FBDA 2C5RA 2R6FA 3LYMA 5DN4A 2L6OA 1FNNA 141LA 4DUYM 5E6JA 1NV8A 1C45A 206LA 1D0KA 4M0DA 1L76A 253LA 1CTWA 5KJ9A 1WHCA 1L8QA 5EBHA 2DKVA 1MJGM 1LSFA 6LYZA 3TPZA 5LA8A 4GC9A 8LYZA 4LDOA 1IR7A 1LMQA 3RUNA 2JP7A 4CHTB 252LA 3GLGB 2XSZD 1LHHA 5EXPA 1LMNA 1IY2A 1EFUB 3LQQA 1UIEA 3HTBA 1LMAA 2LYZA 2UUCM 1C08C 2B7XA 4DDCA 2AHMA 191LA 1B2KA 5FTJA 4CISA 2E5LM 1T6OA 1G07A 3HWLA 3IJVA 2MH8A 4NRVA 1LYSA 4LZZA 1CKCA 1D3FA 2EUCA 4RW1A 1XB2B 3AKZA 1L20A 1VAUA 3UJNA 7LYZA 2I6ZA 3AFHA 5ILCA 1V7TA 2UU9M 1N4FA 3DNAA 3EMSA 4DD3A 245LA 1LZRA 4DR3M 2XF3A 3QE8A 1JSEA 4G4RA 4LDEA 4C5FA 2JY7A 1DGHB 3HZJA 1KY0A 3AOEC 2H9JA 2KRUA 1GEZA 2RBQA 1AT5A 2XSZA 2C96A 1HNWM 3KDSE 110LA 3V76A 3LN2A 3GXRA 1NNJA 1BWHA 4HSFA 2DKLA 2RAYX 2CE7A 2DQHY 1C6CA 3HBDA 4W58A 4MGYE 4W5WA 5KXWA 4DR4M 1C67A 1Z5CA 2D7GA 2ZIJA 2QB0B 3N9CA 1LCNA 153LA 3RE8A 3SYKA 4MR1A 2EKKA 5KXXA 3E46A 3DN0A 2F2NA 4XK8F 4XADA 1J09A 1JWRA 5B05A 4KO8A 1HNLA 1B6IA 3A6CY 1L65A 1L14A 182LA 3D4SA 4DV4M 1DPXA 257LA 2DZOB 4B7HA 1T43A 2MJ5B 1G7MC 1D9WA 1EQ5A 2ZNWY 2BLYA 2FNAA 1QT3A 1WGNA 1OQYA 4WURA 1GD6A 4R71A 2YBJA 1BB7A 3GLFE 1C7YA 3HBEX 3FUTA 1OUJA 1OUCA 1QSAA 1UICA 1LPYA 1C68A 3HU9A 1L94A 1IWXA 2XFSA 1HEPA 184LA 1JJ0A 171LA 1HENA 3OTOM 1T6VL 1NWGA 2BJWA 3A8ZA 1JHLA 5C6JA 3K9PA 2B72A 1DYGA 3CDRA 3AV0A 2DWMA 1JUGA 4A3VB 1QUOA 4J0LA 3TXGA 4B3TM 1XEIA 2C8PA 5KXLA 4LFPA 2HCBA 4TTDA 4OU7A 3GLFA 4NGZA 3JR4A 1V92A 4G3OA 1LI3A 1G7HC 2BQAA 2VF8A 1YAQA 2CDSA 1L68A 4W52A 4NGIA 3DOAA 4CJ6A 244LA 3U6SA 4MCKA 151LA 1WXQA 189LA 4DJHA 3AW7A 3FKEA 4ARQB 4L16A 1LSYA 4HJVA 1ZV1A 1IEEA 2DWZB 5LYTA 3GLHE 4GBRB 3QAKA 5J7CA 1HSWA 3RZEA 3FE3A 4KHPM 1L11A 4DQ5A 150LA 3A92A 1L1TA 3VLFB 4JYAM 3GLHB 4F1IA 5EXSA 1LYFA 1CUQA 1QT6A 2WARA 2DQJY 4W59A 1VDLA 4ET9A 2YBIA 1TH2A 1OIPA 5KXZA 4TUNA 3HJSA 1AT6A 3SASA 4LYTA 4BS7A 2BLXA 3LZMA 3V2WA 2KRKA 2IFFY 3HT6A 3U6LA 1B5VA 1E9RA 213LA 3FI5A 3HUAA 5E9RA 1CV6A 1ZMUA 4J1AA 3FE0A 4QHSA 2BQDA 3I01M 1J1OY 4OWCA 4BADA 3HHXA 2QSFX 3RT5X 1XGTC 1FN5A 2LVPC 3K3TA 1G4AE 1CUKA 1QZMA 2HEEA 2MEBA 4XBOA 3I4VA 3WXTA 2RBSA 1J5EM 1C10A 4YF2A 1P64A 2R65A 1IX0A 1IQPA 1TGUA 1CKGA 1QTBA 1EQ4A 2Y0QA 1LPIA 1DI4A 3C7ZA 1L2CA 5L3IA 3GLGA 5E26A 230LA 3HWSA 5F3WA 4BAFA 2OU0X 4WOAA 246LA 5IELA 4DR1M 1B7MA 1TR8A 4AQNA 3SBAA 4R3DA 143LA 3GPYA 2VIIA 4HJYA 4G4NA 2EKSC 1HFYA 4LGMA 1DYAA 5LVHA 1C69A 1ZURA 4DWXA 3AGGG 3AOGA 1G59A 5F9UA 1YIKA 3L25A 2ZILA 1L85A 3SYLA 3WW6A 3BBZA 4S12A 4I0CA 2MEIA 4NL4H 1IIZA 1GFJA 5KXTA 1L50A 2BJVA 1GF4A 1DYCA 4NSIA 1JQJC 3C8SA 146LA 1KIRC 4G49A 1PJTA 3A42A 1L61A 1IY1A 1JITA 1LJGA 1DGHA 1BHZA 2JZ0A 3N9AA 3PVSA 3W6BA 2CWBA 3A3RX 1HEMA 4FW9A 1QUSA 2CHVA 1OUAA 5KXSA 144LA 1IY0A 1OWYA 4I4LA 4G4HA 2JXNA 3W67A 2YDGA 3FI7A 250LA 3VFDA 4WM5A 1UFZA 4XJDA 1PQOA 3QYBA 1GXV2 1DKKA 4I7PA 3GPUA 3GUJA 3SB9A 1SQ2L 5APDA 1QSWA 2A7DA 4WG7A 1W5SA 5ITYA 4LJ6A 3SB8A 3WL2A 1L53A 114LA 1VATA 5IDDA 2ZNXY 4GHLA 2Z12A 4XENA 2B6TA 2P5TA 3KSXA 4Z46A 4LJ5A 5I14A 3C82A 3HT8A 2Z37A 2OU8A 2C8OA 4H9BA 3LQRA 3U5ZB 1IVMA 4OO9A 1LMTA 3FADA 4H1PA 1N36M 1PJJA 4NHIA 1WQQA 4ITQA 4CFPA 5JENB 1E32A 4JI0M 1LSCA 2RGHA 3HTDA 1YKXX 4X65M 1L80A 4H91A 4J7VA 4R7GA 4LT1A 1CV0A 2FYCA 229LA 1GE2A 1RJCB 1SXJB 2BAAA 1LLHA 1RI8B 4MGKE 2VB1A 2DQIY 2DQFC 4QGZA 3D8BA 2OOBA 2O5RA 1CVKA 3D8LA 4FWDA 2BQLA 4AXTA 1VFBC 1NQIA 4B08A 4KT3A 1GL6A 4B3RM 3UMMA 1KIQC 1L08A 4DV5M 4DYGA 4LF4M 3HUQA 2DENA 2QBYA 1L05A 1L52A 1TDHA 5B1GA 4NSGA 3IECA 1Y8GA 1L06A 1B0DA 2CGIA 1YAMA 3BOSA 2HEAA 1JB0F 3WUMA 4P17A 3KW6A 3HHZA 5HQ1A 2RB2X 4D82A 1HQCA 4LGYA 5KPRA 2DXIA 2OTYX 4RLNA 1D6PA 4W53A 4O34A 4H8YA 4QY9A 3BXWA 207LA 1L63A 1CV5A 4ETDA 1IP6A 1LHMA 1DI3A 3K92A 3R8FA 1LHLA 1WVUA 3A67Y 4S0WA 1VEKA 3BKVA 4G6ZA 122LA 5FSTA 2MEHA 4DT3A 2DQCY 3GRVA 2LNHC 3WUNA 4EIWA 211LA 5HMVA 4DQJA 4YENA 4D81A 132LA 4GRVA 3SC3A 1C46A 3K8ZA 260LA 3M0EA 4YY3M 3QNGA 5LMUM 2CRUA 1QANA 1NDMC 3HGIA 4PK0A 2N5ZA 3TE6A 4IBIA 4GCEA 1HNZM 2RH1A 4WLXA 4M9XA 1GBXA 5FCPA 3FTEA 1WR1B 4WM3A 1TH4A 4XJIA 1BVSA 5I53A 1GO5A 261LA 1EQEA 1LYGA 4P2EA 5C6LA 4I7SA 5KXOA 4LF5M 3WMKA 2BPUA 1L26A 142LA 2FH0A 4LF8M 2FS1A 4GC5A 3HJQA 5FHWA 3W6CA 3J27B 3HHYA 3M7GA 1F10A 1HFZA 3HUKA 1QT7A 4P16A 1GF5A 1I94M 2LYOA 4ETEA 2DI0A 5LXWA 1K28A 1L07A 1Z5BA 2Z4RA 3Q8GA 1GBSA 217LA 3SN6R 2Q9EA 2N35A 3FUWA 4MGZE 108LA 1IWUA 1DPWA 4G9SA 2DHRA 4NC6A 4GKJM 2O4WA 4KODA 2G3QA 5LAFA 4ARPA 1IN8A 4W55A 2YBMA 198LA 3FTDA 1L30A 1GF9A 3U6MA 1OVHA 5LZMA 5IHGA 2BWEA 1XXHE 1AKIA 3A34A 3PDSA 4B4EA 1LZSA 4EOFA 2DVWB 2XFTA 186LA 1NHEA 4HLQA 1IC5Y 1BQLY 2CFOA 4JI5M 1CNSA 1GFEA 3P4ZA 4LZTA 3WW5A 2QBYB 1L59A 1LGWA 2R44A 2Y8PA 3WH1A 2R4JA 1C61A 1L28A 2BQNA 3L26A 1IC7Y 3T36A 3HTFA 4I7LA 1QTKA 4IBJA 1L44A 4NGKA 4LJ7A 2WSFF 3C7YA 2YR0A 3AB6A 5LYZA 1L81A 2RAZX 1L02A 1YL0X 1HC0A 1C6NA 149LA 2HEBA 3WVXA 2QZ4A 4GCCA 1DXJA 4L15A 1A2YC 1L54A 2AUBA 1XEKA 4QNRA 1SX2A 104LA 4B7GA 3RGSA 1MELL 2DAMA 222LA 242LA 3GPPA 1HQYE 2VF7A 1GXXA 3GXKA 126LA 1P5CA 1LMPA 2XLJA 1INUA 1LTMA 3GLFB 2V1UA 1HT1E 2ZAMA 1L89A 233LA 3WYHA 4NXNM 1P2LA 2XZFA 3CT0A 4IBKA 2Y0TA 1QTCA 1TDZA 1IOTA 3U61A 2OTZX 1QTVA 4I7MA 3GLIB 1JTOL 256LA 3GO8A 3C3DA 2LXEA 1PQKA 2X4AA 1L31A 2B6WA 3FRHA 5DNYA 2D4IA 5L8RF 1J1XY 4AG6A 2EO2A 1L58A 1T3TA 3A98B 1I1ZA 2BQKA 129LA 1JTMA 5F9XA 4PJ2C 3QY4A 2H5ZA 1ZMWA 2O7AA 4UN2B 1LZAA 1IOSA 5EXXA 1IY4A 1L48A 147LA 4IJEA 4AZFA 1D2WA 1B7OA 1D3JA 219LA 155LA 1YUBA 4IJFA 5LVJA 2BQFA 9LYZA 1KW7A 4WO9A 5B07A 2BQMA 2K47A 3MMPA 1EL1A 4DV7M 4CGYB 1XGPC 3EBAB 4QHTA 4DD0A 2XEPA 1TLAA 102LA 4LGKA 4EKRA 1TTEA 251LA 3HT7A 1XMOM 2LWXA 5LVGA 3VW7A 1L25A 1LKSA 4RF1A 2LH0A 5FTKA 1LAAA 1DGBA 2BQJA 2B3TA 1SXJC 1WGLA 1BB5A 5ILFA 1C6QA 1GJSA 2LZTA 4UWUA 5I5QA 2QCUA 1CV4A 1C43A 1JKAA 4LZMA 1LI6A 1C6TA 3J2PB 175LA 3WULA 4I7KA 1EE8A 2H1RA 2D7HA 3H4MA 1L91A 4W57A 4HTQA 1I56A 1R4GA 1L62A 4WM1A 5FEKA 139LA 1CKHA 1J1PY 1L99A 3DMVA 1GB0A 1C63A 1GB3A 1LSPA 138LA 4PHIA 3ZQJA 1XGRC 1IXRC 1T8AA 5F16A 1D3MA 1L34A 2MEAA 3DFZA 5EJCA 1L66A 1CV1A 4LF7M 4E97A 2I7PA 1IWTA 4NG1A 3TMUA 2DQAA 1ZVYB 4MGHA 214LA 1UUZC 3T1HM 4DV3M 118LA 4H9EA 2OE4X 2L78A 3E3DA 128LA 1KY1A 1QTZA 1L77A 1T3PA 4X3BA 3UGJA 1I6SA 1C6DA 134LA 4WO6A 4C3WA 2YSSC 1L43A 1D3NA 3PBLA 4GCDA 4NIJA 4IASA 4NOOB 2L7HA 3A6BY 3GQ4A 1ZMVA 2UUAM 2C9OA 1L98A 1O23A 4DR2M 1G1WA 1PS5A 2CV2A 3IJUA 148LE 1OFHA 1R7RA 2MGWA 1C6GA 3J6KA 1GF3A 2KA6B 1PJIA 2ZANA 1IY3A 2XBRA 4HTKA 215LA 4NHPA 4CHXA 3LHMA 4M4OA 4WLDA 1XNQM 3OE8A 1LZ6A 1OAIA 3KS4A 3J81S 225LA 1IXSA 1KXWA 1QTEA 223LA 3B0OA 5L9JA 3VK7A 1JPOA 1FDLY 4NWHA 3MGWA 3WUAA 1LV7A 4IIWA 1LSGA 1L21A 1GABA 2YBLA 4JV5M 4LFCM 1W6ZA 2DWLA 1TAYA 2F5SA 1LJ4A 2Z38A 5KKIA 1F6SA 1G0GA 1DYFA 2K6BA 4FCWA 1YLAA 1L2BA 2JZ1A 2R0IA 2BQHA 3A93A 4OW1A 4D9ZA 3P66A 4PRUA 4HV2A 3ZEKA 4U3XB 1E94E 4EJ4A 1TEWA 6LYTA 2JY5A 3SB7A 1S3SA 3Q8XA 2HL7A 5DN5A 2Y21A 4FCVA 123LA 4I8OA 3AW6A 4A7DA 1SWZA 3IHPA 1ZWNA 3KAMA 172LA 241LA 3AGIA 4FJRA 5F14A 227LA 4QEQA 2CHGA 1VDQA 3ZVQB 1NHWC 1IWVA 4L8RC 1UIBA 1NMMA 3FA0A 2B70A 1G71A 3LYZA 2YNMD 4B1AA 1GE4A 1SLYA 5JI2E 4Z8XA 228LA 2ZM6M 5HNLA 1OUBA 2FFJA 194LA 1ZVHL 1GKIA 2HKJA 3U6EA 169LA 1REZA 3AYQA 2EJSA 1L57A 1BB6A 2HHHM 1GB8A 2HUMA 2CUUA 2DZLA 218LA 5LYMA 1GFTA 1W5TA 177LA 2R18A 3LMMA 1BWIA 4I7QA 2F4AA 1KS3A 4I7RA 4IBFA 4W96A 2RBPA 3U6QA 1L88A 4LJAA 1G7IC 1L23A 3LZTA 2CHQA 1LWKA 1V33A 2R46A 1T97A 1XJUA 3KOXE 1XFPL 1QS9A 1VDTA 3GULA 1YAPA 4IBEA 1B5XA 1BVXA 3PNVA 4LJ8A 3TWMA 3K9OA 3DMZA 4LT3A 4LFBM 5KQDA 1MX0A 160LA 3SAWA 187LA 3GRUA 1LZEA 1G7LC 4ZEEA 1OUEA 4WP2A 4ZPUA 5KKJA 4LF9M 1LZNA 1QAQA 112LA 2LC9A 1C6MA 4IAPA 4FCTA 4NHTA 3B7QA 2JUJA 238LA 2O25A 3RGPA 3B0KA 3C9PA 2UXDM 1IOQA 4N1CC 1OUGA 3K2RA 1OV7A 1GL7A 3HU8A 1HT2E 4NGLA 232LA 2G4QA 1OV5A 1KFVA 1GVNA 3L2XA 5ITQA 1C6AA 2KEBA 4DD1A 4LRTA 2EA0A 1DQJC 1G41A 1L03A 1QUDA 1IP4A 240LA 1L17A 258LA 3AL0C 1RCMA 1DO0A 3EIEA 4DUZM 3DN8A 3WPLA 5HLLA 4LRSA 4REZA 200LA 3C7WA 3KS8A 1J7KA 1K82A 4B4IA 4DD7A 2W1MA 5H37D 1D2YA 1L45A 1ZMYL 3GRRA 3OE0A 2H5XA 1CU5A 1R2YA 157LA 1B7QA 254LA 2VQEM 2CWIA 2XQOA 3OE9A 1L32A 3SATA 4OWBA 4DDAA 1JR3E 161LA 183LA 5C18A 4H92A 3HU3A 4H94A 3M3UA 2EKFA 1LSAA 1LHIA 4LJ4A 259LA 1WQMA 1I4WA 2KXEA 3NY9A 239LA 3M18B 4JXJA 145LA 2HU1A 3FUVA 3C83A 3W0LB 3LCUA 3BKHA 1DKJA 3ATNA 5EP4A 4AKHA 4CGEA 4GLVA 4BBAA 3CB7A 4Y28F 4FVMA 1L19A 1PJSA 4DV0M 3SB5A 2R62A 3CQLA 2OOAA 4KLNA 1LJIA 4LJ9A 181LA 2X49A 1NVMA 4GCBA 1P3NA 2EPEA 4X62M 4EKPA 4DV6M 4G4BA 2B74A 3KP1E 4PCZA 2G4PA 4JI1M 1MN3A 2LZMA 2G5GX 1LHJA 8CATA 1IBKM 1GFUA 1L40A 1A5TA 2MROB 1FLWA 2MR9A 2ANXA 2DAIA 4Z3MA 4H90A 3HU1A 1LGXA 3FYCA 1QTDA 4WLYA 4ZPXA 2QPAA 1C62A 1L16A 1VDPA 2DNAA 248LA 3C8QA 2XJWA 2QP9X 4BLCA 2UXBM 1KNIA 3VWOA 2O79A 2JWSA 2HEFA 1FLQA 1L49A 1C6JA 3HHWA 4ARMB 1QT4A 1SWYA 5APCA 5LVKA 3WPJA 4TWSA 3J4GA 1LGUA 5DM9A 5DYGA 5KXNA 3T1YM 3P68A 4XN6A 1HELA 1P56A 4DD2A 5EQTA 1OAOC 4F2LA 3L29A 3DKEX 3A95A 1C6EA 3OE6A 1NJGA 4I5SA 1PJQA 2J7NA 5D5CA 1C6LA 1XWIA 4N5RA 1LZDA 4NSOB 3SHFA 4HPEA 1GLNA 1XSFA 4I7OA 3G3WA 5GKNA 3AOEA 2Q2EB 1JSFA 1OIZA 2GNOA 2YBNA 3HTGA 3TXIA 3DN3A 4EMNA 4H9FA 1MU5A 4DV1M 193LA 1LSNA 1D2NA 1NBYC 2B75A 1NF5A 1LSEA 1T8FA 1L27A 5AMYA 4OOTA 1V34A 4E3UA 1ORYB 221LA 5KPZA 103LA 2C9CA 3SAVA 3TXHA 4N8ZA 1C66A 3DN2A 4N1EI 1XEJA 1L79A 4NRWA 3L2AA 1IFYA 3E4RA 2OPFA 4LYBA 1C6HA 4GN3A 2CV1A 1Z59A 127LA 1L92A 4N9RA 1L24A 3GLGE 3SMSA 4LYOA 5ITUA 255LA 3ZH9B 4EPFA 2Z8YM 140LA 3R9XB 3VDUA 1XNRM 3I04M 4W54A 3AJIB 231LA 1P46A 3FD9A 1UACY 1GWDA 3NBXX 4X64M 1E8LA 4NSRA 1AZFA 3D9AC 2GV0A 2MEEA 2D7EA 1LW9A 158LA 159LA 2DAKA 4D80A 4YXAC 2KDLA 3PFIA 3T6PA 1G0QA 1LYZA 3G3XA 3WPKA 1YKYX 5A2QS 1LZTA 3DA1A 1G0KA 4GHAA 2ZTCA 2LHCA 4QNMA 1L74A 1GFGA 5B59A 1HEWA 5BPVA 1QIOA 249LA 1XGQC 3RNXA 4J1BA 2GQFA 1HSXA 3U60B 2D4JA 2CV0A 4MB7A 5IZ7D 1IWZA 2RB1X 3RW8A 3CDTA 1L09A 4ANRA 3FYDA 3A46A 3U6CA 4CFOA 4EKSA 4LFAM 4EXMA 2MEDA 1YE9A 3B7ZA 3A90A 1KXXA 1PQIA 192LA 1L47A 1LYHA 4X66M 3C81A 3GRYA 3L27A 4LYCA 1WTHA 1OVJA 1UIHA 2F2QA 1GBOA 2A4TA 1NKHA 3LW5F 3JR5A 3IG8A 236LA 3F92A 2BQBA 3F6ZA 2HU3A 3SARA 3GLHA 3T6UA 2J5YA 208LA 1R2ZA 4YHHM 2LVNC 2LVAA 4HJZA 4B3SM 1C6KA 1Q3BA 4PJZA 1X37A 4K5YA 1LZGA 3ATOA 3IWRA 4JI2M 2NTHA 4NGOA 1LSZA 2A7FA 119LA 4ZIXA 1PGYA 3KOZE 1OQMA 1ZV5L 4PDIA 4II7A 4XJGA 1L93A 5IT9S 1WQOA 1GJTA 3HH5A 3WHLA 1RFPA 125LA 1IWYA 1JR3D 1L33A 2ZYCA 1L18A 1BB4A 2B6XA 5JI3E 1HJPA 113LA 1CU3A 4OWEA 1GF8A 3MK6A 3EO5A 2MECA 1ALCA 2NWDX 1QQWA 262LA 1VG5A 2FOIC 190LA 3CT1A 4WW0A 4KL7A 4PT5A 3ODUA 2HECA 3QAUA 4NHSA 2KNAA 3GP1A 1WVVA 4W56A 4NWEA 3U6OA 3WXUA 4DR5M 2HUBA 4ARQA 1SXJD 4PD2A 2OE9X 1C65A 1L96A 3UONA 4QOSA 1G0MA 1B7NA 3VKGA 2HULA 3NYAA 2Z19A 3RU5A 3CF0A 4WLTA 3W6AA 1GDWA 5LINA 2KNZA 3C3EA 1DYDA 1WIVA 3HU2A 2LTUA 3GUOA 1OUFA 1NHBA 1JIYA 1JR3A 4EKQA 1CUPA 4NGYA 1IO5A 1GE3A 3G3VA 4KT0F 1QZEA 4ETAA 4GH9A 2V6ZM 1L42A 3M6AA 1B7RA 1QDRA 1RU3A 1NV9A 3TQSA 4JI4M 1UBZA 1PRBA 2CUZA 1N78A 1N32M 167LA 3W3EA 1IR8A 2QENA 7CATA 2F5QA 1JISA 4H93A 1GFHA 3GUMA 3WU9A 1SXJA 3GPXA 3TMXA 3KOYE 3SB6A 1L39A 2QHOB 2MEGA 2ERCA 2G4NA 3HDFA 3U6PA 2ZYPA 1KSFX 4WM4A 2DAGA 1L82A 1HEOA 3W68A 2I25L 1QVRA 3W6EA 2LVOC 1XGUC 3B9PA 5DFLA 220LA 4KXIA 4TSBA 2H9KA 1JEFA 4IJ4A 3VKHA 4WL6A 4GITA 2DAEA 3TXFA 3DN1A 6LZMA 2X0AA 1QT8A 3SBBC 4HL4A 4UWVA 4DBGB 4HPIA 4HP0A 1C7PA 1CJ7A 3THGA 2FBBA 2CJLA 3FRIA 3U5ZA 4FD2A 1G8PA 1JTTL 2Z2EA 1YL1X 1XJTA 3B7NA 4GMQA 5IWAM 1YAOA 5EP1A 1GBZA 2BQEA 5KXRA 4JI7M 1B9OA 1FLUA 3SFZA 3EIHA 3L28A 2XBSA 2F5OA 2ZBKB 1LJJA 3HH6A 4BAPA 4Z41A 2UXCM 1AIPC 1EPYA 5ITXA 1UIAA 1GB6A 4NGWA 1OFIA 1W08A 1C6FA 1WQPA 4LZJA 4NEBA 5I4XA 2IHLA 1R6BX 2C99A 4N0JA 3LVWA 1IN7A 3A45A 1GE1A 1LYOA 3SBJA 180LA 1LJNA 3QWLA 2RRUA 1N77A 1CU0A 2DQGY 1R5LA 1GBYA 2M5ZA 1B5WA 4GRIA 1LSBA 2ANVA 4TX7A 3ULRA 1B5YA 107LA 2MEFA 1N75A 3P64A 4ARLA 3CTWB 1CU2A 1L86A 3CF2A 3DN4A 1GB7A 2Z39A 1L36A 3J80S 3ZC7B 2B6YA 2KHHA 1L22A 5B1FA 4G4QA 1L67A 195LA 1AM7A 1L69A 115LA 1H6MA 2BQCA 4RW2A 1LOZA 2RGOA 5KXYA 5LMNM 1KXYA 2ZWBA 1G3IA 1KW5A 1NO1A 5DYIA 1C1KA 1C6IA 1DI5A 4OW0A 4LYZA 1L84A 2F32A 1DO2A 5I54A 1TF0B 2ZQ4A 3HY5A 1QUTA 1G0PA 2BQGA 4PDGA 1DGGA 3TWKA 5KXPA 4H8ZA 3TWLA 4I7JA 1XMQM 3B74A 4JI8M 1GAZA 1XXHA 4GLAA 1CJ9A 2W1XA 1UCOA 165LA 1HR0M 4OWAA 130LA 2RKOA 1HMKA 1UM8A 4OVZA 4M0WA 3DN6A 1IP5A 3NWLA 2DQDY 1L1ZA 2F47A 4M6DA 3OK0A 3RZ4A 1GFAA 3WU7A 4YX7C 4NXMM 1LSDA 4NFVA 1VEJA 2JNHA 2IGCA 1L37A 4I7TA 3CDQA 5DLAA 170LA 5FELA 5LIOA 1DGFA 3W6DA 3AZ5A 2APLA 4PPOA 1L29A 1SG9A 4G4OA 4MSTA 2L09A 1L15A 4DV2M 2XH9A 209LA 5KXKA 1HF4A 1V7SA 3H4JA 1F4IA 5II3A 1XHBA 1HHLA 1BB3A 1C6PA 1LJHA 2LHGA 2D6BA 1LZ9A 3HT9A 1I20A 2B5ZA 1BGIA 5C1BA 2ZQ3A 1Q02A 226LA 3L64A 3FTFA 1L46A 196LA 4IBGA 4CIZA 3DZDA 4IBBA 4DC4A 5FLXS 2DHYA 2F30A 1GHLA 4GN5C 1OKSA 1QAMA 166LA 3GLIE 1GFRA 1IN4A 1LMOA 5HMJA 1L38A 4ZFPA 1LYJA 3G3BB 4R6CA 3UZUA 2CP8A 3WVYA 1GDXA 3TMVA 4W51A 1DV0A 4RDSA 4L78A 2C98A 1C60A 2D4KA 1NY5A 2OU9A 4NHQA 199LA 2YQZA 4ML7A 1TCYA 1OUIA 1CX6A 3ZCBB 2L4EA 3I51A 1D0MA 1L72A 2Q9DA 4I81A 1LZCA 4FWGA 4DQ7A 3AZ4A 4LFXA 1L60A 5FTMA 1HNXM 1OUDA 1G1VA 3GQ5A 152LA 3T38A 1LJEA 2NTGA 1PQDA 234LA 3HX3A 1JTNA 4KPMA 4XYYA 3E21A 2YVBA 1XEPA 3B89A 1OJLA 4TUWA 1MLCE 5BR8M 1ZYTA 1LYYA 1KIPC 3GUPA 1IP3A 2R45A 185LA 4LYMA 2KNVA 2RSCA 2NQ8C 4ET8A 3LYOA 4K0KM 1P36A 4UWNA 5KPTA 1B7SA 3MHVC 3U60A 163LA 4MM3B 1JKDA 1Z5AA 1BVKC 1L83A 3FUUA 1L56A 3SAUA 3LCVB 1EIJA 1UA6Y 1LZ4A 1N34M 1GEVA 4RF0A 4AG5A 3WHKA 4DDBA 5FTNA 3F9LA 3CGWA 2RBNA 1L10A 1IBMM 3TMWA 1L75A 1L90A 2VQFM 5LVIA 1REYA 4Z98A 5K7OA 1JKCA 5KO3A 1LZ8A 4M9SA 1LYDA 2I7NA 4YM8A 1D6QA 4RLMA 2JY6B 1L04A 1D0LA 2BNKA 1K3XA 1YILA 3KVWA 1N33M 2ZIKA 3HDEA 3W0FA 3AJNA 1YKZX 2K9DA 2F5NA 1PQMA 1PM5A 1JJ3A 4AKGA 1G0LA 5LA5A 4AI6A 3HFMY 2WZJA 1SX7A 137LA 3AZ6A 3TXDA 3HBHA 3LYTA 3W6FA 4DD9A 2EIZC 1JQUA 1HMLA 5FSWA 1G7JC 2WSEF 4JI6M 1P2RA 5DL9A 1DYEA 2DBTA 1QTHA 1L0JA 3ZVQA 2EQLA 1FBIX 5LAGA 1UIDA 1CU6A 1B7LA 1L87A 1HFXA 224LA 1WQNA 1L12A 1IP1A 1GFKA 4IBDA 3D3DA 1GFVA 3CSZA 4EPIA 4NGVA 3P65A 1XXHB 1IWWA 3A91A 1NY6A 205LA 120LA 4B0DA 4MGIE 1F0WA 4G4CA 3GUNA 2XGNA 3GQ3A 3GLIA 1L41A 3OJPA 1OYUA 2Z18A 1FJGM 2LHMA 1VEGA 1QS5A 4QDNA 4R0FA 1G0JA 4DKLA 5C6IA 2Z4SA 3KSJA 1A4VA 210LA 3IG5A 3CT5A 1IR9A 2HUKA 1P3QQ 2F4VM 4LT2A 4AW4A 4DAJA 3A3QA 1H6UA 1L2DA 4LDLA 4L41A 1P37A 4I8SA 4LT0A 2UUBM 2BQIA 2RBOA 1GF6A 1QSQA 3AZ7A 4WL7A 1CKDA 4BB9A 2F4GA 2FE8A 3UK6A 3HH3A 1G06A 1Z6TA 5I4YA 109LA 3A94A 4NGJA 197LA 4IBCA 1QAOA 173LA 2JA2A 2R4EA 2QQ8A 2VDBB 1LZ5A 1YSYA 1VEDA 1LJ3A 3SP3A 176LA 4JI3M 1FKVA 4JN6A 1OP9B 1T6HA 4LCBA 4HEOA 1OUHA 164LA 3JAMS 3T15A 237LA 3KOWE 3ILKA 1WQRA 1ZQ9A 3EXDA 4FWHA 3QYEA 3FTCA 2OQ4A 1LHKA 2W1YA 1NBZC 4RKUF 7LZMA 5EXTA 3B6LA 4NY5A 1DZBX 3LVVA 3SHGB 5IREB 3A96A 4ARMA 4FDYA 1LZYA 131LA 1UIGA 2B73A 2HAKA 2L7IA 135LA 2B6ZA 235LA 2Q0MX 3E9SA 1L13A 4W94A 1CJ6A 3GUKA 1TBYA 2FYDA 3U6DA 2V1CA 3VK8A 5I4WA 2PC2A 3B0IA 2G8LA 1IP2A 3KFUG 5KXMA 3V2YA 1L71A 2OEAX 2LVQD 4GIPA 1OWZA 2OO9A 2YFQA 1IN6A 4AKIA 1FKQA 4AGAA 3F8VA 1B5ZA 3RFWA 1P7SA 2YBHA 1IC4Y 2XZUA 2K0BX 3C58A 3HKPA 4GKKM 4IATA 1YANA 1IXSB 1TH3A 4B3MM 1OTRA 2Y20A 1LJFA 3G3AB 1GE0A 1L73A 5E4PA 2KZSA 5ITRA 3TXBA 1Q39A 4NSJA 1JTPL 1LZ1A 2XTHA 4GCFA 1LWGA 3TL4X 3C8RA 2WSCF 1H87A 1VDDA 1LSMA 2KZUA 4OVZB 3HH4A 4XJHA 188LA 5B06A 1TDYA 1PQJA 3J7AS 5EP2A 4WG1A 1CV3A 1L97A 4CJ2A 4QOZC 1IORA 1RE2A 1GBWA 2QARC 5A3ZA 1WTMA 2ZAOA 1K3WA 2HEDA 3EMLA 1GF7A 1NDGC 4Q7JA 3I4YA 3N9EA 3CSQA 5M1YA 1HEQA 1NJFA 4H9HA 216LA 3CDVA 247LA 1IN5A 1L01A 4L4UA 4WMGA 4L6V6 201LA 4ETCA 2QNJA 4GN4A 1LYIA 1L0KA 174LA 1Z55A 1JJ1A 1LZBA 1IBLM 1L35A 1IOCA 4YEMA 5KY1A 1LYEA 4YOPA 4RNAA 2LYMA 3TXKA 2Z7JA 4II8A 162LA 1GPQC 3PNYA 1GF0A 4I7NA 5D5FA 3FUXA 5FTLA 1QUGA 4HV1A 5F81A 1XC8A 4H9IA 2W1LA 1BWJA 1T8GA 4XJBA 3MJ5A 2L2DA 2LBCA 4YEOA 1WTNA 1QSBA 4OWHA 212LA 3SMPA 2Z6BA 3HJ8A 2DZNB 1C64A 3U61B 168LA 1F6RA 4NG8A 3GUIA 3WU8A 1YQVY 154LA 4XGIA 1GAYA 1UIFA 4AQYM 2OE7X 1CJ8A 5EP3A 1D9UA 2O01F 2J7OA 1PZYA 4TSCA 1NHGC 243LA 3K2LA 3KXEC 1KYIA 4ARJA 1L51A 133LA 1L00A 4H9CA 1B7PA 3K1JA 4MH0E 4ETBA 2HTXA 3TXJA 3J7BA 1CKFA 1Q3CA 2KW0A 5A3EA 2A5YB 2CEAA 4WM2A 1HERA 2RBRA 5L3HA 4OX9M 1UC0A 3JR6A 2DWNA 178LA 3LZ2A 2W82A 4M9ZA 4XJFA 1IM2A 4DR7M 1JKBA 1P6YA 1REMA 2Z3XA 1SXJE 5HNCA 1L70A 3NBIA 2RB0X 1AUAA 1NNUC 1IXZA 1YROA 4PGJB 3CF6E 1C6BA 1FLYA 1ZAEA 2I26L 1P2CC 3C80A 4YXCA 4LG2A 2JY8A 1QT5A 2F5PA 111LA 3VDPA 4DR6M 2D91A
chains in the Genus database with same CATH topology
4PRQA 1REXA 1SSWA 1QQYA 3B72A 3NY8A 1IP7A 1DYBA 1QDTA 1B5UA 1LJKA 5APEA 2BQOA 3TXEA 1L95A 3CSRA 5APFA 4H9AA 1GB9A 2LZ2A 4H8XA 1L55A 4B49A 2LCBA 4WM6A 1GB2A 1L64A 1QUHA 3CDOA 1VDSA 1LMCA 1SSYA 156LA 4B4JA 1CX7A 1LI2A 4NSHA 5FDJA 2DQEY 1GB5A 2Z2FA 4OOOA 1OVKA 3DMXA 3AGHA 1LKRA 4HTNA 5T3FA 2FBDA 3LYMA 5DN4A 2D91A 141LA 1C45A 206LA 1D0KA 1L76A 253LA 1CTWA 5KJ9A 5EBHA 2DKVA 1LSFA 6LYZA 5LA8A 8LYZA 4LDOA 1IR7A 1LMQA 3RUNA 252LA 1LHHA 1LMNA 1UIEA 3HTBA 1LMAA 2LYZA 1C08C 2B7XA 4DDCA 191LA 1B2KA 1G07A 3HWLA 3IJVA 1LYSA 1CKCA 1D3FA 4RW1A 1L20A 1VAUA 7LYZA 2I6ZA 5ILCA 1V7TA 1N4FA 3DNAA 3EMSA 4DD3A 245LA 1LZRA 3QE8A 1JSEA 4LDEA 4C5FA 1KY0A 2H9JA 1GEZA 2RBQA 1AT5A 110LA 3LN2A 3GXRA 1BWHA 4HSFA 2RAYX 2DQHY 1C6CA 3HBDA 4W58A 5KXWA 1C67A 2ZIJA 2QB0B 3N9CA 1LCNA 153LA 4MR1A 5KXXA 3DN0A 2F2NA 4XADA 1JWRA 5B05A 1HNLA 1B6IA 3A6CY 1L65A 1L14A 182LA 3D4SA 1DPXA 257LA 1G7MC 1D9WA 1EQ5A 2ZNWY 2BLYA 1QT3A 1GD6A 2YBJA 1BB7A 3HBEX 1OUCA 1OUJA 1QSAA 1UICA 1LPYA 1C68A 3HU9A 1L94A 1IWXA 1HEPA 184LA 1JJ0A 171LA 1HENA 1T6VL 1NWGA 3A8ZA 1JHLA 5C6JA 2B72A 1DYGA 3CDRA 1JUGA 1QUOA 4J0LA 3TXGA 1XEIA 2C8PA 5KXLA 4LFPA 4TTDA 4NGZA 1LI3A 1G7HC 2BQAA 2CDSA 1YAQA 1L68A 4W52A 4NGIA 244LA 4MCKA 151LA 189LA 4DJHA 3AW7A 4ARQB 1LSYA 4HJVA 1IEEA 5LYTA 4GBRB 3QAKA 5J7CA 1HSWA 3RZEA 1L11A 4DQ5A 150LA 3A92A 1LYFA 1CUQA 1QT6A 2WARA 2DQJY 4W59A 4ET9A 2YBIA 5KXZA 4TUNA 1AT6A 4LYTA 4BS7A 2BLXA 3LZMA 3V2WA 2IFFY 3HT6A 1B5VA 213LA 3HUAA 3FI5A 5E9RA 1CV6A 4J1AA 3FE0A 2BQDA 1J1OY 4OWCA 4BADA 3RT5X 1XGTC 1FN5A 3K3TA 2HEEA 2MEBA 3WXTA 2RBSA 4YF2A 1C10A 1P64A 1IX0A 1CKGA 1QTBA 1EQ4A 1LPIA 1DI4A 3C7ZA 5L3IA 230LA 4BAFA 2OU0X 4WOAA 246LA 5IELA 1B7MA 4AQNA 3SBAA 143LA 4HJYA 2EKSC 1HFYA 1DYAA 5LVHA 1C69A 1ZURA 4DWXA 3AGGG 5F9UA 1YIKA 2ZILA 1L85A 3WW6A 4I0CA 2MEIA 1GFJA 1IIZA 5KXTA 1L50A 1GF4A 1DYCA 4NSIA 3C8SA 146LA 1KIRC 4G49A 1L61A 1JITA 1LJGA 1BHZA 3N9AA 3W6BA 3A3RX 1HEMA 1QUSA 1OUAA 5KXSA 144LA 1OWYA 4G4HA 2YDGA 3FI7A 250LA 4WM5A 4XJDA 1PQOA 1GXV2 1DKKA 4I7PA 3GUJA 3SB9A 1SQ2L 5APDA 1QSWA 2A7DA 4WG7A 3WL2A 3SB8A 1L53A 114LA 1VATA 5IDDA 2ZNXY 2Z12A 4XENA 2B6TA 4Z46A 5I14A 3C82A 3HT8A 2Z37A 2OU8A 2C8OA 4H9BA 1IVMA 4OO9A 1LMTA 3FADA 4H1PA 4NHIA 1WQQA 4CFPA 5JENB 1LSCA 3HTDA 1YKXX 1L80A 4H91A 4J7VA 4LT1A 1CV0A 2FYCA 229LA 1GE2A 1RJCB 2BAAA 1LLHA 1RI8B 2VB1A 2DQIY 2DQFC 4QGZA 1CVKA 2BQLA 4AXTA 1VFBC 1NQIA 4KT3A 1L08A 1KIQC 4DYGA 3HUQA 1L52A 1L05A 5B1GA 4NSGA 1L06A 1B0DA 2CGIA 1YAMA 2HEAA 3WUMA 5HQ1A 2RB2X 4W53A 2OTYX 4RLNA 1D6PA 4O34A 4H8YA 4QY9A 207LA 1L63A 1CV5A 4ETDA 1IP6A 1LHMA 1DI3A 1LHLA 1WVUA 3A67Y 4S0WA 3BKVA 122LA 5FSTA 2MEHA 4DT3A 2DQCY 3WUNA 211LA 5HMVA 4DQJA 4YENA 132LA 4GRVA 1C46A 260LA 3QNGA 1NDMC 4PK0A 2N5ZA 4GCEA 2RH1A 4WLXA 1GBXA 5FCPA 4WM3A 4XJIA 5I53A 261LA 1EQEA 1LYGA 4P2EA 5C6LA 4I7SA 5KXOA 3WMKA 2BPUA 1L26A 142LA 5FHWA 3W6CA 3HUKA 1F10A 1HFZA 1QT7A 1GF5A 2LYOA 4ETEA 5LXWA 1K28A 1L07A 1GBSA 217LA 3SN6R 2Q9EA 108LA 1IWUA 1DPWA 4G9SA 2O4WA 5LAFA 4ARPA 4W55A 2YBMA 198LA 1L30A 1GF9A 1OVHA 5LZMA 5IHGA 1AKIA 3A34A 3PDSA 4B4EA 1LZSA 4EOFA 186LA 1NHEA 1IC5Y 1BQLY 1CNSA 1GFEA 3P4ZA 4LZTA 3WW5A 1LGWA 1L59A 2Y8PA 3WH1A 1L28A 1C61A 2BQNA 1IC7Y 3T36A 3HTFA 4I7LA 1QTKA 1L44A 4NGKA 3C7YA 3AB6A 5LYZA 1L81A 2RAZX 1L02A 1YL0X 1HC0A 1C6NA 149LA 2HEBA 3WVXA 4GCCA 1DXJA 1A2YC 1L54A 2AUBA 1XEKA 1SX2A 104LA 1MELL 222LA 242LA 1GXXA 3GXKA 126LA 1P5CA 1LMPA 1INUA 1LTMA 1L89A 3WYHA 233LA 1P2LA 3CT0A 1QTCA 1IOTA 2OTZX 1QTVA 4I7MA 1JTOL 256LA 1PQKA 1L31A 2B6WA 2D4IA 1J1XY 1L58A 1I1ZA 2BQKA 129LA 1JTMA 5F9XA 4PJ2C 3QY4A 2H5ZA 2O7AA 1LZAA 1IOSA 1IY4A 1L48A 147LA 1D2WA 1B7OA 1D3JA 219LA 155LA 5LVJA 2BQFA 9LYZA 1KW7A 4WO9A 5B07A 2BQMA 1EL1A 1XGPC 3EBAB 4DD0A 1TLAA 102LA 4LGKA 4EKRA 3HT7A 251LA 5LVGA 3VW7A 1L25A 1LKSA 1LAAA 2BQJA 1BB5A 5ILFA 1C6QA 2LZTA 4UWUA 5I5QA 1CV4A 1C43A 1JKAA 4LZMA 1LI6A 1C6TA 175LA 3WULA 4I7KA 1L91A 4W57A 4HTQA 1I56A 4WM1A 1L62A 5FEKA 139LA 1CKHA 1J1PY 1L99A 3DMVA 1GB0A 1C63A 1GB3A 1LSPA 138LA 4PHIA 1XGRC 1T8AA 5F16A 1D3MA 1L34A 2MEAA 1L66A 1CV1A 4E97A 1IWTA 4NG1A 2DQAA 1ZVYB 214LA 1UUZC 118LA 4H9EA 2OE4X 2L78A 3E3DA 128LA 1KY1A 1QTZA 1L77A 1T3PA 4X3BA 1I6SA 1C6DA 134LA 4WO6A 4C3WA 2YSSC 1L43A 1D3NA 3PBLA 4GCDA 4NIJA 4IASA 3A6BY 1L98A 1O23A 1G1WA 1PS5A 3IJUA 148LE 1C6GA 3J6KA 1GF3A 2XBRA 1IY3A 4HTKA 215LA 4NHPA 4CHXA 3LHMA 4M4OA 4WLDA 3OE8A 1LZ6A 225LA 1KXWA 1QTEA 223LA 3B0OA 5L9JA 1JPOA 1FDLY 4NWHA 3MGWA 3WUAA 1LSGA 1L21A 2YBLA 1W6ZA 1TAYA 1LJ4A 2Z38A 5KKIA 1F6SA 1G0GA 1DYFA 4OW1A 4D9ZA 2BQHA 3A93A 3P66A 4PRUA 4HV2A 3ZEKA 4U3XB 4EJ4A 6LYTA 1TEWA 3SB7A 5DN5A 123LA 3AW6A 4A7DA 1SWZA 1ZWNA 3KAMA 172LA 241LA 3AGIA 4FJRA 5F14A 227LA 4QEQA 1VDQA 1IWVA 1UIBA 1NMMA 3FA0A 2B70A 3LYZA 4B1AA 1GE4A 1SLYA 228LA 5HNLA 1OUBA 194LA 1ZVHL 169LA 1REZA 3AYQA 1L57A 1BB6A 1GB8A 2HUMA 2CUUA 218LA 5LYMA 1GFTA 177LA 1BWIA 4I7QA 2F4AA 1KS3A 4I7RA 4W96A 2RBPA 1L88A 1G7IC 1L23A 3LZTA 1LWKA 1T97A 1XJUA 1XFPL 1QS9A 1VDTA 3GULA 1YAPA 1B5XA 1BVXA 3DMZA 4LT3A 160LA 187LA 1LZEA 1G7LC 4ZEEA 1OUEA 4ZPUA 5KKJA 1LZNA 112LA 2LC9A 1C6MA 4IAPA 4NHTA 238LA 3B0KA 1IOQA 4N1CC 1OUGA 3K2RA 1OV7A 3HU8A 4NGLA 232LA 2G4QA 1OV5A 3L2XA 1C6AA 4DD1A 1DQJC 1L03A 258LA 1QUDA 1IP4A 240LA 3DN8A 1L17A 3TMUA 1RCMA 3ZVQB 5HLLA 3WPLA 200LA 3C7WA 4B4IA 4DD7A 2W1MA 1D2YA 1L45A 1ZMYL 3OE0A 1CU5A 157LA 1B7QA 254LA 2CWIA 2XQOA 3OE9A 1L32A 4OWBA 4DDAA 161LA 183LA 4H92A 4H94A 3M3UA 1LSAA 1LHIA 259LA 1WQMA 3NY9A 239LA 3M18B 145LA 2HU1A 3C83A 3BKHA 1DKJA 3ATNA 4CGEA 4GLVA 3CB7A 1L19A 3SB5A 3CQLA 1LJIA 181LA 4GCBA 1P3NA 2EPEA 4EKPA 4G4BA 2B74A 2G4PA 2LZMA 1LHJA 1GFUA 1L40A 1FLWA 2ANXA 4Z3MA 4H90A 1LGXA 1QTDA 4WLYA 1C62A 1L16A 1VDPA 248LA 3C8QA 2XJWA 1KNIA 3VWOA 2O79A 2HEFA 1FLQA 1L49A 1C6JA 4ARMB 1QT4A 1SWYA 5APCA 5LVKA 3WPJA 4TWSA 3J4GA 1LGUA 5DM9A 5KXNA 3P68A 4XN6A 1HELA 1P56A 4DD2A 3DKEX 3A95A 1C6EA 3OE6A 5D5CA 1C6LA 4N5RA 1LZDA 4HPEA 1XSFA 4I7OA 3G3WA 1JSFA 2YBNA 3HTGA 3TXIA 3DN3A 4EMNA 4H9FA 193LA 1LSNA 1NBYC 2B75A 1NF5A 1LSEA 1T8FA 1L27A 5AMYA 4OOTA 4E3UA 221LA 103LA 3TXHA 4N8ZA 1C66A 3DN2A 4N1EI 1XEJA 1L79A 4LYBA 1C6HA 4GN3A 127LA 1L92A 4N9RA 1L24A 4LYOA 255LA 4EPFA 140LA 4W54A 231LA 1P46A 1UACY 1GWDA 1E8LA 1AZFA 3D9AC 2GV0A 2MEEA 1LW9A 158LA 159LA 4YXAC 1G0QA 1LYZA 3G3XA 3WPKA 1YKYX 1LZTA 1G0KA 1L74A 1GFGA 5B59A 1HEWA 1QIOA 249LA 1XGQC 3RNXA 4J1BA 1HSXA 2D4JA 1IWZA 2RB1X 3RW8A 3CDTA 1L09A 4ANRA 4CFOA 4EKSA 4EXMA 2MEDA 3A90A 1KXXA 1PQIA 192LA 1L47A 1LYHA 3C81A 4LYCA 1WTHA 1OVJA 1UIHA 2F2QA 1GBOA 2A4TA 1NKHA 236LA 2BQBA 3F6ZA 2HU3A 3T6UA 208LA 4HJZA 1C6KA 4PJZA 4K5YA 1LZGA 3ATOA 3IWRA 4NGOA 2NTHA 1LSZA 2A7FA 119LA 4ZIXA 1OQMA 1ZV5L 4XJGA 1L93A 1WQOA 3HH5A 1RFPA 125LA 1IWYA 2ZYCA 1L33A 1L18A 1BB4A 2B6XA 113LA 1CU3A 4OWEA 1GF8A 3EO5A 2MECA 1ALCA 2NWDX 262LA 190LA 3CT1A 4KL7A 3ODUA 2HECA 4NHSA 1WVVA 4W56A 4NWEA 3WXUA 2HUBA 4ARQA 2OE9X 1C65A 1L96A 3UONA 1G0MA 1B7NA 2HULA 3NYAA 2Z19A 3RU5A 4WLTA 3W6AA 1GDWA 5LINA 1DYDA 3GUOA 1OUFA 1NHBA 1JIYA 4EKQA 1CUPA 4NGYA 1IO5A 1GE3A 3G3VA 4ETAA 1L42A 1B7RA 1QDRA 1UBZA 167LA 3W3EA 1IR8A 1JISA 4H93A 1GFHA 3GUMA 3WU9A 3TMXA 3SB6A 1L39A 2MEGA 2G4NA 3HDFA 2ZYPA 4WM4A 1L82A 1HEOA 2I25L 3W6EA 1XGUC 220LA 4KXIA 4TSBA 2H9KA 1JEFA 4IJ4A 4WL6A 3TXFA 3DN1A 6LZMA 2X0AA 1QT8A 3SBBC 4UWVA 4HPIA 4HP0A 1C7PA 1CJ7A 2FBBA 2CJLA 1JTTL 2Z2EA 1YL1X 1XJTA 1YAOA 1GBZA 5KXRA 2BQEA 1B9OA 1FLUA 2XBSA 1LJJA 3HH6A 4BAPA 4Z41A 1EPYA 1UIAA 4NGWA 1GB6A 1W08A 1C6FA 1WQPA 5I4XA 4NEBA 2IHLA 4N0JA 1GE1A 1LYOA 180LA 1LJNA 1CU0A 2DQGY 1GBYA 2ANVA 1B5WA 1LSBA 4TX7A 3ULRA 1B5YA 107LA 2MEFA 3P64A 4ARLA 1CU2A 1L86A 3DN4A 1GB7A 2Z39A 1L36A 2B6YA 1L22A 5B1FA 1L67A 195LA 1AM7A 1L69A 115LA 1H6MA 2BQCA 4RW2A 1LOZA 5KXYA 1KXYA 2ZWBA 1KW5A 1C6IA 1DI5A 4LYZA 1L84A 2F32A 5I54A 2ZQ4A 1QUTA 1G0PA 2BQGA 5KXPA 4H8ZA 4I7JA 1GAZA 4GLAA 1CJ9A 2W1XA 1UCOA 165LA 4OWAA 130LA 1HMKA 3DN6A 1IP5A 2F47A 2DQDY 4M6DA 3OK0A 3RZ4A 1GFAA 3WU7A 4YX7C 1LSDA 4NFVA 2IGCA 1L37A 4I7TA 3CDQA 5DLAA 170LA 5FELA 5LIOA 3W6DA 3AZ5A 4PPOA 1L29A 4MSTA 1L15A 209LA 5KXKA 1HF4A 1V7SA 5II3A 1HHLA 1BB3A 1C6PA 1LJHA 2D6BA 1LZ9A 3HT9A 1I20A 2B5ZA 1BGIA 2ZQ3A 226LA 3L64A 1L46A 196LA 4DC4A 2F30A 1GHLA 4GN5C 166LA 1GFRA 1LMOA 5HMJA 1L38A 4ZFPA 1LYJA 3G3BB 4R6CA 3WVYA 1GDXA 3TMVA 4W51A 4RDSA 1C60A 2D4KA 2OU9A 4NHQA 199LA 4ML7A 1TCYA 1OUIA 1CX6A 1L72A 1D0MA 2Q9DA 1LZCA 4DQ7A 3AZ4A 4LFXA 1L60A 1OUDA 1G1VA 152LA 1LJEA 2NTGA 1PQDA 234LA 1JTNA 4KPMA 4XYYA 1XEPA 1MLCE 1ZYTA 1LYYA 1KIPC 3GUPA 1IP3A 185LA 4LYMA 2RSCA 4ET8A 3LYOA 1P36A 4UWNA 1B7SA 163LA 1JKDA 1BVKC 1L83A 1L56A 1UA6Y 1LZ4A 1GEVA 4DDBA 3F9LA 2RBNA 1L10A 3TMWA 1L75A 1L90A 5LVIA 1REYA 4Z98A 5K7OA 1JKCA 1LZ8A 1LYDA 4YM8A 1D6QA 4RLMA 1L04A 1D0LA 1YILA 2ZIKA 3HDEA 3AJNA 1YKZX 1PQMA 1JJ3A 1G0LA 5LA5A 3HFMY 1SX7A 137LA 3AZ6A 3TXDA 3HBHA 3LYTA 3W6FA 4DD9A 2EIZC 1JQUA 1HMLA 1G7JC 1P2RA 5DL9A 1DYEA 2DBTA 1QTHA 1L0JA 3ZVQA 2EQLA 1FBIX 5LAGA 1UIDA 1CU6A 1B7LA 1L87A 1HFXA 224LA 1WQNA 1L12A 1IP1A 1GFKA 3D3DA 1GFVA 3CSZA 4EPIA 4NGVA 3P65A 1IWWA 3A91A 205LA 120LA 4B0DA 1F0WA 4G4CA 3GUNA 1L41A 3OJPA 1OYUA 2Z18A 2LHMA 4QDNA 1QS5A 4R0FA 1G0JA 4DKLA 5C6IA 210LA 1A4VA 3CT5A 1IR9A 2HUKA 4LT2A 4DAJA 3A3QA 4LDLA 4L41A 1P37A 4I8SA 4LT0A 2BQIA 2RBOA 1GF6A 1QSQA 3AZ7A 4WL7A 1CKDA 2F4GA 3HH3A 1G06A 5I4YA 109LA 3A94A 4NGJA 197LA 173LA 1LZ5A 1VEDA 3SP3A 1LJ3A 176LA 1FKVA 1OP9B 1T6HA 1OUHA 164LA 237LA 1WQRA 3EXDA 1LHKA 2W1YA 1NBZC 7LZMA 3B6LA 4NY5A 1DZBX 3A96A 4ARMA 4FDYA 1LZYA 131LA 1UIGA 2B73A 135LA 2B6ZA 235LA 2Q0MX 4W94A 1L13A 1CJ6A 3GUKA 1TBYA 2FYDA 5I4WA 2PC2A 3B0IA 1IP2A 5KXMA 3V2YA 1L71A 2OEAX 1OWZA 4AGAA 1FKQA 3F8VA 1B5ZA 2YBHA 1P7SA 1IC4Y 4IATA 1YANA 1LJFA 3G3AB 1GE0A 1L73A 5E4PA 3TXBA 4NSJA 1JTPL 1LZ1A 2XTHA 4GCFA 1LWGA 3C8RA 1H87A 1LSMA 3HH4A 4XJHA 188LA 5B06A 1TDYA 1PQJA 4WG1A 1CV3A 1L97A 4CJ2A 1IORA 1RE2A 1GBWA 2QARC 5A3ZA 1WTMA 2HEDA 3EMLA 1GF7A 1NDGC 3N9EA 3CSQA 5M1YA 1HEQA 4H9HA 216LA 3CDVA 247LA 1L01A 4WMGA 201LA 4ETCA 4GN4A 1LYIA 1L0KA 174LA 1Z55A 1JJ1A 1LZBA 1L35A 1IOCA 4YEMA 5KY1A 1LYEA 4YOPA 2LYMA 3TXKA 4II8A 162LA 1GPQC 1GF0A 4I7NA 5D5FA 1QUGA 4HV1A 5F81A 4H9IA 2W1LA 1BWJA 1T8GA 4XJBA 4YEOA 1WTNA 1QSBA 4OWHA 212LA 2Z6BA 1C64A 168LA 1F6RA 4NG8A 3GUIA 3WU8A 1YQVY 154LA 1GAYA 1UIFA 2OE7X 1CJ8A 1D9UA 1PZYA 4TSCA 243LA 4ARJA 1L51A 133LA 1L00A 4H9CA 1B7PA 4ETBA 2HTXA 3TXJA 1CKFA 5A3EA 4WM2A 1HERA 2RBRA 5L3HA 1UC0A 3JR6A 3LZ2A 178LA 4XJFA 1JKBA 1P6YA 1REMA 5HNCA 1L70A 2RB0X 1YROA 4PGJB 1C6BA 1FLYA 2I26L 3C80A 1P2CC 4YXCA 1QT5A 111LA 2YVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PRQ A;  5KXP A;  1ZMY L;  4H8Z A;  1REX A;  3WUN A;  1GAZ A;  1B7Q A;  2CWI A;  5HMV A;  1QQY A;  3B72 A;  4GLA A;  1CJ9 A;  4OWB A;  2W1X A;  1IP7 A;  4DDA A;  1LJK A;  1QDT A;  1B5U A;  1UCO A;  4H92 A;  4YEN A;  5APE A;  132L A;  4H94 A;  3M3U A;  2BQO A;  4OWA A;  1C46 A;  1LHI A;  1LSA A;  1WQM A;  3TXE A;  1HMK A;  3CSR A;  3QNG A;  5APF A;  4H9A A;  1GB9 A;  1NDM C;  1IP5 A;  2LZ2 A;  2DQD Y;  4H8X A;  4M6D A;  2N5Z A;  3M18 B;  3OK0 A;  1GFA A;  3WU7 A;  2HU1 A;  3RZ4 A;  4B49 A;  4WM6 A;  1LSD A;  1GB2 A;  4GCE A;  4NFV A;  4WLX A;  1VDS A;  1GBX A;  1LMC A;  5FCP A;  3BKH A;  1DKJ A;  4WM3 A;  3ATN A;  4B4J A;  4XJI A;  5I53 A;  4NSH A;  5FDJ A;  5DLA A;  4CGE A;  5FEL A;  2DQE Y;  1EQE A;  4GLV A;  5LIO A;  3W6D A;  3AZ5 A;  3CB7 A;  1GB5 A;  4P2E A;  4PPO A;  2Z2F A;  4MST A;  5C6L A;  3CQL A;  4OOO A;  5KXO A;  3WMK A;  2BPU A;  1LJI A;  5KXK A;  1HF4 A;  1V7S A;  4GCB A;  5II3 A;  2EPE A;  3AGH A;  1HHL A;  1LKR A;  4HTN A;  1BB3 A;  5T3F A;  1LJH A;  4G4B A;  2FBD A;  2G4P A;  5FHW A;  3W6C A;  2D6B A;  1F10 A;  1HFZ A;  3LYM A;  5DN4 A;  1LHJ A;  1GF5 A;  1LZ9 A;  1I20 A;  2B5Z A;  1BGI A;  1GFU A;  2LYO A;  4ETE A;  1FLW A;  1C45 A;  2ZQ3 A;  1D0K A;  5LXW A;  4Z3M A;  1GBS A;  4H90 A;  1IWU A;  1DPW A;  4G9S A;  5KJ9 A;  5EBH A;  2DKV A;  4WLY A;  4DC4 A;  2F30 A;  1GHL A;  1LSF A;  4GN5 C;  1VDP A;  6LYZ A;  5LA8 A;  2XJW A;  5LAF A;  8LYZ A;  1GFR A;  1LMO A;  1IR7 A;  5HMJ A;  1LMQ A;  2YBM A;  3VWO A;  4ZFP A;  3G3B B;  4R6C A;  2HEF A;  1FLQ A;  3WVY A;  1GF9 A;  5IHG A;  1GDX A;  1LHH A;  3TMV A;  1LMN A;  1AKI A;  3A34 A;  4RDS A;  5APC A;  1UIE A;  4B4E A;  5LVK A;  1LMA A;  1LZS A;  3WPJ A;  4TWS A;  2LYZ A;  3J4G A;  5DM9 A;  4EOF A;  1C08 C;  1NHE A;  2D4K A;  4NHQ A;  4DDC A;  1B2K A;  1IC5 Y;  1BQL Y;  4ML7 A;  1TCY A;  1OUI A;  3P68 A;  4XN6 A;  5KXN A;  1HEL A;  3IJV A;  1D0M A;  4DD2 A;  1CNS A;  1GFE A;  1LZC A;  1LYS A;  3P4Z A;  1CKC A;  3AZ4 A;  3A95 A;  4RW1 A;  4LFX A;  4LZT A;  3WW5 A;  2Y8P A;  3WH1 A;  5D5C A;  1OUD A;  2BQN A;  1LZD A;  1VAU A;  1IC7 Y;  4N5R A;  3T36 A;  2I6Z A;  7LYZ A;  5ILC A;  1LJE A;  1QTK A;  1V7T A;  1N4F A;  4NGK A;  3EMS A;  4KPM A;  3AB6 A;  4XYY A;  4HPE A;  5LYZ A;  2YVB A;  1LZR A;  1XSF A;  4DD3 A;  1YL0 X;  1HC0 A;  3QE8 A;  1MLC E;  1JSE A;  4C5F A;  1JSF A;  1LYY A;  2HEB A;  3WVX A;  2YBN A;  2H9J A;  1KIP C;  4GCC A;  3TXI A;  1IP3 A;  1DXJ A;  4EMN A;  1GEZ A;  4H9F A;  1A2Y C;  1AT5 A;  193L A;  1LSN A;  4LYM A;  1NBY C;  2AUB A;  1XEK A;  1NF5 A;  2RSC A;  1LSE A;  3LN2 A;  1MEL L;  4ET8 A;  3GXR A;  5AMY A;  3LYO A;  4OOT A;  1BWH A;  4HSF A;  4E3U A;  4UWN A;  1GXX A;  3GXK A;  1B7S A;  2DQH Y;  3TXH A;  3HBD A;  1LMP A;  4N8Z A;  1INU A;  1LTM A;  1JKD A;  4N1E I;  1BVK C;  1XEJ A;  3WYH A;  5KXW A;  4LYB A;  1UA6 Y;  1LZ4 A;  2ZIJ A;  1GEV A;  4GN3 A;  3CT0 A;  4DDB A;  4N9R A;  3N9C A;  1LCN A;  153L A;  3TMW A;  1IOT A;  4LYO A;  5LVI A;  1REY A;  4Z98 A;  4MR1 A;  5K7O A;  1JKC A;  1LZ8 A;  5KXX A;  1JTO L;  2F2N A;  4XAD A;  4YM8 A;  1JWR A;  5B05 A;  1UAC Y;  1GWD A;  1D6Q A;  1HNL A;  3A6C Y;  4RLM A;  1E8L A;  1D0L A;  2D4I A;  1AZF A;  3D9A C;  1J1X Y;  1YIL A;  2GV0 A;  2MEE A;  2ZIK A;  1DPX A;  3AJN A;  1YKZ X;  1I1Z A;  2BQK A;  5F9X A;  1G7M C;  4PJ2 C;  1JJ3 A;  3QY4 A;  2H5Z A;  1EQ5 A;  2ZNW Y;  2BLY A;  5LA5 A;  1GD6 A;  3HFM Y;  1LZA A;  1IOS A;  3AZ6 A;  2YBJ A;  1BB7 A;  5APD A;  3TXD A;  1LYZ A;  3HBH A;  3LYT A;  3WPK A;  1YKY X;  3W6F A;  1LZT A;  1IY4 A;  4DD9 A;  3HBE X;  1OUC A;  1OUJ A;  1QSA A;  1UIC A;  2EIZ C;  1HML A;  1IWX A;  1GFG A;  1B7O A;  1HEP A;  1JJ0 A;  5B59 A;  1HEW A;  1G7J C;  1HEN A;  1QIO A;  5LVJ A;  1XGQ C;  1T6V L;  1NWG A;  2BQF A;  3RNX A;  3A8Z A;  4J1B A;  1JHL A;  5DL9 A;  5C6J A;  9LYZ A;  4WO9 A;  5B07 A;  2DBT A;  1JUG A;  2BQM A;  4J0L A;  3TXG A;  3ZVQ A;  1EL1 A;  1XEI A;  2C8P A;  1XGP C;  5KXL A;  1HSX A;  2EQL A;  2D4J A;  1FBI X;  3EBA B;  4LFP A;  4TTD A;  5LAG A;  1UID A;  1B7L A;  4DD0 A;  4NGZ A;  1HFX A;  4LGK A;  1WQN A;  1IWZ A;  1IP1 A;  1GFK A;  1G7H C;  2BQA A;  2CDS A;  1YAQ A;  3RW8 A;  4ANR A;  3D3D A;  1GFV A;  3CSZ A;  5LVG A;  1LKS A;  4NGV A;  3P65 A;  4CFO A;  1LAA A;  1IWW A;  4NGI A;  3A91 A;  2MED A;  2BQJ A;  3A90 A;  4B0D A;  1KXX A;  4MCK A;  1F0W A;  4G4C A;  3AW7 A;  1BB5 A;  3OJP A;  2Z18 A;  1LSY A;  4HJV A;  5ILF A;  2LHM A;  4LYC A;  4UWU A;  2LZT A;  1UIH A;  4QDN A;  1IEE A;  4R0F A;  5I5Q A;  5C6I A;  1GBO A;  1A4V A;  1C43 A;  1JKA A;  5LYT A;  1NKH A;  3CT5 A;  1IR9 A;  5J7C A;  1HSW A;  3WUL A;  2BQB A;  3F6Z A;  4LT2 A;  3A92 A;  2HU3 A;  3T6U A;  208L A;  3A3Q A;  4HTQ A;  4HJZ A;  1I56 A;  4L41 A;  2WAR A;  2DQJ Y;  4I8S A;  4WM1 A;  5FEK A;  1CKH A;  1J1P Y;  4LT0 A;  4ET9 A;  2YBI A;  2BQI A;  1GB0 A;  1GB3 A;  1LSP A;  1LZG A;  3ATO A;  4PHI A;  3IWR A;  1XGR C;  4TUN A;  5KXZ A;  1GF6 A;  1AT6 A;  5F16 A;  3AZ7 A;  4NGO A;  1LSZ A;  4LYT A;  2A7F A;  2MEA A;  4WL7 A;  1CKD A;  2BLX A;  2F4G A;  4BS7 A;  4ZIX A;  1OQM A;  1ZV5 L;  2IFF Y;  5I4Y A;  3A94 A;  1IWT A;  4NGJ A;  4XJG A;  4NG1 A;  2DQA A;  1ZVY B;  1B5V A;  1UUZ C;  1LZ5 A;  1WQO A;  1VED A;  5E9R A;  1LJ3 A;  4H9E A;  1RFP A;  3SP3 A;  1IWY A;  4J1A A;  2ZYC A;  1FKV A;  3FE0 A;  1OP9 B;  1BB4 A;  3E3D A;  2BQD A;  1J1O Y;  4OWC A;  1GF8 A;  1OUH A;  4OWE A;  4BAD A;  3EO5 A;  2MEC A;  3RT5 X;  1XGT C;  1FN5 A;  1ALC A;  2NWD X;  3K3T A;  2HEE A;  1WQR A;  2MEB A;  1T3P A;  4X3B A;  3WXT A;  3EXD A;  4YF2 A;  1C10 A;  134L A;  3CT1 A;  4WO6 A;  1IX0 A;  4KL7 A;  4C3W A;  1LHK A;  2YSS C;  2W1Y A;  1NBZ C;  1CKG A;  2HEC A;  1EQ4 A;  4NHS A;  4GCD A;  1LPI A;  3B6L A;  1DI4 A;  4NIJ A;  4NY5 A;  4IAS A;  1DZB X;  1WVV A;  5L3I A;  4NWE A;  3A6B Y;  3WXU A;  3A96 A;  2HUB A;  1LZY A;  4FDY A;  4BAF A;  1UIG A;  1O23 A;  4WOA A;  5IEL A;  135L A;  1B7M A;  2Q0M X;  4W94 A;  1B7N A;  1CJ6 A;  1PS5 A;  1TBY A;  2FYD A;  2Z19 A;  3RU5 A;  3IJU A;  4WLT A;  3W6A A;  1GDW A;  5I4W A;  4HJY A;  2PC2 A;  5LIN A;  3B0I A;  2EKS C;  1IP2 A;  5KXM A;  1HFY A;  3J6K A;  1OUF A;  1GF3 A;  5LVH A;  1JIY A;  1IY3 A;  2XBR A;  3AGG G;  4AGA A;  1FKQ A;  4HTK A;  4NHP A;  4CHX A;  4DWX A;  3LHM A;  4M4O A;  4WLD A;  1B5Z A;  1LZ6 A;  1IO5 A;  1GE3 A;  1IC4 Y;  2W1M A;  1YIK A;  2YBH A;  4NGY A;  2ZIL A;  5F9U A;  4ETA A;  3WW6 A;  4I0C A;  4IAT A;  1GFJ A;  1IIZ A;  1YAN A;  2MEI A;  5KXT A;  1GF4 A;  1B7R A;  1KXW A;  1QTE A;  1QDR A;  4NSI A;  3B0O A;  5L9J A;  1KIR C;  1UBZ A;  4G49 A;  1LJF A;  3G3A B;  1GE0 A;  5E4P A;  1JIT A;  1LJG A;  1BHZ A;  1JPO A;  3W3E A;  1IR8 A;  3TXB A;  1FDL Y;  4NWH A;  3MGW A;  3N9A A;  1JIS A;  4H93 A;  3WUA A;  4NSJ A;  1LSG A;  1JTP L;  1LZ1 A;  2XTH A;  1GFH A;  3A3R X;  4GCF A;  3W6B A;  1HEM A;  1QUS A;  2YBL A;  3WU9 A;  1OUA A;  5KXS A;  3TMX A;  1H87 A;  1LSM A;  1W6Z A;  1TAY A;  1LJ4 A;  4XJH A;  5B06 A;  2Z38 A;  2MEG A;  5KKI A;  1TDY A;  1F6S A;  2G4N A;  4G4H A;  4WG1 A;  2ZYP A;  2YDG A;  4WM4 A;  3FI7 A;  4WM5 A;  4OW1 A;  4D9Z A;  1HEO A;  2BQH A;  3A93 A;  2I25 L;  4XJD A;  3W6E A;  4CJ2 A;  3P66 A;  1XGU C;  4PRU A;  1GXV 2;  1IOR A;  4HV2 A;  1DKK A;  1GBW A;  1RE2 A;  3ZEK A;  4U3X B;  5A3Z A;  6LYT A;  1TEW A;  1WTM A;  4KXI A;  1SQ2 L;  2HED A;  4TSB A;  1GF7 A;  1NDG C;  1QSW A;  2A7D A;  1JEF A;  2H9K A;  3N9E A;  4WG7 A;  3CSQ A;  3WL2 A;  5M1Y A;  4IJ4 A;  1HEQ A;  4WL6 A;  3TXF A;  4H9H A;  1VAT A;  5DN5 A;  5IDD A;  2ZNX Y;  2X0A A;  2Z12 A;  4XEN A;  4WMG A;  4UWV A;  4ETC A;  4GN4 A;  4HPI A;  3AW6 A;  4A7D A;  4Z46 A;  4HP0 A;  1C7P A;  1CJ7 A;  2Z37 A;  3KAM A;  3AGI A;  4FJR A;  5F14 A;  2FBB A;  1Z55 A;  2C8O A;  1JJ1 A;  1LZB A;  2CJL A;  4QEQ A;  1VDQ A;  1IOC A;  4H9B A;  1IVM A;  1JTT L;  1IWV A;  1UIB A;  2Z2E A;  1NMM A;  4YEM A;  5KY1 A;  1LMT A;  3LYZ A;  1YL1 X;  4B1A A;  1GE4 A;  4YOP A;  1SLY A;  4H1P A;  1YAO A;  4NHI A;  1GBZ A;  2LYM A;  2BQE A;  5HNL A;  3TXK A;  1WQQ A;  1B9O A;  4II8 A;  1GPQ C;  1GF0 A;  1FLU A;  1OUB A;  5D5F A;  194L A;  1ZVH L;  4HV1 A;  4CFP A;  5F81 A;  3AYQ A;  1REZ A;  4H9I A;  5JEN B;  1LSC A;  2W1L A;  2XBS A;  1BB6 A;  1BWJ A;  1GB8 A;  1LJJ A;  4XJB A;  1YKX X;  4H91 A;  1GFT A;  4J7V A;  5LYM A;  4YEO A;  4BAP A;  1WTN A;  4Z41 A;  1BWI A;  1UIA A;  2FYC A;  1GB6 A;  4LT1 A;  4NGW A;  4OWH A;  2F4A A;  4W96 A;  1W08 A;  1WQP A;  5I4X A;  4NEB A;  1GE2 A;  2IHL A;  1F6R A;  1G7I C;  1RJC B;  3LZT A;  4N0J A;  2BAA A;  1YQV Y;  4NG8 A;  3WU8 A;  1GE1 A;  154L A;  1RI8 B;  2VB1 A;  1GAY A;  2DQI Y;  1LYO A;  1UIF A;  2DQF C;  1CJ8 A;  1LJN A;  4QGZ A;  1D9U A;  2DQG Y;  1XFP L;  1PZY A;  4TSC A;  1GBY A;  2BQL A;  1B5W A;  1LSB A;  1VDT A;  1VFB C;  4AXT A;  4TX7 A;  1NQI A;  1YAP A;  3ULR A;  133L A;  1B5Y A;  1B5X A;  2MEF A;  1BVX A;  4KT3 A;  3P64 A;  4H9C A;  1KIQ C;  4DYG A;  1B7P A;  4LT3 A;  4ETB A;  2HTX A;  3TXJ A;  1CKF A;  1LZE A;  5A3E A;  1GB7 A;  2Z39 A;  5B1G A;  1G7L C;  4NSG A;  4ZEE A;  1OUE A;  4WM2 A;  1HER A;  5L3H A;  5KKJ A;  1UC0 A;  1B0D A;  2CGI A;  1LZN A;  1YAM A;  3LZ2 A;  2HEA A;  5B1F A;  4NHT A;  3WUM A;  5HQ1 A;  3B0K A;  1AM7 A;  1IOQ A;  4N1C C;  1OUG A;  1H6M A;  4XJF A;  1JKB A;  4NGL A;  1D6P A;  2BQC A;  2G4Q A;  1REM A;  4RLN A;  4O34 A;  4H8Y A;  4RW2 A;  4QY9 A;  207L A;  1LOZ A;  4ETD A;  5KXY A;  5HNC A;  1KXY A;  2ZWB A;  4DD1 A;  1IP6 A;  1YRO A;  1DQJ C;  1LHM A;  4PGJ B;  3TMU A;  1IP4 A;  3ZVQ B;  2I26 L;  1FLY A;  1RCM A;  1DI5 A;  1P2C C;  1DI3 A;  4LYZ A;  3WPL A;  5HLL A;  1LHL A;  1WVU A;  3A67 Y;  5I54 A;  5KXR A;  3BKV A;  2ZQ4 A;  1QUT A;  5FST A;  2MEH A;  4DT3 A;  2DQC Y;  2BQG A;  4B4I A;  4DD7 A;  2D91 A; 
#chains in the Genus database with same CATH topology
 4PRQ A;  2BWB A;  2L4F A;  2X8A A;  1REX A;  3KP0 E;  1SSW A;  3PXG A;  1QQY A;  3B72 A;  2M60 A;  5ITX E;  3NY8 A;  1IP7 A;  1DYB A;  1QDT A;  1B5U A;  1LJK A;  5APE A;  2HWJ A;  2BQO A;  1QYR A;  5KQ8 A;  3TXE A;  1L95 A;  3CSR A;  5APF A;  5ITT A;  4H9A A;  4GEW A;  1GB9 A;  2LZ2 A;  4H8X A;  1L55 A;  4B49 A;  2LCB A;  4WM6 A;  1GB2 A;  1L64 A;  1QUH A;  3CDO A;  1VDS A;  4Z6Y A;  1WJ7 A;  1LMC A;  1SSY A;  4LY6 A;  156L A;  4B4J A;  1CX7 A;  1LI2 A;  4NSH A;  1NSF A;  5FDJ A;  4LF6 M;  2DQE Y;  1GB5 A;  2Z2F A;  1VQ1 A;  4OOO A;  1OVK A;  3DMX A;  2ZTD A;  4B7F A;  3AGH A;  1LKR A;  4HTN A;  5T3F A;  1E9S A;  2FBD A;  2C5R A;  2R6F A;  3LYM A;  5DN4 A;  2L6O A;  1FNN A;  141L A;  4DUY M;  5E6J A;  1NV8 A;  1C45 A;  206L A;  1D0K A;  4M0D A;  1L76 A;  253L A;  1CTW A;  5KJ9 A;  1WHC A;  1L8Q A;  5EBH A;  2DKV A;  1MJG M;  1LSF A;  6LYZ A;  3TPZ A;  5LA8 A;  4GC9 A;  8LYZ A;  4LDO A;  1IR7 A;  1LMQ A;  3RUN A;  2JP7 A;  4CHT B;  252L A;  3GLG B;  2XSZ D;  1LHH A;  5EXP A;  1LMN A;  1IY2 A;  1EFU B;  3LQQ A;  1UIE A;  3HTB A;  1LMA A;  2LYZ A;  2UUC M;  1C08 C;  2B7X A;  4DDC A;  2AHM A;  191L A;  1B2K A;  5FTJ A;  4CIS A;  2E5L M;  1T6O A;  1G07 A;  3HWL A;  3IJV A;  2MH8 A;  4NRV A;  1LYS A;  4LZZ A;  1CKC A;  1D3F A;  2EUC A;  4RW1 A;  1XB2 B;  3AKZ A;  1L20 A;  1VAU A;  3UJN A;  7LYZ A;  2I6Z A;  3AFH A;  5ILC A;  1V7T A;  2UU9 M;  1N4F A;  3DNA A;  3EMS A;  4DD3 A;  245L A;  1LZR A;  4DR3 M;  2XF3 A;  3QE8 A;  1JSE A;  4G4R A;  4LDE A;  4C5F A;  2JY7 A;  1DGH B;  3HZJ A;  1KY0 A;  3AOE C;  2H9J A;  2KRU A;  1GEZ A;  2RBQ A;  1AT5 A;  2XSZ A;  2C96 A;  1HNW M;  3KDS E;  110L A;  3V76 A;  3LN2 A;  3GXR A;  1NNJ A;  1BWH A;  4HSF A;  2DKL A;  2RAY X;  2CE7 A;  2DQH Y;  1C6C A;  3HBD A;  4W58 A;  4MGY E;  4W5W A;  5KXW A;  4DR4 M;  1C67 A;  1Z5C A;  2D7G A;  2ZIJ A;  2QB0 B;  3N9C A;  1LCN A;  153L A;  3RE8 A;  3SYK A;  4MR1 A;  2EKK A;  5KXX A;  3E46 A;  3DN0 A;  2F2N A;  4XK8 F;  4XAD A;  1J09 A;  1JWR A;  5B05 A;  4KO8 A;  1HNL A;  1B6I A;  3A6C Y;  1L65 A;  1L14 A;  182L A;  3D4S A;  4DV4 M;  1DPX A;  257L A;  2DZO B;  4B7H A;  1T43 A;  2MJ5 B;  1G7M C;  1D9W A;  1EQ5 A;  2ZNW Y;  2BLY A;  2FNA A;  1QT3 A;  1WGN A;  1OQY A;  4WUR A;  1GD6 A;  4R71 A;  2YBJ A;  1BB7 A;  3GLF E;  1C7Y A;  3HBE X;  3FUT A;  1OUJ A;  1OUC A;  1QSA A;  1UIC A;  1LPY A;  1C68 A;  3HU9 A;  1L94 A;  1IWX A;  2XFS A;  1HEP A;  184L A;  1JJ0 A;  171L A;  1HEN A;  3OTO M;  1T6V L;  1NWG A;  2BJW A;  3A8Z A;  1JHL A;  5C6J A;  3K9P A;  2B72 A;  1DYG A;  3CDR A;  3AV0 A;  2DWM A;  1JUG A;  4A3V B;  1QUO A;  4J0L A;  3TXG A;  4B3T M;  1XEI A;  2C8P A;  5KXL A;  4LFP A;  2HCB A;  4TTD A;  4OU7 A;  3GLF A;  4NGZ A;  3JR4 A;  1V92 A;  4G3O A;  1LI3 A;  1G7H C;  2BQA A;  2VF8 A;  1YAQ A;  2CDS A;  1L68 A;  4W52 A;  4NGI A;  3DOA A;  4CJ6 A;  244L A;  3U6S A;  4MCK A;  151L A;  1WXQ A;  189L A;  4DJH A;  3AW7 A;  3FKE A;  4ARQ B;  4L16 A;  1LSY A;  4HJV A;  1ZV1 A;  1IEE A;  2DWZ B;  5LYT A;  3GLH E;  4GBR B;  3QAK A;  5J7C A;  1HSW A;  3RZE A;  3FE3 A;  4KHP M;  1L11 A;  4DQ5 A;  150L A;  3A92 A;  1L1T A;  3VLF B;  4JYA M;  3GLH B;  4F1I A;  5EXS A;  1LYF A;  1CUQ A;  1QT6 A;  2WAR A;  2DQJ Y;  4W59 A;  1VDL A;  4ET9 A;  2YBI A;  1TH2 A;  1OIP A;  5KXZ A;  4TUN A;  3HJS A;  1AT6 A;  3SAS A;  4LYT A;  4BS7 A;  2BLX A;  3LZM A;  3V2W A;  2KRK A;  2IFF Y;  3HT6 A;  3U6L A;  1B5V A;  1E9R A;  213L A;  3FI5 A;  3HUA A;  5E9R A;  1CV6 A;  1ZMU A;  4J1A A;  3FE0 A;  4QHS A;  2BQD A;  3I01 M;  1J1O Y;  4OWC A;  4BAD A;  3HHX A;  2QSF X;  3RT5 X;  1XGT C;  1FN5 A;  2LVP C;  3K3T A;  1G4A E;  1CUK A;  1QZM A;  2HEE A;  2MEB A;  4XBO A;  3I4V A;  3WXT A;  2RBS A;  1J5E M;  1C10 A;  4YF2 A;  1P64 A;  2R65 A;  1IX0 A;  1IQP A;  1TGU A;  1CKG A;  1QTB A;  1EQ4 A;  2Y0Q A;  1LPI A;  1DI4 A;  3C7Z A;  1L2C A;  5L3I A;  3GLG A;  5E26 A;  230L A;  3HWS A;  5F3W A;  4BAF A;  2OU0 X;  4WOA A;  246L A;  5IEL A;  4DR1 M;  1B7M A;  1TR8 A;  4AQN A;  3SBA A;  4R3D A;  143L A;  3GPY A;  2VII A;  4HJY A;  4G4N A;  2EKS C;  1HFY A;  4LGM A;  1DYA A;  5LVH A;  1C69 A;  1ZUR A;  4DWX A;  3AGG G;  3AOG A;  1G59 A;  5F9U A;  1YIK A;  3L25 A;  2ZIL A;  1L85 A;  3SYL A;  3WW6 A;  3BBZ A;  4S12 A;  4I0C A;  2MEI A;  4NL4 H;  1IIZ A;  1GFJ A;  5KXT A;  1L50 A;  2BJV A;  1GF4 A;  1DYC A;  4NSI A;  1JQJ C;  3C8S A;  146L A;  1KIR C;  4G49 A;  1PJT A;  3A42 A;  1L61 A;  1IY1 A;  1JIT A;  1LJG A;  1DGH A;  1BHZ A;  2JZ0 A;  3N9A A;  3PVS A;  3W6B A;  2CWB A;  3A3R X;  1HEM A;  4FW9 A;  1QUS A;  2CHV A;  1OUA A;  5KXS A;  144L A;  1IY0 A;  1OWY A;  4I4L A;  4G4H A;  2JXN A;  3W67 A;  2YDG A;  3FI7 A;  250L A;  3VFD A;  4WM5 A;  1UFZ A;  4XJD A;  1PQO A;  3QYB A;  1GXV 2;  1DKK A;  4I7P A;  3GPU A;  3GUJ A;  3SB9 A;  1SQ2 L;  5APD A;  1QSW A;  2A7D A;  4WG7 A;  1W5S A;  5ITY A;  4LJ6 A;  3SB8 A;  3WL2 A;  1L53 A;  114L A;  1VAT A;  5IDD A;  2ZNX Y;  4GHL A;  2Z12 A;  4XEN A;  2B6T A;  2P5T A;  3KSX A;  4Z46 A;  4LJ5 A;  5I14 A;  3C82 A;  3HT8 A;  2Z37 A;  2OU8 A;  2C8O A;  4H9B A;  3LQR A;  3U5Z B;  1IVM A;  4OO9 A;  1LMT A;  3FAD A;  4H1P A;  1N36 M;  1PJJ A;  4NHI A;  1WQQ A;  4ITQ A;  4CFP A;  5JEN B;  1E32 A;  4JI0 M;  1LSC A;  2RGH A;  3HTD A;  1YKX X;  4X65 M;  1L80 A;  4H91 A;  4J7V A;  4R7G A;  4LT1 A;  1CV0 A;  2FYC A;  229L A;  1GE2 A;  1RJC B;  1SXJ B;  2BAA A;  1LLH A;  1RI8 B;  4MGK E;  2VB1 A;  2DQI Y;  2DQF C;  4QGZ A;  3D8B A;  2OOB A;  2O5R A;  1CVK A;  3D8L A;  4FWD A;  2BQL A;  4AXT A;  1VFB C;  1NQI A;  4B08 A;  4KT3 A;  1GL6 A;  4B3R M;  3UMM A;  1KIQ C;  1L08 A;  4DV5 M;  4DYG A;  4LF4 M;  3HUQ A;  2DEN A;  2QBY A;  1L05 A;  1L52 A;  1TDH A;  5B1G A;  4NSG A;  3IEC A;  1Y8G A;  1L06 A;  1B0D A;  2CGI A;  1YAM A;  3BOS A;  2HEA A;  1JB0 F;  3WUM A;  4P17 A;  3KW6 A;  3HHZ A;  5HQ1 A;  2RB2 X;  4D82 A;  1HQC A;  4LGY A;  5KPR A;  2DXI A;  2OTY X;  4RLN A;  1D6P A;  4W53 A;  4O34 A;  4H8Y A;  4QY9 A;  3BXW A;  207L A;  1L63 A;  1CV5 A;  4ETD A;  1IP6 A;  1LHM A;  1DI3 A;  3K92 A;  3R8F A;  1LHL A;  1WVU A;  3A67 Y;  4S0W A;  1VEK A;  3BKV A;  4G6Z A;  122L A;  5FST A;  2MEH A;  4DT3 A;  2DQC Y;  3GRV A;  2LNH C;  3WUN A;  4EIW A;  211L A;  5HMV A;  4DQJ A;  4YEN A;  4D81 A;  132L A;  4GRV A;  3SC3 A;  1C46 A;  3K8Z A;  260L A;  3M0E A;  4YY3 M;  3QNG A;  5LMU M;  2CRU A;  1QAN A;  1NDM C;  3HGI A;  4PK0 A;  2N5Z A;  3TE6 A;  4IBI A;  4GCE A;  1HNZ M;  2RH1 A;  4WLX A;  4M9X A;  1GBX A;  5FCP A;  3FTE A;  1WR1 B;  4WM3 A;  1TH4 A;  4XJI A;  1BVS A;  5I53 A;  1GO5 A;  261L A;  1EQE A;  1LYG A;  4P2E A;  5C6L A;  4I7S A;  5KXO A;  4LF5 M;  3WMK A;  2BPU A;  1L26 A;  142L A;  2FH0 A;  4LF8 M;  2FS1 A;  4GC5 A;  3HJQ A;  5FHW A;  3W6C A;  3J27 B;  3HHY A;  3M7G A;  1F10 A;  1HFZ A;  3HUK A;  1QT7 A;  4P16 A;  1GF5 A;  1I94 M;  2LYO A;  4ETE A;  2DI0 A;  5LXW A;  1K28 A;  1L07 A;  1Z5B A;  2Z4R A;  3Q8G A;  1GBS A;  217L A;  3SN6 R;  2Q9E A;  2N35 A;  3FUW A;  4MGZ E;  108L A;  1IWU A;  1DPW A;  4G9S A;  2DHR A;  4NC6 A;  4GKJ M;  2O4W A;  4KOD A;  2G3Q A;  5LAF A;  4ARP A;  1IN8 A;  4W55 A;  2YBM A;  198L A;  3FTD A;  1L30 A;  1GF9 A;  3U6M A;  1OVH A;  5LZM A;  5IHG A;  2BWE A;  1XXH E;  1AKI A;  3A34 A;  3PDS A;  4B4E A;  1LZS A;  4EOF A;  2DVW B;  2XFT A;  186L A;  1NHE A;  4HLQ A;  1IC5 Y;  1BQL Y;  2CFO A;  4JI5 M;  1CNS A;  1GFE A;  3P4Z A;  4LZT A;  3WW5 A;  2QBY B;  1L59 A;  1LGW A;  2R44 A;  2Y8P A;  3WH1 A;  2R4J A;  1C61 A;  1L28 A;  2BQN A;  3L26 A;  1IC7 Y;  3T36 A;  3HTF A;  4I7L A;  1QTK A;  4IBJ A;  1L44 A;  4NGK A;  4LJ7 A;  2WSF F;  3C7Y A;  2YR0 A;  3AB6 A;  5LYZ A;  1L81 A;  2RAZ X;  1L02 A;  1YL0 X;  1HC0 A;  1C6N A;  149L A;  2HEB A;  3WVX A;  2QZ4 A;  4GCC A;  1DXJ A;  4L15 A;  1A2Y C;  1L54 A;  2AUB A;  1XEK A;  4QNR A;  1SX2 A;  104L A;  4B7G A;  3RGS A;  1MEL L;  2DAM A;  222L A;  242L A;  3GPP A;  1HQY E;  2VF7 A;  1GXX A;  3GXK A;  126L A;  1P5C A;  1LMP A;  2XLJ A;  1INU A;  1LTM A;  3GLF B;  2V1U A;  1HT1 E;  2ZAM A;  1L89 A;  233L A;  3WYH A;  4NXN M;  1P2L A;  2XZF A;  3CT0 A;  4IBK A;  2Y0T A;  1QTC A;  1TDZ A;  1IOT A;  3U61 A;  2OTZ X;  1QTV A;  4I7M A;  3GLI B;  1JTO L;  256L A;  3GO8 A;  3C3D A;  2LXE A;  1PQK A;  2X4A A;  1L31 A;  2B6W A;  3FRH A;  5DNY A;  2D4I A;  5L8R F;  1J1X Y;  4AG6 A;  2EO2 A;  1L58 A;  1T3T A;  3A98 B;  1I1Z A;  2BQK A;  129L A;  1JTM A;  5F9X A;  4PJ2 C;  3QY4 A;  2H5Z A;  1ZMW A;  2O7A A;  4UN2 B;  1LZA A;  1IOS A;  5EXX A;  1IY4 A;  1L48 A;  147L A;  4IJE A;  4AZF A;  1D2W A;  1B7O A;  1D3J A;  219L A;  155L A;  1YUB A;  4IJF A;  5LVJ A;  2BQF A;  9LYZ A;  1KW7 A;  4WO9 A;  5B07 A;  2BQM A;  2K47 A;  3MMP A;  1EL1 A;  4DV7 M;  4CGY B;  1XGP C;  3EBA B;  4QHT A;  4DD0 A;  2XEP A;  1TLA A;  102L A;  4LGK A;  4EKR A;  1TTE A;  251L A;  3HT7 A;  1XMO M;  2LWX A;  5LVG A;  3VW7 A;  1L25 A;  1LKS A;  4RF1 A;  2LH0 A;  5FTK A;  1LAA A;  1DGB A;  2BQJ A;  2B3T A;  1SXJ C;  1WGL A;  1BB5 A;  5ILF A;  1C6Q A;  1GJS A;  2LZT A;  4UWU A;  5I5Q A;  2QCU A;  1CV4 A;  1C43 A;  1JKA A;  4LZM A;  1LI6 A;  1C6T A;  3J2P B;  175L A;  3WUL A;  4I7K A;  1EE8 A;  2H1R A;  2D7H A;  3H4M A;  1L91 A;  4W57 A;  4HTQ A;  1I56 A;  1R4G A;  1L62 A;  4WM1 A;  5FEK A;  139L A;  1CKH A;  1J1P Y;  1L99 A;  3DMV A;  1GB0 A;  1C63 A;  1GB3 A;  1LSP A;  138L A;  4PHI A;  3ZQJ A;  1XGR C;  1IXR C;  1T8A A;  5F16 A;  1D3M A;  1L34 A;  2MEA A;  3DFZ A;  5EJC A;  1L66 A;  1CV1 A;  4LF7 M;  4E97 A;  2I7P A;  1IWT A;  4NG1 A;  3TMU A;  2DQA A;  1ZVY B;  4MGH A;  214L A;  1UUZ C;  3T1H M;  4DV3 M;  118L A;  4H9E A;  2OE4 X;  2L78 A;  3E3D A;  128L A;  1KY1 A;  1QTZ A;  1L77 A;  1T3P A;  4X3B A;  3UGJ A;  1I6S A;  1C6D A;  134L A;  4WO6 A;  4C3W A;  2YSS C;  1L43 A;  1D3N A;  3PBL A;  4GCD A;  4NIJ A;  4IAS A;  4NOO B;  2L7H A;  3A6B Y;  3GQ4 A;  1ZMV A;  2UUA M;  2C9O A;  1L98 A;  1O23 A;  4DR2 M;  1G1W A;  1PS5 A;  2CV2 A;  3IJU A;  148L E;  1OFH A;  1R7R A;  2MGW A;  1C6G A;  3J6K A;  1GF3 A;  2KA6 B;  1PJI A;  2ZAN A;  1IY3 A;  2XBR A;  4HTK A;  215L A;  4NHP A;  4CHX A;  3LHM A;  4M4O A;  4WLD A;  1XNQ M;  3OE8 A;  1LZ6 A;  1OAI A;  3KS4 A;  3J81 S;  225L A;  1IXS A;  1KXW A;  1QTE A;  223L A;  3B0O A;  5L9J A;  3VK7 A;  1JPO A;  1FDL Y;  4NWH A;  3MGW A;  3WUA A;  1LV7 A;  4IIW A;  1LSG A;  1L21 A;  1GAB A;  2YBL A;  4JV5 M;  4LFC M;  1W6Z A;  2DWL A;  1TAY A;  2F5S A;  1LJ4 A;  2Z38 A;  5KKI A;  1F6S A;  1G0G A;  1DYF A;  2K6B A;  4FCW A;  1YLA A;  1L2B A;  2JZ1 A;  2R0I A;  2BQH A;  3A93 A;  4OW1 A;  4D9Z A;  3P66 A;  4PRU A;  4HV2 A;  3ZEK A;  4U3X B;  1E94 E;  4EJ4 A;  1TEW A;  6LYT A;  2JY5 A;  3SB7 A;  1S3S A;  3Q8X A;  2HL7 A;  5DN5 A;  2Y21 A;  4FCV A;  123L A;  4I8O A;  3AW6 A;  4A7D A;  1SWZ A;  3IHP A;  1ZWN A;  3KAM A;  172L A;  241L A;  3AGI A;  4FJR A;  5F14 A;  227L A;  4QEQ A;  2CHG A;  1VDQ A;  3ZVQ B;  1NHW C;  1IWV A;  4L8R C;  1UIB A;  1NMM A;  3FA0 A;  2B70 A;  1G71 A;  3LYZ A;  2YNM D;  4B1A A;  1GE4 A;  1SLY A;  5JI2 E;  4Z8X A;  228L A;  2ZM6 M;  5HNL A;  1OUB A;  2FFJ A;  194L A;  1ZVH L;  1GKI A;  2HKJ A;  3U6E A;  169L A;  1REZ A;  3AYQ A;  2EJS A;  1L57 A;  1BB6 A;  2HHH M;  1GB8 A;  2HUM A;  2CUU A;  2DZL A;  218L A;  5LYM A;  1GFT A;  1W5T A;  177L A;  2R18 A;  3LMM A;  1BWI A;  4I7Q A;  2F4A A;  1KS3 A;  4I7R A;  4IBF A;  4W96 A;  2RBP A;  3U6Q A;  1L88 A;  4LJA A;  1G7I C;  1L23 A;  3LZT A;  2CHQ A;  1LWK A;  1V33 A;  2R46 A;  1T97 A;  1XJU A;  3KOX E;  1XFP L;  1QS9 A;  1VDT A;  3GUL A;  1YAP A;  4IBE A;  1B5X A;  1BVX A;  3PNV A;  4LJ8 A;  3TWM A;  3K9O A;  3DMZ A;  4LT3 A;  4LFB M;  5KQD A;  1MX0 A;  160L A;  3SAW A;  187L A;  3GRU A;  1LZE A;  1G7L C;  4ZEE A;  1OUE A;  4WP2 A;  4ZPU A;  5KKJ A;  4LF9 M;  1LZN A;  1QAQ A;  112L A;  2LC9 A;  1C6M A;  4IAP A;  4FCT A;  4NHT A;  3B7Q A;  2JUJ A;  238L A;  2O25 A;  3RGP A;  3B0K A;  3C9P A;  2UXD M;  1IOQ A;  4N1C C;  1OUG A;  3K2R A;  1OV7 A;  1GL7 A;  3HU8 A;  1HT2 E;  4NGL A;  232L A;  2G4Q A;  1OV5 A;  1KFV A;  1GVN A;  3L2X A;  5ITQ A;  1C6A A;  2KEB A;  4DD1 A;  4LRT A;  2EA0 A;  1DQJ C;  1G41 A;  1L03 A;  1QUD A;  1IP4 A;  240L A;  1L17 A;  258L A;  3AL0 C;  1RCM A;  1DO0 A;  3EIE A;  4DUZ M;  3DN8 A;  3WPL A;  5HLL A;  4LRS A;  4REZ A;  200L A;  3C7W A;  3KS8 A;  1J7K A;  1K82 A;  4B4I A;  4DD7 A;  2W1M A;  5H37 D;  1D2Y A;  1L45 A;  1ZMY L;  3GRR A;  3OE0 A;  2H5X A;  1CU5 A;  1R2Y A;  157L A;  1B7Q A;  254L A;  2VQE M;  2CWI A;  2XQO A;  3OE9 A;  1L32 A;  3SAT A;  4OWB A;  4DDA A;  1JR3 E;  161L A;  183L A;  5C18 A;  4H92 A;  3HU3 A;  4H94 A;  3M3U A;  2EKF A;  1LSA A;  1LHI A;  4LJ4 A;  259L A;  1WQM A;  1I4W A;  2KXE A;  3NY9 A;  239L A;  3M18 B;  4JXJ A;  145L A;  2HU1 A;  3FUV A;  3C83 A;  3W0L B;  3LCU A;  3BKH A;  1DKJ A;  3ATN A;  5EP4 A;  4AKH A;  4CGE A;  4GLV A;  4BBA A;  3CB7 A;  4Y28 F;  4FVM A;  1L19 A;  1PJS A;  4DV0 M;  3SB5 A;  2R62 A;  3CQL A;  2OOA A;  4KLN A;  1LJI A;  4LJ9 A;  181L A;  2X49 A;  1NVM A;  4GCB A;  1P3N A;  2EPE A;  4X62 M;  4EKP A;  4DV6 M;  4G4B A;  2B74 A;  3KP1 E;  4PCZ A;  2G4P A;  4JI1 M;  1MN3 A;  2LZM A;  2G5G X;  1LHJ A;  8CAT A;  1IBK M;  1GFU A;  1L40 A;  1A5T A;  2MRO B;  1FLW A;  2MR9 A;  2ANX A;  2DAI A;  4Z3M A;  4H90 A;  3HU1 A;  1LGX A;  3FYC A;  1QTD A;  4WLY A;  4ZPX A;  2QPA A;  1C62 A;  1L16 A;  1VDP A;  2DNA A;  248L A;  3C8Q A;  2XJW A;  2QP9 X;  4BLC A;  2UXB M;  1KNI A;  3VWO A;  2O79 A;  2JWS A;  2HEF A;  1FLQ A;  1L49 A;  1C6J A;  3HHW A;  4ARM B;  1QT4 A;  1SWY A;  5APC A;  5LVK A;  3WPJ A;  4TWS A;  3J4G A;  1LGU A;  5DM9 A;  5DYG A;  5KXN A;  3T1Y M;  3P68 A;  4XN6 A;  1HEL A;  1P56 A;  4DD2 A;  5EQT A;  1OAO C;  4F2L A;  3L29 A;  3DKE X;  3A95 A;  1C6E A;  3OE6 A;  1NJG A;  4I5S A;  1PJQ A;  2J7N A;  5D5C A;  1C6L A;  1XWI A;  4N5R A;  1LZD A;  4NSO B;  3SHF A;  4HPE A;  1GLN A;  1XSF A;  4I7O A;  3G3W A;  5GKN A;  3AOE A;  2Q2E B;  1JSF A;  1OIZ A;  2GNO A;  2YBN A;  3HTG A;  3TXI A;  3DN3 A;  4EMN A;  4H9F A;  1MU5 A;  4DV1 M;  193L A;  1LSN A;  1D2N A;  1NBY C;  2B75 A;  1NF5 A;  1LSE A;  1T8F A;  1L27 A;  5AMY A;  4OOT A;  1V34 A;  4E3U A;  1ORY B;  221L A;  5KPZ A;  103L A;  2C9C A;  3SAV A;  3TXH A;  4N8Z A;  1C66 A;  3DN2 A;  4N1E I;  1XEJ A;  1L79 A;  4NRW A;  3L2A A;  1IFY A;  3E4R A;  2OPF A;  4LYB A;  1C6H A;  4GN3 A;  2CV1 A;  1Z59 A;  127L A;  1L92 A;  4N9R A;  1L24 A;  3GLG E;  3SMS A;  4LYO A;  5ITU A;  255L A;  3ZH9 B;  4EPF A;  2Z8Y M;  140L A;  3R9X B;  3VDU A;  1XNR M;  3I04 M;  4W54 A;  3AJI B;  231L A;  1P46 A;  3FD9 A;  1UAC Y;  1GWD A;  3NBX X;  4X64 M;  1E8L A;  4NSR A;  1AZF A;  3D9A C;  2GV0 A;  2MEE A;  2D7E A;  1LW9 A;  158L A;  159L A;  2DAK A;  4D80 A;  4YXA C;  2KDL A;  3PFI A;  3T6P A;  1G0Q A;  1LYZ A;  3G3X A;  3WPK A;  1YKY X;  5A2Q S;  1LZT A;  3DA1 A;  1G0K A;  4GHA A;  2ZTC A;  2LHC A;  4QNM A;  1L74 A;  1GFG A;  5B59 A;  1HEW A;  5BPV A;  1QIO A;  249L A;  1XGQ C;  3RNX A;  4J1B A;  2GQF A;  1HSX A;  3U60 B;  2D4J A;  2CV0 A;  4MB7 A;  5IZ7 D;  1IWZ A;  2RB1 X;  3RW8 A;  3CDT A;  1L09 A;  4ANR A;  3FYD A;  3A46 A;  3U6C A;  4CFO A;  4EKS A;  4LFA M;  4EXM A;  2MED A;  1YE9 A;  3B7Z A;  3A90 A;  1KXX A;  1PQI A;  192L A;  1L47 A;  1LYH A;  4X66 M;  3C81 A;  3GRY A;  3L27 A;  4LYC A;  1WTH A;  1OVJ A;  1UIH A;  2F2Q A;  1GBO A;  2A4T A;  1NKH A;  3LW5 F;  3JR5 A;  3IG8 A;  236L A;  3F92 A;  2BQB A;  3F6Z A;  2HU3 A;  3SAR A;  3GLH A;  3T6U A;  2J5Y A;  208L A;  1R2Z A;  4YHH M;  2LVN C;  2LVA A;  4HJZ A;  4B3S M;  1C6K A;  1Q3B A;  4PJZ A;  1X37 A;  4K5Y A;  1LZG A;  3ATO A;  3IWR A;  4JI2 M;  2NTH A;  4NGO A;  1LSZ A;  2A7F A;  119L A;  4ZIX A;  1PGY A;  3KOZ E;  1OQM A;  1ZV5 L;  4PDI A;  4II7 A;  4XJG A;  1L93 A;  5IT9 S;  1WQO A;  1GJT A;  3HH5 A;  3WHL A;  1RFP A;  125L A;  1IWY A;  1JR3 D;  1L33 A;  2ZYC A;  1L18 A;  1BB4 A;  2B6X A;  5JI3 E;  1HJP A;  113L A;  1CU3 A;  4OWE A;  1GF8 A;  3MK6 A;  3EO5 A;  2MEC A;  1ALC A;  2NWD X;  1QQW A;  262L A;  1VG5 A;  2FOI C;  190L A;  3CT1 A;  4WW0 A;  4KL7 A;  4PT5 A;  3ODU A;  2HEC A;  3QAU A;  4NHS A;  2KNA A;  3GP1 A;  1WVV A;  4W56 A;  4NWE A;  3U6O A;  3WXU A;  4DR5 M;  2HUB A;  4ARQ A;  1SXJ D;  4PD2 A;  2OE9 X;  1C65 A;  1L96 A;  3UON A;  4QOS A;  1G0M A;  1B7N A;  3VKG A;  2HUL A;  3NYA A;  2Z19 A;  3RU5 A;  3CF0 A;  4WLT A;  3W6A A;  1GDW A;  5LIN A;  2KNZ A;  3C3E A;  1DYD A;  1WIV A;  3HU2 A;  2LTU A;  3GUO A;  1OUF A;  1NHB A;  1JIY A;  1JR3 A;  4EKQ A;  1CUP A;  4NGY A;  1IO5 A;  1GE3 A;  3G3V A;  4KT0 F;  1QZE A;  4ETA A;  4GH9 A;  2V6Z M;  1L42 A;  3M6A A;  1B7R A;  1QDR A;  1RU3 A;  1NV9 A;  3TQS A;  4JI4 M;  1UBZ A;  1PRB A;  2CUZ A;  1N78 A;  1N32 M;  167L A;  3W3E A;  1IR8 A;  2QEN A;  7CAT A;  2F5Q A;  1JIS A;  4H93 A;  1GFH A;  3GUM A;  3WU9 A;  1SXJ A;  3GPX A;  3TMX A;  3KOY E;  3SB6 A;  1L39 A;  2QHO B;  2MEG A;  2ERC A;  2G4N A;  3HDF A;  3U6P A;  2ZYP A;  1KSF X;  4WM4 A;  2DAG A;  1L82 A;  1HEO A;  3W68 A;  2I25 L;  1QVR A;  3W6E A;  2LVO C;  1XGU C;  3B9P A;  5DFL A;  220L A;  4KXI A;  4TSB A;  2H9K A;  1JEF A;  4IJ4 A;  3VKH A;  4WL6 A;  4GIT A;  2DAE A;  3TXF A;  3DN1 A;  6LZM A;  2X0A A;  1QT8 A;  3SBB C;  4HL4 A;  4UWV A;  4DBG B;  4HPI A;  4HP0 A;  1C7P A;  1CJ7 A;  3THG A;  2FBB A;  2CJL A;  3FRI A;  3U5Z A;  4FD2 A;  1G8P A;  1JTT L;  2Z2E A;  1YL1 X;  1XJT A;  3B7N A;  4GMQ A;  5IWA M;  1YAO A;  5EP1 A;  1GBZ A;  2BQE A;  5KXR A;  4JI7 M;  1B9O A;  1FLU A;  3SFZ A;  3EIH A;  3L28 A;  2XBS A;  2F5O A;  2ZBK B;  1LJJ A;  3HH6 A;  4BAP A;  4Z41 A;  2UXC M;  1AIP C;  1EPY A;  5ITX A;  1UIA A;  1GB6 A;  4NGW A;  1OFI A;  1W08 A;  1C6F A;  1WQP A;  4LZJ A;  4NEB A;  5I4X A;  2IHL A;  1R6B X;  2C99 A;  4N0J A;  3LVW A;  1IN7 A;  3A45 A;  1GE1 A;  1LYO A;  3SBJ A;  180L A;  1LJN A;  3QWL A;  2RRU A;  1N77 A;  1CU0 A;  2DQG Y;  1R5L A;  1GBY A;  2M5Z A;  1B5W A;  4GRI A;  1LSB A;  2ANV A;  4TX7 A;  3ULR A;  1B5Y A;  107L A;  2MEF A;  1N75 A;  3P64 A;  4ARL A;  3CTW B;  1CU2 A;  1L86 A;  3CF2 A;  3DN4 A;  1GB7 A;  2Z39 A;  1L36 A;  3J80 S;  3ZC7 B;  2B6Y A;  2KHH A;  1L22 A;  5B1F A;  4G4Q A;  1L67 A;  195L A;  1AM7 A;  1L69 A;  115L A;  1H6M A;  2BQC A;  4RW2 A;  1LOZ A;  2RGO A;  5KXY A;  5LMN M;  1KXY A;  2ZWB A;  1G3I A;  1KW5 A;  1NO1 A;  5DYI A;  1C1K A;  1C6I A;  1DI5 A;  4OW0 A;  4LYZ A;  1L84 A;  2F32 A;  1DO2 A;  5I54 A;  1TF0 B;  2ZQ4 A;  3HY5 A;  1QUT A;  1G0P A;  2BQG A;  4PDG A;  1DGG A;  3TWK A;  5KXP A;  4H8Z A;  3TWL A;  4I7J A;  1XMQ M;  3B74 A;  4JI8 M;  1GAZ A;  1XXH A;  4GLA A;  1CJ9 A;  2W1X A;  1UCO A;  165L A;  1HR0 M;  4OWA A;  130L A;  2RKO A;  1HMK A;  1UM8 A;  4OVZ A;  4M0W A;  3DN6 A;  1IP5 A;  3NWL A;  2DQD Y;  1L1Z A;  2F47 A;  4M6D A;  3OK0 A;  3RZ4 A;  1GFA A;  3WU7 A;  4YX7 C;  4NXM M;  1LSD A;  4NFV A;  1VEJ A;  2JNH A;  2IGC A;  1L37 A;  4I7T A;  3CDQ A;  5DLA A;  170L A;  5FEL A;  5LIO A;  1DGF A;  3W6D A;  3AZ5 A;  2APL A;  4PPO A;  1L29 A;  1SG9 A;  4G4O A;  4MST A;  2L09 A;  1L15 A;  4DV2 M;  2XH9 A;  209L A;  5KXK A;  1HF4 A;  1V7S A;  3H4J A;  1F4I A;  5II3 A;  1XHB A;  1HHL A;  1BB3 A;  1C6P A;  1LJH A;  2LHG A;  2D6B A;  1LZ9 A;  3HT9 A;  1I20 A;  2B5Z A;  1BGI A;  5C1B A;  2ZQ3 A;  1Q02 A;  226L A;  3L64 A;  3FTF A;  1L46 A;  196L A;  4IBG A;  4CIZ A;  3DZD A;  4IBB A;  4DC4 A;  5FLX S;  2DHY A;  2F30 A;  1GHL A;  4GN5 C;  1OKS A;  1QAM A;  166L A;  3GLI E;  1GFR A;  1IN4 A;  1LMO A;  5HMJ A;  1L38 A;  4ZFP A;  1LYJ A;  3G3B B;  4R6C A;  3UZU A;  2CP8 A;  3WVY A;  1GDX A;  3TMV A;  4W51 A;  1DV0 A;  4RDS A;  4L78 A;  2C98 A;  1C60 A;  2D4K A;  1NY5 A;  2OU9 A;  4NHQ A;  199L A;  2YQZ A;  4ML7 A;  1TCY A;  1OUI A;  1CX6 A;  3ZCB B;  2L4E A;  3I51 A;  1D0M A;  1L72 A;  2Q9D A;  4I81 A;  1LZC A;  4FWG A;  4DQ7 A;  3AZ4 A;  4LFX A;  1L60 A;  5FTM A;  1HNX M;  1OUD A;  1G1V A;  3GQ5 A;  152L A;  3T38 A;  1LJE A;  2NTG A;  1PQD A;  234L A;  3HX3 A;  1JTN A;  4KPM A;  4XYY A;  3E21 A;  2YVB A;  1XEP A;  3B89 A;  1OJL A;  4TUW A;  1MLC E;  5BR8 M;  1ZYT A;  1LYY A;  1KIP C;  3GUP A;  1IP3 A;  2R45 A;  185L A;  4LYM A;  2KNV A;  2RSC A;  2NQ8 C;  4ET8 A;  3LYO A;  4K0K M;  1P36 A;  4UWN A;  5KPT A;  1B7S A;  3MHV C;  3U60 A;  163L A;  4MM3 B;  1JKD A;  1Z5A A;  1BVK C;  1L83 A;  3FUU A;  1L56 A;  3SAU A;  3LCV B;  1EIJ A;  1UA6 Y;  1LZ4 A;  1N34 M;  1GEV A;  4RF0 A;  4AG5 A;  3WHK A;  4DDB A;  5FTN A;  3F9L A;  3CGW A;  2RBN A;  1L10 A;  1IBM M;  3TMW A;  1L75 A;  1L90 A;  2VQF M;  5LVI A;  1REY A;  4Z98 A;  5K7O A;  1JKC A;  5KO3 A;  1LZ8 A;  4M9S A;  1LYD A;  2I7N A;  4YM8 A;  1D6Q A;  4RLM A;  2JY6 B;  1L04 A;  1D0L A;  2BNK A;  1K3X A;  1YIL A;  3KVW A;  1N33 M;  2ZIK A;  3HDE A;  3W0F A;  3AJN A;  1YKZ X;  2K9D A;  2F5N A;  1PQM A;  1PM5 A;  1JJ3 A;  4AKG A;  1G0L A;  5LA5 A;  4AI6 A;  3HFM Y;  2WZJ A;  1SX7 A;  137L A;  3AZ6 A;  3TXD A;  3HBH A;  3LYT A;  3W6F A;  4DD9 A;  2EIZ C;  1JQU A;  1HML A;  5FSW A;  1G7J C;  2WSE F;  4JI6 M;  1P2R A;  5DL9 A;  1DYE A;  2DBT A;  1QTH A;  1L0J A;  3ZVQ A;  2EQL A;  1FBI X;  5LAG A;  1UID A;  1CU6 A;  1B7L A;  1L87 A;  1HFX A;  224L A;  1WQN A;  1L12 A;  1IP1 A;  1GFK A;  4IBD A;  3D3D A;  1GFV A;  3CSZ A;  4EPI A;  4NGV A;  3P65 A;  1XXH B;  1IWW A;  3A91 A;  1NY6 A;  205L A;  120L A;  4B0D A;  4MGI E;  1F0W A;  4G4C A;  3GUN A;  2XGN A;  3GQ3 A;  3GLI A;  1L41 A;  3OJP A;  1OYU A;  2Z18 A;  1FJG M;  2LHM A;  1VEG A;  1QS5 A;  4QDN A;  4R0F A;  1G0J A;  4DKL A;  5C6I A;  2Z4S A;  3KSJ A;  1A4V A;  210L A;  3IG5 A;  3CT5 A;  1IR9 A;  2HUK A;  1P3Q Q;  2F4V M;  4LT2 A;  4AW4 A;  4DAJ A;  3A3Q A;  1H6U A;  1L2D A;  4LDL A;  4L41 A;  1P37 A;  4I8S A;  4LT0 A;  2UUB M;  2BQI A;  2RBO A;  1GF6 A;  1QSQ A;  3AZ7 A;  4WL7 A;  1CKD A;  4BB9 A;  2F4G A;  2FE8 A;  3UK6 A;  3HH3 A;  1G06 A;  1Z6T A;  5I4Y A;  109L A;  3A94 A;  4NGJ A;  197L A;  4IBC A;  1QAO A;  173L A;  2JA2 A;  2R4E A;  2QQ8 A;  2VDB B;  1LZ5 A;  1YSY A;  1VED A;  1LJ3 A;  3SP3 A;  176L A;  4JI3 M;  1FKV A;  4JN6 A;  1OP9 B;  1T6H A;  4LCB A;  4HEO A;  1OUH A;  164L A;  3JAM S;  3T15 A;  237L A;  3KOW E;  3ILK A;  1WQR A;  1ZQ9 A;  3EXD A;  4FWH A;  3QYE A;  3FTC A;  2OQ4 A;  1LHK A;  2W1Y A;  1NBZ C;  4RKU F;  7LZM A;  5EXT A;  3B6L A;  4NY5 A;  1DZB X;  3LVV A;  3SHG B;  5IRE B;  3A96 A;  4ARM A;  4FDY A;  1LZY A;  131L A;  1UIG A;  2B73 A;  2HAK A;  2L7I A;  135L A;  2B6Z A;  235L A;  2Q0M X;  3E9S A;  1L13 A;  4W94 A;  1CJ6 A;  3GUK A;  1TBY A;  2FYD A;  3U6D A;  2V1C A;  3VK8 A;  5I4W A;  2PC2 A;  3B0I A;  2G8L A;  1IP2 A;  3KFU G;  5KXM A;  3V2Y A;  1L71 A;  2OEA X;  2LVQ D;  4GIP A;  1OWZ A;  2OO9 A;  2YFQ A;  1IN6 A;  4AKI A;  1FKQ A;  4AGA A;  3F8V A;  1B5Z A;  3RFW A;  1P7S A;  2YBH A;  1IC4 Y;  2XZU A;  2K0B X;  3C58 A;  3HKP A;  4GKK M;  4IAT A;  1YAN A;  1IXS B;  1TH3 A;  4B3M M;  1OTR A;  2Y20 A;  1LJF A;  3G3A B;  1GE0 A;  1L73 A;  5E4P A;  2KZS A;  5ITR A;  3TXB A;  1Q39 A;  4NSJ A;  1JTP L;  1LZ1 A;  2XTH A;  4GCF A;  1LWG A;  3TL4 X;  3C8R A;  2WSC F;  1H87 A;  1VDD A;  1LSM A;  2KZU A;  4OVZ B;  3HH4 A;  4XJH A;  188L A;  5B06 A;  1TDY A;  1PQJ A;  3J7A S;  5EP2 A;  4WG1 A;  1CV3 A;  1L97 A;  4CJ2 A;  4QOZ C;  1IOR A;  1RE2 A;  1GBW A;  2QAR C;  5A3Z A;  1WTM A;  2ZAO A;  1K3W A;  2HED A;  3EML A;  1GF7 A;  1NDG C;  4Q7J A;  3I4Y A;  3N9E A;  3CSQ A;  5M1Y A;  1HEQ A;  1NJF A;  4H9H A;  216L A;  3CDV A;  247L A;  1IN5 A;  1L01 A;  4L4U A;  4WMG A;  4L6V 6;  201L A;  4ETC A;  2QNJ A;  4GN4 A;  1LYI A;  1L0K A;  174L A;  1Z55 A;  1JJ1 A;  1LZB A;  1IBL M;  1L35 A;  1IOC A;  4YEM A;  5KY1 A;  1LYE A;  4YOP A;  4RNA A;  2LYM A;  3TXK A;  2Z7J A;  4II8 A;  162L A;  1GPQ C;  3PNY A;  1GF0 A;  4I7N A;  5D5F A;  3FUX A;  5FTL A;  1QUG A;  4HV1 A;  5F81 A;  1XC8 A;  4H9I A;  2W1L A;  1BWJ A;  1T8G A;  4XJB A;  3MJ5 A;  2L2D A;  2LBC A;  4YEO A;  1WTN A;  1QSB A;  4OWH A;  212L A;  3SMP A;  2Z6B A;  3HJ8 A;  2DZN B;  1C64 A;  3U61 B;  168L A;  1F6R A;  4NG8 A;  3GUI A;  3WU8 A;  1YQV Y;  154L A;  4XGI A;  1GAY A;  1UIF A;  4AQY M;  2OE7 X;  1CJ8 A;  5EP3 A;  1D9U A;  2O01 F;  2J7O A;  1PZY A;  4TSC A;  1NHG C;  243L A;  3K2L A;  3KXE C;  1KYI A;  4ARJ A;  1L51 A;  133L A;  1L00 A;  4H9C A;  1B7P A;  3K1J A;  4MH0 E;  4ETB A;  2HTX A;  3TXJ A;  3J7B A;  1CKF A;  1Q3C A;  2KW0 A;  5A3E A;  2A5Y B;  2CEA A;  4WM2 A;  1HER A;  2RBR A;  5L3H A;  4OX9 M;  1UC0 A;  3JR6 A;  2DWN A;  178L A;  3LZ2 A;  2W82 A;  4M9Z A;  4XJF A;  1IM2 A;  4DR7 M;  1JKB A;  1P6Y A;  1REM A;  2Z3X A;  1SXJ E;  5HNC A;  1L70 A;  3NBI A;  2RB0 X;  1AUA A;  1NNU C;  1IXZ A;  1YRO A;  4PGJ B;  3CF6 E;  1C6B A;  1FLY A;  1ZAE A;  2I26 L;  1P2C C;  3C80 A;  4YXC A;  4LG2 A;  2JY8 A;  1QT5 A;  2F5P A;  111L A;  3VDP A;  4DR6 M;  2D91 A; 
#chains in the Genus database with same CATH homology
 4PRQ A;  1REX A;  1SSW A;  1QQY A;  3B72 A;  3NY8 A;  1IP7 A;  1DYB A;  1QDT A;  1B5U A;  1LJK A;  5APE A;  2BQO A;  3TXE A;  1L95 A;  3CSR A;  5APF A;  4H9A A;  1GB9 A;  2LZ2 A;  4H8X A;  1L55 A;  4B49 A;  2LCB A;  4WM6 A;  1GB2 A;  1L64 A;  1QUH A;  3CDO A;  1VDS A;  1LMC A;  1SSY A;  156L A;  4B4J A;  1CX7 A;  1LI2 A;  4NSH A;  5FDJ A;  2DQE Y;  1GB5 A;  2Z2F A;  4OOO A;  1OVK A;  3DMX A;  3AGH A;  1LKR A;  4HTN A;  5T3F A;  2FBD A;  3LYM A;  5DN4 A;  2D91 A;  141L A;  1C45 A;  206L A;  1D0K A;  1L76 A;  253L A;  1CTW A;  5KJ9 A;  5EBH A;  2DKV A;  1LSF A;  6LYZ A;  5LA8 A;  8LYZ A;  4LDO A;  1IR7 A;  1LMQ A;  3RUN A;  252L A;  1LHH A;  1LMN A;  1UIE A;  3HTB A;  1LMA A;  2LYZ A;  1C08 C;  2B7X A;  4DDC A;  191L A;  1B2K A;  1G07 A;  3HWL A;  3IJV A;  1LYS A;  1CKC A;  1D3F A;  4RW1 A;  1L20 A;  1VAU A;  7LYZ A;  2I6Z A;  5ILC A;  1V7T A;  1N4F A;  3DNA A;  3EMS A;  4DD3 A;  245L A;  1LZR A;  3QE8 A;  1JSE A;  4LDE A;  4C5F A;  1KY0 A;  2H9J A;  1GEZ A;  2RBQ A;  1AT5 A;  110L A;  3LN2 A;  3GXR A;  1BWH A;  4HSF A;  2RAY X;  2DQH Y;  1C6C A;  3HBD A;  4W58 A;  5KXW A;  1C67 A;  2ZIJ A;  2QB0 B;  3N9C A;  1LCN A;  153L A;  4MR1 A;  5KXX A;  3DN0 A;  2F2N A;  4XAD A;  1JWR A;  5B05 A;  1HNL A;  1B6I A;  3A6C Y;  1L65 A;  1L14 A;  182L A;  3D4S A;  1DPX A;  257L A;  1G7M C;  1D9W A;  1EQ5 A;  2ZNW Y;  2BLY A;  1QT3 A;  1GD6 A;  2YBJ A;  1BB7 A;  3HBE X;  1OUC A;  1OUJ A;  1QSA A;  1UIC A;  1LPY A;  1C68 A;  3HU9 A;  1L94 A;  1IWX A;  1HEP A;  184L A;  1JJ0 A;  171L A;  1HEN A;  1T6V L;  1NWG A;  3A8Z A;  1JHL A;  5C6J A;  2B72 A;  1DYG A;  3CDR A;  1JUG A;  1QUO A;  4J0L A;  3TXG A;  1XEI A;  2C8P A;  5KXL A;  4LFP A;  4TTD A;  4NGZ A;  1LI3 A;  1G7H C;  2BQA A;  2CDS A;  1YAQ A;  1L68 A;  4W52 A;  4NGI A;  244L A;  4MCK A;  151L A;  189L A;  4DJH A;  3AW7 A;  4ARQ B;  1LSY A;  4HJV A;  1IEE A;  5LYT A;  4GBR B;  3QAK A;  5J7C A;  1HSW A;  3RZE A;  1L11 A;  4DQ5 A;  150L A;  3A92 A;  1LYF A;  1CUQ A;  1QT6 A;  2WAR A;  2DQJ Y;  4W59 A;  4ET9 A;  2YBI A;  5KXZ A;  4TUN A;  1AT6 A;  4LYT A;  4BS7 A;  2BLX A;  3LZM A;  3V2W A;  2IFF Y;  3HT6 A;  1B5V A;  213L A;  3HUA A;  3FI5 A;  5E9R A;  1CV6 A;  4J1A A;  3FE0 A;  2BQD A;  1J1O Y;  4OWC A;  4BAD A;  3RT5 X;  1XGT C;  1FN5 A;  3K3T A;  2HEE A;  2MEB A;  3WXT A;  2RBS A;  4YF2 A;  1C10 A;  1P64 A;  1IX0 A;  1CKG A;  1QTB A;  1EQ4 A;  1LPI A;  1DI4 A;  3C7Z A;  5L3I A;  230L A;  4BAF A;  2OU0 X;  4WOA A;  246L A;  5IEL A;  1B7M A;  4AQN A;  3SBA A;  143L A;  4HJY A;  2EKS C;  1HFY A;  1DYA A;  5LVH A;  1C69 A;  1ZUR A;  4DWX A;  3AGG G;  5F9U A;  1YIK A;  2ZIL A;  1L85 A;  3WW6 A;  4I0C A;  2MEI A;  1GFJ A;  1IIZ A;  5KXT A;  1L50 A;  1GF4 A;  1DYC A;  4NSI A;  3C8S A;  146L A;  1KIR C;  4G49 A;  1L61 A;  1JIT A;  1LJG A;  1BHZ A;  3N9A A;  3W6B A;  3A3R X;  1HEM A;  1QUS A;  1OUA A;  5KXS A;  144L A;  1OWY A;  4G4H A;  2YDG A;  3FI7 A;  250L A;  4WM5 A;  4XJD A;  1PQO A;  1GXV 2;  1DKK A;  4I7P A;  3GUJ A;  3SB9 A;  1SQ2 L;  5APD A;  1QSW A;  2A7D A;  4WG7 A;  3WL2 A;  3SB8 A;  1L53 A;  114L A;  1VAT A;  5IDD A;  2ZNX Y;  2Z12 A;  4XEN A;  2B6T A;  4Z46 A;  5I14 A;  3C82 A;  3HT8 A;  2Z37 A;  2OU8 A;  2C8O A;  4H9B A;  1IVM A;  4OO9 A;  1LMT A;  3FAD A;  4H1P A;  4NHI A;  1WQQ A;  4CFP A;  5JEN B;  1LSC A;  3HTD A;  1YKX X;  1L80 A;  4H91 A;  4J7V A;  4LT1 A;  1CV0 A;  2FYC A;  229L A;  1GE2 A;  1RJC B;  2BAA A;  1LLH A;  1RI8 B;  2VB1 A;  2DQI Y;  2DQF C;  4QGZ A;  1CVK A;  2BQL A;  4AXT A;  1VFB C;  1NQI A;  4KT3 A;  1L08 A;  1KIQ C;  4DYG A;  3HUQ A;  1L52 A;  1L05 A;  5B1G A;  4NSG A;  1L06 A;  1B0D A;  2CGI A;  1YAM A;  2HEA A;  3WUM A;  5HQ1 A;  2RB2 X;  4W53 A;  2OTY X;  4RLN A;  1D6P A;  4O34 A;  4H8Y A;  4QY9 A;  207L A;  1L63 A;  1CV5 A;  4ETD A;  1IP6 A;  1LHM A;  1DI3 A;  1LHL A;  1WVU A;  3A67 Y;  4S0W A;  3BKV A;  122L A;  5FST A;  2MEH A;  4DT3 A;  2DQC Y;  3WUN A;  211L A;  5HMV A;  4DQJ A;  4YEN A;  132L A;  4GRV A;  1C46 A;  260L A;  3QNG A;  1NDM C;  4PK0 A;  2N5Z A;  4GCE A;  2RH1 A;  4WLX A;  1GBX A;  5FCP A;  4WM3 A;  4XJI A;  5I53 A;  261L A;  1EQE A;  1LYG A;  4P2E A;  5C6L A;  4I7S A;  5KXO A;  3WMK A;  2BPU A;  1L26 A;  142L A;  5FHW A;  3W6C A;  3HUK A;  1F10 A;  1HFZ A;  1QT7 A;  1GF5 A;  2LYO A;  4ETE A;  5LXW A;  1K28 A;  1L07 A;  1GBS A;  217L A;  3SN6 R;  2Q9E A;  108L A;  1IWU A;  1DPW A;  4G9S A;  2O4W A;  5LAF A;  4ARP A;  4W55 A;  2YBM A;  198L A;  1L30 A;  1GF9 A;  1OVH A;  5LZM A;  5IHG A;  1AKI A;  3A34 A;  3PDS A;  4B4E A;  1LZS A;  4EOF A;  186L A;  1NHE A;  1IC5 Y;  1BQL Y;  1CNS A;  1GFE A;  3P4Z A;  4LZT A;  3WW5 A;  1LGW A;  1L59 A;  2Y8P A;  3WH1 A;  1L28 A;  1C61 A;  2BQN A;  1IC7 Y;  3T36 A;  3HTF A;  4I7L A;  1QTK A;  1L44 A;  4NGK A;  3C7Y A;  3AB6 A;  5LYZ A;  1L81 A;  2RAZ X;  1L02 A;  1YL0 X;  1HC0 A;  1C6N A;  149L A;  2HEB A;  3WVX A;  4GCC A;  1DXJ A;  1A2Y C;  1L54 A;  2AUB A;  1XEK A;  1SX2 A;  104L A;  1MEL L;  222L A;  242L A;  1GXX A;  3GXK A;  126L A;  1P5C A;  1LMP A;  1INU A;  1LTM A;  1L89 A;  3WYH A;  233L A;  1P2L A;  3CT0 A;  1QTC A;  1IOT A;  2OTZ X;  1QTV A;  4I7M A;  1JTO L;  256L A;  1PQK A;  1L31 A;  2B6W A;  2D4I A;  1J1X Y;  1L58 A;  1I1Z A;  2BQK A;  129L A;  1JTM A;  5F9X A;  4PJ2 C;  3QY4 A;  2H5Z A;  2O7A A;  1LZA A;  1IOS A;  1IY4 A;  1L48 A;  147L A;  1D2W A;  1B7O A;  1D3J A;  219L A;  155L A;  5LVJ A;  2BQF A;  9LYZ A;  1KW7 A;  4WO9 A;  5B07 A;  2BQM A;  1EL1 A;  1XGP C;  3EBA B;  4DD0 A;  1TLA A;  102L A;  4LGK A;  4EKR A;  3HT7 A;  251L A;  5LVG A;  3VW7 A;  1L25 A;  1LKS A;  1LAA A;  2BQJ A;  1BB5 A;  5ILF A;  1C6Q A;  2LZT A;  4UWU A;  5I5Q A;  1CV4 A;  1C43 A;  1JKA A;  4LZM A;  1LI6 A;  1C6T A;  175L A;  3WUL A;  4I7K A;  1L91 A;  4W57 A;  4HTQ A;  1I56 A;  4WM1 A;  1L62 A;  5FEK A;  139L A;  1CKH A;  1J1P Y;  1L99 A;  3DMV A;  1GB0 A;  1C63 A;  1GB3 A;  1LSP A;  138L A;  4PHI A;  1XGR C;  1T8A A;  5F16 A;  1D3M A;  1L34 A;  2MEA A;  1L66 A;  1CV1 A;  4E97 A;  1IWT A;  4NG1 A;  2DQA A;  1ZVY B;  214L A;  1UUZ C;  118L A;  4H9E A;  2OE4 X;  2L78 A;  3E3D A;  128L A;  1KY1 A;  1QTZ A;  1L77 A;  1T3P A;  4X3B A;  1I6S A;  1C6D A;  134L A;  4WO6 A;  4C3W A;  2YSS C;  1L43 A;  1D3N A;  3PBL A;  4GCD A;  4NIJ A;  4IAS A;  3A6B Y;  1L98 A;  1O23 A;  1G1W A;  1PS5 A;  3IJU A;  148L E;  1C6G A;  3J6K A;  1GF3 A;  2XBR A;  1IY3 A;  4HTK A;  215L A;  4NHP A;  4CHX A;  3LHM A;  4M4O A;  4WLD A;  3OE8 A;  1LZ6 A;  225L A;  1KXW A;  1QTE A;  223L A;  3B0O A;  5L9J A;  1JPO A;  1FDL Y;  4NWH A;  3MGW A;  3WUA A;  1LSG A;  1L21 A;  2YBL A;  1W6Z A;  1TAY A;  1LJ4 A;  2Z38 A;  5KKI A;  1F6S A;  1G0G A;  1DYF A;  4OW1 A;  4D9Z A;  2BQH A;  3A93 A;  3P66 A;  4PRU A;  4HV2 A;  3ZEK A;  4U3X B;  4EJ4 A;  6LYT A;  1TEW A;  3SB7 A;  5DN5 A;  123L A;  3AW6 A;  4A7D A;  1SWZ A;  1ZWN A;  3KAM A;  172L A;  241L A;  3AGI A;  4FJR A;  5F14 A;  227L A;  4QEQ A;  1VDQ A;  1IWV A;  1UIB A;  1NMM A;  3FA0 A;  2B70 A;  3LYZ A;  4B1A A;  1GE4 A;  1SLY A;  228L A;  5HNL A;  1OUB A;  194L A;  1ZVH L;  169L A;  1REZ A;  3AYQ A;  1L57 A;  1BB6 A;  1GB8 A;  2HUM A;  2CUU A;  218L A;  5LYM A;  1GFT A;  177L A;  1BWI A;  4I7Q A;  2F4A A;  1KS3 A;  4I7R A;  4W96 A;  2RBP A;  1L88 A;  1G7I C;  1L23 A;  3LZT A;  1LWK A;  1T97 A;  1XJU A;  1XFP L;  1QS9 A;  1VDT A;  3GUL A;  1YAP A;  1B5X A;  1BVX A;  3DMZ A;  4LT3 A;  160L A;  187L A;  1LZE A;  1G7L C;  4ZEE A;  1OUE A;  4ZPU A;  5KKJ A;  1LZN A;  112L A;  2LC9 A;  1C6M A;  4IAP A;  4NHT A;  238L A;  3B0K A;  1IOQ A;  4N1C C;  1OUG A;  3K2R A;  1OV7 A;  3HU8 A;  4NGL A;  232L A;  2G4Q A;  1OV5 A;  3L2X A;  1C6A A;  4DD1 A;  1DQJ C;  1L03 A;  258L A;  1QUD A;  1IP4 A;  240L A;  3DN8 A;  1L17 A;  3TMU A;  1RCM A;  3ZVQ B;  5HLL A;  3WPL A;  200L A;  3C7W A;  4B4I A;  4DD7 A;  2W1M A;  1D2Y A;  1L45 A;  1ZMY L;  3OE0 A;  1CU5 A;  157L A;  1B7Q A;  254L A;  2CWI A;  2XQO A;  3OE9 A;  1L32 A;  4OWB A;  4DDA A;  161L A;  183L A;  4H92 A;  4H94 A;  3M3U A;  1LSA A;  1LHI A;  259L A;  1WQM A;  3NY9 A;  239L A;  3M18 B;  145L A;  2HU1 A;  3C83 A;  3BKH A;  1DKJ A;  3ATN A;  4CGE A;  4GLV A;  3CB7 A;  1L19 A;  3SB5 A;  3CQL A;  1LJI A;  181L A;  4GCB A;  1P3N A;  2EPE A;  4EKP A;  4G4B A;  2B74 A;  2G4P A;  2LZM A;  1LHJ A;  1GFU A;  1L40 A;  1FLW A;  2ANX A;  4Z3M A;  4H90 A;  1LGX A;  1QTD A;  4WLY A;  1C62 A;  1L16 A;  1VDP A;  248L A;  3C8Q A;  2XJW A;  1KNI A;  3VWO A;  2O79 A;  2HEF A;  1FLQ A;  1L49 A;  1C6J A;  4ARM B;  1QT4 A;  1SWY A;  5APC A;  5LVK A;  3WPJ A;  4TWS A;  3J4G A;  1LGU A;  5DM9 A;  5KXN A;  3P68 A;  4XN6 A;  1HEL A;  1P56 A;  4DD2 A;  3DKE X;  3A95 A;  1C6E A;  3OE6 A;  5D5C A;  1C6L A;  4N5R A;  1LZD A;  4HPE A;  1XSF A;  4I7O A;  3G3W A;  1JSF A;  2YBN A;  3HTG A;  3TXI A;  3DN3 A;  4EMN A;  4H9F A;  193L A;  1LSN A;  1NBY C;  2B75 A;  1NF5 A;  1LSE A;  1T8F A;  1L27 A;  5AMY A;  4OOT A;  4E3U A;  221L A;  103L A;  3TXH A;  4N8Z A;  1C66 A;  3DN2 A;  4N1E I;  1XEJ A;  1L79 A;  4LYB A;  1C6H A;  4GN3 A;  127L A;  1L92 A;  4N9R A;  1L24 A;  4LYO A;  255L A;  4EPF A;  140L A;  4W54 A;  231L A;  1P46 A;  1UAC Y;  1GWD A;  1E8L A;  1AZF A;  3D9A C;  2GV0 A;  2MEE A;  1LW9 A;  158L A;  159L A;  4YXA C;  1G0Q A;  1LYZ A;  3G3X A;  3WPK A;  1YKY X;  1LZT A;  1G0K A;  1L74 A;  1GFG A;  5B59 A;  1HEW A;  1QIO A;  249L A;  1XGQ C;  3RNX A;  4J1B A;  1HSX A;  2D4J A;  1IWZ A;  2RB1 X;  3RW8 A;  3CDT A;  1L09 A;  4ANR A;  4CFO A;  4EKS A;  4EXM A;  2MED A;  3A90 A;  1KXX A;  1PQI A;  192L A;  1L47 A;  1LYH A;  3C81 A;  4LYC A;  1WTH A;  1OVJ A;  1UIH A;  2F2Q A;  1GBO A;  2A4T A;  1NKH A;  236L A;  2BQB A;  3F6Z A;  2HU3 A;  3T6U A;  208L A;  4HJZ A;  1C6K A;  4PJZ A;  4K5Y A;  1LZG A;  3ATO A;  3IWR A;  4NGO A;  2NTH A;  1LSZ A;  2A7F A;  119L A;  4ZIX A;  1OQM A;  1ZV5 L;  4XJG A;  1L93 A;  1WQO A;  3HH5 A;  1RFP A;  125L A;  1IWY A;  2ZYC A;  1L33 A;  1L18 A;  1BB4 A;  2B6X A;  113L A;  1CU3 A;  4OWE A;  1GF8 A;  3EO5 A;  2MEC A;  1ALC A;  2NWD X;  262L A;  190L A;  3CT1 A;  4KL7 A;  3ODU A;  2HEC A;  4NHS A;  1WVV A;  4W56 A;  4NWE A;  3WXU A;  2HUB A;  4ARQ A;  2OE9 X;  1C65 A;  1L96 A;  3UON A;  1G0M A;  1B7N A;  2HUL A;  3NYA A;  2Z19 A;  3RU5 A;  4WLT A;  3W6A A;  1GDW A;  5LIN A;  1DYD A;  3GUO A;  1OUF A;  1NHB A;  1JIY A;  4EKQ A;  1CUP A;  4NGY A;  1IO5 A;  1GE3 A;  3G3V A;  4ETA A;  1L42 A;  1B7R A;  1QDR A;  1UBZ A;  167L A;  3W3E A;  1IR8 A;  1JIS A;  4H93 A;  1GFH A;  3GUM A;  3WU9 A;  3TMX A;  3SB6 A;  1L39 A;  2MEG A;  2G4N A;  3HDF A;  2ZYP A;  4WM4 A;  1L82 A;  1HEO A;  2I25 L;  3W6E A;  1XGU C;  220L A;  4KXI A;  4TSB A;  2H9K A;  1JEF A;  4IJ4 A;  4WL6 A;  3TXF A;  3DN1 A;  6LZM A;  2X0A A;  1QT8 A;  3SBB C;  4UWV A;  4HPI A;  4HP0 A;  1C7P A;  1CJ7 A;  2FBB A;  2CJL A;  1JTT L;  2Z2E A;  1YL1 X;  1XJT A;  1YAO A;  1GBZ A;  5KXR A;  2BQE A;  1B9O A;  1FLU A;  2XBS A;  1LJJ A;  3HH6 A;  4BAP A;  4Z41 A;  1EPY A;  1UIA A;  4NGW A;  1GB6 A;  1W08 A;  1C6F A;  1WQP A;  5I4X A;  4NEB A;  2IHL A;  4N0J A;  1GE1 A;  1LYO A;  180L A;  1LJN A;  1CU0 A;  2DQG Y;  1GBY A;  2ANV A;  1B5W A;  1LSB A;  4TX7 A;  3ULR A;  1B5Y A;  107L A;  2MEF A;  3P64 A;  4ARL A;  1CU2 A;  1L86 A;  3DN4 A;  1GB7 A;  2Z39 A;  1L36 A;  2B6Y A;  1L22 A;  5B1F A;  1L67 A;  195L A;  1AM7 A;  1L69 A;  115L A;  1H6M A;  2BQC A;  4RW2 A;  1LOZ A;  5KXY A;  1KXY A;  2ZWB A;  1KW5 A;  1C6I A;  1DI5 A;  4LYZ A;  1L84 A;  2F32 A;  5I54 A;  2ZQ4 A;  1QUT A;  1G0P A;  2BQG A;  5KXP A;  4H8Z A;  4I7J A;  1GAZ A;  4GLA A;  1CJ9 A;  2W1X A;  1UCO A;  165L A;  4OWA A;  130L A;  1HMK A;  3DN6 A;  1IP5 A;  2F47 A;  2DQD Y;  4M6D A;  3OK0 A;  3RZ4 A;  1GFA A;  3WU7 A;  4YX7 C;  1LSD A;  4NFV A;  2IGC A;  1L37 A;  4I7T A;  3CDQ A;  5DLA A;  170L A;  5FEL A;  5LIO A;  3W6D A;  3AZ5 A;  4PPO A;  1L29 A;  4MST A;  1L15 A;  209L A;  5KXK A;  1HF4 A;  1V7S A;  5II3 A;  1HHL A;  1BB3 A;  1C6P A;  1LJH A;  2D6B A;  1LZ9 A;  3HT9 A;  1I20 A;  2B5Z A;  1BGI A;  2ZQ3 A;  226L A;  3L64 A;  1L46 A;  196L A;  4DC4 A;  2F30 A;  1GHL A;  4GN5 C;  166L A;  1GFR A;  1LMO A;  5HMJ A;  1L38 A;  4ZFP A;  1LYJ A;  3G3B B;  4R6C A;  3WVY A;  1GDX A;  3TMV A;  4W51 A;  4RDS A;  1C60 A;  2D4K A;  2OU9 A;  4NHQ A;  199L A;  4ML7 A;  1TCY A;  1OUI A;  1CX6 A;  1L72 A;  1D0M A;  2Q9D A;  1LZC A;  4DQ7 A;  3AZ4 A;  4LFX A;  1L60 A;  1OUD A;  1G1V A;  152L A;  1LJE A;  2NTG A;  1PQD A;  234L A;  1JTN A;  4KPM A;  4XYY A;  1XEP A;  1MLC E;  1ZYT A;  1LYY A;  1KIP C;  3GUP A;  1IP3 A;  185L A;  4LYM A;  2RSC A;  4ET8 A;  3LYO A;  1P36 A;  4UWN A;  1B7S A;  163L A;  1JKD A;  1BVK C;  1L83 A;  1L56 A;  1UA6 Y;  1LZ4 A;  1GEV A;  4DDB A;  3F9L A;  2RBN A;  1L10 A;  3TMW A;  1L75 A;  1L90 A;  5LVI A;  1REY A;  4Z98 A;  5K7O A;  1JKC A;  1LZ8 A;  1LYD A;  4YM8 A;  1D6Q A;  4RLM A;  1L04 A;  1D0L A;  1YIL A;  2ZIK A;  3HDE A;  3AJN A;  1YKZ X;  1PQM A;  1JJ3 A;  1G0L A;  5LA5 A;  3HFM Y;  1SX7 A;  137L A;  3AZ6 A;  3TXD A;  3HBH A;  3LYT A;  3W6F A;  4DD9 A;  2EIZ C;  1JQU A;  1HML A;  1G7J C;  1P2R A;  5DL9 A;  1DYE A;  2DBT A;  1QTH A;  1L0J A;  3ZVQ A;  2EQL A;  1FBI X;  5LAG A;  1UID A;  1CU6 A;  1B7L A;  1L87 A;  1HFX A;  224L A;  1WQN A;  1L12 A;  1IP1 A;  1GFK A;  3D3D A;  1GFV A;  3CSZ A;  4EPI A;  4NGV A;  3P65 A;  1IWW A;  3A91 A;  205L A;  120L A;  4B0D A;  1F0W A;  4G4C A;  3GUN A;  1L41 A;  3OJP A;  1OYU A;  2Z18 A;  2LHM A;  4QDN A;  1QS5 A;  4R0F A;  1G0J A;  4DKL A;  5C6I A;  210L A;  1A4V A;  3CT5 A;  1IR9 A;  2HUK A;  4LT2 A;  4DAJ A;  3A3Q A;  4LDL A;  4L41 A;  1P37 A;  4I8S A;  4LT0 A;  2BQI A;  2RBO A;  1GF6 A;  1QSQ A;  3AZ7 A;  4WL7 A;  1CKD A;  2F4G A;  3HH3 A;  1G06 A;  5I4Y A;  109L A;  3A94 A;  4NGJ A;  197L A;  173L A;  1LZ5 A;  1VED A;  3SP3 A;  1LJ3 A;  176L A;  1FKV A;  1OP9 B;  1T6H A;  1OUH A;  164L A;  237L A;  1WQR A;  3EXD A;  1LHK A;  2W1Y A;  1NBZ C;  7LZM A;  3B6L A;  4NY5 A;  1DZB X;  3A96 A;  4ARM A;  4FDY A;  1LZY A;  131L A;  1UIG A;  2B73 A;  135L A;  2B6Z A;  235L A;  2Q0M X;  4W94 A;  1L13 A;  1CJ6 A;  3GUK A;  1TBY A;  2FYD A;  5I4W A;  2PC2 A;  3B0I A;  1IP2 A;  5KXM A;  3V2Y A;  1L71 A;  2OEA X;  1OWZ A;  4AGA A;  1FKQ A;  3F8V A;  1B5Z A;  2YBH A;  1P7S A;  1IC4 Y;  4IAT A;  1YAN A;  1LJF A;  3G3A B;  1GE0 A;  1L73 A;  5E4P A;  3TXB A;  4NSJ A;  1JTP L;  1LZ1 A;  2XTH A;  4GCF A;  1LWG A;  3C8R A;  1H87 A;  1LSM A;  3HH4 A;  4XJH A;  188L A;  5B06 A;  1TDY A;  1PQJ A;  4WG1 A;  1CV3 A;  1L97 A;  4CJ2 A;  1IOR A;  1RE2 A;  1GBW A;  2QAR C;  5A3Z A;  1WTM A;  2HED A;  3EML A;  1GF7 A;  1NDG C;  3N9E A;  3CSQ A;  5M1Y A;  1HEQ A;  4H9H A;  216L A;  3CDV A;  247L A;  1L01 A;  4WMG A;  201L A;  4ETC A;  4GN4 A;  1LYI A;  1L0K A;  174L A;  1Z55 A;  1JJ1 A;  1LZB A;  1L35 A;  1IOC A;  4YEM A;  5KY1 A;  1LYE A;  4YOP A;  2LYM A;  3TXK A;  4II8 A;  162L A;  1GPQ C;  1GF0 A;  4I7N A;  5D5F A;  1QUG A;  4HV1 A;  5F81 A;  4H9I A;  2W1L A;  1BWJ A;  1T8G A;  4XJB A;  4YEO A;  1WTN A;  1QSB A;  4OWH A;  212L A;  2Z6B A;  1C64 A;  168L A;  1F6R A;  4NG8 A;  3GUI A;  3WU8 A;  1YQV Y;  154L A;  1GAY A;  1UIF A;  2OE7 X;  1CJ8 A;  1D9U A;  1PZY A;  4TSC A;  243L A;  4ARJ A;  1L51 A;  133L A;  1L00 A;  4H9C A;  1B7P A;  4ETB A;  2HTX A;  3TXJ A;  1CKF A;  5A3E A;  4WM2 A;  1HER A;  2RBR A;  5L3H A;  1UC0 A;  3JR6 A;  3LZ2 A;  178L A;  4XJF A;  1JKB A;  1P6Y A;  1REM A;  5HNC A;  1L70 A;  2RB0 X;  1YRO A;  4PGJ B;  1C6B A;  1FLY A;  2I26 L;  3C80 A;  1P2C C;  4YXC A;  1QT5 A;  111L A;  2YVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...