1QUSA

1.7 a resolution structure of the soluble lytic transglycosylase slt35 from escherichia coli
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
322
structure length
312
Chain Sequence
b'MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
publication title Crystal structure of Escherichia coli lytic transglycosylase Slt35 reveals a lysozyme-like catalytic domain with an EF-hand.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 110
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qusA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qusA02
1GE0A 1GFGA 1YANA 3TXHA 4LGKA 4IASA 2EKSC 2MEEA 5LA5A 3J4GA 3FI7A 1Z55A 4NHTA 3D3DA 4M6DA 1DKKA 4GN4A 4KXIA 2LZTA 1LZ4A 2H9JA 1LSDA 3ATNA 2WARA 1OUIA 1LZEA 3RU5A 4WOAA 4MSTA 4NHPA 4NGYA 1UIBA 1LOZA 1IC4Y 3AYQA 4NHIA 4DC4A 4YF2A 1YAMA 1A2YC 1I56A 3LZ2A 1HHLA 4WL6A 1GBWA 1LJKA 3RW8A 5KKJA 1CJ8A 1GDXA 1GF3A 4D9ZA 1LYYA 4C3WA 3P65A 1WQPA 1JIYA 2AUBA 4ETEA 5KXKA 4YEOA 1LZ9A 4NGIA 5ILCA 1B7QA 4AGAA 2CJLA 4WLDA 1A4VA 1REMA 4DD0A 4GCFA 4NHSA 1CKCA 1B5YA 2DQCY 3TXGA 4RW2A 1YROA 5KXXA 1IORA 4TX7A 3F6ZA 1B7RA 3N9AA 154LA 5A3ZA 2Z37A 1W08A 4HJYA 1KXWA 3ULRA 5JENB 1CKGA 2Z12A 4MR1A 4GLAA 4TWSA 2FYDA 2YBHA 2BQNA 4B49A 1YAOA 2G4NA 5KXNA 2HEEA 1GB7A 2ZIJA 4ETBA 4TTDA 1GFKA 4Z98A 5KXPA 4NG8A 1GF9A 1OUHA 4YOPA 5KXZA 3B0OA 1D0LA 1JUGA 1B2KA 2MECA 3AJNA 3AZ7A 3CT5A 3RNXA 3TMXA 5F14A 4NSIA 2BQCA 1LJEA 4DD1A 4KPMA 5FCPA 3WPKA 2A7FA 1QIOA 1LZSA 1BWHA 1J1XY 1N4FA 4NG1A 4XJDA 1YKZX 3VWOA 2DBTA 5C6JA 5II3A 1IP6A 1LJ3A 4GN5C 4DD9A 2XBSA 5B05A 1EQEA 2I6ZA 4QY9A 5LAGA 2BQBA 2Y8PA 3TMVA 1D0KA 2BQEA 2EQLA 4PPOA 1LTMA 2F30A 1JJ3A 1DKJA 5LINA 1RFPA 3HFMY 2F2NA 1WTMA 4OWEA 1MLCE 4XYYA 1F0WA 3A6BY 1D9UA 3TMUA 1IX0A 2DQFC 1D0MA 4N0JA 1C45A 1I1ZA 1IC7Y 1GAYA 1B5WA 1BQLY 1WQNA 4H8ZA 1HENA 1HEQA 2H5ZA 1IWWA 1GF8A 4B1AA 2HU3A 1GBZA 3CQLA 1DZBX 1EQ4A 1C46A 4H9AA 2MEIA 4ETAA 3TXKA 4RLMA 1B5ZA 1LZTA 2I26L 1IP5A 1D6PA 1IOSA 2YBNA 1LHJA 1LSFA 2DQIY 2CGIA 1VDQA 4HTKA 4HJZA 5KXOA 1TEWA 3OK0A 5DM9A 4WM3A 4UWNA 3EMSA 4RLNA 3AGGG 1IVMA 1B7NA 1UA6Y 4DDBA 3WUNA 1JEFA 1UIHA 1VAUA 1LZ5A 1B9OA 1LMOA 1IOTA 4PHIA 4UWUA 3ZVQA 1LZNA 4CJ2A 5I4WA 5KXMA 1V7SA 3TXEA 2Q0MX 3HBHA 3WPLA 1REXA 1QTKA 4WLYA 1HF4A 3CSRA 4TSBA 1IWYA 1IO5A 1INUA 1BVKC 3IJVA 2HEFA 4Z46A 1IWVA 2FBBA 1HEOA 5F9XA 5LVKA 1GE3A 4M4OA 194LA 5APEA 1HSXA 3LYOA 1NWGA 1VDTA 2W1XA 1FLQA 2YDGA 1JKCA 1DI4A 1HEWA 1YL1X 1HMLA 1HFYA 1VEDA 2BPUA 2D4KA 4A7DA 1XEJA 5B1GA 2X0AA 3T6UA 5KY1A 3ZEKA 1REZA 3A90A 4MCKA 1OUCA 1LJHA 1VDSA 2YBIA 1RCMA 4LZTA 4I8SA 4CHXA 1DPWA 3WH1A 2MEFA 4NSJA 1NDGC 1JPOA 1XEIA 1TAYA 1XSFA 1E8LA 4QGZA 5FELA 2D6BA 1RE2A 2F4AA 1GAZA 1JWRA 3N9CA 2BLXA 2YBMA 3AGHA 3CB7A 4H8YA 4GCEA 1XGPC 4L41A 4WO9A 5FSTA 1PZYA 4W94A 5E4PA 1HELA 3A6CY 4I0CA 3WUMA 1WTNA 5C6LA 1B5UA 1BWIA 2DKVA 3AW7A 3LHMA 4YENA 1LJGA 4G9SA 1AM7A 4TSCA 207LA 1LSYA 1BHZA 1IR7A 3QE8A 4J7VA 1QDRA 4TUNA 1LMQA 4BS7A 1BB4A 3G3BB 3M18B 4DD2A 2CWIA 1UBZA 2G4QA 3WVXA 4DYGA 5L3HA 3OJPA 4HV2A 1LAAA 5B59A 1GB0A 3W3EA 1UIAA 1GB5A 3N9EA 4R0FA 4P2EA 2ZYCA 5ILFA 3CT1A 1HNLA 2W1MA 1BGIA 1FBIX 1GF6A 1LYZA 4N1EI 1LZ8A 1JISA 2D4JA 1GE1A 4WG7A 3A8ZA 3A94A 4GLVA 1G7HC 3B6LA 3WULA 4QDNA 1GFAA 4IJ4A 3WUAA 3WXUA 2W1LA 4PRQA 2D4IA 1GHLA 5A3EA 5I54A 193LA 3P64A 1G7JC 1FLWA 4WM6A 5LXWA 2MEBA 1NBYC 3A34A 5IHGA 1GXV2 1TCYA 4ETCA 4G4HA 4E3UA 2XBRA 4XJIA 1ZVYB 4LFXA 3W6CA 4BADA 4LT1A 1HC0A 3HBDA 4GCBA 5HLLA 1G7LC 1OUBA 1FKVA 4LFPA 5HMJA 5HNCA 3TXFA 1IR9A 5LIOA 1GFJA 2BAAA 3J6KA 3M3UA 4G4BA 1AT5A 3A95A 3EO5A 5KXRA 5I4YA 1IOQA 2H9KA 4H9FA 4XENA 3SP3A 2Z19A 1XFPL 4OWBA 2BQLA 1HSWA 1XEKA 1DXJA 3P68A 1GE2A 1CNSA 5APDA 1CKDA 4LYOA 1FLUA 1IP4A 1IEEA 1GF4A 2BQDA 1AT6A 3AB6A 4HTNA 1OP9B 4H8XA 1IY3A 3W6BA 2BQFA 1GBSA 1NF5A 1C7PA 3WMKA 5C6IA 1GXXA 1IY4A 1NKHA 1LHMA 2LHMA 3WXTA 4H9BA 1CJ9A 2MEAA 4NFVA 1GF7A 2D91A 1LKSA 7LYZA 1BB7A 2C8PA 2LYMA 3IWRA 2Z2EA 2EIZC 1IWTA 4H90A 3AZ5A 4B4IA 1LZDA 153LA 5APFA 3WW6A 1ZVHL 4WO6A 1JITA 1LSNA 2BQHA 1BB3A 2LYZA 3A91A 1J1OY 132LA 3TXDA 1VATA 1GEVA 1RI8B 2ZIKA 1LJNA 1LJJA 1QSWA 2HEDA 1WVUA 1WQQA 2BQOA 4NGKA 1YIKA 5I4XA 5B1FA 1UICA 2MEDA 1GF0A 1HERA 4RDSA 1DI5A 1HFXA 1IWZA 4DT3A 1KXXA 2HEBA 1LKRA 1T3PA 2YBJA 4IATA 4NWHA 3BKVA 4R6CA 2HECA 1LZ1A 3IJUA 1KIQC 1QUSA 1JHLA 3W6EA 5IELA 1OUDA 2HEAA 4NGZA 1B7SA 4H91A 1EQ5A 1F10A 4KL7A 1CJ7A 1GE4A 3ATOA 1LSCA 1LSPA 1LSZA 2W1YA 1LZGA 1ZV5L 4OOTA 4X3BA 1W6ZA 3WU8A 1WQMA 1CJ6A 2ZNWY 4FJRA 4OWAA 4DD7A 1XGUC 1UC0A 1F6SA 4HSFA 1LHIA 4Z41A 4EOFA 2B5ZA 3EXDA 3WYHA 3WVYA 2Z38A 4H1PA 4LYCA 4LT3A 3KAMA 134LA 1LHLA 2DQJY 1IP7A 5I53A 1LMNA 2A7DA 4ZFPA 5KXTA 1B7LA 1LSGA 4WLXA 4N9RA 4NEBA 4W96A 2NWDX 5HMVA 1JJ1A 2BQGA 3P4ZA 5EBHA 1DQJC 1LZAA 4G4CA 1LJFA 3A92A 4CFOA 1HEPA 3A93A 3LZTA 4OW1A 1NBZC 1JTPL 1LZBA 5J7CA 5DL9A 1GFTA 1IR8A 5KJ9A 1H6MA 1UACY 2IFFY 1YQVY 2BQKA 2LZ2A 2VB1A 1HFZA 1VDPA 2Z39A 4II8A 4WL7A 5LAFA 4B4JA 4BAFA 1XGRC 4ZIXA 1JKAA 1WVVA 1OUEA 4WM4A 4J1AA 3LYMA 5B07A 1IWXA 5FDJA 3BKHA 3AZ4A 1BB6A 3CSZA 1LMAA 3B72A 1B0DA 1LSEA 2DQHY 5I5QA 1LHKA 3A3RX 3TXIA 1FLYA 4OWCA 2CDSA 1LJIA 3QY4A 1HEMA 5T3FA 1CKHA 1VFBC 4H9CA 4XADA 1LZYA 208LA 2DQDY 1LHHA 1IP2A 3D9AC 3A3QA 3W6DA 3W6AA 4HP0A 4DD3A 1QSAA 2BLYA 1F6RA 1LPIA 1JSFA 1LCNA 4N1CC 1G7MC 3AW6A 4WMGA 3RZ4A 2HU1A 2LYOA 2ZQ3A 5B06A 4H92A 1OQMA 4ET8A 2IHLA 4B4EA 1KXYA 1LSBA 1OUGA 3GXKA 4RW1A 2DQGY 4WG1A 5F16A 5DLAA 2Z18A 5DN5A 5F81A 2ZQ4A 1RJCB 1GF5A 1BVXA 1I20A 1GB6A 1IP1A 1YL0X 4NSGA 3P66A 4LT0A 4NY5A 3WPJA 5L9JA 4NGLA 4XJBA 4DWXA 5LVHA 1C10A 4U3XB 4NGWA 3EBAB 1WQRA 4NSHA 5HNLA 1XGQC 2N5ZA 2BQIA 1C08C 1FKQA 4HJVA 4ANRA 2XJWA 1NHEA 3WU9A 3E3DA 1PS5A 4N8ZA 4CGEA 2XTHA 3K3TA 4H9IA 5LVJA 3WL2A 6LYTA 2MEGA 2ZYPA 3A67Y 1IOCA 4ML7A 3CT0A 3B0IA 4PGJB 1QDTA 1UCOA 1GFHA 4J0LA 5E9RA 1T6VL 3W6FA 5DN4A 4DDAA 5D5FA 4EMNA 1GFUA 4G49A 4NGJA 1REYA 2GV0A 4Z3MA 1O23A 1LZ6A 3WU7A 1LSAA 1BWJA 1UIEA 1QUTA 2HTXA 4YEMA 4XJGA 5D5CA 4B0DA 3LN2A 4HTQA 4WM5A 1GDWA 4OOOA 4O34A 4PJ2C 5F9UA 4LYZA 1JKBA 1GEZA 1QQYA 3TXJA 3WW5A 5IDDA 5APCA 1JTOL 2YSSC 4WLTA 4ET9A 1GFRA 8LYZA 1OUFA 1LZRA 1FDLY 4LYTA 1XGTC 1TBYA 1B7PA 1B5VA 3GXRA 5AMYA 1TDYA 4BAPA 4ZEEA 5KKIA 5KXWA 1IWUA 2C8OA 1GPQC 1HMKA 1NMMA 2Z2FA 2DQEY 2BQMA 2RSCA 1LYOA 1BB5A 4UWVA 1UIGA 5FHWA 1B7MA 2PC2A 1CKFA 1C43A 2DQAA 4HPEA 3TXBA 5L3IA 5LVGA 4ETDA 5KXLA 5HQ1A 2EPEA 3AGIA 4FDYA 1GFVA 3HBEX 1UIFA 3FE0A 5LA8A 1GWDA 4N5RA 2FYCA 4GCDA 3TMWA 3LYTA 1GD6A 1NDMC 4PRUA 2ZILA 1LMTA 1YKYX 4LYMA 1JTTL 1KIRC 133LA 1EL1A 1NQIA 4YM8A 2FBDA 4WM1A 1UUZC 4XJHA 1GB3A 2HUBA 1P2CC 1DI3A 4LT2A 1D6QA 1LJ4A 3B0KA 5FEKA 1JJ0A 1JSEA 2YVBA 3LYZA 1YILA 3A96A 3MGWA 1KIPC 1V7TA 1AZFA 2BQJA 1J1PY 5LYZA 1YKXX 4HPIA 1ZMYL 4NGOA 4H93A 4XN6A 9LYZA 4NGVA 1GB9A 1GBXA 1GBOA 2G4PA 1OUJA 4CFPA 1QTEA 2I25L 1FN5A 1H87A 2ZNXY 2YBLA 3QNGA 2BQAA 4GN3A 1YAQA 5M1YA 1OUAA 4GCCA 2MEHA 1GB8A 1GBYA 1LSMA 135LA 3RT5X 3AZ6A 1GB2A 1LZCA 1DPXA 6LYZA 1YAPA 5LYMA 1LMCA 1SLYA 4QEQA 2F4GA 5LVIA 3T36A 1B5XA 3G3AB 4NHQA 3ZVQB 4C5FA 4LYBA 1B7OA 5K7OA 3CSQA 4OWHA 4KT3A 1ALCA 2ZWBA 4H94A 1IP3A 1LYSA 4AXTA 5LYTA 4HV1A 1G7IC 1IC5Y 4H9EA 1UIDA 4H9HA 1GFEA 1LMPA 4NWEA 1WQOA 4J1BA 5KXYA 5KXSA 1IIZA 1JKDA 4XJFA 1AKIA 1MELL 4DDCA 4NIJA 4WM2A 1SQ2L
chains in the Genus database with same CATH superfamily
1GE0A 1XEPA 1GFGA 1QAOA 1NNJA 4LGKA 1C6EA 3HJSA 3QYBA 1QT4A 1L47A 2EKSC 4EKPA 1L92A 3J4GA 1JR3E 1DKKA 3U6OA 2L09A 4GN4A 1LLHA 1LZ4A 1LSDA 1QTDA 1OUIA 2L6OA 4NGYA 1UIBA 1N78A 4YF2A 2UUAM 3LZ2A 1LJKA 1NJGA 4M9XA 3TWLA 1CJ8A 1GDXA 1GF3A 3KSJA 1C6AA 1LYYA 2JZ1A 4DR4M 4NGIA 3DN1A 4QHSA 123LA 1B7QA 4AGAA 4LRTA 1A4VA 4LFBM 1CU2A 149LA 3GLFA 1IM2A 4W56A 1L09A 1L82A 5LMNM 4I5SA 4TX7A 5EXXA 3JR4A 3D8BA 2GQFA 3HHZA 2J7NA 3RZEA 3ULRA 1N32M 5JENB 2Z12A 3KS4A 195LA 2M60A 4MR1A 4AQYM 4CHTB 4I7JA 2G4NA 4FWHA 5KXNA 4EJ4A 3WHKA 1GFKA 4Z98A 3UK6A 1GF9A 1K3XA 5KXZA 4RF1A 2MROB 4WW0A 3TMXA 1SWYA 1OAOC 2BQCA 1LJEA 217LA 3MJ5A 3GRYA 2A7FA 2JY8A 2DI0A 5II3A 4JV5M 2R46A 2UXBM 3DN2A 1L63A 1MJGM 244LA 3TE6A 5LAGA 2BQBA 2C5RA 158LA 1KNIA 2B7XA 4PPOA 1LTMA 2JY6B 1JJ3A 1DKJA 1VDDA 1RFPA 249LA 5LINA 1C6GA 1MLCE 250LA 2D7HA 1QSQA 4LF8M 171LA 4KT0F 1IX0A 2K47A 1GAYA 1B5WA 1KYIA 1L08A 1YLAA 1HENA 3UJNA 1L0KA 1C6MA 2R6FA 1L86A 1XXHE 2B6WA 2OE7X 2HL7A 3V2YA 102LA 1LHJA 2CGIA 1X37A 160LA 3GUIA 4HJZA 5KXOA 5DM9A 1DYAA 1C6TA 4UWNA 4RLNA 1OWYA 1B7NA 4IBGA 2ZM6M 3L26A 2BJWA 4UWUA 1LMOA 1LZNA 4B3TM 2ZTDA 2Q0MX 3HBHA 3WPLA 1REXA 1CV4A 2IGCA 2B74A 5LVKA 4B7HA 4MGKE 258LA 3GUPA 194LA 3LYOA 1NWGA 5E26A 1GABA 1KW5A 1HMLA 1HFYA 4A7DA 3T6UA 164LA 3ZEKA 2QBYB 3THGA 2L4EA 1UFZA 5GKNA 1NSFA 1RCMA 5IT9S 4LZTA 4CHXA 220LA 3WH1A 4LJ4A 4NSJA 2C99A 1L77A 1TAYA 3HJ8A 1L44A 4QGZA 1L15A 139LA 1JWRA 4NL4H 1L80A 2YBMA 5KPRA 4GCEA 4WO9A 4M0WA 5FSTA 4NOOB 4I0CA 1SWZA 3LHMA 4G9SA 1AM7A 4AKHA 207LA 4W57A 1IR7A 1L28A 3PNYA 3AJIB 4BS7A 4DD2A 2CWIA 2G4QA 1NJFA 4B3RM 4IBEA 5B59A 4YXAC 2OOBA 227LA 2A4TA 3N9EA 3HHYA 4P2EA 2W1MA 1BGIA 1DYFA 4N1EI 1LZ8A 252LA 1ZMVA 2OE4X 1L98A 3A8ZA 3AKZA 2FNAA 2XFSA 1QANA 4DV2M 1VQ1A 193LA 1L73A 1G7JC 1WHCA 5IHGA 1SX2A 3ILKA 1CV1A 236LA 2R18A 1C62A 5FTKA 1R4GA 4LF4M 4BADA 4JI7M 3NY9A 1KFVA 1L51A 3GLHA 1L64A 4GCBA 1G7LC 4DR5M 1L37A 5HNCA 4GC5A 1SX7A 2D7GA 5LIOA 3M0EA 186LA 2HKJA 3SHGB 162LA 3M3UA 3A95A 2WZJA 3GRRA 3SB7A 5KXRA 1IOQA 232LA 3QAKA 3SP3A 5EXTA 2BQLA 1LYJA 4JYAM 1NY6A 1XEKA 2LCBA 1CNSA 4LYOA 3CTWB 1GF4A 1OP9B 2LBCA 4QOZC 4I7TA 1NHBA 1TH4A 5C6IA 1NVMA 5IWAM 1I94M 1L53A 2ERCA 1GF7A 2B70A 4FCVA 1L60A 239LA 2Z2EA 2EIZC 1IWTA 3HU8A 1QT3A 1TH3A 4LF6M 153LA 1TH2A 1ZVHL 2LYZA 2BQHA 1BB3A 1L12A 1J1OY 2B75A 1LYDA 1VATA 1GEVA 1RI8B 5EJCA 2HEDA 2BJVA 3FTEA 1CV0A 3LCUA 1HERA 4DT3A 1KXXA 1LKRA 2K0BX 3VK7A 4WP2A 1T3PA 4NWHA 4LDEA 2HECA 2LNHC 1HQCA 1LZ1A 3FRIA 4LJAA 4GEWA 5IELA 3UZUA 4HL4A 1OYUA 3FUVA 1B7SA 1QUOA 2W1YA 3WU8A 3GPPA 3CDRA 4OWAA 3U6PA 1UC0A 2F5SA 1LHIA 4Z41A 2Z38A 4LT3A 1GKIA 3CF2A 1LHLA 2DQJY 5I53A 1WGLA 2A7DA 4W59A 1LSGA 4WLXA 2J7OA 4PDGA 4N9RA 2JNHA 5ITXE 1IXSA 1SXJE 3P4ZA 4CFOA 1JB0F 1L67A 4AI6A 4ZPUA 3OTOM 5DL9A 1IR8A 4BBAA 1H6MA 2Y20A 3DN3A 4L8RC 4LJ6A 2BQKA 5LAFA 4B7GA 1V34A 5KPTA 4KHPM 1JKAA 3HTFA 1OUEA 3C83A 2F5NA 1CX7A 1IWXA 5FDJA 234LA 1JQUA 4FW9A 4UN2B 2R65A 1EPYA 1LHKA 3A3RX 4K0KM 2Q9DA 1FLYA 3LCVB 3A46A 1C66A 3HJQA 4LFCM 208LA 2DQDY 3W6DA 1IP2A 112LA 1D3MA 2LC9A 4DD3A 1IN6A 2DZLA 2XZFA 1F6RA 5FTLA 3VKHA 1IXZA 1L70A 122LA 3OE0A 4PCZA 3RZ4A 4RKUF 2QSFX 2HU1A 2ZQ3A 5B06A 1R6BX 2DAIA 4B4EA 1L84A 3BBZA 3GXKA 2DQGY 4WG1A 5DN5A 2Z18A 5F81A 1C63A 2ZQ4A 1Y8GA 4D80A 5EP4A 3G3WA 1GF5A 3JR6A 1BVXA 1GB6A 1IP1A 4NY5A 2RGOA 2HCBA 4LT0A 5L9JA 111LA 3HDEA 230LA 199LA 3AOGA 4ANRA 3WU9A 1OIZA 4CGEA 1L74A 3A67Y 2EUCA 3GLFB 4ML7A 4DQJA 143LA 1GFHA 3C9PA 5E9RA 2RAZX 1L0JA 3QAUA 210LA 1GFUA 2HUKA 1REYA 181LA 3SN6R 1O23A 1G0LA 1UIEA 4DV6M 1QUTA 4I8OA 1DYGA 4HTQA 4IAPA 1C60A 4WM5A 1GDWA 1CV5A 4PJ2C 2K6BA 1JKBA 1GEZA 4MB7A 4ET9A 1GFRA 4LJ9A 4AZFA 3IHPA 3KVWA 3GPYA 1L30A 2QP9X 3FE3A 1B7PA 4ZEEA 2UXDM 4I4LA 3D4SA 4M9ZA 1L26A 1HMKA 114LA 1LYOA 2PC2A 2DQAA 1QUDA 4OX9M 4BB9A 2CP8A 1QAMA 3HT9A 4ETDA 5KXLA 1GFVA 5LA8A 1ZQ9A 1L05A 1QAQA 1GD6A 3GQ4A 3DZDA 1L39A 4S0WA 2ZILA 4LYMA 1E32A 1EL1A 3FUWA 2X4AA 1UUZC 2HUBA 4XJHA 4NRVA 260LA 1D6QA 1L13A 1L17A 3A98B 1JSEA 3SBBC 2YVBA 1IBLM 3LYZA 1YILA 1T8FA 4LGMA 1N77A 1DYCA 1AZFA 2X8AA 4ARLA 2BQJA 3GLIA 4G4OA 1L55A 1YKXX 5LYZA 1ZMYL 4NGOA 3AL0C 4H93A 9LYZA 4CFPA 1OUJA 2F5QA 1H87A 2ZNXY 5ITYA 5M1YA 1XJTA 228LA 3SB9A 1GB2A 2DAMA 1DPXA 4QEQA 5LVIA 1J09A 3I04M 152LA 2ZWBA 1IP3A 1LYSA 4IBIA 1D2YA 3AV0A 4H9EA 1C7YA 187LA 1AKIA 3ZQJA 1PQDA 2Z3XA 2UUCM 3C82A 1YUBA 2JA2A 3SBJA 1Q3CA 3D3DA 3PFIA 2H9JA 2OU8A 1D3NA 1N34M 1BVSA 2WARA 4CISA 3RFWA 3H4MA 4NHPA 1LOZA 4NHIA 1ZWNA 4DC4A 2KRUA 1YAMA 4LY6A 1GBWA 215LA 5KKJA 1OVHA 1IY1A 3SAWA 4QHTA 4D9ZA 242LA 1LZ9A 2XEPA 3JAMS 1REMA 4GCFA 1TDZA 1QT6A 1P7SA 4I7MA 2XZUA 4PJZA 1YROA 2O25A 1LYFA 225LA 1VEKA 3F6ZA 3DOAA 3HWLA 2V6ZM 4OW0A 1W08A 4HJYA 1KXWA 3NBXX 4RF0A 2BWBA 4TWSA 2YBHA 1C6HA 2UU9M 4ARMA 3FADA 5FTNA 1NHWC 2CWBA 4CJ6A 1B2KA 3AJNA 2MJ5B 3K1JA 1N36M 4NSIA 4DD1A 1G0QA 4IBBA 3TWMA 4XJDA 5C6JA 2B3TA 1J1XY 1N4FA 1IP6A 1LJ3A 3U6EA 3NYAA 1L2BA 1IN4A 1LYHA 4QY9A 2Y8PA 1L90A 3V76A 1G3IA 2LVPC 1LWGA 2F2NA 3GLHB 4OWEA 1L45A 1D9UA 3TMUA 3SAUA 4N0JA 1D0MA 3IG5A 1PJTA 4DR2M 4W51A 1WQNA 1N75A 1HEQA 1LGUA 4W53A 1IWWA 1GF8A 2F32A 2CE7A 3CQLA 3K2LA 1DZBX 146LA 4JI8M 4W52A 2KW0A 1LYGA 1PJQA 1L06A 1OTRA 1VDQA 1LW9A 1TEWA 3OK0A 3NY8A 1CX6A 2FFJA 3U6SA 3C8QA 3KOWE 4DDBA 3WUNA 1JEFA 1XMQM 1UIHA 3ZVQA 4GIPA 3HUQA 3FKEA 1G1WA 1D2WA 3HU2A 2CUZA 1WIVA 3U60A 110LA 1IWYA 3IJVA 1HEOA 1D2NA 2RBRA 3AOEA 1XHBA 1HSXA 251LA 1VDTA 2YDGA 4I7RA 3WW5A 1JKCA 1DI4A 2D4KA 3CDOA 5KY1A 3DMVA 1T8GA 2DKLA 3A90A 1Z5BA 5A2QS 206LA 4QOSA 4MGYE 2YBIA 1L88A 3GUJA 4I7LA 5KPZA 2H1RA 224LA 4DBGB 1NDGC 1XEIA 1RE2A 3AGHA 3B89A 4W94A 2ZTCA 1B5UA 2DKVA 2MR9A 4TSCA 4DR7M 1GL7A 3M18B 1L99A 1UBZA 1IXSB 5L3HA 4PK0A 1GB0A 7CATA 1GB5A 2Z4RA 2LTUA 3GUMA 1ZV1A 1GL6A 5EQTA 2ZYCA 5ILFA 4JN6A 1GF6A 2APLA 1LYZA 1IBMM 1KY0A 2D4JA 2HHHM 3F92A 4A3VB 3CF0A 3LW5F 237LA 1L22A 1NNUC 1R2YA 2V1CA 1GFAA 1L00A 2W1LA 3TWKA 1L52A 4PRQA 1PRBA 2O79A 4IJFA 1A5TA 4W54A 150LA 3P64A 4WM6A 1OFIA 1IN7A 2XF3A 1G0JA 4R71A 3A34A 2LHCA 5ITUA 1OWZA 1PQMA 2XBRA 5LMUM 4XJIA 3W6CA 1HC0A 1W5SA 1Q39A 1C6FA 4F1IA 229LA 5HMJA 2F5PA 1TLAA 1L16A 4CIZA 2BAAA 4JI1M 4G4BA 1P3QQ 2H9KA 128LA 3VDPA 1L04A 4XENA 1HSWA 1DXJA 3P68A 2DENA 1IP4A 4GH9A 1IEEA 1XWIA 3AB6A 1IY3A 2BQFA 3WMKA 1T3TA 4R3DA 2UXCM 1DO2A 1NKHA 2DZOB 2KDLA 4H9BA 3SC3A 2MEAA 3WXTA 2D91A 1L85A 1LKSA 1BB7A 5H37D 4H90A 2QENA 4WO6A 1XMOM 3KXEC 3FA0A 3FUTA 3A91A 2ZIKA 2MGWA 3SB5A 1LJJA 4L16A 2XH9A 4RNAA 1QSWA 1WVUA 5DNYA 5B1FA 4LJ8A 1GF0A 4RDSA 4IBFA 2OO9A 1IWZA 4DV4M 1HT1E 2YBJA 3DMZA 1P3NA 1KS3A 1KIQC 1JHLA 3W6EA 1OUDA 3M6AA 2B6ZA 4IJEA 1T97A 3I01M 3HDFA 2QZ4A 190LA 5JI3E 1LSPA 1DGBA 1ZV5L 3EMLA 2ZNWY 2Z7JA 1CV3A 4ITQA 1F6SA 155LA 1PJJA 2B5ZA 3DN0A 3WVYA 3KAMA 3GLHE 134LA 1IP7A 245LA 4ZFPA 5KXTA 1P56A 3GLIB 4W96A 1L8QA 4YXCA 1OKSA 1G4AE 1DQJC 4G4CA 1LJFA 2CHQA 240LA 3OE9A 1IN8A 2M5ZA 4DV5M 1JTPL 1GFTA 4GRIA 3B7QA 5C1BA 2CV2A 5KJ9A 1UACY 2CV1A 4II8A 1SXJD 1VDPA 2Z39A 4B4JA 4BAFA 1WVVA 2NQ8C 5B07A 126LA 1CUQA 1BB6A 1LSEA 2DQHY 4OWCA 5IZ7D 1XNQM 170LA 1LJIA 1L42A 4XADA 4GC9A 3A3QA 1XXHA 2BLYA 184LA 1LCNA 4N1CC 3U6MA 2Z4SA 3HU1A 1G7MC 2CEAA 3B9PA 1J7KA 2DWNA 4FCWA 4ET8A 1OUGA 1WXQA 4RW1A 3BOSA 3ZC7B 5DLAA 1RJCB 4XK8F 2CV0A 4NSGA 4NGLA 3I51A 2I7NA 1TR8A 4MGIE 5HNLA 1CU3A 1L62A 1ZURA 4GHAA 1DV0A 2CHVA 1DO0A 1FKQA 4JI6M 3J7AS 2BQIA 4NXMM 4MM3B 1QT5A 3HZJA 3E3DA 5EXPA 3ODUA 1CU6A 2ZYPA 1IOCA 3B0IA 4EPFA 1N33M 176LA 141LA 2XSZD 3A42A 1TGUA 4DDAA 5D5FA 4Z3MA 3WU7A 1LSAA 4YEMA 5C18A 4EKRA 1EIJA 4ARMB 1KW7A 3TXJA 3HH5A 3DA1A 5FTJA 4WLTA 3SBAA 1L48A 8LYZA 2C9CA 5L8RF 4P16A 1OUFA 1LZRA 1FDLY 4LYTA 1XGTC 1B5VA 1D3JA 1TDYA 222LA 1IWUA 2D7EA 1L43A 3HH6A 4G6ZA 1G06A 5F3WA 1BB5A 3F8VA 4HPEA 1CKFA 1L75A 5L3IA 3KP1E 1CU5A 2OTZX 5JI2E 166LA 2EPEA 2NTHA 1CVKA 3HBEX 1L1ZA 1GWDA 3TMWA 4GCDA 1T43A 2KRKA 1V33A 2KNZA 1QTVA 4PRUA 4L78A 1LMTA 3J2PB 4AG6A 1JTTL 3SMPA 261LA 3E9SA 1NQIA 2ANVA 4NC6A 4ARQB 1DI3A 1L81A 2EA0A 3GUNA 3VFDA 196LA 3MGWA 1Z6TA 3R8FA 1L21A 1AUAA 1SSWA 2FS1A 4B3MM 1GBXA 3T15A 3FUXA 1GBOA 1QTEA 1L2CA 4QNMA 4JI4M 1F4IA 2YBLA 3K92A 4GN3A 2MEHA 3RT5X 3AZ6A 1L19A 1LZCA 1P2RA 4B3SM 2FE8A 2F4GA 2B6TA 3G3AB 1FNNA 4NHQA 3ZVQB 4OWHA 2GNOA 2VF7A 5LYTA 3HUKA 2KEBA 192LA 1G7IC 1IC5Y 3IECA 3KSXA 3U60B 1C6BA 1L57A 4H9HA 1C1KA 1C6KA 4J1BA 1IY2A 5KXSA 4XJFA 2OTYX 3J80S 2L4FA 4WM2A 1SQ2L 253LA 1LYIA 1L02A 165LA 3W67A 1YANA 3FUUA 2RBNA 2EO2A 5EP2A 1D9WA 1Z55A 1C6NA 1B6IA 2Y0QA 1P37A 2LVOC 2LZTA 1JTMA 1LZEA 4WOAA 3GO8A 2FOIC 2RBQA 197LA 2DNAA 1IC4Y 4LJ5A 4AG5A 185LA 1A2YC 1I56A 1HHLA 2Z6BA 3RW8A 1E9SA 1GJTA 4C3WA 1JIYA 2AUBA 4ETEA 1XJUA 4YEOA 5KXKA 5ILCA 3NWLA 1LGWA 1IFYA 1PQJA 2CJLA 4WLDA 1KSFX 2UUBM 256LA 4NHSA 3L2AA 2DQCY 3TXGA 2JUJA 4RW2A 1C6LA 5KXXA 4AKIA 1L41A 1C6CA 3N9AA 154LA 4DV3M 5A3ZA 1L71A 3GLGB 2BQNA 4B49A 1YAOA 4X64M 2HEEA 1GB7A 1LI3A 1OUHA 4YOPA 1D0LA 2OQ4A 1JUGA 2MECA 3AZ7A 1LPYA 3CT5A 1ZMWA 1NO1A 4LDLA 3WPKA 118LA 1QIOA 4NG1A 2KNAA 137LA 4DD9A 3LMMA 2XBSA 5B05A 1EQEA 2I6ZA 5ITXA 2ZANA 5BPVA 1QVRA 1L29A 3TMVA 1SXJA 3VLFB 1HJPA 2A5YB 2F30A 212LA 3VW7A 1Z5CA 4XYYA 1F0WA 3I4YA 173LA 3A6BY 3GQ5A 2RB0X 1G41A 1C45A 2BWEA 1I1ZA 4XBOA 1BQLY 182LA 109LA 4QNRA 4H8ZA 2ANXA 3DMXA 1I4WA 4B1AA 2HU3A 1EQ4A 1HNZM 1C46A 3HH4A 4G3OA 2F5OA 3C7ZA 4H9AA 2MEIA 4ETAA 3TXKA 4RLMA 1LZTA 2I26L 1IP5A 1D6PA 2L2DA 1IOSA 2DQIY 1OJLA 4HTKA 2RB2X 2C98A 3MK6A 2DAGA 3HT8A 3EMSA 4L15A 1IVMA 1UA6Y 3DNAA 191LA 1DGFA 1VAUA 5KXMA 4KLNA 1V7SA 3TXEA 3KOYE 2VDBB 1QTKA 1C6IA 4TSBA 1BVKC 2F2QA 4I7KA 1IWVA 4Z46A 5F9XA 127LA 1GE3A 1L83A 3E4RA 2DZNB 4M4OA 4FJRA 2W1XA 4TTDA 1HEWA 1YL1X 1VEDA 2BPUA 5B1GA 3A45A 4ARPA 1KY1A 145LA 1YE9A 216LA 5I14A 1VDSA 1PQOA 4X66M 4HLQA 2RBOA 3FYCA 2MEFA 1L89A 4DV0M 1JPOA 1XSFA 5FELA 2F4AA 1GAZA 3N9CA 4L41A 1E9RA 3HX3A 2G3QA 5E4PA 4S12A 1C6JA 1DYEA 1H6UA 3WUMA 1WTNA 4GRVA 1W5TA 3AW7A 2EKKA 1L34A 4LDOA 1MN3A 1LSYA 3C80A 3QE8A 4J7VA 1CUKA 1QDRA 2G5GX 3G3BB 2RBPA 1JR3D 5KQ8A 198LA 3OJPA 1QZEA 1UIAA 3KP0E 1HNLA 1FBIX 1L10A 1JISA 2WSEF 3K2RA 1GE1A 1QQWA 5HQ1A 4Y28F 4WG7A 4LZZA 4ZPXA 2R44A 2ZAOA 3KW6A 1G7HC 3B6LA 3WULA 1VDLA 2KZSA 3HH3A 3WUAA 1LI2A 1GHLA 5A3EA 4MH0E 4Z6YA 4D82A 1L01A 235LA 3DN4A 5LXWA 1L93A 3AOEC 2MEBA 1L25A 4LFAM 1XXHB 1TCYA 3K8ZA 3UGJA 1IXRC 2R62A 2V1UA 4G4HA 3B7ZA 3DN8A 1ZVYB 4LFXA 4OU7A 259LA 1G0PA 1L91A 231LA 214LA 3RE8A 1FKVA 1V92A 4D81A 1L61A 4LFPA 3TXFA 3K9PA 1C68A 3J6KA 3UMMA 1L46A 1E94E 2RBSA 4H9FA 2Z19A 4PD2A 2HWJA 1DGHA 3I4VA 1J5EM 120LA 1Q02A 3LVVA 1GE2A 4IIWA 172LA 1QUGA 1CKDA 2RB1X 1AT6A 4HTNA 4I7SA 3W6BA 4K5YA 4ARQA 201LA 1GBSA 1HNWM 1C7PA 1IY4A 1L94A 3PNVA 1LHMA 7LZMA 1JQJC 1MX0A 1SSYA 1FJGM 4NFVA 1I6SA 3KOXE 2C8PA 4PT5A 3IWRA 4I7OA 2F47A 4DV7M 1LZDA 5APFA 3WW6A 4EIWA 4JI3M 1L23A 132LA 2Y21A 3TXDA 1LJNA 3OE6A 1QUHA 2BQOA 5I4XA 1YIKA 113LA 2MEDA 180LA 3GLFE 1L95A 3CDVA 1L40A 1DI5A 3W0FA 1G07A 3R9XB 1QTBA 1EE8A 3PBLA 3T38A 4H91A 1F10A 3CF6E 4KL7A 2YFQA 4ARJA 4G4NA 1PM5A 2R4JA 1LSCA 2QARC 1LSZA 1W6ZA 1CJ6A 3B74A 4DUZM 1XGUC 2Q9EA 1T6HA 247LA 4EOFA 1HQYE 3EXDA 3WYHA 4LYCA 218LA 4GMQA 2VQFM 1B7LA 1C67A 2X49A 167LA 1ZMUA 223LA 1OV7A 1L27A 2QCUA 4DJHA 1T8AA 1JJ1A 3G3VA 4MGHA 2BQGA 5EBHA 1PQIA 3A92A 168LA 1HEPA 205LA 3A93A 3LZTA 3SB8A 233LA 5J7CA 4XGIA 4DR3M 2JY7A 2VIIA 4EKSA 6LZMA 1L66A 2DHRA 3H4JA 2LZ2A 2VB1A 1HFZA 2CUUA 131LA 4ZIXA 4F2LA 3LQRA 4J1AA 3LYMA 3HTBA 103LA 3BKHA 4E97A 3B72A 1B0DA 213LA 5I5QA 2K9DA 1HT2E 2CDSA 1L69A 4EKQA 3GLGA 3QY4A 1HEMA 5T3FA 1VFBC 1LHHA 4WURA 1CUPA 148LE 4L4UA 1LPIA 1JSFA 1OV5A 4IBDA 175LA 3FYDA 4WMGA 200LA 142LA 1KXYA 1LSBA 1L96A 4DR1M 4REZA 156LA 3BXWA 4W5WA 5DYGA 3T6PA 2O01F 4PDIA 2DHYA 2H5XA 4XJBA 1QS9A 4DWXA 1G8PA 4NGWA 3MHVC 1WQRA 3EBAB 3G3XA 4NSHA 4Z8XA 248LA 2N5ZA 1C08C 3PXGA 3C7YA 2YR0A 1PS5A 2XTHA 4H9IA 5LVJA 4AKGA 3WL2A 6LYTA 2MEGA 4IBCA 3CT0A 4Q7JA 1C6DA 4W55A 3DKEX 1T6VL 3W6FA 5DN4A 4EMNA 4G49A 2GV0A 4JI5M 3SHFA 1L50A 3SARA 1LZ6A 2HTXA 4CGYB 4NSOB 2B6YA 4GITA 3TQSA 3LN2A 4O34A 5F9UA 1EFUB 1QQYA 5ITRA 3KDSE 5IDDA 4LZMA 1IQPA 3J81S 1JR3A 219LA 4G4RA 2O5RA 3Q8XA 1TBYA 2OEAX 4FD2A 3GXRA 5AMYA 1L35A 3SYLA 1Q3BA 2HULA 1CV6A 1PQKA 2CRUA 3W68A 2RSCA 188LA 178LA 1QSBA 4UWVA 1UIGA 5FHWA 1B7MA 4HEOA 3TXBA 3E21A 1SXJB 2WSCF 3AGIA 3DFZA 1C6QA 2FYCA 2LVAA 3LYTA 1NDMC 133LA 2E5LM 4YM8A 3GULA 1P2CC 3F9LA 3B0KA 1JJ0A 1P64A 1HR0M 1S3SA 3A96A 3HU3A 4LGYA 1L56A 3DN6A 1LWKA 1J1PY 1DYDA 3AFHA 238LA 4XN6A 4NGVA 1GB9A 5EXSA 2G4PA 1FN5A 1WTHA 2BQAA 1OUAA 1LSMA 135LA 6LYZA 1OQYA 5K7OA 4M0DA 1B7OA 3VDUA 2KZUA 3CSQA 4DQ5A 4KT3A 4M9SA 1TF0B 1D3FA 4I81A 3GUKA 254LA 255LA 4H94A 4AXTA 3SYKA 4FWGA 1QS5A 3VKGA 1UIDA 1GFEA 1WQOA 5KXYA 3ZCBB 2B73A 189LA 4DDCA 1IBKM 1L03A 3TXHA 5KQDA 4IASA 2MEEA 5LA5A 3FI7A 5E6JA 1L79A 4NHTA 1L31A 4P17A 4KXIA 2DXIA 3ATNA 1P46A 1XNRM 1YSYA 3RU5A 1P36A 4MSTA 2EJSA 1G59A 3AYQA 4LZJA 3U5ZA 4WL6A 1QT7A 4I7PA 2RAYX 2WSFF 1ORYB 3P65A 1WQPA 3L28A 2LWXA 4DD0A 1CKCA 1B5YA 1R7RA 3U61A 2JZ0A 3V2WA 1JTNA 4NSRA 1IORA 2QB0B 1B7RA 2OE9X 1L14A 2Z37A 1R2ZA 2XLJA 1CKGA 4GLAA 2FYDA 2VF8A 4NXNM 2ZIJA 3JR5A 4ETBA 5FLXS 5KXPA 4NG8A 2J5YA 3B0OA 3RNXA 5F14A 3EIHA 4LG2A 1CTWA 5FCPA 1G0MA 4KPMA 169LA 3VWOA 1LZSA 1BWHA 119LA 3HKPA 3FTCA 1YKZX 2C96A 2DBTA 2KA6B 2OU9A 4OO9A 4GN5C 3D8LA 3HTDA 2ZBKB 4G4QA 2ZAMA 3SASA 3CDTA 3LZMA 1D0KA 5KO3A 2BQEA 2EQLA 2P5TA 241LA 3FI5A 3HFMY 4X65M 4X62M 161LA 1WTMA 2QPAA 2R45A 3B7NA 2DQFC 4LF7M 3C58A 1IC7Y 1L87A 2LZMA 2FH0A 1CU0A 1G0GA 8CATA 1G0KA 2H5ZA 183LA 4AW4A 1GBZA 3HHXA 3C81A 174LA 1DGHB 4AQNA 129LA 157LA 1L33A 4DUYM 3FTDA 1B5ZA 4DV1M 3KFUG 2I7PA 2YBNA 1LSFA 1L32A 1PGYA 4BLCA 4IBKA 4KO8A 4WM3A 4DKLA 1L97A 4OVZA 1TDHA 3AGGG 3UONA 4LRSA 2JWSA 3J27B 1C65A 1LZ5A 1OIPA 4JI2M 1B9OA 1IOTA 4PHIA 4CJ2A 5I4WA 2KNVA 4WLYA 1HF4A 3CSRA 1IO5A 1INUA 3PVSA 2HEFA 2FBBA 1L58A 1L76A 5APEA 4M6DA 2QHOB 1VEJA 1FLQA 3SMSA 1XEJA 2X0AA 3T1YM 1REZA 3RGSA 108LA 4MCKA 1OUCA 1LJHA 4FCTA 4I8SA 2QNJA 4LJ7A 1DPWA 1SXJC 1L38A 1E8LA 2DAKA 2D6BA 2BLXA 3CB7A 4H8YA 5IREB 1XGPC 3GRVA 1PZYA 2N35A 1Z5AA 3U6DA 1HELA 3A6CY 2VQEM 1P2LA 144LA 1L54A 5C6LA 1BWIA 1P5CA 4YENA 4EXMA 1LJGA 2JY5A 1BHZA 3HT7A 4L6V6 4TUNA 1LMQA 1BB4A 3WHLA 3WVXA 4DYGA 4HV2A 1LAAA 3W3EA 2LXEA 3GUOA 3OE8A 2XFTA 2HUMA 4R0FA 4II7A 3CT1A 2DAEA 2XQOA 1L36A 1HNXM 3QWLA 2Y0TA 3A94A 4GLVA 2KHHA 4QDNA 3HHWA 1L65A 3HU9A 4IJ4A 3WXUA 2D4IA 3GLIE 5I54A 3EIEA 1Z59A 1FLWA 1L20A 138LA 1WJ7A 1NBYC 3J7BA 5EP3A 1GXV2 2CFOA 4ETCA 2RRUA 3HTGA 4E3UA 1L68A 3GPUA 1LYEA 1NHGC 4LT1A 2KXEA 3HBDA 1PJIA 5HLLA 1OUBA 3L27A 2F4VM 262LA 2O7AA 1IR9A 147LA 1GFJA 4DQ7A 3RUNA 151LA 1AT5A 3EO5A 1QZMA 5I4YA 1TTEA 2EKFA 1VEGA 3CGWA 1XFPL 4OWBA 1C61A 1QTZA 1WGNA 1OAIA 1OVJA 1OVKA 5APDA 1FLUA 1C69A 2BQDA 130LA 4H8XA 1NF5A 5ITQA 1LI6A 1GLNA 1GXXA 2JXNA 3LQQA 2L7HA 2LHMA 4LF9M 1CJ9A 3IG8A 7LYZA 1T6OA 2LYMA 226LA 3AZ5A 1L07A 4B4IA 115LA 1MU5A 163LA 3KS8A 3GP1A 1JITA 1LSNA 221LA 3HGIA 2O4WA 2B72A 1XB2B 3RGPA 1QT8A 1WQQA 4NGKA 3E46A 1UICA 3SFZA 4GKKM 1HFXA 2HEBA 1R5LA 4IATA 3BKVA 4R6CA 3PDSA 2QBYA 1L59A 3IJUA 4I7NA 1QUSA 3SB6A 4LF5M 104LA 1G1VA 2RKOA 2HEAA 2DWMA 3TPZA 2OPFA 4NGZA 1EQ5A 1IN5A 5DYIA 5ITTA 1CJ7A 1GVNA 1GE4A 1OFHA 1L2DA 4FWDA 3ATOA 1QTHA 1LZGA 2XSZA 3U6QA 4OOTA 4X3BA 1K28A 211LA 1WQMA 4DD7A 1NV8A 4YHHM 1DGGA 3KOZE 4HSFA 3L2XA 1RU3A 1L11A 4H1PA 3C8RA 1ZYTA 1LMNA 2Z8YM 1WR1B 3TL4X 4NEBA 4DR6M 257LA 2NWDX 140LA 5HMVA 3L29A 2JP7A 1LZAA 4I7QA 4OW1A 1PJSA 4YY3M 3FTFA 1NBZC 3SATA 2DVWB 3M7GA 2QQ8A 1LZBA 246LA 4YX7C 2IFFY 1YQVY 3GRUA 4WL7A 1XGRC 4WM4A 2RH1A 3FD9A 1C64A 1DYBA 3AZ4A 3HUAA 4IBJA 3CSZA 1LMAA 3U6CA 3TXIA 1VG5A 1UM8A 1CKHA 4H9CA 1L18A 1LZYA 4B08A 3D9AC 3W6AA 177LA 4HP0A 209LA 1QSAA 2MH8A 2NTGA 3AW6A 5DFLA 4LCBA 1IY0A 2LYOA 3VK8A 1K3WA 4H92A 1OQMA 2IHLA 5F16A 2L7IA 2HAKA 3GPXA 2XGNA 2R4EA 1I20A 1YL0X 1P6YA 3L64A 3P66A 3U5ZB 3WPJA 3Q8GA 2LHGA 5LVHA 4GHLA 1C10A 4U3XB 1XGQC 2OU0X 4HJVA 1XC8A 2XJWA 1NHEA 2OOAA 3ZH9B 4N8ZA 2YNMD 3K3TA 107LA 1G71A 3U61B 4PGJB 1QDTA 5BR8M 1GO5A 1UCOA 1LGXA 4J0LA 2B6XA 3MMPA 3FRHA 3L25A 3C8SA 4JXJA 4NGJA 3HWSA 1QYRA 1BWJA 3HY5A 2CHGA 2Q2EB 2C9OA 2W82A 4R7GA 1L1TA 4XJGA 3GQ3A 5D5CA 4B0DA 4OOOA 1ZAEA 2L78A 4MGZE 4LYZA 5APCA 1JTOL 2YSSC 4NRWA 3CDQA 5KXWA 2LVNC 4BAPA 5KKIA 2C8OA 2AHMA 1GPQC 1K82A 1NMMA 2Z2FA 2DQEY 3QYEA 2BQMA 1C43A 5LVGA 5LZMA 2DWZB 2LVQD 5FTMA 2RGHA 3GLGE 4GKJM 3HT6A 4FDYA 4GBRB 1UIFA 1C6PA 3FE0A 3W0LB 4N5RA 1L72A 4KODA 2YQZA 3C3DA 4B7FA 3C3EA 3SAVA 1YKYX 1KIRC 4DAJA 2FBDA 1NY5A 4WM1A 243LA 5FSWA 1GB3A 4LT2A 4FVMA 1LJ4A 5FEKA 4JI0M 2BNKA 1KIPC 1V7TA 3LVWA 4HPIA 5EP1A 4TUWA 4W58A 1NV9A 3C7WA 2DWLA 2I25L 2G8LA 3QNGA 3T1HM 1L24A 1YAQA 4GCCA 4OVZB 1LV7A 1GB8A 1GBYA 2R0IA 1YAPA 5LYMA 1LMCA 1SLYA 4EPIA 3T36A 1B5XA 4C5FA 4LYBA 1AIPC 3U6LA 2LH0A 1ALCA 125LA 1GJSA 4HV1A 3K9OA 1L49A 1SG9A 1LMPA 4NWEA 1QTCA 1IIZA 1JKDA 1MELL 3NBIA 4NIJA 159LA
chains in the Genus database with same CATH topology
1GE0A 1XEPA 1GFGA 4LGKA 1C6EA 1QT4A 1L47A 2EKSC 4EKPA 1L92A 3J4GA 1DKKA 4GN4A 1LLHA 1LZ4A 1LSDA 1QTDA 1OUIA 4NGYA 1UIBA 4YF2A 3LZ2A 1LJKA 1CJ8A 1GDXA 1GF3A 1C6AA 1LYYA 4NGIA 3DN1A 123LA 1B7QA 4AGAA 1A4VA 1CU2A 149LA 4W56A 1L09A 1L82A 4TX7A 3RZEA 3ULRA 5JENB 2Z12A 195LA 4MR1A 4I7JA 2G4NA 5KXNA 4EJ4A 1GFKA 4Z98A 1GF9A 5KXZA 3TMXA 1SWYA 2BQCA 1LJEA 217LA 2A7FA 5II3A 3DN2A 1L63A 244LA 5LAGA 2BQBA 158LA 1KNIA 2B7XA 4PPOA 1LTMA 249LA 1JJ3A 1DKJA 5LINA 1RFPA 1C6GA 1MLCE 250LA 1QSQA 171LA 1IX0A 1GAYA 1B5WA 1L08A 1HENA 1L0KA 1C6MA 1L86A 2B6WA 2OE7X 3V2YA 102LA 1LHJA 2CGIA 160LA 3GUIA 4HJZA 5KXOA 5DM9A 1DYAA 1C6TA 4UWNA 4RLNA 1OWYA 1B7NA 4UWUA 1LMOA 1LZNA 2Q0MX 3HBHA 3WPLA 1REXA 1CV4A 2IGCA 2B74A 5LVKA 258LA 3GUPA 194LA 3LYOA 1NWGA 1KW5A 1HMLA 1HFYA 4A7DA 3T6UA 164LA 3ZEKA 1RCMA 4LZTA 4CHXA 220LA 3WH1A 4NSJA 1L77A 1TAYA 1L44A 4QGZA 1L15A 139LA 1JWRA 1L80A 2YBMA 4GCEA 4WO9A 5FSTA 4I0CA 1SWZA 3LHMA 4G9SA 1AM7A 4W57A 207LA 1IR7A 1L28A 4BS7A 4DD2A 2CWIA 2G4QA 5B59A 4YXAC 227LA 2A4TA 3N9EA 4P2EA 2W1MA 1BGIA 1DYFA 4N1EI 1LZ8A 252LA 2OE4X 1L98A 3A8ZA 193LA 1L73A 1G7JC 5IHGA 1SX2A 1CV1A 236LA 1C62A 4BADA 3NY9A 1L51A 1L64A 4GCBA 1G7LC 1L37A 5HNCA 1SX7A 5LIOA 186LA 162LA 3M3UA 3A95A 3SB7A 5KXRA 1IOQA 232LA 3QAKA 3SP3A 2BQLA 1LYJA 1XEKA 2LCBA 1CNSA 4LYOA 1GF4A 1OP9B 4I7TA 1NHBA 5C6IA 1L53A 2B70A 1GF7A 1L60A 239LA 2Z2EA 2EIZC 1IWTA 3HU8A 1QT3A 153LA 1ZVHL 2LYZA 2BQHA 1BB3A 1L12A 1J1OY 2B75A 1LYDA 1VATA 1GEVA 1RI8B 2HEDA 1CV0A 1HERA 4DT3A 1KXXA 1LKRA 1T3PA 4NWHA 4LDEA 2HECA 1LZ1A 5IELA 1OYUA 1B7SA 1QUOA 2W1YA 3WU8A 3CDRA 4OWAA 1UC0A 1LHIA 4Z41A 2Z38A 4LT3A 1LHLA 2DQJY 5I53A 2A7DA 4W59A 1LSGA 4WLXA 4N9RA 3P4ZA 4CFOA 1L67A 4ZPUA 5DL9A 1IR8A 1H6MA 3DN3A 2BQKA 5LAFA 1JKAA 3HTFA 1OUEA 3C83A 1CX7A 1IWXA 5FDJA 234LA 1JQUA 1EPYA 1LHKA 3A3RX 2Q9DA 1FLYA 1C66A 208LA 2DQDY 3W6DA 1IP2A 112LA 1D3MA 2LC9A 4DD3A 1F6RA 1L70A 122LA 3OE0A 3RZ4A 2HU1A 2ZQ3A 5B06A 4B4EA 1L84A 3GXKA 2DQGY 4WG1A 5DN5A 2Z18A 5F81A 1C63A 2ZQ4A 3G3WA 1GF5A 3JR6A 1BVXA 1GB6A 1IP1A 4NY5A 4LT0A 5L9JA 111LA 3HDEA 230LA 199LA 4ANRA 3WU9A 4CGEA 1L74A 3A67Y 4ML7A 4DQJA 143LA 1GFHA 5E9RA 2RAZX 1L0JA 210LA 1GFUA 2HUKA 1REYA 181LA 3SN6R 1O23A 1G0LA 1UIEA 1QUTA 1DYGA 4HTQA 4IAPA 1C60A 4WM5A 1GDWA 1CV5A 4PJ2C 1JKBA 1GEZA 4ET9A 1GFRA 1L30A 1B7PA 4ZEEA 3D4SA 1L26A 1HMKA 114LA 1LYOA 2PC2A 2DQAA 1QUDA 3HT9A 4ETDA 5KXLA 1GFVA 5LA8A 1L05A 1GD6A 1L39A 4S0WA 2ZILA 4LYMA 1EL1A 1UUZC 4XJHA 2HUBA 260LA 1D6QA 1L13A 1L17A 1JSEA 3SBBC 2YVBA 3LYZA 1YILA 1T8FA 1DYCA 1AZFA 4ARLA 2BQJA 1L55A 5LYZA 1YKXX 1ZMYL 4NGOA 4H93A 9LYZA 4CFPA 1OUJA 1H87A 2ZNXY 5M1YA 1XJTA 228LA 3SB9A 1GB2A 1DPXA 4QEQA 5LVIA 152LA 2ZWBA 1IP3A 1LYSA 1D2YA 4H9EA 187LA 1AKIA 1PQDA 3C82A 3D3DA 2H9JA 2OU8A 1D3NA 2WARA 4NHPA 1LOZA 4NHIA 1ZWNA 4DC4A 1YAMA 1GBWA 215LA 5KKJA 1OVHA 4D9ZA 242LA 1LZ9A 1REMA 4GCFA 1QT6A 1P7SA 4I7MA 4PJZA 1YROA 1LYFA 225LA 3F6ZA 3HWLA 1W08A 4HJYA 1KXWA 4TWSA 2YBHA 1C6HA 4ARMA 3FADA 1B2KA 3AJNA 4NSIA 4DD1A 1G0QA 4XJDA 5C6JA 1N4FA 1J1XY 1IP6A 1LJ3A 3NYAA 1LYHA 4QY9A 2Y8PA 1L90A 1LWGA 2F2NA 4OWEA 1L45A 1D9UA 3TMUA 4N0JA 1D0MA 4W51A 1WQNA 1LGUA 1HEQA 4W53A 1IWWA 1GF8A 2F32A 3CQLA 1DZBX 146LA 4W52A 1LYGA 1L06A 1VDQA 1LW9A 1TEWA 3OK0A 3NY8A 1CX6A 3C8QA 4DDBA 3WUNA 1JEFA 1UIHA 3ZVQA 3HUQA 1G1WA 1D2WA 110LA 1IWYA 3IJVA 1HEOA 2RBRA 1HSXA 251LA 1VDTA 2YDGA 4I7RA 3WW5A 1JKCA 1DI4A 2D4KA 3CDOA 5KY1A 3DMVA 1T8GA 3A90A 206LA 2YBIA 1L88A 3GUJA 4I7LA 224LA 1NDGC 1XEIA 1RE2A 3AGHA 4W94A 1B5UA 2DKVA 4TSCA 3M18B 1L99A 1UBZA 5L3HA 4PK0A 1GB0A 1GB5A 3GUMA 2ZYCA 5ILFA 1GF6A 1LYZA 1KY0A 2D4JA 237LA 1L22A 1GFAA 1L00A 2W1LA 1L52A 4PRQA 2O79A 4W54A 150LA 3P64A 4WM6A 3A34A 1G0JA 1OWZA 1PQMA 2XBRA 4XJIA 3W6CA 1HC0A 1C6FA 229LA 5HMJA 1TLAA 1L16A 2BAAA 4G4BA 2H9KA 128LA 1L04A 4XENA 1HSWA 1DXJA 3P68A 1IP4A 1IEEA 3AB6A 1IY3A 2BQFA 3WMKA 1NKHA 3WXTA 4H9BA 2MEAA 2D91A 1L85A 1LKSA 1BB7A 4H90A 4WO6A 3A91A 3FA0A 2ZIKA 3SB5A 1LJJA 1QSWA 1WVUA 5B1FA 1GF0A 4RDSA 1IWZA 2YBJA 3DMZA 1P3NA 1KS3A 1KIQC 1JHLA 3W6EA 1OUDA 2B6ZA 1T97A 3HDFA 190LA 1LSPA 1ZV5L 3EMLA 2ZNWY 1CV3A 1F6SA 155LA 2B5ZA 3DN0A 3WVYA 3KAMA 134LA 1IP7A 245LA 4ZFPA 5KXTA 1P56A 4W96A 4YXCA 1DQJC 4G4CA 1LJFA 240LA 3OE9A 1JTPL 1GFTA 5KJ9A 1UACY 4II8A 1VDPA 2Z39A 4B4JA 4BAFA 1WVVA 5B07A 126LA 1CUQA 1BB6A 1LSEA 2DQHY 4OWCA 170LA 1LJIA 1L42A 4XADA 3A3QA 2BLYA 184LA 1LCNA 4N1CC 1G7MC 4ET8A 1OUGA 4RW1A 5DLAA 1RJCB 4NSGA 4NGLA 5HNLA 1CU3A 1L62A 1ZURA 2BQIA 1FKQA 1QT5A 3E3DA 3ODUA 1CU6A 2ZYPA 1IOCA 3B0IA 4EPFA 176LA 141LA 4DDAA 5D5FA 4Z3MA 3WU7A 1LSAA 4YEMA 4EKRA 4ARMB 1KW7A 3TXJA 3HH5A 4WLTA 3SBAA 1L48A 8LYZA 1OUFA 1LZRA 1FDLY 4LYTA 1XGTC 1B5VA 1D3JA 1TDYA 222LA 1IWUA 1L43A 3HH6A 1G06A 1BB5A 3F8VA 4HPEA 1CKFA 1L75A 5L3IA 1CU5A 2OTZX 166LA 2EPEA 2NTHA 1CVKA 3HBEX 1GWDA 3TMWA 4GCDA 1QTVA 4PRUA 1LMTA 261LA 1JTTL 1NQIA 2ANVA 4ARQB 1DI3A 1L81A 3GUNA 196LA 3MGWA 1L21A 1SSWA 1GBXA 1GBOA 1QTEA 2YBLA 4GN3A 2MEHA 3RT5X 3AZ6A 1L19A 1LZCA 1P2RA 2F4GA 2B6TA 3G3AB 4NHQA 3ZVQB 4OWHA 5LYTA 3HUKA 192LA 1G7IC 1IC5Y 1C6BA 1L57A 4H9HA 1C6KA 4J1BA 5KXSA 4XJFA 2OTYX 4WM2A 1SQ2L 253LA 1LYIA 1L02A 165LA 1YANA 2RBNA 1D9WA 1Z55A 1C6NA 1B6IA 1P37A 2LZTA 1JTMA 1LZEA 4WOAA 2RBQA 197LA 1IC4Y 185LA 1A2YC 1I56A 1HHLA 2Z6BA 3RW8A 4C3WA 1JIYA 2AUBA 4ETEA 1XJUA 4YEOA 5KXKA 5ILCA 1LGWA 1PQJA 2CJLA 4WLDA 256LA 4NHSA 2DQCY 3TXGA 4RW2A 1C6LA 5KXXA 1L41A 1C6CA 3N9AA 154LA 5A3ZA 1L71A 2BQNA 4B49A 1YAOA 2HEEA 1GB7A 1LI3A 1OUHA 4YOPA 1D0LA 1JUGA 2MECA 3AZ7A 1LPYA 3CT5A 4LDLA 3WPKA 118LA 1QIOA 4NG1A 137LA 4DD9A 2XBSA 5B05A 1EQEA 2I6ZA 3TMVA 1L29A 2F30A 212LA 3VW7A 4XYYA 1F0WA 173LA 3A6BY 2RB0X 1C45A 1I1ZA 1BQLY 182LA 109LA 4H8ZA 2ANXA 3DMXA 4B1AA 2HU3A 1EQ4A 1C46A 3HH4A 3C7ZA 4H9AA 2MEIA 4ETAA 3TXKA 4RLMA 1LZTA 2I26L 1IP5A 1D6PA 1IOSA 2DQIY 4HTKA 2RB2X 3HT8A 3EMSA 1IVMA 1UA6Y 3DNAA 191LA 1VAUA 5KXMA 1V7SA 3TXEA 1QTKA 1C6IA 4TSBA 1BVKC 2F2QA 4I7KA 1IWVA 4Z46A 5F9XA 127LA 1GE3A 1L83A 4M4OA 4FJRA 2W1XA 4TTDA 1HEWA 1YL1X 1VEDA 2BPUA 5B1GA 4ARPA 1KY1A 145LA 216LA 5I14A 1VDSA 1PQOA 2RBOA 2MEFA 1L89A 1JPOA 1XSFA 5FELA 2F4AA 1GAZA 3N9CA 4L41A 5E4PA 1C6JA 1DYEA 3WUMA 1WTNA 4GRVA 3AW7A 1L34A 4LDOA 1LSYA 3C80A 3QE8A 4J7VA 1QDRA 3G3BB 2RBPA 198LA 3OJPA 1UIAA 1HNLA 1FBIX 1L10A 1JISA 3K2RA 1GE1A 4WG7A 1G7HC 3B6LA 3WULA 3HH3A 3WUAA 1LI2A 1GHLA 5A3EA 1L01A 235LA 3DN4A 5LXWA 1L93A 2MEBA 1L25A 1TCYA 4G4HA 3DN8A 1ZVYB 4LFXA 259LA 1G0PA 1L91A 231LA 214LA 1FKVA 1L61A 4LFPA 3TXFA 1C68A 3J6KA 1L46A 2RBSA 4H9FA 2Z19A 120LA 1GE2A 172LA 1QUGA 1CKDA 2RB1X 1AT6A 4HTNA 4I7SA 3W6BA 4K5YA 4ARQA 201LA 1GBSA 1C7PA 1IY4A 1L94A 1LHMA 7LZMA 1SSYA 4NFVA 1I6SA 2C8PA 4I7OA 3IWRA 2F47A 1LZDA 5APFA 3WW6A 1L23A 132LA 3TXDA 1LJNA 3OE6A 1QUHA 2BQOA 5I4XA 1YIKA 113LA 2MEDA 180LA 1L95A 3CDVA 1L40A 1DI5A 1G07A 1QTBA 3PBLA 4H91A 1F10A 4KL7A 4ARJA 1LSCA 2QARC 1LSZA 1W6ZA 1CJ6A 1XGUC 2Q9EA 1T6HA 247LA 4EOFA 3EXDA 3WYHA 4LYCA 218LA 1B7LA 1C67A 167LA 223LA 1OV7A 1L27A 4DJHA 1T8AA 1JJ1A 3G3VA 2BQGA 5EBHA 1PQIA 3A92A 168LA 1HEPA 205LA 3A93A 3LZTA 3SB8A 233LA 5J7CA 6LZMA 4EKSA 1L66A 2LZ2A 2VB1A 1HFZA 2CUUA 131LA 4ZIXA 4J1AA 3LYMA 3HTBA 103LA 3BKHA 4E97A 3B72A 1B0DA 213LA 5I5QA 2CDSA 1L69A 4EKQA 3QY4A 1HEMA 5T3FA 1VFBC 1LHHA 1CUPA 148LE 1LPIA 1JSFA 1OV5A 175LA 4WMGA 200LA 142LA 1KXYA 1LSBA 1L96A 156LA 4XJBA 1QS9A 4DWXA 4NGWA 3EBAB 1WQRA 3G3XA 4NSHA 248LA 2N5ZA 1C08C 3C7YA 1PS5A 2XTHA 4H9IA 5LVJA 3WL2A 6LYTA 2MEGA 3CT0A 1C6DA 4W55A 3DKEX 1T6VL 3W6FA 5DN4A 4EMNA 4G49A 2GV0A 1L50A 1LZ6A 2HTXA 2B6YA 3LN2A 4O34A 5F9UA 1QQYA 5IDDA 4LZMA 219LA 1TBYA 2OEAX 3GXRA 5AMYA 1L35A 2HULA 1CV6A 1PQKA 2RSCA 188LA 178LA 1QSBA 4UWVA 1UIGA 5FHWA 1B7MA 3TXBA 3AGIA 1C6QA 2FYCA 3LYTA 1NDMC 133LA 4YM8A 3GULA 1P2CC 3F9LA 3B0KA 1JJ0A 1P64A 3A96A 3DN6A 1L56A 1LWKA 1J1PY 1DYDA 238LA 4XN6A 4NGVA 1GB9A 2G4PA 1FN5A 1WTHA 2BQAA 1OUAA 1LSMA 135LA 6LYZA 5K7OA 1B7OA 3CSQA 4DQ5A 4KT3A 1D3FA 4AXTA 3GUKA 4H94A 254LA 255LA 1QS5A 1UIDA 1GFEA 1WQOA 5KXYA 2B73A 189LA 4DDCA 1L03A 3TXHA 4IASA 2MEEA 5LA5A 3FI7A 1L79A 4NHTA 1L31A 4KXIA 3ATNA 1P46A 3RU5A 1P36A 4MSTA 3AYQA 4WL6A 1QT7A 4I7PA 2RAYX 3P65A 1WQPA 4DD0A 1CKCA 1B5YA 3V2WA 1JTNA 1IORA 2QB0B 1B7RA 2OE9X 1L14A 2Z37A 1CKGA 4GLAA 2FYDA 2ZIJA 4ETBA 5KXPA 4NG8A 3B0OA 3RNXA 5F14A 1CTWA 5FCPA 1G0MA 4KPMA 169LA 3VWOA 1LZSA 1BWHA 119LA 1YKZX 2OU9A 2DBTA 4OO9A 4GN5C 3HTDA 3CDTA 3LZMA 1D0KA 2BQEA 2EQLA 3FI5A 241LA 3HFMY 161LA 1WTMA 2DQFC 1IC7Y 1L87A 2LZMA 1CU0A 1G0GA 1G0KA 2H5ZA 183LA 1GBZA 3C81A 174LA 4AQNA 129LA 157LA 1L33A 1B5ZA 2YBNA 1LSFA 1L32A 4WM3A 4DKLA 1L97A 3AGGG 3UONA 1C65A 1LZ5A 1B9OA 4PHIA 1IOTA 4CJ2A 5I4WA 4WLYA 1HF4A 3CSRA 1IO5A 1INUA 2HEFA 2FBBA 1L58A 1L76A 5APEA 4M6DA 1FLQA 1XEJA 2X0AA 1REZA 108LA 4MCKA 1OUCA 1LJHA 4I8SA 1DPWA 1L38A 1E8LA 2D6BA 2BLXA 3CB7A 4H8YA 1XGPC 1PZYA 1HELA 3A6CY 1P2LA 144LA 1L54A 5C6LA 1BWIA 1P5CA 4YENA 4EXMA 1LJGA 1BHZA 3HT7A 4TUNA 1LMQA 1BB4A 3WVXA 4DYGA 4HV2A 1LAAA 3W3EA 3GUOA 3OE8A 2HUMA 4R0FA 3CT1A 2XQOA 1L36A 3A94A 4GLVA 4QDNA 1L65A 3HU9A 4IJ4A 3WXUA 2D4IA 5I54A 1FLWA 1L20A 138LA 1NBYC 1GXV2 4ETCA 3HTGA 4E3UA 1L68A 1LYEA 4LT1A 3HBDA 5HLLA 1OUBA 262LA 2O7AA 1IR9A 147LA 1GFJA 4DQ7A 3RUNA 151LA 1AT5A 3EO5A 5I4YA 1XFPL 4OWBA 1C61A 1QTZA 1OVJA 1OVKA 5APDA 1FLUA 1C69A 2BQDA 130LA 4H8XA 1NF5A 1LI6A 1GXXA 2LHMA 1CJ9A 7LYZA 2LYMA 226LA 3AZ5A 1L07A 4B4IA 115LA 163LA 1JITA 1LSNA 221LA 2O4WA 2B72A 1QT8A 1WQQA 4NGKA 1UICA 1HFXA 2HEBA 4IATA 3BKVA 4R6CA 3PDSA 1L59A 3IJUA 4I7NA 1QUSA 3SB6A 104LA 1G1VA 2HEAA 4NGZA 1EQ5A 1CJ7A 1GE4A 3ATOA 1QTHA 1LZGA 4OOTA 4X3BA 1K28A 211LA 1WQMA 4DD7A 4HSFA 3L2XA 1L11A 4H1PA 3C8RA 1ZYTA 1LMNA 4NEBA 257LA 2NWDX 140LA 5HMVA 1LZAA 4I7QA 4OW1A 1NBZC 246LA 1LZBA 4YX7C 2IFFY 1YQVY 4WL7A 1XGRC 4WM4A 2RH1A 1C64A 1DYBA 3AZ4A 3HUAA 3CSZA 1LMAA 3TXIA 1CKHA 4H9CA 1L18A 3D9AC 1LZYA 3W6AA 177LA 4HP0A 209LA 1QSAA 2NTGA 3AW6A 2LYOA 4H92A 1OQMA 2IHLA 5F16A 1I20A 1YL0X 1P6YA 3L64A 3P66A 5LVHA 3WPJA 1C10A 4U3XB 1XGQC 2OU0X 4HJVA 2XJWA 1NHEA 4N8ZA 3K3TA 107LA 4PGJB 1QDTA 1UCOA 1LGXA 4J0LA 2B6XA 3C8SA 4NGJA 1BWJA 4XJGA 5D5CA 4B0DA 4OOOA 2L78A 4LYZA 5APCA 1JTOL 2YSSC 3CDQA 5KXWA 4BAPA 5KKIA 2C8OA 1GPQC 1NMMA 2Z2FA 2DQEY 2BQMA 1C43A 5LVGA 5LZMA 5HQ1A 4FDYA 3HT6A 4GBRB 1UIFA 1C6PA 3FE0A 4N5RA 1L72A 1YKYX 1KIRC 4DAJA 2FBDA 4WM1A 243LA 1GB3A 4LT2A 1LJ4A 5FEKA 1KIPC 1V7TA 4HPIA 4W58A 3C7WA 2I25L 3QNGA 1L24A 1YAQA 4GCCA 1GB8A 1GBYA 1YAPA 5LYMA 1LMCA 1SLYA 4EPIA 3T36A 1B5XA 4C5FA 4LYBA 1ALCA 125LA 4HV1A 1L49A 1LMPA 4NWEA 1QTCA 1IIZA 1JKDA 1MELL 4NIJA 159LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GE0 A;  1GFG A;  1YAN A;  3TXH A;  4LGK A;  4IAS A;  2EKS C;  2MEE A;  5LA5 A;  3J4G A;  3FI7 A;  1Z55 A;  4NHT A;  3D3D A;  4M6D A;  1DKK A;  4GN4 A;  4KXI A;  2LZT A;  1LZ4 A;  2H9J A;  1LSD A;  3ATN A;  2WAR A;  1OUI A;  1LZE A;  3RU5 A;  4WOA A;  4MST A;  4NHP A;  4NGY A;  1UIB A;  1LOZ A;  1IC4 Y;  3AYQ A;  4NHI A;  4DC4 A;  4YF2 A;  1YAM A;  1A2Y C;  1I56 A;  3LZ2 A;  1HHL A;  4WL6 A;  1GBW A;  1LJK A;  3RW8 A;  5KKJ A;  1CJ8 A;  1GDX A;  1GF3 A;  4D9Z A;  1LYY A;  4C3W A;  3P65 A;  1WQP A;  1JIY A;  2AUB A;  4ETE A;  5KXK A;  4YEO A;  1LZ9 A;  4NGI A;  5ILC A;  1B7Q A;  4AGA A;  2CJL A;  4WLD A;  1A4V A;  1REM A;  4DD0 A;  4GCF A;  4NHS A;  1CKC A;  1B5Y A;  2DQC Y;  3TXG A;  4RW2 A;  1YRO A;  5KXX A;  1IOR A;  4TX7 A;  3F6Z A;  1B7R A;  3N9A A;  154L A;  5A3Z A;  2Z37 A;  1W08 A;  4HJY A;  1KXW A;  3ULR A;  5JEN B;  1CKG A;  2Z12 A;  4MR1 A;  4GLA A;  4TWS A;  2FYD A;  2YBH A;  2BQN A;  4B49 A;  1YAO A;  2G4N A;  5KXN A;  2HEE A;  1GB7 A;  2ZIJ A;  4ETB A;  4TTD A;  1GFK A;  4Z98 A;  5KXP A;  4NG8 A;  1GF9 A;  1OUH A;  4YOP A;  5KXZ A;  3B0O A;  1D0L A;  1JUG A;  1B2K A;  2MEC A;  3AJN A;  3AZ7 A;  3CT5 A;  3RNX A;  3TMX A;  5F14 A;  4NSI A;  2BQC A;  1LJE A;  4DD1 A;  4KPM A;  5FCP A;  3WPK A;  2A7F A;  1QIO A;  1LZS A;  1BWH A;  1J1X Y;  1N4F A;  4NG1 A;  4XJD A;  1YKZ X;  3VWO A;  2DBT A;  5C6J A;  5II3 A;  1IP6 A;  1LJ3 A;  4GN5 C;  4DD9 A;  2XBS A;  5B05 A;  1EQE A;  2I6Z A;  4QY9 A;  5LAG A;  2BQB A;  2Y8P A;  3TMV A;  1D0K A;  2BQE A;  2EQL A;  4PPO A;  1LTM A;  2F30 A;  1JJ3 A;  1DKJ A;  5LIN A;  1RFP A;  3HFM Y;  2F2N A;  1WTM A;  4OWE A;  1MLC E;  4XYY A;  1F0W A;  3A6B Y;  1D9U A;  3TMU A;  1IX0 A;  2DQF C;  1D0M A;  4N0J A;  1C45 A;  1I1Z A;  1IC7 Y;  1GAY A;  1B5W A;  1BQL Y;  1WQN A;  4H8Z A;  1HEN A;  1HEQ A;  2H5Z A;  1IWW A;  1GF8 A;  4B1A A;  2HU3 A;  1GBZ A;  3CQL A;  1DZB X;  1EQ4 A;  1C46 A;  4H9A A;  2MEI A;  4ETA A;  3TXK A;  4RLM A;  1B5Z A;  1LZT A;  2I26 L;  1IP5 A;  1D6P A;  1IOS A;  2YBN A;  1LHJ A;  1LSF A;  2DQI Y;  2CGI A;  1VDQ A;  4HTK A;  4HJZ A;  5KXO A;  1TEW A;  3OK0 A;  5DM9 A;  4WM3 A;  4UWN A;  3EMS A;  4RLN A;  3AGG G;  1IVM A;  1B7N A;  1UA6 Y;  4DDB A;  3WUN A;  1JEF A;  1UIH A;  1VAU A;  1LZ5 A;  1B9O A;  1LMO A;  1IOT A;  4PHI A;  4UWU A;  3ZVQ A;  1LZN A;  4CJ2 A;  5I4W A;  5KXM A;  1V7S A;  3TXE A;  2Q0M X;  3HBH A;  3WPL A;  1REX A;  1QTK A;  4WLY A;  1HF4 A;  3CSR A;  4TSB A;  1IWY A;  1IO5 A;  1INU A;  1BVK C;  3IJV A;  2HEF A;  4Z46 A;  1IWV A;  2FBB A;  1HEO A;  5F9X A;  5LVK A;  1GE3 A;  4M4O A;  194L A;  5APE A;  1HSX A;  3LYO A;  1NWG A;  1VDT A;  2W1X A;  1FLQ A;  2YDG A;  1JKC A;  1DI4 A;  1HEW A;  1YL1 X;  1HML A;  1HFY A;  1VED A;  2BPU A;  2D4K A;  4A7D A;  1XEJ A;  5B1G A;  2X0A A;  3T6U A;  5KY1 A;  3ZEK A;  1REZ A;  3A90 A;  4MCK A;  1OUC A;  1LJH A;  1VDS A;  2YBI A;  1RCM A;  4LZT A;  4I8S A;  4CHX A;  1DPW A;  3WH1 A;  2MEF A;  4NSJ A;  1NDG C;  1JPO A;  1XEI A;  1TAY A;  1XSF A;  1E8L A;  4QGZ A;  5FEL A;  2D6B A;  1RE2 A;  2F4A A;  1GAZ A;  1JWR A;  3N9C A;  2BLX A;  2YBM A;  3AGH A;  3CB7 A;  4H8Y A;  4GCE A;  1XGP C;  4L41 A;  4WO9 A;  5FST A;  1PZY A;  4W94 A;  5E4P A;  1HEL A;  3A6C Y;  4I0C A;  3WUM A;  1WTN A;  5C6L A;  1B5U A;  1BWI A;  2DKV A;  3AW7 A;  3LHM A;  4YEN A;  1LJG A;  4G9S A;  1AM7 A;  4TSC A;  207L A;  1LSY A;  1BHZ A;  1IR7 A;  3QE8 A;  4J7V A;  1QDR A;  4TUN A;  1LMQ A;  4BS7 A;  1BB4 A;  3G3B B;  3M18 B;  4DD2 A;  2CWI A;  1UBZ A;  2G4Q A;  3WVX A;  4DYG A;  5L3H A;  3OJP A;  4HV2 A;  1LAA A;  5B59 A;  1GB0 A;  3W3E A;  1UIA A;  1GB5 A;  3N9E A;  4R0F A;  4P2E A;  2ZYC A;  5ILF A;  3CT1 A;  1HNL A;  2W1M A;  1BGI A;  1FBI X;  1GF6 A;  1LYZ A;  4N1E I;  1LZ8 A;  1JIS A;  2D4J A;  1GE1 A;  4WG7 A;  3A8Z A;  3A94 A;  4GLV A;  1G7H C;  3B6L A;  3WUL A;  4QDN A;  1GFA A;  4IJ4 A;  3WUA A;  3WXU A;  2W1L A;  4PRQ A;  2D4I A;  1GHL A;  5A3E A;  5I54 A;  193L A;  3P64 A;  1G7J C;  1FLW A;  4WM6 A;  5LXW A;  2MEB A;  1NBY C;  3A34 A;  5IHG A;  1GXV 2;  1TCY A;  4ETC A;  4G4H A;  4E3U A;  2XBR A;  4XJI A;  1ZVY B;  4LFX A;  3W6C A;  4BAD A;  4LT1 A;  1HC0 A;  3HBD A;  4GCB A;  5HLL A;  1G7L C;  1OUB A;  1FKV A;  4LFP A;  5HMJ A;  5HNC A;  3TXF A;  1IR9 A;  5LIO A;  1GFJ A;  2BAA A;  3J6K A;  3M3U A;  4G4B A;  1AT5 A;  3A95 A;  3EO5 A;  5KXR A;  5I4Y A;  1IOQ A;  2H9K A;  4H9F A;  4XEN A;  3SP3 A;  2Z19 A;  1XFP L;  4OWB A;  2BQL A;  1HSW A;  1XEK A;  1DXJ A;  3P68 A;  1GE2 A;  1CNS A;  5APD A;  1CKD A;  4LYO A;  1FLU A;  1IP4 A;  1IEE A;  1GF4 A;  2BQD A;  1AT6 A;  3AB6 A;  4HTN A;  1OP9 B;  4H8X A;  1IY3 A;  3W6B A;  2BQF A;  1GBS A;  1NF5 A;  1C7P A;  3WMK A;  5C6I A;  1GXX A;  1IY4 A;  1NKH A;  1LHM A;  2LHM A;  3WXT A;  4H9B A;  1CJ9 A;  2MEA A;  4NFV A;  1GF7 A;  2D91 A;  1LKS A;  7LYZ A;  1BB7 A;  2C8P A;  2LYM A;  3IWR A;  2Z2E A;  2EIZ C;  1IWT A;  4H90 A;  3AZ5 A;  4B4I A;  1LZD A;  153L A;  5APF A;  3WW6 A;  1ZVH L;  4WO6 A;  1JIT A;  1LSN A;  2BQH A;  1BB3 A;  2LYZ A;  3A91 A;  1J1O Y;  132L A;  3TXD A;  1VAT A;  1GEV A;  1RI8 B;  2ZIK A;  1LJN A;  1LJJ A;  1QSW A;  2HED A;  1WVU A;  1WQQ A;  2BQO A;  4NGK A;  1YIK A;  5I4X A;  5B1F A;  1UIC A;  2MED A;  1GF0 A;  1HER A;  4RDS A;  1DI5 A;  1HFX A;  1IWZ A;  4DT3 A;  1KXX A;  2HEB A;  1LKR A;  1T3P A;  2YBJ A;  4IAT A;  4NWH A;  3BKV A;  4R6C A;  2HEC A;  1LZ1 A;  3IJU A;  1KIQ C;  1QUS A;  1JHL A;  3W6E A;  5IEL A;  1OUD A;  2HEA A;  4NGZ A;  1B7S A;  4H91 A;  1EQ5 A;  1F10 A;  4KL7 A;  1CJ7 A;  1GE4 A;  3ATO A;  1LSC A;  1LSP A;  1LSZ A;  2W1Y A;  1LZG A;  1ZV5 L;  4OOT A;  4X3B A;  1W6Z A;  3WU8 A;  1WQM A;  1CJ6 A;  2ZNW Y;  4FJR A;  4OWA A;  4DD7 A;  1XGU C;  1UC0 A;  1F6S A;  4HSF A;  1LHI A;  4Z41 A;  4EOF A;  2B5Z A;  3EXD A;  3WYH A;  3WVY A;  2Z38 A;  4H1P A;  4LYC A;  4LT3 A;  3KAM A;  134L A;  1LHL A;  2DQJ Y;  1IP7 A;  5I53 A;  1LMN A;  2A7D A;  4ZFP A;  5KXT A;  1B7L A;  1LSG A;  4WLX A;  4N9R A;  4NEB A;  4W96 A;  2NWD X;  5HMV A;  1JJ1 A;  2BQG A;  3P4Z A;  5EBH A;  1DQJ C;  1LZA A;  4G4C A;  1LJF A;  3A92 A;  4CFO A;  1HEP A;  3A93 A;  3LZT A;  4OW1 A;  1NBZ C;  1JTP L;  1LZB A;  5J7C A;  5DL9 A;  1GFT A;  1IR8 A;  5KJ9 A;  1H6M A;  1UAC Y;  2IFF Y;  1YQV Y;  2BQK A;  2LZ2 A;  2VB1 A;  1HFZ A;  1VDP A;  2Z39 A;  4II8 A;  4WL7 A;  5LAF A;  4B4J A;  4BAF A;  1XGR C;  4ZIX A;  1JKA A;  1WVV A;  1OUE A;  4WM4 A;  4J1A A;  3LYM A;  5B07 A;  1IWX A;  5FDJ A;  3BKH A;  3AZ4 A;  1BB6 A;  3CSZ A;  1LMA A;  3B72 A;  1B0D A;  1LSE A;  2DQH Y;  5I5Q A;  1LHK A;  3A3R X;  3TXI A;  1FLY A;  4OWC A;  2CDS A;  1LJI A;  3QY4 A;  1HEM A;  5T3F A;  1CKH A;  1VFB C;  4H9C A;  4XAD A;  1LZY A;  208L A;  2DQD Y;  1LHH A;  1IP2 A;  3D9A C;  3A3Q A;  3W6D A;  3W6A A;  4HP0 A;  4DD3 A;  1QSA A;  2BLY A;  1F6R A;  1LPI A;  1JSF A;  1LCN A;  4N1C C;  1G7M C;  3AW6 A;  4WMG A;  3RZ4 A;  2HU1 A;  2LYO A;  2ZQ3 A;  5B06 A;  4H92 A;  1OQM A;  4ET8 A;  2IHL A;  4B4E A;  1KXY A;  1LSB A;  1OUG A;  3GXK A;  4RW1 A;  2DQG Y;  4WG1 A;  5F16 A;  5DLA A;  2Z18 A;  5DN5 A;  5F81 A;  2ZQ4 A;  1RJC B;  1GF5 A;  1BVX A;  1I20 A;  1GB6 A;  1IP1 A;  1YL0 X;  4NSG A;  3P66 A;  4LT0 A;  4NY5 A;  3WPJ A;  5L9J A;  4NGL A;  4XJB A;  4DWX A;  5LVH A;  1C10 A;  4U3X B;  4NGW A;  3EBA B;  1WQR A;  4NSH A;  5HNL A;  1XGQ C;  2N5Z A;  2BQI A;  1C08 C;  1FKQ A;  4HJV A;  4ANR A;  2XJW A;  1NHE A;  3WU9 A;  3E3D A;  1PS5 A;  4N8Z A;  4CGE A;  2XTH A;  3K3T A;  4H9I A;  5LVJ A;  3WL2 A;  6LYT A;  2MEG A;  2ZYP A;  3A67 Y;  1IOC A;  4ML7 A;  3CT0 A;  3B0I A;  4PGJ B;  1QDT A;  1UCO A;  1GFH A;  4J0L A;  5E9R A;  1T6V L;  3W6F A;  5DN4 A;  4DDA A;  5D5F A;  4EMN A;  1GFU A;  4G49 A;  4NGJ A;  1REY A;  2GV0 A;  4Z3M A;  1O23 A;  1LZ6 A;  3WU7 A;  1LSA A;  1BWJ A;  1UIE A;  1QUT A;  2HTX A;  4YEM A;  4XJG A;  5D5C A;  4B0D A;  3LN2 A;  4HTQ A;  4WM5 A;  1GDW A;  4OOO A;  4O34 A;  4PJ2 C;  5F9U A;  4LYZ A;  1JKB A;  1GEZ A;  1QQY A;  3TXJ A;  3WW5 A;  5IDD A;  5APC A;  1JTO L;  2YSS C;  4WLT A;  4ET9 A;  1GFR A;  8LYZ A;  1OUF A;  1LZR A;  1FDL Y;  4LYT A;  1XGT C;  1TBY A;  1B7P A;  1B5V A;  3GXR A;  5AMY A;  1TDY A;  4BAP A;  4ZEE A;  5KKI A;  5KXW A;  1IWU A;  2C8O A;  1GPQ C;  1HMK A;  1NMM A;  2Z2F A;  2DQE Y;  2BQM A;  2RSC A;  1LYO A;  1BB5 A;  4UWV A;  1UIG A;  5FHW A;  1B7M A;  2PC2 A;  1CKF A;  1C43 A;  2DQA A;  4HPE A;  3TXB A;  5L3I A;  5LVG A;  4ETD A;  5KXL A;  5HQ1 A;  2EPE A;  3AGI A;  4FDY A;  1GFV A;  3HBE X;  1UIF A;  3FE0 A;  5LA8 A;  1GWD A;  4N5R A;  2FYC A;  4GCD A;  3TMW A;  3LYT A;  1GD6 A;  1NDM C;  4PRU A;  2ZIL A;  1LMT A;  1YKY X;  4LYM A;  1JTT L;  1KIR C;  133L A;  1EL1 A;  1NQI A;  4YM8 A;  2FBD A;  4WM1 A;  1UUZ C;  4XJH A;  1GB3 A;  2HUB A;  1P2C C;  1DI3 A;  4LT2 A;  1D6Q A;  1LJ4 A;  3B0K A;  5FEK A;  1JJ0 A;  1JSE A;  2YVB A;  3LYZ A;  1YIL A;  3A96 A;  3MGW A;  1KIP C;  1V7T A;  1AZF A;  2BQJ A;  1J1P Y;  5LYZ A;  1YKX X;  4HPI A;  1ZMY L;  4NGO A;  4H93 A;  4XN6 A;  9LYZ A;  4NGV A;  1GB9 A;  1GBX A;  1GBO A;  2G4P A;  1OUJ A;  4CFP A;  1QTE A;  2I25 L;  1FN5 A;  1H87 A;  2ZNX Y;  2YBL A;  3QNG A;  2BQA A;  4GN3 A;  1YAQ A;  5M1Y A;  1OUA A;  4GCC A;  2MEH A;  1GB8 A;  1GBY A;  1LSM A;  135L A;  3RT5 X;  3AZ6 A;  1GB2 A;  1LZC A;  1DPX A;  6LYZ A;  1YAP A;  5LYM A;  1LMC A;  1SLY A;  4QEQ A;  2F4G A;  5LVI A;  3T36 A;  1B5X A;  3G3A B;  4NHQ A;  3ZVQ B;  4C5F A;  4LYB A;  1B7O A;  5K7O A;  3CSQ A;  4OWH A;  4KT3 A;  1ALC A;  2ZWB A;  4H94 A;  1IP3 A;  1LYS A;  4AXT A;  5LYT A;  4HV1 A;  1G7I C;  1IC5 Y;  4H9E A;  1UID A;  4H9H A;  1GFE A;  1LMP A;  4NWE A;  1WQO A;  4J1B A;  5KXY A;  5KXS A;  1IIZ A;  1JKD A;  4XJF A;  1AKI A;  1MEL L;  4DDC A;  4NIJ A;  4WM2 A;  1SQ2 L; 
#chains in the Genus database with same CATH topology
 1GE0 A;  1XEP A;  1GFG A;  1QAO A;  1NNJ A;  4LGK A;  1C6E A;  3HJS A;  3QYB A;  1QT4 A;  1L47 A;  2EKS C;  4EKP A;  1L92 A;  3J4G A;  1JR3 E;  1DKK A;  3U6O A;  2L09 A;  4GN4 A;  1LLH A;  1LZ4 A;  1LSD A;  1QTD A;  1OUI A;  2L6O A;  4NGY A;  1UIB A;  1N78 A;  4YF2 A;  2UUA M;  3LZ2 A;  1LJK A;  1NJG A;  4M9X A;  3TWL A;  1CJ8 A;  1GDX A;  1GF3 A;  3KSJ A;  1C6A A;  1LYY A;  2JZ1 A;  4DR4 M;  4NGI A;  3DN1 A;  4QHS A;  123L A;  1B7Q A;  4AGA A;  4LRT A;  1A4V A;  4LFB M;  1CU2 A;  149L A;  3GLF A;  1IM2 A;  4W56 A;  1L09 A;  1L82 A;  5LMN M;  4I5S A;  4TX7 A;  5EXX A;  3JR4 A;  3D8B A;  2GQF A;  3HHZ A;  2J7N A;  3RZE A;  3ULR A;  1N32 M;  5JEN B;  2Z12 A;  3KS4 A;  195L A;  2M60 A;  4MR1 A;  4AQY M;  4CHT B;  4I7J A;  2G4N A;  4FWH A;  5KXN A;  4EJ4 A;  3WHK A;  1GFK A;  4Z98 A;  3UK6 A;  1GF9 A;  1K3X A;  5KXZ A;  4RF1 A;  2MRO B;  4WW0 A;  3TMX A;  1SWY A;  1OAO C;  2BQC A;  1LJE A;  217L A;  3MJ5 A;  3GRY A;  2A7F A;  2JY8 A;  2DI0 A;  5II3 A;  4JV5 M;  2R46 A;  2UXB M;  3DN2 A;  1L63 A;  1MJG M;  244L A;  3TE6 A;  5LAG A;  2BQB A;  2C5R A;  158L A;  1KNI A;  2B7X A;  4PPO A;  1LTM A;  2JY6 B;  1JJ3 A;  1DKJ A;  1VDD A;  1RFP A;  249L A;  5LIN A;  1C6G A;  1MLC E;  250L A;  2D7H A;  1QSQ A;  4LF8 M;  171L A;  4KT0 F;  1IX0 A;  2K47 A;  1GAY A;  1B5W A;  1KYI A;  1L08 A;  1YLA A;  1HEN A;  3UJN A;  1L0K A;  1C6M A;  2R6F A;  1L86 A;  1XXH E;  2B6W A;  2OE7 X;  2HL7 A;  3V2Y A;  102L A;  1LHJ A;  2CGI A;  1X37 A;  160L A;  3GUI A;  4HJZ A;  5KXO A;  5DM9 A;  1DYA A;  1C6T A;  4UWN A;  4RLN A;  1OWY A;  1B7N A;  4IBG A;  2ZM6 M;  3L26 A;  2BJW A;  4UWU A;  1LMO A;  1LZN A;  4B3T M;  2ZTD A;  2Q0M X;  3HBH A;  3WPL A;  1REX A;  1CV4 A;  2IGC A;  2B74 A;  5LVK A;  4B7H A;  4MGK E;  258L A;  3GUP A;  194L A;  3LYO A;  1NWG A;  5E26 A;  1GAB A;  1KW5 A;  1HML A;  1HFY A;  4A7D A;  3T6U A;  164L A;  3ZEK A;  2QBY B;  3THG A;  2L4E A;  1UFZ A;  5GKN A;  1NSF A;  1RCM A;  5IT9 S;  4LZT A;  4CHX A;  220L A;  3WH1 A;  4LJ4 A;  4NSJ A;  2C99 A;  1L77 A;  1TAY A;  3HJ8 A;  1L44 A;  4QGZ A;  1L15 A;  139L A;  1JWR A;  4NL4 H;  1L80 A;  2YBM A;  5KPR A;  4GCE A;  4WO9 A;  4M0W A;  5FST A;  4NOO B;  4I0C A;  1SWZ A;  3LHM A;  4G9S A;  1AM7 A;  4AKH A;  207L A;  4W57 A;  1IR7 A;  1L28 A;  3PNY A;  3AJI B;  4BS7 A;  4DD2 A;  2CWI A;  2G4Q A;  1NJF A;  4B3R M;  4IBE A;  5B59 A;  4YXA C;  2OOB A;  227L A;  2A4T A;  3N9E A;  3HHY A;  4P2E A;  2W1M A;  1BGI A;  1DYF A;  4N1E I;  1LZ8 A;  252L A;  1ZMV A;  2OE4 X;  1L98 A;  3A8Z A;  3AKZ A;  2FNA A;  2XFS A;  1QAN A;  4DV2 M;  1VQ1 A;  193L A;  1L73 A;  1G7J C;  1WHC A;  5IHG A;  1SX2 A;  3ILK A;  1CV1 A;  236L A;  2R18 A;  1C62 A;  5FTK A;  1R4G A;  4LF4 M;  4BAD A;  4JI7 M;  3NY9 A;  1KFV A;  1L51 A;  3GLH A;  1L64 A;  4GCB A;  1G7L C;  4DR5 M;  1L37 A;  5HNC A;  4GC5 A;  1SX7 A;  2D7G A;  5LIO A;  3M0E A;  186L A;  2HKJ A;  3SHG B;  162L A;  3M3U A;  3A95 A;  2WZJ A;  3GRR A;  3SB7 A;  5KXR A;  1IOQ A;  232L A;  3QAK A;  3SP3 A;  5EXT A;  2BQL A;  1LYJ A;  4JYA M;  1NY6 A;  1XEK A;  2LCB A;  1CNS A;  4LYO A;  3CTW B;  1GF4 A;  1OP9 B;  2LBC A;  4QOZ C;  4I7T A;  1NHB A;  1TH4 A;  5C6I A;  1NVM A;  5IWA M;  1I94 M;  1L53 A;  2ERC A;  1GF7 A;  2B70 A;  4FCV A;  1L60 A;  239L A;  2Z2E A;  2EIZ C;  1IWT A;  3HU8 A;  1QT3 A;  1TH3 A;  4LF6 M;  153L A;  1TH2 A;  1ZVH L;  2LYZ A;  2BQH A;  1BB3 A;  1L12 A;  1J1O Y;  2B75 A;  1LYD A;  1VAT A;  1GEV A;  1RI8 B;  5EJC A;  2HED A;  2BJV A;  3FTE A;  1CV0 A;  3LCU A;  1HER A;  4DT3 A;  1KXX A;  1LKR A;  2K0B X;  3VK7 A;  4WP2 A;  1T3P A;  4NWH A;  4LDE A;  2HEC A;  2LNH C;  1HQC A;  1LZ1 A;  3FRI A;  4LJA A;  4GEW A;  5IEL A;  3UZU A;  4HL4 A;  1OYU A;  3FUV A;  1B7S A;  1QUO A;  2W1Y A;  3WU8 A;  3GPP A;  3CDR A;  4OWA A;  3U6P A;  1UC0 A;  2F5S A;  1LHI A;  4Z41 A;  2Z38 A;  4LT3 A;  1GKI A;  3CF2 A;  1LHL A;  2DQJ Y;  5I53 A;  1WGL A;  2A7D A;  4W59 A;  1LSG A;  4WLX A;  2J7O A;  4PDG A;  4N9R A;  2JNH A;  5ITX E;  1IXS A;  1SXJ E;  3P4Z A;  4CFO A;  1JB0 F;  1L67 A;  4AI6 A;  4ZPU A;  3OTO M;  5DL9 A;  1IR8 A;  4BBA A;  1H6M A;  2Y20 A;  3DN3 A;  4L8R C;  4LJ6 A;  2BQK A;  5LAF A;  4B7G A;  1V34 A;  5KPT A;  4KHP M;  1JKA A;  3HTF A;  1OUE A;  3C83 A;  2F5N A;  1CX7 A;  1IWX A;  5FDJ A;  234L A;  1JQU A;  4FW9 A;  4UN2 B;  2R65 A;  1EPY A;  1LHK A;  3A3R X;  4K0K M;  2Q9D A;  1FLY A;  3LCV B;  3A46 A;  1C66 A;  3HJQ A;  4LFC M;  208L A;  2DQD Y;  3W6D A;  1IP2 A;  112L A;  1D3M A;  2LC9 A;  4DD3 A;  1IN6 A;  2DZL A;  2XZF A;  1F6R A;  5FTL A;  3VKH A;  1IXZ A;  1L70 A;  122L A;  3OE0 A;  4PCZ A;  3RZ4 A;  4RKU F;  2QSF X;  2HU1 A;  2ZQ3 A;  5B06 A;  1R6B X;  2DAI A;  4B4E A;  1L84 A;  3BBZ A;  3GXK A;  2DQG Y;  4WG1 A;  5DN5 A;  2Z18 A;  5F81 A;  1C63 A;  2ZQ4 A;  1Y8G A;  4D80 A;  5EP4 A;  3G3W A;  1GF5 A;  3JR6 A;  1BVX A;  1GB6 A;  1IP1 A;  4NY5 A;  2RGO A;  2HCB A;  4LT0 A;  5L9J A;  111L A;  3HDE A;  230L A;  199L A;  3AOG A;  4ANR A;  3WU9 A;  1OIZ A;  4CGE A;  1L74 A;  3A67 Y;  2EUC A;  3GLF B;  4ML7 A;  4DQJ A;  143L A;  1GFH A;  3C9P A;  5E9R A;  2RAZ X;  1L0J A;  3QAU A;  210L A;  1GFU A;  2HUK A;  1REY A;  181L A;  3SN6 R;  1O23 A;  1G0L A;  1UIE A;  4DV6 M;  1QUT A;  4I8O A;  1DYG A;  4HTQ A;  4IAP A;  1C60 A;  4WM5 A;  1GDW A;  1CV5 A;  4PJ2 C;  2K6B A;  1JKB A;  1GEZ A;  4MB7 A;  4ET9 A;  1GFR A;  4LJ9 A;  4AZF A;  3IHP A;  3KVW A;  3GPY A;  1L30 A;  2QP9 X;  3FE3 A;  1B7P A;  4ZEE A;  2UXD M;  4I4L A;  3D4S A;  4M9Z A;  1L26 A;  1HMK A;  114L A;  1LYO A;  2PC2 A;  2DQA A;  1QUD A;  4OX9 M;  4BB9 A;  2CP8 A;  1QAM A;  3HT9 A;  4ETD A;  5KXL A;  1GFV A;  5LA8 A;  1ZQ9 A;  1L05 A;  1QAQ A;  1GD6 A;  3GQ4 A;  3DZD A;  1L39 A;  4S0W A;  2ZIL A;  4LYM A;  1E32 A;  1EL1 A;  3FUW A;  2X4A A;  1UUZ C;  2HUB A;  4XJH A;  4NRV A;  260L A;  1D6Q A;  1L13 A;  1L17 A;  3A98 B;  1JSE A;  3SBB C;  2YVB A;  1IBL M;  3LYZ A;  1YIL A;  1T8F A;  4LGM A;  1N77 A;  1DYC A;  1AZF A;  2X8A A;  4ARL A;  2BQJ A;  3GLI A;  4G4O A;  1L55 A;  1YKX X;  5LYZ A;  1ZMY L;  4NGO A;  3AL0 C;  4H93 A;  9LYZ A;  4CFP A;  1OUJ A;  2F5Q A;  1H87 A;  2ZNX Y;  5ITY A;  5M1Y A;  1XJT A;  228L A;  3SB9 A;  1GB2 A;  2DAM A;  1DPX A;  4QEQ A;  5LVI A;  1J09 A;  3I04 M;  152L A;  2ZWB A;  1IP3 A;  1LYS A;  4IBI A;  1D2Y A;  3AV0 A;  4H9E A;  1C7Y A;  187L A;  1AKI A;  3ZQJ A;  1PQD A;  2Z3X A;  2UUC M;  3C82 A;  1YUB A;  2JA2 A;  3SBJ A;  1Q3C A;  3D3D A;  3PFI A;  2H9J A;  2OU8 A;  1D3N A;  1N34 M;  1BVS A;  2WAR A;  4CIS A;  3RFW A;  3H4M A;  4NHP A;  1LOZ A;  4NHI A;  1ZWN A;  4DC4 A;  2KRU A;  1YAM A;  4LY6 A;  1GBW A;  215L A;  5KKJ A;  1OVH A;  1IY1 A;  3SAW A;  4QHT A;  4D9Z A;  242L A;  1LZ9 A;  2XEP A;  3JAM S;  1REM A;  4GCF A;  1TDZ A;  1QT6 A;  1P7S A;  4I7M A;  2XZU A;  4PJZ A;  1YRO A;  2O25 A;  1LYF A;  225L A;  1VEK A;  3F6Z A;  3DOA A;  3HWL A;  2V6Z M;  4OW0 A;  1W08 A;  4HJY A;  1KXW A;  3NBX X;  4RF0 A;  2BWB A;  4TWS A;  2YBH A;  1C6H A;  2UU9 M;  4ARM A;  3FAD A;  5FTN A;  1NHW C;  2CWB A;  4CJ6 A;  1B2K A;  3AJN A;  2MJ5 B;  3K1J A;  1N36 M;  4NSI A;  4DD1 A;  1G0Q A;  4IBB A;  3TWM A;  4XJD A;  5C6J A;  2B3T A;  1J1X Y;  1N4F A;  1IP6 A;  1LJ3 A;  3U6E A;  3NYA A;  1L2B A;  1IN4 A;  1LYH A;  4QY9 A;  2Y8P A;  1L90 A;  3V76 A;  1G3I A;  2LVP C;  1LWG A;  2F2N A;  3GLH B;  4OWE A;  1L45 A;  1D9U A;  3TMU A;  3SAU A;  4N0J A;  1D0M A;  3IG5 A;  1PJT A;  4DR2 M;  4W51 A;  1WQN A;  1N75 A;  1HEQ A;  1LGU A;  4W53 A;  1IWW A;  1GF8 A;  2F32 A;  2CE7 A;  3CQL A;  3K2L A;  1DZB X;  146L A;  4JI8 M;  4W52 A;  2KW0 A;  1LYG A;  1PJQ A;  1L06 A;  1OTR A;  1VDQ A;  1LW9 A;  1TEW A;  3OK0 A;  3NY8 A;  1CX6 A;  2FFJ A;  3U6S A;  3C8Q A;  3KOW E;  4DDB A;  3WUN A;  1JEF A;  1XMQ M;  1UIH A;  3ZVQ A;  4GIP A;  3HUQ A;  3FKE A;  1G1W A;  1D2W A;  3HU2 A;  2CUZ A;  1WIV A;  3U60 A;  110L A;  1IWY A;  3IJV A;  1HEO A;  1D2N A;  2RBR A;  3AOE A;  1XHB A;  1HSX A;  251L A;  1VDT A;  2YDG A;  4I7R A;  3WW5 A;  1JKC A;  1DI4 A;  2D4K A;  3CDO A;  5KY1 A;  3DMV A;  1T8G A;  2DKL A;  3A90 A;  1Z5B A;  5A2Q S;  206L A;  4QOS A;  4MGY E;  2YBI A;  1L88 A;  3GUJ A;  4I7L A;  5KPZ A;  2H1R A;  224L A;  4DBG B;  1NDG C;  1XEI A;  1RE2 A;  3AGH A;  3B89 A;  4W94 A;  2ZTC A;  1B5U A;  2DKV A;  2MR9 A;  4TSC A;  4DR7 M;  1GL7 A;  3M18 B;  1L99 A;  1UBZ A;  1IXS B;  5L3H A;  4PK0 A;  1GB0 A;  7CAT A;  1GB5 A;  2Z4R A;  2LTU A;  3GUM A;  1ZV1 A;  1GL6 A;  5EQT A;  2ZYC A;  5ILF A;  4JN6 A;  1GF6 A;  2APL A;  1LYZ A;  1IBM M;  1KY0 A;  2D4J A;  2HHH M;  3F92 A;  4A3V B;  3CF0 A;  3LW5 F;  237L A;  1L22 A;  1NNU C;  1R2Y A;  2V1C A;  1GFA A;  1L00 A;  2W1L A;  3TWK A;  1L52 A;  4PRQ A;  1PRB A;  2O79 A;  4IJF A;  1A5T A;  4W54 A;  150L A;  3P64 A;  4WM6 A;  1OFI A;  1IN7 A;  2XF3 A;  1G0J A;  4R71 A;  3A34 A;  2LHC A;  5ITU A;  1OWZ A;  1PQM A;  2XBR A;  5LMU M;  4XJI A;  3W6C A;  1HC0 A;  1W5S A;  1Q39 A;  1C6F A;  4F1I A;  229L A;  5HMJ A;  2F5P A;  1TLA A;  1L16 A;  4CIZ A;  2BAA A;  4JI1 M;  4G4B A;  1P3Q Q;  2H9K A;  128L A;  3VDP A;  1L04 A;  4XEN A;  1HSW A;  1DXJ A;  3P68 A;  2DEN A;  1IP4 A;  4GH9 A;  1IEE A;  1XWI A;  3AB6 A;  1IY3 A;  2BQF A;  3WMK A;  1T3T A;  4R3D A;  2UXC M;  1DO2 A;  1NKH A;  2DZO B;  2KDL A;  4H9B A;  3SC3 A;  2MEA A;  3WXT A;  2D91 A;  1L85 A;  1LKS A;  1BB7 A;  5H37 D;  4H90 A;  2QEN A;  4WO6 A;  1XMO M;  3KXE C;  3FA0 A;  3FUT A;  3A91 A;  2ZIK A;  2MGW A;  3SB5 A;  1LJJ A;  4L16 A;  2XH9 A;  4RNA A;  1QSW A;  1WVU A;  5DNY A;  5B1F A;  4LJ8 A;  1GF0 A;  4RDS A;  4IBF A;  2OO9 A;  1IWZ A;  4DV4 M;  1HT1 E;  2YBJ A;  3DMZ A;  1P3N A;  1KS3 A;  1KIQ C;  1JHL A;  3W6E A;  1OUD A;  3M6A A;  2B6Z A;  4IJE A;  1T97 A;  3I01 M;  3HDF A;  2QZ4 A;  190L A;  5JI3 E;  1LSP A;  1DGB A;  1ZV5 L;  3EML A;  2ZNW Y;  2Z7J A;  1CV3 A;  4ITQ A;  1F6S A;  155L A;  1PJJ A;  2B5Z A;  3DN0 A;  3WVY A;  3KAM A;  3GLH E;  134L A;  1IP7 A;  245L A;  4ZFP A;  5KXT A;  1P56 A;  3GLI B;  4W96 A;  1L8Q A;  4YXC A;  1OKS A;  1G4A E;  1DQJ C;  4G4C A;  1LJF A;  2CHQ A;  240L A;  3OE9 A;  1IN8 A;  2M5Z A;  4DV5 M;  1JTP L;  1GFT A;  4GRI A;  3B7Q A;  5C1B A;  2CV2 A;  5KJ9 A;  1UAC Y;  2CV1 A;  4II8 A;  1SXJ D;  1VDP A;  2Z39 A;  4B4J A;  4BAF A;  1WVV A;  2NQ8 C;  5B07 A;  126L A;  1CUQ A;  1BB6 A;  1LSE A;  2DQH Y;  4OWC A;  5IZ7 D;  1XNQ M;  170L A;  1LJI A;  1L42 A;  4XAD A;  4GC9 A;  3A3Q A;  1XXH A;  2BLY A;  184L A;  1LCN A;  4N1C C;  3U6M A;  2Z4S A;  3HU1 A;  1G7M C;  2CEA A;  3B9P A;  1J7K A;  2DWN A;  4FCW A;  4ET8 A;  1OUG A;  1WXQ A;  4RW1 A;  3BOS A;  3ZC7 B;  5DLA A;  1RJC B;  4XK8 F;  2CV0 A;  4NSG A;  4NGL A;  3I51 A;  2I7N A;  1TR8 A;  4MGI E;  5HNL A;  1CU3 A;  1L62 A;  1ZUR A;  4GHA A;  1DV0 A;  2CHV A;  1DO0 A;  1FKQ A;  4JI6 M;  3J7A S;  2BQI A;  4NXM M;  4MM3 B;  1QT5 A;  3HZJ A;  3E3D A;  5EXP A;  3ODU A;  1CU6 A;  2ZYP A;  1IOC A;  3B0I A;  4EPF A;  1N33 M;  176L A;  141L A;  2XSZ D;  3A42 A;  1TGU A;  4DDA A;  5D5F A;  4Z3M A;  3WU7 A;  1LSA A;  4YEM A;  5C18 A;  4EKR A;  1EIJ A;  4ARM B;  1KW7 A;  3TXJ A;  3HH5 A;  3DA1 A;  5FTJ A;  4WLT A;  3SBA A;  1L48 A;  8LYZ A;  2C9C A;  5L8R F;  4P16 A;  1OUF A;  1LZR A;  1FDL Y;  4LYT A;  1XGT C;  1B5V A;  1D3J A;  1TDY A;  222L A;  1IWU A;  2D7E A;  1L43 A;  3HH6 A;  4G6Z A;  1G06 A;  5F3W A;  1BB5 A;  3F8V A;  4HPE A;  1CKF A;  1L75 A;  5L3I A;  3KP1 E;  1CU5 A;  2OTZ X;  5JI2 E;  166L A;  2EPE A;  2NTH A;  1CVK A;  3HBE X;  1L1Z A;  1GWD A;  3TMW A;  4GCD A;  1T43 A;  2KRK A;  1V33 A;  2KNZ A;  1QTV A;  4PRU A;  4L78 A;  1LMT A;  3J2P B;  4AG6 A;  1JTT L;  3SMP A;  261L A;  3E9S A;  1NQI A;  2ANV A;  4NC6 A;  4ARQ B;  1DI3 A;  1L81 A;  2EA0 A;  3GUN A;  3VFD A;  196L A;  3MGW A;  1Z6T A;  3R8F A;  1L21 A;  1AUA A;  1SSW A;  2FS1 A;  4B3M M;  1GBX A;  3T15 A;  3FUX A;  1GBO A;  1QTE A;  1L2C A;  4QNM A;  4JI4 M;  1F4I A;  2YBL A;  3K92 A;  4GN3 A;  2MEH A;  3RT5 X;  3AZ6 A;  1L19 A;  1LZC A;  1P2R A;  4B3S M;  2FE8 A;  2F4G A;  2B6T A;  3G3A B;  1FNN A;  4NHQ A;  3ZVQ B;  4OWH A;  2GNO A;  2VF7 A;  5LYT A;  3HUK A;  2KEB A;  192L A;  1G7I C;  1IC5 Y;  3IEC A;  3KSX A;  3U60 B;  1C6B A;  1L57 A;  4H9H A;  1C1K A;  1C6K A;  4J1B A;  1IY2 A;  5KXS A;  4XJF A;  2OTY X;  3J80 S;  2L4F A;  4WM2 A;  1SQ2 L;  253L A;  1LYI A;  1L02 A;  165L A;  3W67 A;  1YAN A;  3FUU A;  2RBN A;  2EO2 A;  5EP2 A;  1D9W A;  1Z55 A;  1C6N A;  1B6I A;  2Y0Q A;  1P37 A;  2LVO C;  2LZT A;  1JTM A;  1LZE A;  4WOA A;  3GO8 A;  2FOI C;  2RBQ A;  197L A;  2DNA A;  1IC4 Y;  4LJ5 A;  4AG5 A;  185L A;  1A2Y C;  1I56 A;  1HHL A;  2Z6B A;  3RW8 A;  1E9S A;  1GJT A;  4C3W A;  1JIY A;  2AUB A;  4ETE A;  1XJU A;  4YEO A;  5KXK A;  5ILC A;  3NWL A;  1LGW A;  1IFY A;  1PQJ A;  2CJL A;  4WLD A;  1KSF X;  2UUB M;  256L A;  4NHS A;  3L2A A;  2DQC Y;  3TXG A;  2JUJ A;  4RW2 A;  1C6L A;  5KXX A;  4AKI A;  1L41 A;  1C6C A;  3N9A A;  154L A;  4DV3 M;  5A3Z A;  1L71 A;  3GLG B;  2BQN A;  4B49 A;  1YAO A;  4X64 M;  2HEE A;  1GB7 A;  1LI3 A;  1OUH A;  4YOP A;  1D0L A;  2OQ4 A;  1JUG A;  2MEC A;  3AZ7 A;  1LPY A;  3CT5 A;  1ZMW A;  1NO1 A;  4LDL A;  3WPK A;  118L A;  1QIO A;  4NG1 A;  2KNA A;  137L A;  4DD9 A;  3LMM A;  2XBS A;  5B05 A;  1EQE A;  2I6Z A;  5ITX A;  2ZAN A;  5BPV A;  1QVR A;  1L29 A;  3TMV A;  1SXJ A;  3VLF B;  1HJP A;  2A5Y B;  2F30 A;  212L A;  3VW7 A;  1Z5C A;  4XYY A;  1F0W A;  3I4Y A;  173L A;  3A6B Y;  3GQ5 A;  2RB0 X;  1G41 A;  1C45 A;  2BWE A;  1I1Z A;  4XBO A;  1BQL Y;  182L A;  109L A;  4QNR A;  4H8Z A;  2ANX A;  3DMX A;  1I4W A;  4B1A A;  2HU3 A;  1EQ4 A;  1HNZ M;  1C46 A;  3HH4 A;  4G3O A;  2F5O A;  3C7Z A;  4H9A A;  2MEI A;  4ETA A;  3TXK A;  4RLM A;  1LZT A;  2I26 L;  1IP5 A;  1D6P A;  2L2D A;  1IOS A;  2DQI Y;  1OJL A;  4HTK A;  2RB2 X;  2C98 A;  3MK6 A;  2DAG A;  3HT8 A;  3EMS A;  4L15 A;  1IVM A;  1UA6 Y;  3DNA A;  191L A;  1DGF A;  1VAU A;  5KXM A;  4KLN A;  1V7S A;  3TXE A;  3KOY E;  2VDB B;  1QTK A;  1C6I A;  4TSB A;  1BVK C;  2F2Q A;  4I7K A;  1IWV A;  4Z46 A;  5F9X A;  127L A;  1GE3 A;  1L83 A;  3E4R A;  2DZN B;  4M4O A;  4FJR A;  2W1X A;  4TTD A;  1HEW A;  1YL1 X;  1VED A;  2BPU A;  5B1G A;  3A45 A;  4ARP A;  1KY1 A;  145L A;  1YE9 A;  216L A;  5I14 A;  1VDS A;  1PQO A;  4X66 M;  4HLQ A;  2RBO A;  3FYC A;  2MEF A;  1L89 A;  4DV0 M;  1JPO A;  1XSF A;  5FEL A;  2F4A A;  1GAZ A;  3N9C A;  4L41 A;  1E9R A;  3HX3 A;  2G3Q A;  5E4P A;  4S12 A;  1C6J A;  1DYE A;  1H6U A;  3WUM A;  1WTN A;  4GRV A;  1W5T A;  3AW7 A;  2EKK A;  1L34 A;  4LDO A;  1MN3 A;  1LSY A;  3C80 A;  3QE8 A;  4J7V A;  1CUK A;  1QDR A;  2G5G X;  3G3B B;  2RBP A;  1JR3 D;  5KQ8 A;  198L A;  3OJP A;  1QZE A;  1UIA A;  3KP0 E;  1HNL A;  1FBI X;  1L10 A;  1JIS A;  2WSE F;  3K2R A;  1GE1 A;  1QQW A;  5HQ1 A;  4Y28 F;  4WG7 A;  4LZZ A;  4ZPX A;  2R44 A;  2ZAO A;  3KW6 A;  1G7H C;  3B6L A;  3WUL A;  1VDL A;  2KZS A;  3HH3 A;  3WUA A;  1LI2 A;  1GHL A;  5A3E A;  4MH0 E;  4Z6Y A;  4D82 A;  1L01 A;  235L A;  3DN4 A;  5LXW A;  1L93 A;  3AOE C;  2MEB A;  1L25 A;  4LFA M;  1XXH B;  1TCY A;  3K8Z A;  3UGJ A;  1IXR C;  2R62 A;  2V1U A;  4G4H A;  3B7Z A;  3DN8 A;  1ZVY B;  4LFX A;  4OU7 A;  259L A;  1G0P A;  1L91 A;  231L A;  214L A;  3RE8 A;  1FKV A;  1V92 A;  4D81 A;  1L61 A;  4LFP A;  3TXF A;  3K9P A;  1C68 A;  3J6K A;  3UMM A;  1L46 A;  1E94 E;  2RBS A;  4H9F A;  2Z19 A;  4PD2 A;  2HWJ A;  1DGH A;  3I4V A;  1J5E M;  120L A;  1Q02 A;  3LVV A;  1GE2 A;  4IIW A;  172L A;  1QUG A;  1CKD A;  2RB1 X;  1AT6 A;  4HTN A;  4I7S A;  3W6B A;  4K5Y A;  4ARQ A;  201L A;  1GBS A;  1HNW M;  1C7P A;  1IY4 A;  1L94 A;  3PNV A;  1LHM A;  7LZM A;  1JQJ C;  1MX0 A;  1SSY A;  1FJG M;  4NFV A;  1I6S A;  3KOX E;  2C8P A;  4PT5 A;  3IWR A;  4I7O A;  2F47 A;  4DV7 M;  1LZD A;  5APF A;  3WW6 A;  4EIW A;  4JI3 M;  1L23 A;  132L A;  2Y21 A;  3TXD A;  1LJN A;  3OE6 A;  1QUH A;  2BQO A;  5I4X A;  1YIK A;  113L A;  2MED A;  180L A;  3GLF E;  1L95 A;  3CDV A;  1L40 A;  1DI5 A;  3W0F A;  1G07 A;  3R9X B;  1QTB A;  1EE8 A;  3PBL A;  3T38 A;  4H91 A;  1F10 A;  3CF6 E;  4KL7 A;  2YFQ A;  4ARJ A;  4G4N A;  1PM5 A;  2R4J A;  1LSC A;  2QAR C;  1LSZ A;  1W6Z A;  1CJ6 A;  3B74 A;  4DUZ M;  1XGU C;  2Q9E A;  1T6H A;  247L A;  4EOF A;  1HQY E;  3EXD A;  3WYH A;  4LYC A;  218L A;  4GMQ A;  2VQF M;  1B7L A;  1C67 A;  2X49 A;  167L A;  1ZMU A;  223L A;  1OV7 A;  1L27 A;  2QCU A;  4DJH A;  1T8A A;  1JJ1 A;  3G3V A;  4MGH A;  2BQG A;  5EBH A;  1PQI A;  3A92 A;  168L A;  1HEP A;  205L A;  3A93 A;  3LZT A;  3SB8 A;  233L A;  5J7C A;  4XGI A;  4DR3 M;  2JY7 A;  2VII A;  4EKS A;  6LZM A;  1L66 A;  2DHR A;  3H4J A;  2LZ2 A;  2VB1 A;  1HFZ A;  2CUU A;  131L A;  4ZIX A;  4F2L A;  3LQR A;  4J1A A;  3LYM A;  3HTB A;  103L A;  3BKH A;  4E97 A;  3B72 A;  1B0D A;  213L A;  5I5Q A;  2K9D A;  1HT2 E;  2CDS A;  1L69 A;  4EKQ A;  3GLG A;  3QY4 A;  1HEM A;  5T3F A;  1VFB C;  1LHH A;  4WUR A;  1CUP A;  148L E;  4L4U A;  1LPI A;  1JSF A;  1OV5 A;  4IBD A;  175L A;  3FYD A;  4WMG A;  200L A;  142L A;  1KXY A;  1LSB A;  1L96 A;  4DR1 M;  4REZ A;  156L A;  3BXW A;  4W5W A;  5DYG A;  3T6P A;  2O01 F;  4PDI A;  2DHY A;  2H5X A;  4XJB A;  1QS9 A;  4DWX A;  1G8P A;  4NGW A;  3MHV C;  1WQR A;  3EBA B;  3G3X A;  4NSH A;  4Z8X A;  248L A;  2N5Z A;  1C08 C;  3PXG A;  3C7Y A;  2YR0 A;  1PS5 A;  2XTH A;  4H9I A;  5LVJ A;  4AKG A;  3WL2 A;  6LYT A;  2MEG A;  4IBC A;  3CT0 A;  4Q7J A;  1C6D A;  4W55 A;  3DKE X;  1T6V L;  3W6F A;  5DN4 A;  4EMN A;  4G49 A;  2GV0 A;  4JI5 M;  3SHF A;  1L50 A;  3SAR A;  1LZ6 A;  2HTX A;  4CGY B;  4NSO B;  2B6Y A;  4GIT A;  3TQS A;  3LN2 A;  4O34 A;  5F9U A;  1EFU B;  1QQY A;  5ITR A;  3KDS E;  5IDD A;  4LZM A;  1IQP A;  3J81 S;  1JR3 A;  219L A;  4G4R A;  2O5R A;  3Q8X A;  1TBY A;  2OEA X;  4FD2 A;  3GXR A;  5AMY A;  1L35 A;  3SYL A;  1Q3B A;  2HUL A;  1CV6 A;  1PQK A;  2CRU A;  3W68 A;  2RSC A;  188L A;  178L A;  1QSB A;  4UWV A;  1UIG A;  5FHW A;  1B7M A;  4HEO A;  3TXB A;  3E21 A;  1SXJ B;  2WSC F;  3AGI A;  3DFZ A;  1C6Q A;  2FYC A;  2LVA A;  3LYT A;  1NDM C;  133L A;  2E5L M;  4YM8 A;  3GUL A;  1P2C C;  3F9L A;  3B0K A;  1JJ0 A;  1P64 A;  1HR0 M;  1S3S A;  3A96 A;  3HU3 A;  4LGY A;  1L56 A;  3DN6 A;  1LWK A;  1J1P Y;  1DYD A;  3AFH A;  238L A;  4XN6 A;  4NGV A;  1GB9 A;  5EXS A;  2G4P A;  1FN5 A;  1WTH A;  2BQA A;  1OUA A;  1LSM A;  135L A;  6LYZ A;  1OQY A;  5K7O A;  4M0D A;  1B7O A;  3VDU A;  2KZU A;  3CSQ A;  4DQ5 A;  4KT3 A;  4M9S A;  1TF0 B;  1D3F A;  4I81 A;  3GUK A;  254L A;  255L A;  4H94 A;  4AXT A;  3SYK A;  4FWG A;  1QS5 A;  3VKG A;  1UID A;  1GFE A;  1WQO A;  5KXY A;  3ZCB B;  2B73 A;  189L A;  4DDC A;  1IBK M;  1L03 A;  3TXH A;  5KQD A;  4IAS A;  2MEE A;  5LA5 A;  3FI7 A;  5E6J A;  1L79 A;  4NHT A;  1L31 A;  4P17 A;  4KXI A;  2DXI A;  3ATN A;  1P46 A;  1XNR M;  1YSY A;  3RU5 A;  1P36 A;  4MST A;  2EJS A;  1G59 A;  3AYQ A;  4LZJ A;  3U5Z A;  4WL6 A;  1QT7 A;  4I7P A;  2RAY X;  2WSF F;  1ORY B;  3P65 A;  1WQP A;  3L28 A;  2LWX A;  4DD0 A;  1CKC A;  1B5Y A;  1R7R A;  3U61 A;  2JZ0 A;  3V2W A;  1JTN A;  4NSR A;  1IOR A;  2QB0 B;  1B7R A;  2OE9 X;  1L14 A;  2Z37 A;  1R2Z A;  2XLJ A;  1CKG A;  4GLA A;  2FYD A;  2VF8 A;  4NXN M;  2ZIJ A;  3JR5 A;  4ETB A;  5FLX S;  5KXP A;  4NG8 A;  2J5Y A;  3B0O A;  3RNX A;  5F14 A;  3EIH A;  4LG2 A;  1CTW A;  5FCP A;  1G0M A;  4KPM A;  169L A;  3VWO A;  1LZS A;  1BWH A;  119L A;  3HKP A;  3FTC A;  1YKZ X;  2C96 A;  2DBT A;  2KA6 B;  2OU9 A;  4OO9 A;  4GN5 C;  3D8L A;  3HTD A;  2ZBK B;  4G4Q A;  2ZAM A;  3SAS A;  3CDT A;  3LZM A;  1D0K A;  5KO3 A;  2BQE A;  2EQL A;  2P5T A;  241L A;  3FI5 A;  3HFM Y;  4X65 M;  4X62 M;  161L A;  1WTM A;  2QPA A;  2R45 A;  3B7N A;  2DQF C;  4LF7 M;  3C58 A;  1IC7 Y;  1L87 A;  2LZM A;  2FH0 A;  1CU0 A;  1G0G A;  8CAT A;  1G0K A;  2H5Z A;  183L A;  4AW4 A;  1GBZ A;  3HHX A;  3C81 A;  174L A;  1DGH B;  4AQN A;  129L A;  157L A;  1L33 A;  4DUY M;  3FTD A;  1B5Z A;  4DV1 M;  3KFU G;  2I7P A;  2YBN A;  1LSF A;  1L32 A;  1PGY A;  4BLC A;  4IBK A;  4KO8 A;  4WM3 A;  4DKL A;  1L97 A;  4OVZ A;  1TDH A;  3AGG G;  3UON A;  4LRS A;  2JWS A;  3J27 B;  1C65 A;  1LZ5 A;  1OIP A;  4JI2 M;  1B9O A;  1IOT A;  4PHI A;  4CJ2 A;  5I4W A;  2KNV A;  4WLY A;  1HF4 A;  3CSR A;  1IO5 A;  1INU A;  3PVS A;  2HEF A;  2FBB A;  1L58 A;  1L76 A;  5APE A;  4M6D A;  2QHO B;  1VEJ A;  1FLQ A;  3SMS A;  1XEJ A;  2X0A A;  3T1Y M;  1REZ A;  3RGS A;  108L A;  4MCK A;  1OUC A;  1LJH A;  4FCT A;  4I8S A;  2QNJ A;  4LJ7 A;  1DPW A;  1SXJ C;  1L38 A;  1E8L A;  2DAK A;  2D6B A;  2BLX A;  3CB7 A;  4H8Y A;  5IRE B;  1XGP C;  3GRV A;  1PZY A;  2N35 A;  1Z5A A;  3U6D A;  1HEL A;  3A6C Y;  2VQE M;  1P2L A;  144L A;  1L54 A;  5C6L A;  1BWI A;  1P5C A;  4YEN A;  4EXM A;  1LJG A;  2JY5 A;  1BHZ A;  3HT7 A;  4L6V 6;  4TUN A;  1LMQ A;  1BB4 A;  3WHL A;  3WVX A;  4DYG A;  4HV2 A;  1LAA A;  3W3E A;  2LXE A;  3GUO A;  3OE8 A;  2XFT A;  2HUM A;  4R0F A;  4II7 A;  3CT1 A;  2DAE A;  2XQO A;  1L36 A;  1HNX M;  3QWL A;  2Y0T A;  3A94 A;  4GLV A;  2KHH A;  4QDN A;  3HHW A;  1L65 A;  3HU9 A;  4IJ4 A;  3WXU A;  2D4I A;  3GLI E;  5I54 A;  3EIE A;  1Z59 A;  1FLW A;  1L20 A;  138L A;  1WJ7 A;  1NBY C;  3J7B A;  5EP3 A;  1GXV 2;  2CFO A;  4ETC A;  2RRU A;  3HTG A;  4E3U A;  1L68 A;  3GPU A;  1LYE A;  1NHG C;  4LT1 A;  2KXE A;  3HBD A;  1PJI A;  5HLL A;  1OUB A;  3L27 A;  2F4V M;  262L A;  2O7A A;  1IR9 A;  147L A;  1GFJ A;  4DQ7 A;  3RUN A;  151L A;  1AT5 A;  3EO5 A;  1QZM A;  5I4Y A;  1TTE A;  2EKF A;  1VEG A;  3CGW A;  1XFP L;  4OWB A;  1C61 A;  1QTZ A;  1WGN A;  1OAI A;  1OVJ A;  1OVK A;  5APD A;  1FLU A;  1C69 A;  2BQD A;  130L A;  4H8X A;  1NF5 A;  5ITQ A;  1LI6 A;  1GLN A;  1GXX A;  2JXN A;  3LQQ A;  2L7H A;  2LHM A;  4LF9 M;  1CJ9 A;  3IG8 A;  7LYZ A;  1T6O A;  2LYM A;  226L A;  3AZ5 A;  1L07 A;  4B4I A;  115L A;  1MU5 A;  163L A;  3KS8 A;  3GP1 A;  1JIT A;  1LSN A;  221L A;  3HGI A;  2O4W A;  2B72 A;  1XB2 B;  3RGP A;  1QT8 A;  1WQQ A;  4NGK A;  3E46 A;  1UIC A;  3SFZ A;  4GKK M;  1HFX A;  2HEB A;  1R5L A;  4IAT A;  3BKV A;  4R6C A;  3PDS A;  2QBY A;  1L59 A;  3IJU A;  4I7N A;  1QUS A;  3SB6 A;  4LF5 M;  104L A;  1G1V A;  2RKO A;  2HEA A;  2DWM A;  3TPZ A;  2OPF A;  4NGZ A;  1EQ5 A;  1IN5 A;  5DYI A;  5ITT A;  1CJ7 A;  1GVN A;  1GE4 A;  1OFH A;  1L2D A;  4FWD A;  3ATO A;  1QTH A;  1LZG A;  2XSZ A;  3U6Q A;  4OOT A;  4X3B A;  1K28 A;  211L A;  1WQM A;  4DD7 A;  1NV8 A;  4YHH M;  1DGG A;  3KOZ E;  4HSF A;  3L2X A;  1RU3 A;  1L11 A;  4H1P A;  3C8R A;  1ZYT A;  1LMN A;  2Z8Y M;  1WR1 B;  3TL4 X;  4NEB A;  4DR6 M;  257L A;  2NWD X;  140L A;  5HMV A;  3L29 A;  2JP7 A;  1LZA A;  4I7Q A;  4OW1 A;  1PJS A;  4YY3 M;  3FTF A;  1NBZ C;  3SAT A;  2DVW B;  3M7G A;  2QQ8 A;  1LZB A;  246L A;  4YX7 C;  2IFF Y;  1YQV Y;  3GRU A;  4WL7 A;  1XGR C;  4WM4 A;  2RH1 A;  3FD9 A;  1C64 A;  1DYB A;  3AZ4 A;  3HUA A;  4IBJ A;  3CSZ A;  1LMA A;  3U6C A;  3TXI A;  1VG5 A;  1UM8 A;  1CKH A;  4H9C A;  1L18 A;  1LZY A;  4B08 A;  3D9A C;  3W6A A;  177L A;  4HP0 A;  209L A;  1QSA A;  2MH8 A;  2NTG A;  3AW6 A;  5DFL A;  4LCB A;  1IY0 A;  2LYO A;  3VK8 A;  1K3W A;  4H92 A;  1OQM A;  2IHL A;  5F16 A;  2L7I A;  2HAK A;  3GPX A;  2XGN A;  2R4E A;  1I20 A;  1YL0 X;  1P6Y A;  3L64 A;  3P66 A;  3U5Z B;  3WPJ A;  3Q8G A;  2LHG A;  5LVH A;  4GHL A;  1C10 A;  4U3X B;  1XGQ C;  2OU0 X;  4HJV A;  1XC8 A;  2XJW A;  1NHE A;  2OOA A;  3ZH9 B;  4N8Z A;  2YNM D;  3K3T A;  107L A;  1G71 A;  3U61 B;  4PGJ B;  1QDT A;  5BR8 M;  1GO5 A;  1UCO A;  1LGX A;  4J0L A;  2B6X A;  3MMP A;  3FRH A;  3L25 A;  3C8S A;  4JXJ A;  4NGJ A;  3HWS A;  1QYR A;  1BWJ A;  3HY5 A;  2CHG A;  2Q2E B;  2C9O A;  2W82 A;  4R7G A;  1L1T A;  4XJG A;  3GQ3 A;  5D5C A;  4B0D A;  4OOO A;  1ZAE A;  2L78 A;  4MGZ E;  4LYZ A;  5APC A;  1JTO L;  2YSS C;  4NRW A;  3CDQ A;  5KXW A;  2LVN C;  4BAP A;  5KKI A;  2C8O A;  2AHM A;  1GPQ C;  1K82 A;  1NMM A;  2Z2F A;  2DQE Y;  3QYE A;  2BQM A;  1C43 A;  5LVG A;  5LZM A;  2DWZ B;  2LVQ D;  5FTM A;  2RGH A;  3GLG E;  4GKJ M;  3HT6 A;  4FDY A;  4GBR B;  1UIF A;  1C6P A;  3FE0 A;  3W0L B;  4N5R A;  1L72 A;  4KOD A;  2YQZ A;  3C3D A;  4B7F A;  3C3E A;  3SAV A;  1YKY X;  1KIR C;  4DAJ A;  2FBD A;  1NY5 A;  4WM1 A;  243L A;  5FSW A;  1GB3 A;  4LT2 A;  4FVM A;  1LJ4 A;  5FEK A;  4JI0 M;  2BNK A;  1KIP C;  1V7T A;  3LVW A;  4HPI A;  5EP1 A;  4TUW A;  4W58 A;  1NV9 A;  3C7W A;  2DWL A;  2I25 L;  2G8L A;  3QNG A;  3T1H M;  1L24 A;  1YAQ A;  4GCC A;  4OVZ B;  1LV7 A;  1GB8 A;  1GBY A;  2R0I A;  1YAP A;  5LYM A;  1LMC A;  1SLY A;  4EPI A;  3T36 A;  1B5X A;  4C5F A;  4LYB A;  1AIP C;  3U6L A;  2LH0 A;  1ALC A;  125L A;  1GJS A;  4HV1 A;  3K9O A;  1L49 A;  1SG9 A;  1LMP A;  4NWE A;  1QTC A;  1IIZ A;  1JKD A;  1MEL L;  3NBI A;  4NIJ A;  159L A; 
#chains in the Genus database with same CATH homology
 1GE0 A;  1XEP A;  1GFG A;  4LGK A;  1C6E A;  1QT4 A;  1L47 A;  2EKS C;  4EKP A;  1L92 A;  3J4G A;  1DKK A;  4GN4 A;  1LLH A;  1LZ4 A;  1LSD A;  1QTD A;  1OUI A;  4NGY A;  1UIB A;  4YF2 A;  3LZ2 A;  1LJK A;  1CJ8 A;  1GDX A;  1GF3 A;  1C6A A;  1LYY A;  4NGI A;  3DN1 A;  123L A;  1B7Q A;  4AGA A;  1A4V A;  1CU2 A;  149L A;  4W56 A;  1L09 A;  1L82 A;  4TX7 A;  3RZE A;  3ULR A;  5JEN B;  2Z12 A;  195L A;  4MR1 A;  4I7J A;  2G4N A;  5KXN A;  4EJ4 A;  1GFK A;  4Z98 A;  1GF9 A;  5KXZ A;  3TMX A;  1SWY A;  2BQC A;  1LJE A;  217L A;  2A7F A;  5II3 A;  3DN2 A;  1L63 A;  244L A;  5LAG A;  2BQB A;  158L A;  1KNI A;  2B7X A;  4PPO A;  1LTM A;  249L A;  1JJ3 A;  1DKJ A;  5LIN A;  1RFP A;  1C6G A;  1MLC E;  250L A;  1QSQ A;  171L A;  1IX0 A;  1GAY A;  1B5W A;  1L08 A;  1HEN A;  1L0K A;  1C6M A;  1L86 A;  2B6W A;  2OE7 X;  3V2Y A;  102L A;  1LHJ A;  2CGI A;  160L A;  3GUI A;  4HJZ A;  5KXO A;  5DM9 A;  1DYA A;  1C6T A;  4UWN A;  4RLN A;  1OWY A;  1B7N A;  4UWU A;  1LMO A;  1LZN A;  2Q0M X;  3HBH A;  3WPL A;  1REX A;  1CV4 A;  2IGC A;  2B74 A;  5LVK A;  258L A;  3GUP A;  194L A;  3LYO A;  1NWG A;  1KW5 A;  1HML A;  1HFY A;  4A7D A;  3T6U A;  164L A;  3ZEK A;  1RCM A;  4LZT A;  4CHX A;  220L A;  3WH1 A;  4NSJ A;  1L77 A;  1TAY A;  1L44 A;  4QGZ A;  1L15 A;  139L A;  1JWR A;  1L80 A;  2YBM A;  4GCE A;  4WO9 A;  5FST A;  4I0C A;  1SWZ A;  3LHM A;  4G9S A;  1AM7 A;  4W57 A;  207L A;  1IR7 A;  1L28 A;  4BS7 A;  4DD2 A;  2CWI A;  2G4Q A;  5B59 A;  4YXA C;  227L A;  2A4T A;  3N9E A;  4P2E A;  2W1M A;  1BGI A;  1DYF A;  4N1E I;  1LZ8 A;  252L A;  2OE4 X;  1L98 A;  3A8Z A;  193L A;  1L73 A;  1G7J C;  5IHG A;  1SX2 A;  1CV1 A;  236L A;  1C62 A;  4BAD A;  3NY9 A;  1L51 A;  1L64 A;  4GCB A;  1G7L C;  1L37 A;  5HNC A;  1SX7 A;  5LIO A;  186L A;  162L A;  3M3U A;  3A95 A;  3SB7 A;  5KXR A;  1IOQ A;  232L A;  3QAK A;  3SP3 A;  2BQL A;  1LYJ A;  1XEK A;  2LCB A;  1CNS A;  4LYO A;  1GF4 A;  1OP9 B;  4I7T A;  1NHB A;  5C6I A;  1L53 A;  2B70 A;  1GF7 A;  1L60 A;  239L A;  2Z2E A;  2EIZ C;  1IWT A;  3HU8 A;  1QT3 A;  153L A;  1ZVH L;  2LYZ A;  2BQH A;  1BB3 A;  1L12 A;  1J1O Y;  2B75 A;  1LYD A;  1VAT A;  1GEV A;  1RI8 B;  2HED A;  1CV0 A;  1HER A;  4DT3 A;  1KXX A;  1LKR A;  1T3P A;  4NWH A;  4LDE A;  2HEC A;  1LZ1 A;  5IEL A;  1OYU A;  1B7S A;  1QUO A;  2W1Y A;  3WU8 A;  3CDR A;  4OWA A;  1UC0 A;  1LHI A;  4Z41 A;  2Z38 A;  4LT3 A;  1LHL A;  2DQJ Y;  5I53 A;  2A7D A;  4W59 A;  1LSG A;  4WLX A;  4N9R A;  3P4Z A;  4CFO A;  1L67 A;  4ZPU A;  5DL9 A;  1IR8 A;  1H6M A;  3DN3 A;  2BQK A;  5LAF A;  1JKA A;  3HTF A;  1OUE A;  3C83 A;  1CX7 A;  1IWX A;  5FDJ A;  234L A;  1JQU A;  1EPY A;  1LHK A;  3A3R X;  2Q9D A;  1FLY A;  1C66 A;  208L A;  2DQD Y;  3W6D A;  1IP2 A;  112L A;  1D3M A;  2LC9 A;  4DD3 A;  1F6R A;  1L70 A;  122L A;  3OE0 A;  3RZ4 A;  2HU1 A;  2ZQ3 A;  5B06 A;  4B4E A;  1L84 A;  3GXK A;  2DQG Y;  4WG1 A;  5DN5 A;  2Z18 A;  5F81 A;  1C63 A;  2ZQ4 A;  3G3W A;  1GF5 A;  3JR6 A;  1BVX A;  1GB6 A;  1IP1 A;  4NY5 A;  4LT0 A;  5L9J A;  111L A;  3HDE A;  230L A;  199L A;  4ANR A;  3WU9 A;  4CGE A;  1L74 A;  3A67 Y;  4ML7 A;  4DQJ A;  143L A;  1GFH A;  5E9R A;  2RAZ X;  1L0J A;  210L A;  1GFU A;  2HUK A;  1REY A;  181L A;  3SN6 R;  1O23 A;  1G0L A;  1UIE A;  1QUT A;  1DYG A;  4HTQ A;  4IAP A;  1C60 A;  4WM5 A;  1GDW A;  1CV5 A;  4PJ2 C;  1JKB A;  1GEZ A;  4ET9 A;  1GFR A;  1L30 A;  1B7P A;  4ZEE A;  3D4S A;  1L26 A;  1HMK A;  114L A;  1LYO A;  2PC2 A;  2DQA A;  1QUD A;  3HT9 A;  4ETD A;  5KXL A;  1GFV A;  5LA8 A;  1L05 A;  1GD6 A;  1L39 A;  4S0W A;  2ZIL A;  4LYM A;  1EL1 A;  1UUZ C;  4XJH A;  2HUB A;  260L A;  1D6Q A;  1L13 A;  1L17 A;  1JSE A;  3SBB C;  2YVB A;  3LYZ A;  1YIL A;  1T8F A;  1DYC A;  1AZF A;  4ARL A;  2BQJ A;  1L55 A;  5LYZ A;  1YKX X;  1ZMY L;  4NGO A;  4H93 A;  9LYZ A;  4CFP A;  1OUJ A;  1H87 A;  2ZNX Y;  5M1Y A;  1XJT A;  228L A;  3SB9 A;  1GB2 A;  1DPX A;  4QEQ A;  5LVI A;  152L A;  2ZWB A;  1IP3 A;  1LYS A;  1D2Y A;  4H9E A;  187L A;  1AKI A;  1PQD A;  3C82 A;  3D3D A;  2H9J A;  2OU8 A;  1D3N A;  2WAR A;  4NHP A;  1LOZ A;  4NHI A;  1ZWN A;  4DC4 A;  1YAM A;  1GBW A;  215L A;  5KKJ A;  1OVH A;  4D9Z A;  242L A;  1LZ9 A;  1REM A;  4GCF A;  1QT6 A;  1P7S A;  4I7M A;  4PJZ A;  1YRO A;  1LYF A;  225L A;  3F6Z A;  3HWL A;  1W08 A;  4HJY A;  1KXW A;  4TWS A;  2YBH A;  1C6H A;  4ARM A;  3FAD A;  1B2K A;  3AJN A;  4NSI A;  4DD1 A;  1G0Q A;  4XJD A;  5C6J A;  1N4F A;  1J1X Y;  1IP6 A;  1LJ3 A;  3NYA A;  1LYH A;  4QY9 A;  2Y8P A;  1L90 A;  1LWG A;  2F2N A;  4OWE A;  1L45 A;  1D9U A;  3TMU A;  4N0J A;  1D0M A;  4W51 A;  1WQN A;  1LGU A;  1HEQ A;  4W53 A;  1IWW A;  1GF8 A;  2F32 A;  3CQL A;  1DZB X;  146L A;  4W52 A;  1LYG A;  1L06 A;  1VDQ A;  1LW9 A;  1TEW A;  3OK0 A;  3NY8 A;  1CX6 A;  3C8Q A;  4DDB A;  3WUN A;  1JEF A;  1UIH A;  3ZVQ A;  3HUQ A;  1G1W A;  1D2W A;  110L A;  1IWY A;  3IJV A;  1HEO A;  2RBR A;  1HSX A;  251L A;  1VDT A;  2YDG A;  4I7R A;  3WW5 A;  1JKC A;  1DI4 A;  2D4K A;  3CDO A;  5KY1 A;  3DMV A;  1T8G A;  3A90 A;  206L A;  2YBI A;  1L88 A;  3GUJ A;  4I7L A;  224L A;  1NDG C;  1XEI A;  1RE2 A;  3AGH A;  4W94 A;  1B5U A;  2DKV A;  4TSC A;  3M18 B;  1L99 A;  1UBZ A;  5L3H A;  4PK0 A;  1GB0 A;  1GB5 A;  3GUM A;  2ZYC A;  5ILF A;  1GF6 A;  1LYZ A;  1KY0 A;  2D4J A;  237L A;  1L22 A;  1GFA A;  1L00 A;  2W1L A;  1L52 A;  4PRQ A;  2O79 A;  4W54 A;  150L A;  3P64 A;  4WM6 A;  3A34 A;  1G0J A;  1OWZ A;  1PQM A;  2XBR A;  4XJI A;  3W6C A;  1HC0 A;  1C6F A;  229L A;  5HMJ A;  1TLA A;  1L16 A;  2BAA A;  4G4B A;  2H9K A;  128L A;  1L04 A;  4XEN A;  1HSW A;  1DXJ A;  3P68 A;  1IP4 A;  1IEE A;  3AB6 A;  1IY3 A;  2BQF A;  3WMK A;  1NKH A;  3WXT A;  4H9B A;  2MEA A;  2D91 A;  1L85 A;  1LKS A;  1BB7 A;  4H90 A;  4WO6 A;  3A91 A;  3FA0 A;  2ZIK A;  3SB5 A;  1LJJ A;  1QSW A;  1WVU A;  5B1F A;  1GF0 A;  4RDS A;  1IWZ A;  2YBJ A;  3DMZ A;  1P3N A;  1KS3 A;  1KIQ C;  1JHL A;  3W6E A;  1OUD A;  2B6Z A;  1T97 A;  3HDF A;  190L A;  1LSP A;  1ZV5 L;  3EML A;  2ZNW Y;  1CV3 A;  1F6S A;  155L A;  2B5Z A;  3DN0 A;  3WVY A;  3KAM A;  134L A;  1IP7 A;  245L A;  4ZFP A;  5KXT A;  1P56 A;  4W96 A;  4YXC A;  1DQJ C;  4G4C A;  1LJF A;  240L A;  3OE9 A;  1JTP L;  1GFT A;  5KJ9 A;  1UAC Y;  4II8 A;  1VDP A;  2Z39 A;  4B4J A;  4BAF A;  1WVV A;  5B07 A;  126L A;  1CUQ A;  1BB6 A;  1LSE A;  2DQH Y;  4OWC A;  170L A;  1LJI A;  1L42 A;  4XAD A;  3A3Q A;  2BLY A;  184L A;  1LCN A;  4N1C C;  1G7M C;  4ET8 A;  1OUG A;  4RW1 A;  5DLA A;  1RJC B;  4NSG A;  4NGL A;  5HNL A;  1CU3 A;  1L62 A;  1ZUR A;  2BQI A;  1FKQ A;  1QT5 A;  3E3D A;  3ODU A;  1CU6 A;  2ZYP A;  1IOC A;  3B0I A;  4EPF A;  176L A;  141L A;  4DDA A;  5D5F A;  4Z3M A;  3WU7 A;  1LSA A;  4YEM A;  4EKR A;  4ARM B;  1KW7 A;  3TXJ A;  3HH5 A;  4WLT A;  3SBA A;  1L48 A;  8LYZ A;  1OUF A;  1LZR A;  1FDL Y;  4LYT A;  1XGT C;  1B5V A;  1D3J A;  1TDY A;  222L A;  1IWU A;  1L43 A;  3HH6 A;  1G06 A;  1BB5 A;  3F8V A;  4HPE A;  1CKF A;  1L75 A;  5L3I A;  1CU5 A;  2OTZ X;  166L A;  2EPE A;  2NTH A;  1CVK A;  3HBE X;  1GWD A;  3TMW A;  4GCD A;  1QTV A;  4PRU A;  1LMT A;  261L A;  1JTT L;  1NQI A;  2ANV A;  4ARQ B;  1DI3 A;  1L81 A;  3GUN A;  196L A;  3MGW A;  1L21 A;  1SSW A;  1GBX A;  1GBO A;  1QTE A;  2YBL A;  4GN3 A;  2MEH A;  3RT5 X;  3AZ6 A;  1L19 A;  1LZC A;  1P2R A;  2F4G A;  2B6T A;  3G3A B;  4NHQ A;  3ZVQ B;  4OWH A;  5LYT A;  3HUK A;  192L A;  1G7I C;  1IC5 Y;  1C6B A;  1L57 A;  4H9H A;  1C6K A;  4J1B A;  5KXS A;  4XJF A;  2OTY X;  4WM2 A;  1SQ2 L;  253L A;  1LYI A;  1L02 A;  165L A;  1YAN A;  2RBN A;  1D9W A;  1Z55 A;  1C6N A;  1B6I A;  1P37 A;  2LZT A;  1JTM A;  1LZE A;  4WOA A;  2RBQ A;  197L A;  1IC4 Y;  185L A;  1A2Y C;  1I56 A;  1HHL A;  2Z6B A;  3RW8 A;  4C3W A;  1JIY A;  2AUB A;  4ETE A;  1XJU A;  4YEO A;  5KXK A;  5ILC A;  1LGW A;  1PQJ A;  2CJL A;  4WLD A;  256L A;  4NHS A;  2DQC Y;  3TXG A;  4RW2 A;  1C6L A;  5KXX A;  1L41 A;  1C6C A;  3N9A A;  154L A;  5A3Z A;  1L71 A;  2BQN A;  4B49 A;  1YAO A;  2HEE A;  1GB7 A;  1LI3 A;  1OUH A;  4YOP A;  1D0L A;  1JUG A;  2MEC A;  3AZ7 A;  1LPY A;  3CT5 A;  4LDL A;  3WPK A;  118L A;  1QIO A;  4NG1 A;  137L A;  4DD9 A;  2XBS A;  5B05 A;  1EQE A;  2I6Z A;  3TMV A;  1L29 A;  2F30 A;  212L A;  3VW7 A;  4XYY A;  1F0W A;  173L A;  3A6B Y;  2RB0 X;  1C45 A;  1I1Z A;  1BQL Y;  182L A;  109L A;  4H8Z A;  2ANX A;  3DMX A;  4B1A A;  2HU3 A;  1EQ4 A;  1C46 A;  3HH4 A;  3C7Z A;  4H9A A;  2MEI A;  4ETA A;  3TXK A;  4RLM A;  1LZT A;  2I26 L;  1IP5 A;  1D6P A;  1IOS A;  2DQI Y;  4HTK A;  2RB2 X;  3HT8 A;  3EMS A;  1IVM A;  1UA6 Y;  3DNA A;  191L A;  1VAU A;  5KXM A;  1V7S A;  3TXE A;  1QTK A;  1C6I A;  4TSB A;  1BVK C;  2F2Q A;  4I7K A;  1IWV A;  4Z46 A;  5F9X A;  127L A;  1GE3 A;  1L83 A;  4M4O A;  4FJR A;  2W1X A;  4TTD A;  1HEW A;  1YL1 X;  1VED A;  2BPU A;  5B1G A;  4ARP A;  1KY1 A;  145L A;  216L A;  5I14 A;  1VDS A;  1PQO A;  2RBO A;  2MEF A;  1L89 A;  1JPO A;  1XSF A;  5FEL A;  2F4A A;  1GAZ A;  3N9C A;  4L41 A;  5E4P A;  1C6J A;  1DYE A;  3WUM A;  1WTN A;  4GRV A;  3AW7 A;  1L34 A;  4LDO A;  1LSY A;  3C80 A;  3QE8 A;  4J7V A;  1QDR A;  3G3B B;  2RBP A;  198L A;  3OJP A;  1UIA A;  1HNL A;  1FBI X;  1L10 A;  1JIS A;  3K2R A;  1GE1 A;  4WG7 A;  1G7H C;  3B6L A;  3WUL A;  3HH3 A;  3WUA A;  1LI2 A;  1GHL A;  5A3E A;  1L01 A;  235L A;  3DN4 A;  5LXW A;  1L93 A;  2MEB A;  1L25 A;  1TCY A;  4G4H A;  3DN8 A;  1ZVY B;  4LFX A;  259L A;  1G0P A;  1L91 A;  231L A;  214L A;  1FKV A;  1L61 A;  4LFP A;  3TXF A;  1C68 A;  3J6K A;  1L46 A;  2RBS A;  4H9F A;  2Z19 A;  120L A;  1GE2 A;  172L A;  1QUG A;  1CKD A;  2RB1 X;  1AT6 A;  4HTN A;  4I7S A;  3W6B A;  4K5Y A;  4ARQ A;  201L A;  1GBS A;  1C7P A;  1IY4 A;  1L94 A;  1LHM A;  7LZM A;  1SSY A;  4NFV A;  1I6S A;  2C8P A;  4I7O A;  3IWR A;  2F47 A;  1LZD A;  5APF A;  3WW6 A;  1L23 A;  132L A;  3TXD A;  1LJN A;  3OE6 A;  1QUH A;  2BQO A;  5I4X A;  1YIK A;  113L A;  2MED A;  180L A;  1L95 A;  3CDV A;  1L40 A;  1DI5 A;  1G07 A;  1QTB A;  3PBL A;  4H91 A;  1F10 A;  4KL7 A;  4ARJ A;  1LSC A;  2QAR C;  1LSZ A;  1W6Z A;  1CJ6 A;  1XGU C;  2Q9E A;  1T6H A;  247L A;  4EOF A;  3EXD A;  3WYH A;  4LYC A;  218L A;  1B7L A;  1C67 A;  167L A;  223L A;  1OV7 A;  1L27 A;  4DJH A;  1T8A A;  1JJ1 A;  3G3V A;  2BQG A;  5EBH A;  1PQI A;  3A92 A;  168L A;  1HEP A;  205L A;  3A93 A;  3LZT A;  3SB8 A;  233L A;  5J7C A;  6LZM A;  4EKS A;  1L66 A;  2LZ2 A;  2VB1 A;  1HFZ A;  2CUU A;  131L A;  4ZIX A;  4J1A A;  3LYM A;  3HTB A;  103L A;  3BKH A;  4E97 A;  3B72 A;  1B0D A;  213L A;  5I5Q A;  2CDS A;  1L69 A;  4EKQ A;  3QY4 A;  1HEM A;  5T3F A;  1VFB C;  1LHH A;  1CUP A;  148L E;  1LPI A;  1JSF A;  1OV5 A;  175L A;  4WMG A;  200L A;  142L A;  1KXY A;  1LSB A;  1L96 A;  156L A;  4XJB A;  1QS9 A;  4DWX A;  4NGW A;  3EBA B;  1WQR A;  3G3X A;  4NSH A;  248L A;  2N5Z A;  1C08 C;  3C7Y A;  1PS5 A;  2XTH A;  4H9I A;  5LVJ A;  3WL2 A;  6LYT A;  2MEG A;  3CT0 A;  1C6D A;  4W55 A;  3DKE X;  1T6V L;  3W6F A;  5DN4 A;  4EMN A;  4G49 A;  2GV0 A;  1L50 A;  1LZ6 A;  2HTX A;  2B6Y A;  3LN2 A;  4O34 A;  5F9U A;  1QQY A;  5IDD A;  4LZM A;  219L A;  1TBY A;  2OEA X;  3GXR A;  5AMY A;  1L35 A;  2HUL A;  1CV6 A;  1PQK A;  2RSC A;  188L A;  178L A;  1QSB A;  4UWV A;  1UIG A;  5FHW A;  1B7M A;  3TXB A;  3AGI A;  1C6Q A;  2FYC A;  3LYT A;  1NDM C;  133L A;  4YM8 A;  3GUL A;  1P2C C;  3F9L A;  3B0K A;  1JJ0 A;  1P64 A;  3A96 A;  3DN6 A;  1L56 A;  1LWK A;  1J1P Y;  1DYD A;  238L A;  4XN6 A;  4NGV A;  1GB9 A;  2G4P A;  1FN5 A;  1WTH A;  2BQA A;  1OUA A;  1LSM A;  135L A;  6LYZ A;  5K7O A;  1B7O A;  3CSQ A;  4DQ5 A;  4KT3 A;  1D3F A;  4AXT A;  3GUK A;  4H94 A;  254L A;  255L A;  1QS5 A;  1UID A;  1GFE A;  1WQO A;  5KXY A;  2B73 A;  189L A;  4DDC A;  1L03 A;  3TXH A;  4IAS A;  2MEE A;  5LA5 A;  3FI7 A;  1L79 A;  4NHT A;  1L31 A;  4KXI A;  3ATN A;  1P46 A;  3RU5 A;  1P36 A;  4MST A;  3AYQ A;  4WL6 A;  1QT7 A;  4I7P A;  2RAY X;  3P65 A;  1WQP A;  4DD0 A;  1CKC A;  1B5Y A;  3V2W A;  1JTN A;  1IOR A;  2QB0 B;  1B7R A;  2OE9 X;  1L14 A;  2Z37 A;  1CKG A;  4GLA A;  2FYD A;  2ZIJ A;  4ETB A;  5KXP A;  4NG8 A;  3B0O A;  3RNX A;  5F14 A;  1CTW A;  5FCP A;  1G0M A;  4KPM A;  169L A;  3VWO A;  1LZS A;  1BWH A;  119L A;  1YKZ X;  2OU9 A;  2DBT A;  4OO9 A;  4GN5 C;  3HTD A;  3CDT A;  3LZM A;  1D0K A;  2BQE A;  2EQL A;  3FI5 A;  241L A;  3HFM Y;  161L A;  1WTM A;  2DQF C;  1IC7 Y;  1L87 A;  2LZM A;  1CU0 A;  1G0G A;  1G0K A;  2H5Z A;  183L A;  1GBZ A;  3C81 A;  174L A;  4AQN A;  129L A;  157L A;  1L33 A;  1B5Z A;  2YBN A;  1LSF A;  1L32 A;  4WM3 A;  4DKL A;  1L97 A;  3AGG G;  3UON A;  1C65 A;  1LZ5 A;  1B9O A;  4PHI A;  1IOT A;  4CJ2 A;  5I4W A;  4WLY A;  1HF4 A;  3CSR A;  1IO5 A;  1INU A;  2HEF A;  2FBB A;  1L58 A;  1L76 A;  5APE A;  4M6D A;  1FLQ A;  1XEJ A;  2X0A A;  1REZ A;  108L A;  4MCK A;  1OUC A;  1LJH A;  4I8S A;  1DPW A;  1L38 A;  1E8L A;  2D6B A;  2BLX A;  3CB7 A;  4H8Y A;  1XGP C;  1PZY A;  1HEL A;  3A6C Y;  1P2L A;  144L A;  1L54 A;  5C6L A;  1BWI A;  1P5C A;  4YEN A;  4EXM A;  1LJG A;  1BHZ A;  3HT7 A;  4TUN A;  1LMQ A;  1BB4 A;  3WVX A;  4DYG A;  4HV2 A;  1LAA A;  3W3E A;  3GUO A;  3OE8 A;  2HUM A;  4R0F A;  3CT1 A;  2XQO A;  1L36 A;  3A94 A;  4GLV A;  4QDN A;  1L65 A;  3HU9 A;  4IJ4 A;  3WXU A;  2D4I A;  5I54 A;  1FLW A;  1L20 A;  138L A;  1NBY C;  1GXV 2;  4ETC A;  3HTG A;  4E3U A;  1L68 A;  1LYE A;  4LT1 A;  3HBD A;  5HLL A;  1OUB A;  262L A;  2O7A A;  1IR9 A;  147L A;  1GFJ A;  4DQ7 A;  3RUN A;  151L A;  1AT5 A;  3EO5 A;  5I4Y A;  1XFP L;  4OWB A;  1C61 A;  1QTZ A;  1OVJ A;  1OVK A;  5APD A;  1FLU A;  1C69 A;  2BQD A;  130L A;  4H8X A;  1NF5 A;  1LI6 A;  1GXX A;  2LHM A;  1CJ9 A;  7LYZ A;  2LYM A;  226L A;  3AZ5 A;  1L07 A;  4B4I A;  115L A;  163L A;  1JIT A;  1LSN A;  221L A;  2O4W A;  2B72 A;  1QT8 A;  1WQQ A;  4NGK A;  1UIC A;  1HFX A;  2HEB A;  4IAT A;  3BKV A;  4R6C A;  3PDS A;  1L59 A;  3IJU A;  4I7N A;  1QUS A;  3SB6 A;  104L A;  1G1V A;  2HEA A;  4NGZ A;  1EQ5 A;  1CJ7 A;  1GE4 A;  3ATO A;  1QTH A;  1LZG A;  4OOT A;  4X3B A;  1K28 A;  211L A;  1WQM A;  4DD7 A;  4HSF A;  3L2X A;  1L11 A;  4H1P A;  3C8R A;  1ZYT A;  1LMN A;  4NEB A;  257L A;  2NWD X;  140L A;  5HMV A;  1LZA A;  4I7Q A;  4OW1 A;  1NBZ C;  246L A;  1LZB A;  4YX7 C;  2IFF Y;  1YQV Y;  4WL7 A;  1XGR C;  4WM4 A;  2RH1 A;  1C64 A;  1DYB A;  3AZ4 A;  3HUA A;  3CSZ A;  1LMA A;  3TXI A;  1CKH A;  4H9C A;  1L18 A;  3D9A C;  1LZY A;  3W6A A;  177L A;  4HP0 A;  209L A;  1QSA A;  2NTG A;  3AW6 A;  2LYO A;  4H92 A;  1OQM A;  2IHL A;  5F16 A;  1I20 A;  1YL0 X;  1P6Y A;  3L64 A;  3P66 A;  5LVH A;  3WPJ A;  1C10 A;  4U3X B;  1XGQ C;  2OU0 X;  4HJV A;  2XJW A;  1NHE A;  4N8Z A;  3K3T A;  107L A;  4PGJ B;  1QDT A;  1UCO A;  1LGX A;  4J0L A;  2B6X A;  3C8S A;  4NGJ A;  1BWJ A;  4XJG A;  5D5C A;  4B0D A;  4OOO A;  2L78 A;  4LYZ A;  5APC A;  1JTO L;  2YSS C;  3CDQ A;  5KXW A;  4BAP A;  5KKI A;  2C8O A;  1GPQ C;  1NMM A;  2Z2F A;  2DQE Y;  2BQM A;  1C43 A;  5LVG A;  5LZM A;  5HQ1 A;  4FDY A;  3HT6 A;  4GBR B;  1UIF A;  1C6P A;  3FE0 A;  4N5R A;  1L72 A;  1YKY X;  1KIR C;  4DAJ A;  2FBD A;  4WM1 A;  243L A;  1GB3 A;  4LT2 A;  1LJ4 A;  5FEK A;  1KIP C;  1V7T A;  4HPI A;  4W58 A;  3C7W A;  2I25 L;  3QNG A;  1L24 A;  1YAQ A;  4GCC A;  1GB8 A;  1GBY A;  1YAP A;  5LYM A;  1LMC A;  1SLY A;  4EPI A;  3T36 A;  1B5X A;  4C5F A;  4LYB A;  1ALC A;  125L A;  4HV1 A;  1L49 A;  1LMP A;  4NWE A;  1QTC A;  1IIZ A;  1JKD A;  1MEL L;  4NIJ A;  159L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...