1QUSA

1.7 a resolution structure of the soluble lytic transglycosylase slt35 from escherichia coli
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Escherichia coli lytic transglycosylase Slt35 reveals a lysozyme-like catalytic domain with an EF-hand.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
total genus 110
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qusA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qusA02
1JKDA 1C7PA 1BGIA 1FLWA 2MEGA 1JSEA 2MEIA 5B59A 4OWCA 5B05A 4WM3A 1NQIA 1JKCA 2D4KA 2ZWBA 1GXV2 1GBYA 5LIOA 1QQYA 1LSYA 1GFUA 133LA 3CSRA 1HFYA 2H9KA 3WUMA 2HU3A 4GLVA 1QUSA 1GEVA 1VDQA 1ZMYL 5HLLA 3WH1A 5KY1A 1REYA 1FLQA 4XJDA 1OUCA 1BVXA 4YEMA 3WUAA 1OUAA 1LHHA 4YEOA 4BS7A 3TXJA 5LA5A 5F81A 2F2NA 1B2KA 1GF5A 2MECA 1QTKA 3WW5A 1B7MA 2ZNWY 2WARA 1OUBA 1LMOA 1OUFA 5I4WA 4PPOA 4WLTA 2LHMA 1B5XA 1WVVA 1YKZX 5LAFA 4D9ZA 6LYZA 1UIHA 4NY5A 3D9AC 5HMVA 1GE0A 3AGHA 4TSBA 5E4PA 1BVKC 5F9UA 3SP3A 4H8YA 1VATA 3TXFA 207LA 4LYZA 4RLNA 5KKJA 1JHLA 1E8LA 2ZIKA 1FDLY 1UACY 1HERA 2EPEA 1GBWA 1HFXA 3M18B 4LZTA 5KXSA 1YQVY 1GF6A 5F9XA 3CT1A 3WL2A 4NSIA 3WU8A 1CJ7A 5KXYA 5KXRA 3W6AA 4TTDA 2XTHA 1LZ9A 4OWHA 5B1FA 3WPJA 8LYZA 4NGOA 1DPXA 1NWGA 5F16A 1IX0A 1VFBC 1NDGC 194LA 4RLMA 5KXTA 1IWVA 3BKVA 1GHLA 3A96A 3AZ6A 5DN5A 4NFVA 2VB1A 1UC0A 1BWIA 4NHIA 4PRUA 1H6MA 1JISA 1LMNA 1IR7A 4W96A 1GBOA 2HEAA 3W6DA 1UUZC 1XEKA 3AGIA 1C08C 4OWBA 4UWNA 3RU5A 2IHLA 2ZILA 5B1GA 1IP2A 3LN2A 1F0WA 1G7LC 2HU1A 1GE1A 4E3UA 1D0KA 4H9CA 1LYSA 5C6IA 1AZFA 1VDSA 1YL1X 3LYMA 1HC0A 4LT0A 4OWAA 4XN6A 4KXIA 5I4YA 1IR8A 1QUTA 1IWXA 1GB5A 2GV0A 1LJFA 4P2EA 1FN5A 4ML7A 1DZBX 3QNGA 4A7DA 1J1XY 3W3EA 2YBLA 1IY4A 1IC5Y 4NGVA 5KXWA 2Z19A 2D6BA 1D6PA 4J7VA 3HBHA 5D5CA 4HJVA 3KAMA 1XGTC 4WM5A 5L9JA 1DI5A 4LYMA 1JJ0A 3TXGA 1B7OA 1AT5A 1B7RA 3W6CA 3TXBA 1F6SA 1JIYA 4NGJA 3TXIA 4AGAA 2I25L 4QEQA 1W08A 2A7FA 3LYOA 4WM4A 4HV2A 5J7CA 4N1EI 5DN4A 1BWJA 5LYTA 1WQOA 1D9UA 3EO5A 1LYYA 4NGZA 5APDA 3D3DA 2YBNA 1YILA 4NSGA 1KXWA 3J6KA 1H87A 2LZTA 4WM1A 5K7OA 1WQNA 3AJNA 4NHPA 1JUGA 5I54A 4YOPA 5LYZA 1LSZA 2IFFY 1B5WA 134LA 4PGJB 3LZTA 4XENA 4ZEEA 1LJEA 1HMLA 3A90A 5JENB 1GF7A 2BQGA 1NBZC 1KIRC 1FKVA 2CWIA 1WQQA 2HECA 1BQLY 2BAAA 5DM9A 4CHXA 5FDJA 1G7MC 3ZEKA 2XBSA 4II8A 4NGWA 4WG1A 4ANRA 3CT5A 1GB3A 4H91A 1CNSA 1LZGA 2BQHA 4BAFA 1DXJA 1OP9B 4H9BA 2N5ZA 1LJHA 1LZSA 3N9AA 4WLDA 3RT5X 4DDCA 1GFKA 2BQLA 2DQJY 1LYZA 1XEIA 2FYDA 4N0JA 3WW6A 1G7JC 3W6BA 1HSXA 1DI3A 1B5ZA 1JSFA 3WUNA 2YBJA 5M1YA 1GFEA 1GF4A 5L3HA 5LVHA 2C8OA 4R0FA 4CFOA 4NGKA 1XGUC 4QGZA 1CJ6A 2Z39A 5ILFA 1LJJA 1REZA 1VDPA 1LHMA 4KL7A 2YVBA 3ULRA 4WLYA 3WMKA 132LA 1CJ9A 2HEBA 5I4XA 3T36A 3N9CA 2LYMA 4DD3A 1HEMA 1LMQA 1VAUA 2F4AA 3RNXA 4RW2A 1N4FA 1I1ZA 1YAPA 1IP1A 1LZNA 4G4BA 4NHSA 4GCDA 4OOTA 1XFPL 1DPWA 1TBYA 4LFPA 1LSBA 1GFRA 1J1OY 1DKKA 4PJ2C 1EQ5A 2Z37A 4DYGA 4J1AA 3IWRA 5E9RA 4B49A 5KXKA 4GN5C 1XGQC 4PRQA 1UIBA 5D5FA 1GFJA 4J0LA 2DQGY 2CJLA 1LOZA 1GB8A 5B06A 4C3WA 5IELA 1CKHA 3A92A 4FJRA 153LA 5ILCA 1B7NA 4B0DA 3A6BY 1P2CC 1UIAA 4C5FA 4H9HA 1IEEA 5HMJA 3F6ZA 1KIPC 3TXEA 2FYCA 4B4EA 1XSFA 1B7QA 3FE0A 1DI4A 4Z41A 135LA 3HFMY 3TMUA 1LJGA 2BQCA 3AW7A 1LZYA 1O23A 1YANA 1YL0X 5FCPA 3A34A 1IOCA 4H9IA 1B0DA 1GFAA 4XADA 4B4IA 3QE8A 4TX7A 2PC2A 2W1LA 2MEDA 4G9SA 5LAGA 4H1PA 3AZ4A 3WYHA 1UCOA 1GWDA 1LHIA 4LGKA 4R6CA 4CGEA 5L3IA 1IWUA 3J4GA 2ZIJA 4XYYA 3WU9A 4NGIA 1NBYC 2BQFA 5KXOA 1GAZA 1FLYA 3WPKA 2LYOA 2MEAA 2DQIY 2DQCY 3A3QA 4HTNA 5DLAA 3WVYA 5DL9A 1XGPC 1B9OA 1IP3A 1YIKA 2F30A 1C46A 1JJ3A 2HEEA 1B7PA 4H8ZA 4DDBA 1C10A 1GF9A 2HEFA 4QDNA 1IC7Y 1RE2A 1YKXX 3AZ7A 3TXHA 9LYZA 1HFZA 3P66A 4WOAA 1CKCA 3LYTA 5FELA 4ET9A 1HNLA 4YF2A 2BQEA 1LZ1A 1QSAA 3B0IA 4UWUA 1C43A 4M6DA 1OUDA 1CKDA 3AZ5A 4H92A 1GE2A 1A4VA 1JWRA 2BQNA 1LHJA 4XJIA 154LA 1QIOA 2Z38A 1LJIA 3ZVQB 4GCEA 3TXDA 2X0AA 2BQBA 2Z18A 1B5YA 2Q0MX 2ZQ3A 4XJBA 2MEHA 1YKYX 2W1XA 3CSQA 1UIDA 1IP5A 1FKQA 1LZTA 2I26L 3A67Y 1IIZA 1VEDA 3BKHA 1WQPA 2BPUA 2BQJA 3AYQA 3FI7A 4DD0A 1YAOA 5B07A 1DQJC 1VDTA 5AMYA 1IOTA 1RFPA 1IC4Y 3EBAB 4DD9A 3A8ZA 3B0OA 1BB3A 1LJNA 2DQEY 1INUA 4PHIA 2I6ZA 1B5VA 4LT2A 2DQHY 3N9EA 3W6EA 1LZ5A 1LSEA 2BQAA 5KXMA 1IP4A 3G3BB 1T6VL 3IJUA 4EOFA 1XEJA 1GE3A 4NG8A 1GF8A 2A7DA 2MEEA 4BADA 1GFHA 4G49A 2D4JA 2C8PA 4DDAA 5HQ1A 1JTTL 5LINA 1AKIA 1LKSA 1SLYA 1LMPA 3EMSA 1HENA 208LA 3RZ4A 3A6CY 1LAAA 1GF3A 4KT3A 4H8XA 1LKRA 1LMTA 5APEA 1LTMA 1GAYA 1LJ4A 1LSFA 2BQDA 1BHZA 4NEBA 4LT3A 3A93A 1ZVYB 4NHTA 4YENA 1T3PA 4IJ4A 4WM6A 4BAPA 4G4HA 3HBDA 3GXRA 1Z55A 2W1MA 1D0LA 1GB0A 4M4OA 4NWEA 2EKSC 3A94A 5FEKA 1V7TA 1LMCA 2ZYCA 1SQ2L 1HEWA 1D6QA 1B7SA 1LMAA 2EQLA 1WVUA 3CT0A 1LZCA 5APCA 1B7LA 1BB6A 1JJ1A 1XGRC 4H93A 1OUHA 1GF0A 1WQRA 1LCNA 1OUJA 1IWTA 1LSGA 4NWHA 4OOOA 1FLUA 4WM2A 4ZIXA 1KXXA 1LZRA 3B0KA 3LYZA 5KXPA 2HTXA 2RSCA 4DC4A 4NGLA 2FBBA 1LSDA 1LZ4A 1JKAA 2B5ZA 4HJYA 4EMNA 5LXWA 3RW8A 2CDSA 4I0CA 1LSNA 1BWHA 1A2YC 5KJ9A 4WMGA 1YAQA 1IR9A 1W6ZA 2YDGA 3ATOA 1JPOA 4HPEA 3VWOA 2H9JA 3CQLA 4H90A 1EL1A 2D4IA 5LVJA 1JKBA 2YBMA 4DD2A 1KXYA 5LVIA 2NWDX 2ZYPA 3OJPA 3P64A 3WXTA 1IWWA 1HELA 4HPIA 4X3BA 4WL6A 5KXLA 1JTOL 1RJCB 1IWYA 1OUIA 4I8SA 1G7HC 2DQDY 3TMWA 1NF5A 4LYBA 1HHLA 4GCBA 3IJVA 2BLYA 1TAYA 3A3RX 1BB4A 4HP0A 1G7IC 1GEZA 4DD7A 1ALCA 4WL7A 4NHQA 6LYTA 4LYCA 4NSHA 2BQKA 4WLXA 4LYTA 1HEQA 1QDRA 4RDSA 1DKJA 5A3ZA 2DKVA 1GD6A 3M3UA 1WQMA 1F6RA 3AB6A 1JITA 2HEDA 4KPMA 4Z98A 5A3EA 1UA6Y 3TMVA 2CGIA 1QTEA 4GN4A 4GCFA 4Z46A 1JTPL 5II3A 1F10A 1OUEA 2LZ2A 4IATA 1UIGA 4LFXA 4QY9A 4GCCA 1LZAA 2Z2EA 4O34A 1IVMA 1HF4A 2EIZC 1LZ8A 1GXXA 4GN3A 1LJKA 1LSCA 1GDXA 1ZV5L 3E3DA 5EBHA 2G4PA 3K3TA 1RCMA 4HTKA 1GFGA 4MCKA 1IP7A 5HNLA 1ZVHL 4GLAA 5LA8A 2ZNXY 5T3FA 1HEOA 4ETEA 4H9AA 1GFTA 3QY4A 3CB7A 5FHWA 1LSMA 1HSWA 1J1PY 1MLCE 3EXDA 1UIEA 2BQIA 4WO6A 1TCYA 1OUGA 1QSWA 2Y8PA 1REMA 1MELL 1WTMA 1LHKA 4L41A 2AUBA 1IOSA 4H94A 4Z3MA 1PS5A 1V7SA 4G4CA 4ZFPA 1KIQC 2H5ZA 1LPIA 4LT1A 1IP6A 1TEWA 3TXKA 1B5UA 1EQEA 1LHLA 4TUNA 3WULA 3P4ZA 4YM8A 4AXTA 1BB7A 1CKGA 4IASA 3A95A 7LYZA 5F14A 4TSCA 4B1AA 3GXKA 2DBTA 4NSJA 4LYOA 3G3AB 1UIFA 4XJGA 1GBZA 2BLXA 4B4JA 1FBIX 1YROA 4ET8A 1GBXA 2G4NA 4ETAA 3WPLA 1LYOA 2LYZA 1NDMC 4OWEA 5KKIA 1IO5A 1NKHA 1LZ6A 2BQOA 5LVKA 3B72A 3WU7A 3TMXA 2DQAA 3CSZA 4N5RA 2D91A 2YBIA 1LJ3A 3A91A 1GB6A 4UWVA 4N8ZA 4TWSA 2MEBA 1YAMA 2W1YA 5IDDA 5KXXA 4NIJA 1OQMA 1IY3A 2ZQ4A 193LA 1QDTA 3B6LA 4XJHA 1IOQA 1IWZA 1UICA 2HUBA 1GB7A 4U3XB 5KXZA 4ETDA 5KXNA 1CJ8A 4H9FA 5I5QA 3WVXA 1I20A 3W6FA 4H9EA 1WTNA 4CJ2A 2YSSC 3AGGG 1GPQC 4ETBA 1EQ4A 5C6LA 1D0MA 1LZEA 2Z2FA 4CFPA 1UBZA 1LSAA 1JEFA 1NMMA 1GDWA 4NG1A 4OW1A 2DQFC 4NGYA 4WG7A 4W94A 1AT6A 2MEFA 4ETCA 3AW6A 4HJZA 1C45A 3MGWA 3LHMA 1LZDA 1AM7A 1TDYA 1PZYA 4HSFA 4HTQA 5FSTA 1RI8B 3ZVQA 1BB5A 1GB2A 4XJFA 5C6JA 3LZ2A 3ATNA 1IORA 1NHEA 4WO9A 1GBSA 2YBHA 4FDYA 4MSTA 5IHGA 1HEPA 1LSPA 2XJWA 1HMKA 4DD1A 5HNCA 2XBRA 4RW1A 3P65A 1GB9A 4N1CC 1GFVA 4HV1A 5I53A 2G4QA 1LZBA 4J1BA 3T6UA 5LVGA 4DT3A 2Z12A 1I56A 4DWXA 2F4GA 2FBDA 3HBEX 1CKFA 3WXUA 5LYMA 1GE4A 4MR1A 1REXA 3OK0A 2BQMA 3P68A 4N9RA 5APFA
chains in the Genus database with same CATH superfamily
4DR2M 1JKDA 4M0WA 4OWCA 1L57A 4PDIA 4WM3A 4LJ6A 1JKCA 242LA 1KW5A 2D4KA 3KOWE 5LIOA 4QOSA 1QQYA 2KNZA 114LA 3NY8A 3CSRA 3HU8A 3B74A 2H9KA 4I7PA 3FI5A 1GEVA 3T6PA 141LA 113LA 1D2YA 1OUAA 4W54A 231LA 164LA 4YEOA 3J81S 1WHCA 2MECA 1HJPA 1ZYTA 1OUBA 2O4WA 2WARA 2OOAA 1DGHB 1OUFA 1IN7A 4D9ZA 3FA0A 3SASA 4IIWA 5EXXA 1GL7A 1GE0A 3HWSA 1E8LA 5KKJA 1UFZA 1L69A 250LA 1TTEA 3DOAA 2BWBA 2LZMA 4MGZE 4DJHA 1NSFA 3GLHB 5KXYA 251LA 1LZ9A 4OWHA 4NGOA 1DPXA 1NWGA 1NDGC 2XSZD 1IWVA 3CDOA 2JZ0A 3BKVA 1H6UA 143LA 3CGWA 158LA 4NHIA 2HWJA 3DN3A 1H6MA 4LJ8A 1IXRC 1IR7A 2ZTCA 3V76A 3AL0C 1L53A 1VDLA 129LA 3AGIA 1AUAA 1C08C 1PQIA 4UWNA 156LA 3HT9A 1G7LC 2B3TA 4EJ4A 2BJVA 1LYSA 1AZFA 2B6TA 1OWZA 1HC0A 1L94A 4LT0A 4KXIA 2H5XA 144LA 1IR8A 2CEAA 2UXCM 1CVKA 1LJFA 4P2EA 245LA 1ZMUA 1PJIA 1J1XY 3W3EA 5KXWA 1IY4A 3SBBC 2JY7A 2D6BA 3ODUA 2C9OA 3GUKA 3TWKA 4MM3B 1AT5A 2JWSA 1B7RA 3W6CA 1L8QA 3JR6A 2JUJA 1C6HA 4WM4A 4HV2A 4I7JA 4JI4M 1D9WA 1C63A 5DN4A 5J7CA 5GKNA 5LYTA 3EO5A 2O7AA 1XJUA 4GHLA 1JR3D 1JTMA 3J6KA 2LZTA 5I54A 5ITXE 3UK6A 1LSZA 4AKGA 1QTBA 1BVSA 134LA 1OIZA 1C6PA 4ZEEA 1LJEA 3A90A 2ANVA 3U5ZA 2YFQA 5DM9A 1LI6A 2XBSA 4WG1A 5JI2E 3PBLA 4H91A 3CT5A 1GB3A 3FTFA 1J5EM 4QNMA 1CNSA 1DXJA 3N9AA 4NRVA 2DQJY 1XEIA 2FYDA 3C80A 3HU1A 4DR3M 5M1YA 3GLFB 1GFEA 5L3HA 1X37A 5LVHA 2C8OA 4CFOA 1NV8A 2EO2A 1N33M 3E4RA 3M6AA 5LMUM 1QTCA 4F1IA 4KL7A 225LA 4RF0A 2BJWA 4NXMM 3HY5A 3KP1E 2HEBA 3W67A 4LF4M 3N9CA 3GUJA 1L74A 2OE4X 4MGKE 1LMQA 1LWKA 1DYFA 1IP1A 3C8SA 1DO0A 4GCDA 1ZWNA 4I8OA 1DPWA 1J1OY 1DKKA 1CUKA 4J1AA 4GN5C 5FTJA 3OE0A 4PRQA 5D5FA 1GFJA 1QT7A 4L78A 1L27A 4EIWA 5B06A 4C3WA 1CKHA 4FJRA 162LA 2G8LA 4B0DA 3A6BY 1G71A 1P2CC 3F6ZA 2ZANA 4LFAM 2C99A 1PQJA 1B7QA 4Z41A 1IFYA 1LJGA 1IBMM 195LA 2BQCA 248LA 3AW7A 1LZYA 1YANA 5FCPA 1IOCA 4H9IA 2A4TA 1B0DA 1GFAA 1C6TA 3HTDA 1CU2A 4TX7A 4AQYM 4H1PA 1UM8A 4BLCA 5E26A 1OYUA 1GWDA 4DV0M 5L3IA 219LA 1F4IA 2RB0X 4NGIA 254LA 1GAZA 1T8FA 1L55A 2KA6B 4ZPUA 3FADA 3U6LA 1XGPC 2V1UA 1B7PA 1S3SA 1C10A 1IXSA 1GF9A 2HEFA 1YKXX 3AZ7A 1L93A 1HFZA 4D80A 4YF2A 1FJGM 3IHPA 2RBNA 4FWDA 3AZ5A 1A4VA 1LJIA 2KZSA 2ZBKB 5ITXA 3TXDA 217LA 1QVRA 2Z18A 3PDSA 1TR8A 3SAUA 1L09A 3CSQA 2W1XA 2JY5A 1UIDA 1LZTA 1IIZA 1VEDA 3HU9A 1WQPA 3LVWA 3V2WA 5H37D 2DZOB 1YAOA 3C58A 3VFDA 1QSQA 3PVSA 3HT8A 3A8ZA 252LA 2WSFF 2Y20A 2DQEY 4LGMA 1B5VA 2RGHA 4LT2A 3W6EA 3RZEA 182LA 4NG8A 1R7RA 1I94M 4DV6M 172LA 3RUNA 5FTLA 3TWMA 2C8PA 1JTTL 1T43A 5LINA 4JXJA 1MN3A 208LA 1C64A 4P17A 3A6CY 1LKRA 1GAYA 5JI3E 1LSFA 2BQDA 1ZVYB 4YENA 3BOSA 4IJ4A 3B7QA 3RGSA 163LA 1LMCA 1L48A 4EKPA 1HEWA 4NL4H 2L09A 1L1TA 1WVUA 112LA 166LA 4H93A 1GF0A 1IWTA 4LG2A 1XHBA 184LA 224LA 1FLUA 4DQ5A 1N75A 103LA 3B0KA 4IBIA 4DC4A 1D2NA 3A45A 3U5ZB 4NGLA 1QAQA 1KW7A 4I0CA 2OE9X 4WMGA 2YDGA 4GC9A 3NWLA 2H9JA 2L4EA 2KW0A 4KT0F 1EL1A 4MGIE 1V34A 3HJSA 4DD2A 165LA 2NWDX 2ZYPA 1N32M 3WXTA 4HPIA 3GUIA 4BB9A 5KXLA 1PJSA 3WHKA 2R45A 1NV9A 160LA 3TMWA 4IBGA 1NF5A 2K6BA 2DHYA 2BLYA 2NTHA 4HP0A 1GEZA 4LYCA 3SB7A 2BQKA 4LYTA 1QANA 3L26A 3PNVA 1L22A 4AQNA 1DKJA 3HJ8A 1WQMA 2OU0X 1F6RA 3M3UA 1JITA 4Z98A 3U6MA 3L27A 3TMVA 1QTEA 1LWGA 1IY0A 3FUTA 2LZ2A 4CISA 1T97A 1IVMA 3Q8GA 2EIZC 4Z6YA 4FCTA 3SYLA 2Z4RA 4EKSA 3D4SA 1OQYA 4MCKA 4HEOA 1GFGA 2OEAX 5HNLA 4JI8M 3SAVA 2O25A 4GLAA 196LA 2HAKA 3KDSE 1HEOA 146LA 2JXNA 5FHWA 1LSMA 2VF8A 4JYAM 1J1PY 3EXDA 4W57A 2HHHM 1TCYA 3GLHA 2F5SA 2K0BX 3DMZA 2HL7A 1L88A 4JV5M 2RBPA 4ZFPA 2KDLA 1KIQC 2H5ZA 1IP6A 4TUNA 1BB7A 1L0JA 4EPIA 2IGCA 3SMSA 2BLXA 3GPXA 4DV4M 2B74A 4ETAA 1C7YA 3NBIA 1I4WA 2D7GA 4OWEA 4LZZA 1NKHA 3NY9A 1LZ6A 2BQOA 1L97A 220LA 2DQAA 2QENA 4I7RA 2D91A 4N5RA 2YBIA 3OTOM 3E21A 4I7NA 3DZDA 4LDEA 2KRUA 1DYAA 2MEBA 3C3EA 4IBKA 4D82A 1YAMA 126LA 147LA 2DVWB 3GLIA 1QT4A 3KFUG 3B6LA 3RGPA 1IWZA 4LGYA 161LA 1GB7A 4H9FA 1OFHA 5I5QA 148LE 1I20A 2R62A 1GJTA 120LA 2DAGA 1EQ4A 4KLNA 4AG6A 5A2QS 1LZEA 255LA 142LA 1JTNA 1VDDA 1LSAA 4NGYA 4W94A 3J7BA 2RB2X 1L61A 1GJSA 2MEFA 2XFTA 3AW6A 2QBYB 4ARPA 2DXIA 3LHMA 1TDYA 3VDPA 1RI8B 3C8RA 3LZ2A 1G0LA 1L65A 4WO9A 2DAEA 3ILKA 3TQSA 4B7GA 2QHOB 2XJWA 1HMKA 4DD1A 3F8VA 1L23A 1L56A 3IG8A 1GFVA 5I53A 5E6JA 4K5YA 3I01M 1DV0A 5EP2A 1ZMVA 1I56A 5KPTA 2F4GA 3GLFE 5LYMA 1GE4A 3ZQJA 4XGIA 4ZPXA 1C7PA 3GPYA 3SN6R 1JSEA 3K2LA 4G3OA 5B59A 4XK8F 5ITUA 4GHAA 1CUQA 1GFUA 133LA 2NTGA 1HFYA 1ZAEA 1JQUA 227LA 2HU3A 3HWLA 1QUSA 5KY1A 1PJJA 1BVXA 4YEMA 3WUAA 1OWYA 1D2WA 4E97A 3SATA 201LA 3TXJA 2F2NA 3WW5A 4MH0E 3LQQA 4M9SA 2LVNC 2ZNWY 2LHGA 246LA 4PPOA 3GRUA 2L2DA 6LYZA 1UIHA 1OFIA 3AGHA 4TSBA 5E4PA 4B3TM 3NBXX 1BVKC 3SP3A 1VATA 1XXHE 191LA 234LA 1MU5A 2ZIKA 3K92A 3D8BA 4R71A 3LMMA 3W68A 4I7TA 1UACY 1HERA 2EPEA 4LZTA 4D81A 3CT1A 3AOGA 1CJ7A 3A98B 178LA 185LA 5B1FA 4IBFA 4LCBA 194LA 1OTRA 5KXTA 4JI5M 3JAMS 3LQRA 1KFVA 3A96A 1UC0A 2QARC 2V6ZM 1L11A 1JISA 3V2YA 4WURA 1GBOA 1XEKA 4JI6M 1SXJA 1KY0A 1OVJA 3RU5A 235LA 2B70A 1OAIA 1LGWA 1LYDA 1OV7A 1GE1A 5ITQA 226LA 1WXQA 1P6YA 5C6IA 2EJSA 192LA 1L84A 1NY6A 4DV5M 1XNRM 1L75A 1TGUA 1IWXA 188LA 1L51A 1DZBX 213LA 4W56A 2YBLA 1IC5Y 1QUHA 4NGVA 3SHGB 1D6PA 232LA 5EJCA 3FD9A 2QBYA 1C6QA 1WGLA 4LYMA 1CV1A 1JJ0A 3TXGA 1B7OA 4B08A 1F6SA 3TXIA 4NGJA 109LA 1QUGA 1W08A 2W82A 3A42A 5EXSA 1BWJA 1TDHA 4NSOB 3OE9A 3M0EA 2YBNA 4JI3M 1YILA 7CATA 1WQNA 1L30A 1C6LA 5EP4A 4GBRB 2DKLA 3DN2A 4YOPA 5LYZA 1T8GA 4FCWA 4XENA 3LZTA 5JENB 2BQGA 1NBZC 1KIRC 1FKVA 2CWIA 2HECA 2Q9EA 5FDJA 4II8A 1ZV1A 4CIZA 1K3XA 4FCVA 2BQHA 4RKUF 5FLXS 4BAFA 1OP9B 3RT5X 4WLDA 4DDCA 1C6JA 4N0JA 2RGOA 3WW6A 3W6BA 4FWGA 115LA 2YBJA 1GF4A 4R0FA 3I4YA 4NGKA 1XGUC 5EP1A 4QGZA 3QYEA 1L40A 1CJ6A 2OOBA 5ILFA 1LLHA 1NO1A 1P56A 1CJ9A 2R4EA 102LA 5I4XA 2LYMA 1ZMWA 3SC3A 2A5YB 2R6FA 1PQOA 3RNXA 2WZJA 222LA 4DR1M 2DWLA 1I1ZA 4EKRA 1C6AA 197LA 2M5ZA 2L7IA 2Z8YM 1TBYA 1L73A 249LA 1L98A 3IWRA 4B49A 4OW0A 2MH8A 4GMQA 1LV7A 2Z4SA 1UIBA 2DQGY 2CJLA 3QAUA 1P3QQ 1ZQ9A 1GB8A 4QHSA 3GQ5A 5IELA 3A92A 153LA 2LBCA 1B7NA 1DYCA 1K82A 4C5FA 1QTVA 1UIAA 1L96A 5HMJA 3VK8A 3WHLA 2FYCA 125LA 2R65A 4DAJA 3FE0A 5DNYA 3TMUA 2LH0A 1NJFA 3KXEC 214LA 1O23A 1YL0X 3A34A 3D8LA 4F2LA 1KY1A 3GLHE 2L78A 1L36A 215LA 3HU2A 1C60A 5LAGA 3OE6A 1UCOA 1LHIA 4R6CA 1IWUA 4XYYA 3WU9A 2D7HA 2QQ8A 2WSEF 1NBYC 3GPUA 2MEAA 3A3QA 1L42A 2Z3XA 3UONA 5DL9A 1P5CA 1YIKA 1IP3A 2F30A 2HEEA 1C46A 4QDNA 1L31A 4YX7C 1RE2A 3P66A 4WOAA 3HDFA 1CKCA 1C6KA 2B6WA 4ET9A 2BQEA 1QSAA 4UWUA 3HH4A 4M6DA 1OUDA 4H92A 2K9DA 4XJIA 1QIOA 3ZVQB 3U61A 2CV1A 2X0AA 2BQBA 1L2DA 4NXNM 2Q0MX 2ZQ3A 3G3VA 1D3FA 1FKQA 1YE9A 2UXBM 1Z59A 4DD0A 4B7HA 1VDTA 3EBAB 1L12A 1GKIA 1LJNA 1INUA 2I6ZA 2DENA 2DQHY 1LZ5A 1QAOA 3R9XB 4CGYB 2BQAA 3G3BB 4EOFA 1Q3CA 1GABA 3GLGE 2A7DA 4HL4A 1L66A 4KODA 1GFHA 3KP0E 4DDAA 1LKSA 1OAOC 1LMPA 2LCBA 1L15A 1L28A 3FRHA 4AG5A 3SHFA 4AI6A 2R0IA 5APEA 1JR3A 1LTMA 3SYKA 1XEPA 4NEBA 2LNHC 1T3PA 2XEPA 4BAPA 3HTGA 3J27B 1SWZA 1Z55A 4G4HA 1WR1B 258LA 4NWEA 3RFWA 2ZYCA 3GQ4A 2EQLA 2ZM6M 1IBKM 1LMAA 3HUQA 1LZCA 3HUKA 3HTFA 5APCA 1BB6A 1JJ1A 1XGRC 1WQRA 1LCNA 1OUJA 1LZRA 5C1BA 4DR5M 3LYZA 2HTXA 2RSCA 3JR4A 247LA 1EFUB 3KW6A 3C3DA 4JI1M 4G4NA 2CDSA 3GUNA 2YR0A 1YAQA 1IR9A 3ATOA 3ZCBB 3HHYA 3K1JA 2E5LM 2D4IA 1JKBA 2YBMA 1KYIA 1KXYA 3P64A 3OJPA 1IWWA 1G0KA 1L20A 3FUXA 3DN1A 1G7HC 4I8SA 1SG9A 4KHPM 2DNAA 3IECA 3K2RA 1PQKA 1HHLA 3SFZA 4G4QA 122LA 2VF7A 7LZMA 4NHQA 123LA 4WLXA 4OVZA 5L8RF 4W5WA 6LZMA 3FYDA 2L4FA 1QDRA 1OVKA 5A3ZA 2DKVA 3C81A 1IBLM 4ARMA 1CU3A 2FOIC 2B72A 4IBEA 1G4AE 3CF2A 4GCFA 1JTPL 1OUEA 2R18A 4PK0A 4QY9A 229LA 4O34A 1C67A 1HF4A 1LZ8A 233LA 4FVMA 1J09A 1LSCA 4ARQB 1SX7A 3E3DA 5EBHA 1N34M 4ITQA 2EKKA 4HTKA 4LDOA 2C98A 1ZVHL 2O5RA 2RH1A 5T3FA 4I5SA 3UZUA 1UIEA 3PFIA 2BQIA 1CUPA 127LA 5F3WA 1WTMA 4EPFA 2M60A 1LHKA 4I81A 1IOSA 5BR8M 1V7SA 3ZC7B 3GLGA 189LA 1LHLA 1OKSA 1CKGA 2HKJA 3FE3A 2FS1A 3U6CA 205LA 7LYZA 4I7SA 1IXZA 3VLFB 4B1AA 111LA 1RU3A 1L52A 1GBZA 4DUZM 1C1KA 4ET8A 3VK7A 2G4NA 1IN5A 1LYOA 3U61B 1QAMA 1G59A 2RBSA 3HX3A 2Q9DA 3F9LA 2B7XA 169LA 3KOXE 3AFHA 3CDRA 4TWSA 5KO3A 1D3NA 5KXXA 1IY3A 2ZQ4A 1G07A 2FFJA 3SB5A 4WW0A 1NHBA 1G0JA 4H9EA 4X66M 4CJ2A 2YSSC 3GULA 5C6LA 2J7OA 1D0MA 1XXHA 1TH3A 3GUPA 230LA 3FUWA 4IBCA 4NG1A 1NMMA 2DQFC 1PGYA 2I7PA 3C7ZA 1IM2A 4ETCA 4HJZA 1C45A 1L2BA 1AM7A 167LA 3TE6A 3C9PA 1BB5A 4XJFA 5EXTA 1HNXM 190LA 2JZ1A 4AW4A 1L80A 2XQOA 1E9SA 4FDYA 4ARMB 1HEPA 3JR5A 3TL4X 5DFLA 5DYGA 1XC8A 3SARA 2XBRA 4N1CC 4HV1A 3KVWA 3OE8A 4OVZB 3L29A 2G4QA 1LZBA 1L64A 4RNAA 1XB2B 1B6IA 1L24A 1SWYA 3T6UA 4DT3A 5LVGA 3K8ZA 2XGNA 1XMQM 4DWXA 2FBDA 4LJ5A 2LWXA 1LGXA 4MR1A 2KEBA 3P68A 180LA 2DWNA 5APFA 2QB0B 1PJTA 2MEIA 206LA 2OTYX 3HH5A 2F4VM 1LSYA 3WUMA 1L38A 1QT6A 2OU9A 3G3XA 3WH1A 4XJDA 177LA 1CX6A 3HHWA 2DWZB 1MJGM 1C6BA 1LHHA 1Z5CA 4Q7JA 5F81A 1GF5A 1QTKA 1GL6A 2K47A 3CDTA 4IAPA 3EMLA 1LMOA 1QT5A 2LHMA 4M0DA 1G41A 2RRUA 1B5XA 2UUCM 1L03A 1WVVA 5LAFA 5HMVA 3MMPA 2JNHA 1P36A 2BWEA 3C7YA 4H8YA 3TXFA 4REZA 3HHXA 2CV2A 207LA 4LYZA 4RLNA 3KSXA 2LHCA 3L2XA 1L58A 1HFXA 5KXSA 1GF6A 5F9XA 2C96A 3WL2A 3U60A 4NSIA 3WU8A 174LA 1NY5A 3W6AA 2ANXA 2XTHA 3WPJA 5F16A 1VFBC 5LMNM 1L87A 3AOEA 4RLMA 1P46A 1P7SA 1L59A 5DN5A 3DFZA 4NFVA 1NJGA 1BWIA 1L33A 1DGGA 3SMPA 4W96A 2HEAA 3W6DA 2G5GX 1L92A 4W52A 2IHLA 2CP8A 2HU1A 4GIPA 1D0KA 4H9CA 3HHZA 2HUMA 4LY6A 1K3WA 216LA 1CV0A 4OWAA 4XN6A 4MGHA 3GPPA 1QUTA 1GB5A 1L44A 5KPRA 4ML7A 1LYHA 2Z19A 4XBOA 5FTNA 4J7VA 3HBHA 5D5CA 3L28A 3LZMA 3KAMA 3GRYA 1XGTC 4WM5A 4LJAA 3FTDA 3TPZA 3TXBA 1JIYA 1A5TA 4AGAA 2I25L 4QEQA 1L35A 1T8AA 3LYOA 175LA 4N1EI 240LA 1WJ7A 1K28A 3HH3A 5APDA 4LF5M 238LA 4NGZA 3IG5A 3D3DA 1DYEA 1CV3A 4NSGA 3AJNA 4NHPA 2C9CA 5EXPA 1B5WA 1HMLA 2CWBA 1XWIA 2R4JA 1HNZM 1L49A 1WQQA 2BAAA 4X65M 4CHXA 1TDZA 2XFSA 4IBBA 3KS8A 1D3MA 1L0KA 1TH4A 1LZSA 2NQ8C 183LA 1GFKA 1PQMA 1LYZA 4LFCM 1G7JC 1HSXA 2OO9A 1B5ZA 4W55A 2I7NA 1R4GA 1DYGA 4L16A 2Z39A 2B6ZA 1LYGA 1LJJA 1REZA 1LHMA 3ULRA 4WLYA 1XNQM 4FWHA 132LA 4JI0M 5KQ8A 3T36A 4L15A 4DD3A 3U60B 228LA 2F4AA 152LA 199LA 4RW2A 1N4FA 1YAPA 1TF0B 1LZNA 1L34A 140LA 3HUAA 4AKIA 4OOTA 3DMVA 1L82A 4LFPA 4W58A 1GFRA 4PJ2C 1EQ5A 3AV0A 5E9RA 1L13A 5KXKA 1QS5A 1NHGC 1L01A 221LA 2RAYX 1DO2A 4DV3M 1J7KA 1LOZA 4TUWA 2DI0A 4YY3M 5ILCA 186LA 4H9HA 1IEEA 1KIPC 3E46A 3TXEA 1XSFA 2LVPC 2GQFA 2CFOA 1DI4A 135LA 4G6ZA 3HFMY 4EKQA 5KPZA 4LF7M 241LA 1LYIA 2MGWA 1L81A 4XADA 4B4IA 3C8QA 2PC2A 1L21A 2W1LA 1IN8A 2MEDA 3DMXA 4G9SA 3WYHA 1C69A 1G06A 1EE8A 4LGKA 2R46A 4I7QA 2ZIJA 1CX7A 5KXOA 3ZH9B 2LYOA 2DQCY 5DLAA 3AJIB 1C66A 4LF8M 2CHQA 1JJ3A 4DDBA 1VG5A 2KRKA 5DYIA 3VDUA 4WP2A 1IC7Y 9LYZA 3TXHA 2XF3A 2ZAOA 2LVAA 5FELA 2X4AA 3B0IA 1QZEA 1C43A 1LW9A 1LI2A 2CV0A 1GE2A 151LA 1JWRA 1L05A 1LHJA 2BQNA 1W5SA 4NSRA 154LA 4EXMA 1YLAA 3CTWB 1B5YA 4XJBA 2MEHA 1LYJA 4B3RM 1IP5A 1P2RA 2I26L 3BKHA 3N9EA 4BBAA 3AYQA 1CU0A 1SXJB 1DQJC 5AMYA 1IOTA 2UUAM 1KNIA 3C7WA 3MHVC 3BBZA 2KZUA 1LSEA 1T6VL 3THGA 1XEJA 2MEEA 2F5NA 4BADA 1L95A 1V92A 4G49A 2D4JA 4GRIA 5HQ1A 1SLYA 2LTUA 2JY6B 1GLNA 1HENA 1JB0F 1OIPA 2KNAA 3HJQA 2Y0TA 2CRUA 2FE8A 4KT3A 4H8XA 1LMTA 1L50A 1IY1A 4NHTA 4M9XA 1E9RA 4UN2B 1L77A 4WM6A 3GXRA 4I7OA 1G8PA 1L08A 4L4UA 1GB0A 1P37A 2EKSC 5FEKA 4DV7M 1D6QA 1B7SA 1B7LA 1R2ZA 2QZ4A 1QTHA 1OUHA 1L79A 2FNAA 4OU7A 1LI3A 1OJLA 4NWHA 1L39A 1KXXA 3SAWA 3B7NA 1C6IA 1LZ4A 1JKAA 1L06A 2B5ZA 3CF0A 2ERCA 4JI2M 1T6OA 1L18A 1Q02A 1LSNA 1BWHA 3K9PA 5KJ9A 4I7MA 3A46A 1W6ZA 3VWOA 4HPEA 4QOZC 1L90A 3CQLA 1QZMA 176LA 3LCUA 3DN4A 218LA 1WTHA 4X3BA 4WL6A 2LC9A 1RJCB 1IWYA 1OUIA 3HTBA 2VDBB 2Z6BA 1L86A 4LYBA 1MX0A 2DAMA 3IJVA 4L8RC 1BB4A 2X8AA 1G7IC 1ALCA 3HU3A 6LYTA 3MK6A 4NSHA 1G1WA 1HEQA 4RDSA 2R44A 4LZMA 3GUMA 2G3QA 2APLA 4A3VB 211LA 1GD6A 2HEDA 3UJNA 3FUVA 1C6MA 4GKJM 2OTZX 4Z46A 1V33A 4PCZA 4IATA 1UIGA 4YXCA 1HT2E 1E32A 4GCCA 4FW9A 2DAKA 4GITA 1LJKA 1GDXA 1I6SA 2MJ5B 2G4PA 4AZFA 3K3TA 2CUZA 1CV6A 3FRIA 4DV1M 5LA8A 3J2PB 1HSWA 1C6CA 3B7ZA 3GLIB 1QSWA 2Y8PA 1L32A 1DGFA 4QHTA 4X64M 1SXJD 130LA 4GRVA 4L41A 4H94A 3HT7A 2RBOA 2MROB 3WULA 4LT1A 1TEWA 4YXAC 1L60A 4IASA 3PXGA 4W53A 1QT3A 3A95A 3DKEX 1G0PA 5F14A 4LRSA 4AKHA 1XJTA 4TSCA 3GXKA 2DBTA 4NSJA 4PD2A 1L54A 1UIFA 1L17A 3GUOA 4XJGA 1GVNA 4II7A 1L72A 4CJ6A 1QTZA 1GBXA 2LYZA 3HKPA 4MGYE 5KKIA 3U6PA 1IO5A 3DN6A 3B72A 3WU7A 3TMXA 1NNJA 2DZLA 1LJ3A 3A91A 2EA0A 2DZNB 4UWVA 4N8ZA 1QQWA 1L04A 1VEKA 1L63A 2W1YA 5IDDA 155LA 4NIJA 1L68A 1Q3BA 3KOYE 4GH9A 193LA 1IXSB 1QDTA 1IOQA 1UICA 2HUBA 4M9ZA 3T15A 157LA 4U3XB 1CJ8A 4R3DA 3WVXA 1L1ZA 104LA 3W6FA 1HT1E 1R6BX 1WTNA 4DUYM 1GPQC 2QSFX 181LA 4I7LA 2Z2FA 2CE7A 3GLFA 1C6GA 1C6DA 4WG7A 1G0MA 4LDLA 131LA 3MGWA 1LZDA 4HSFA 3U6SA 1PZYA 4HTQA 3ZVQA 4K0KM 2OU8A 4I4LA 5C6JA 5IWAM 4Y28F 2D7EA 2YBHA 1C62A 4DR7M 3GRVA 5IHGA 4CHTB 2HULA 3DN0A 1L02A 5HNCA 3KS4A 5C18A 3P65A 5IZ7D 3U6QA 8CATA 1WGNA 2YNMD 3I4VA 1VQ1A 1T3TA 2Z12A 4JI7M 3J80S 3HBEX 3WXUA 1DYDA 1REXA 3OK0A 4OO9A 1XXHB 4N9RA 2JY8A 1BGIA 1FLWA 2MEGA 3GLIE 5B05A 1NQIA 2ZWBA 4DQJA 2AHMA 1NNUC 1GXV2 1L41A 171LA 1GBYA 2KNVA 2F5PA 3HDEA 1VDQA 1ZMYL 4GLVA 5HLLA 1REYA 1FLQA 1OUCA 212LA 2B73A 3QWLA 4BS7A 5LA5A 1B2KA 3MJ5A 1B7MA 2LVQD 2ZTDA 5I4WA 4WLTA 4DR6M 198LA 1YKZX 4NY5A 2ZAMA 1NVMA 3AKZA 3D9AC 3T38A 5F9UA 1Y8GA 1CV5A 1JHLA 3UGJA 3GLGB 1L71A 1FDLY 4DKLA 1C65A 1GBWA 4LJ7A 3M18B 4PDGA 1YQVY 3B9PA 1L47A 4OX9M 5KXRA 1EPYA 4TTDA 8LYZA 3LVVA 1IX0A 3UMMA 2LXEA 1GHLA 2O79A 3AZ6A 3C83A 2J5YA 4DV2M 257LA 2VB1A 3QYBA 4ARLA 4PRUA 4ARQA 4GC5A 4B3SM 1LMNA 168LA 1UUZC 2F32A 3M7GA 2F2QA 2B6YA 1T6HA 4OWBA 3SB8A 4S0WA 2ZILA 1CU6A 1L76A 1IP2A 3GP1A 1F0WA 3LN2A 5B1GA 4E3UA 1P2LA 1VDSA 4IBJA 3Q8XA 1OVHA 1YL1X 3LYMA 137LA 4YHHM 3B89A 5I4YA 2GV0A 1L29A 1FN5A 2UUBM 3F92A 3QNGA 5ITYA 4A7DA 1HNWM 3CDQA 3AOEC 2XLJA 4G4OA 1L83A 4HJVA 2QPAA 1G0GA 5L9JA 1DI5A 1R5LA 2VIIA 5LZMA 1C6EA 1L07A 2A7FA 128LA 1QT8A 2GNOA 1WQOA 1D9UA 1LYYA 4W51A 1L62A 1KXWA 4WM1A 1H87A 5K7OA 2OQ4A 149LA 1CTWA 2OPFA 1HQYE 3HT6A 1JUGA 1E94E 2IFFY 1L70A 4PGJB 4KO8A 1CU5A 1GF7A 2P5TA 1L67A 1BQLY 1G7MC 3QAKA 3ZEKA 4NGWA 2H1RA 1TH2A 4ANRA 1LYFA 1L00A 2N35A 1LZGA 2VQFM 4H9BA 1L89A 3SBJA 1LJHA 2N5ZA 2BQLA 3E9SA 3GQ3A 1DGHA 1DI3A 1JSFA 3WUNA 2B75A 2L7HA 1L16A 1IN6A 1VDPA 2YVBA 4LZJA 2UXDM 1Q39A 1WIVA 2L6OA 110LA 1FNNA 2X49A 1C6NA 3HGIA 1HEMA 1VAUA 3W0LB 4DR4M 1CV4A 5ITRA 2F5QA 4G4BA 1Z6TA 262LA 4NHSA 3W0FA 1XFPL 1LSBA 2RAZX 2Z37A 4DYGA 1EIJA 4B3MM 1XGQC 1VEGA 1KS3A 4FD2A 173LA 4J0LA 2Q2EB 3FYCA 1P3NA 4LF6M 5KQDA 1G0QA 1ZURA 4B4EA 2KXEA 138LA 2J7NA 1L99A 4P16A 1R2YA 3QE8A 118LA 3FTEA 1W5TA 1OV5A 2B6XA 4NOOB 3AZ4A 2O01F 261LA 3L25A 4CGEA 1AIPC 3J4GA 3FUUA 3RE8A 4QNRA 2BQFA 1FLYA 1LYEA 3WPKA 3DN8A 2DQIY 4HTNA 150LA 3WVYA 1JR3E 1G1VA 1B9OA 1QSBA 4H8ZA 3BXWA 3FKEA 119LA 1PQDA 3LYTA 1SSYA 3J7AS 1HNLA 1LZ1A 5I14A 1CKDA 2BNKA 2Z38A 4GCEA 1L91A 5IT9S 1L37A 4ARJA 2F5OA 3G3WA 1L43A 139LA 3KOZE 2XZFA 1YKYX 107LA 3LCVB 3WMKA 3A67Y 5EP3A 2BPUA 2BQJA 3FI7A 5B07A 1RFPA 1IC4Y 4DD9A 1IY2A 3CDVA 2RBRA 3B0OA 1DGBA 1BB3A 4PHIA 1D3JA 5KXMA 2Y21A 1IP4A 3IJUA 1GE3A 1GF8A 4PT5A 1QYRA 4S12A 239LA 1C68A 170LA 1AKIA 2Z7JA 3GRRA 3EMSA 4LF9M 2DAIA 2V1CA 1PRBA 2DHRA 3RZ4A 1LAAA 1XMOM 1GF3A 3DA1A 3HZJA 256LA 2RB1X 145LA 4L6V6 4LJ4A 1LJ4A 2CHGA 1BHZA 4LT3A 3A93A 2VQEM 3HBDA 4RF1A 2W1MA 1D0LA 5FSWA 4M4OA 1IN4A 3A94A 1V7TA 4LJ9A 4JN6A 1G3IA 2HCBA 1SQ2L 2JP7A 3CT0A 5FTMA 1L10A 3VKHA 1L45A 3U6DA 1LSGA 4OOOA 4WM2A 4ZIXA 5KXPA 1LGUA 2FBBA 1LSDA 1PM5A 4EMNA 2CHVA 4HJYA 2Y0QA 4GEWA 3RW8A 1KSFX 210LA 5LXWA 3L64A 3U6OA 1A2YC 5IREB 2EKFA 1JPOA 209LA 4X62M 4H90A 3U6EA 2EUCA 5LVJA 1HR0M 5LVIA 3C82A 2JA2A 1HELA 1JTOL 187LA 2DQDY 4IJEA 1LPYA 4R7GA 3GO8A 4GCBA 3A3RX 1TAYA 4DD7A 2XSZA 4WL7A 2CUUA 3R8FA 4LRTA 1L85A 4MB7A 1YSYA 4NC6A 3LW5F 3PNYA 3AB6A 4KPMA 5A3EA 1UA6Y 2CGIA 1JQJC 4GN4A 5II3A 1F10A 1C61A 3T1HM 4LFXA 1LZAA 2Z2EA 2MR9A 3T1YM 2DWMA 1GXXA 4GN3A 3L2AA 108LA 1ZV5L 2OE7X 1GO5A 2QP9X 1DYBA 2RBQA 4NRWA 5BPVA 1RCMA 1IP7A 3NYAA 3CF6E 159LA 1Z5BA 3EIEA 2FH0A 2ZNXY 4ETEA 4H9AA 1GFTA 1L19A 3QY4A 3CB7A 260LA 1MLCE 4WO6A 1QUDA 3HH6A 1OUGA 4B7FA 3SBAA 1YUBA 1REMA 1MELL 4IJFA 1N77A 2AUBA 2LVOC 1VEJA 3TWLA 4Z3MA 1PS5A 4G4CA 2QCUA 1LPIA 3TXKA 1B5UA 1EQEA 4YM8A 3P4ZA 1N78A 4AXTA 1P64A 1L25A 3H4JA 4LYOA 3G3AB 1ORYB 4B4JA 2QNJA 1FBIX 1YROA 3K9OA 4Z8XA 2KHHA 3WPLA 4GKKM 1NDMC 5LVKA 3CSZA 1SX2A 1SSWA 253LA 1QTDA 236LA 3FTCA 3VW7A 1GB6A 2F47A 1HQCA 1NHWC 1OQMA 5EQTA 259LA 4XJHA 1Z5AA 200LA 3I04M 5KXZA 2XZUA 1SXJE 5KXNA 4ETDA 1QS9A 5ITTA 4W59A 3AGGG 4ETBA 1PJQA 3KSJA 3VKGA 1L2CA 4CFPA 1UBZA 2WSCF 1JEFA 1GDWA 4OW1A 2C5RA 3DNAA 4G4RA 4LFBM 1AT6A 243LA 244LA 1SXJC 2YQZA 4I7KA 1QUOA 5FSTA 1GB2A 3SB9A 3ATNA 2RKOA 1IORA 5FTKA 4DBGB 1L14A 1NHEA 1IQPA 3H4MA 1GBSA 4IBDA 1TLAA 4MSTA 4PJZA 4HLQA 1LSPA 4DQ7A 2XH9A 3EIHA 4RW1A 1GB9A 1L46A 2HUKA 1L26A 4J1BA 2UU9M 223LA 237LA 1N36M 1CKFA 3SB6A 2BQMA 1C6FA 3I51A
chains in the Genus database with same CATH topology
1JKDA 4OWCA 1L57A 4WM3A 1JKCA 242LA 2D4KA 1KW5A 5LIOA 1QQYA 3NY8A 114LA 3CSRA 3HU8A 2H9KA 4I7PA 3FI5A 1GEVA 141LA 113LA 1D2YA 1OUAA 4W54A 231LA 164LA 4YEOA 2MECA 1ZYTA 1OUBA 2O4WA 2WARA 1OUFA 4D9ZA 3FA0A 1GE0A 1E8LA 5KKJA 1L69A 250LA 2LZMA 4DJHA 5KXYA 251LA 1LZ9A 4OWHA 4NGOA 1DPXA 1NWGA 1NDGC 1IWVA 3CDOA 3BKVA 143LA 158LA 4NHIA 3DN3A 1H6MA 1IR7A 1L53A 129LA 3AGIA 1C08C 1PQIA 4UWNA 156LA 3HT9A 1G7LC 4EJ4A 1LYSA 1AZFA 2B6TA 1OWZA 1HC0A 1L94A 4LT0A 4KXIA 144LA 1IR8A 1CVKA 1LJFA 4P2EA 245LA 1J1XY 3W3EA 5KXWA 1IY4A 3SBBC 2D6BA 3ODUA 3GUKA 1AT5A 1B7RA 3W6CA 3JR6A 1C6HA 4WM4A 4HV2A 4I7JA 1D9WA 5J7CA 1C63A 5DN4A 5LYTA 3EO5A 2O7AA 1XJUA 1JTMA 3J6KA 2LZTA 5I54A 1LSZA 1QTBA 4ZEEA 134LA 1C6PA 1LJEA 3A90A 2ANVA 5DM9A 1LI6A 2XBSA 4WG1A 3PBLA 4H91A 3CT5A 1GB3A 1CNSA 1DXJA 3N9AA 2DQJY 1XEIA 2FYDA 3C80A 5M1YA 1GFEA 5L3HA 5LVHA 2C8OA 4CFOA 1QTCA 4KL7A 225LA 2HEBA 3N9CA 3GUJA 1L74A 2OE4X 1LMQA 1LWKA 1DYFA 1IP1A 3C8SA 4GCDA 1ZWNA 1DPWA 1J1OY 1DKKA 4J1AA 4GN5C 3OE0A 4PRQA 5D5FA 1GFJA 1QT7A 1L27A 5B06A 4C3WA 1CKHA 4FJRA 162LA 4B0DA 3A6BY 1P2CC 3F6ZA 1PQJA 1B7QA 4Z41A 1LJGA 195LA 2BQCA 248LA 3AW7A 1LZYA 1YANA 5FCPA 1IOCA 4H9IA 2A4TA 1B0DA 1GFAA 1C6TA 3HTDA 1CU2A 4TX7A 4H1PA 1OYUA 1GWDA 5L3IA 219LA 2RB0X 4NGIA 254LA 1GAZA 1T8FA 1L55A 4ZPUA 3FADA 1XGPC 1B7PA 1C10A 1GF9A 2HEFA 1YKXX 3AZ7A 1L93A 1HFZA 4YF2A 2RBNA 3AZ5A 1A4VA 1LJIA 3TXDA 217LA 2Z18A 3PDSA 1L09A 3CSQA 2W1XA 1UIDA 1LZTA 1IIZA 1VEDA 3HU9A 1WQPA 3V2WA 1YAOA 1QSQA 3HT8A 3A8ZA 252LA 2DQEY 1B5VA 4LT2A 3W6EA 3RZEA 182LA 4NG8A 172LA 3RUNA 2C8PA 1JTTL 5LINA 208LA 1C64A 3A6CY 1LKRA 1GAYA 2BQDA 1LSFA 1ZVYB 4YENA 4IJ4A 163LA 1LMCA 1L48A 4EKPA 1HEWA 1WVUA 112LA 166LA 4H93A 1GF0A 1IWTA 184LA 224LA 1FLUA 4DQ5A 103LA 3B0KA 4DC4A 4NGLA 1KW7A 4I0CA 2OE9X 4WMGA 2YDGA 2H9JA 1EL1A 4DD2A 165LA 2NWDX 2ZYPA 3WXTA 4HPIA 3GUIA 5KXLA 3TMWA 160LA 1NF5A 2BLYA 2NTHA 4HP0A 1GEZA 4LYCA 3SB7A 2BQKA 4LYTA 1L22A 4AQNA 1DKJA 2OU0X 1WQMA 3M3UA 1F6RA 1JITA 4Z98A 3TMVA 1QTEA 1LWGA 2LZ2A 1T97A 1IVMA 2EIZC 4EKSA 3D4SA 4MCKA 1GFGA 2OEAX 5HNLA 4GLAA 196LA 1HEOA 146LA 5FHWA 1LSMA 3EXDA 1J1PY 4W57A 1TCYA 3DMZA 1L88A 2RBPA 4ZFPA 1KIQC 2H5ZA 1IP6A 4TUNA 1BB7A 1L0JA 4EPIA 2IGCA 2BLXA 2B74A 4ETAA 4OWEA 1NKHA 3NY9A 1LZ6A 2BQOA 1L97A 220LA 2DQAA 4I7RA 4N5RA 2D91A 2YBIA 4LDEA 4I7NA 1DYAA 2MEBA 1YAMA 126LA 147LA 1QT4A 3B6LA 1IWZA 161LA 1GB7A 4H9FA 5I5QA 148LE 1I20A 120LA 255LA 1EQ4A 1LZEA 142LA 1JTNA 1LSAA 4NGYA 4W94A 2RB2X 1L61A 2MEFA 3AW6A 4ARPA 3LHMA 1TDYA 1RI8B 3C8RA 3LZ2A 1G0LA 1L65A 4WO9A 2XJWA 1HMKA 4DD1A 3F8VA 1L23A 1L56A 1GFVA 5I53A 4K5YA 1I56A 2F4GA 5LYMA 1GE4A 1C7PA 3SN6R 1JSEA 5B59A 1CUQA 1GFUA 133LA 2NTGA 1HFYA 1JQUA 227LA 2HU3A 3HWLA 1QUSA 5KY1A 1BVXA 4YEMA 3WUAA 1OWYA 1D2WA 4E97A 201LA 3TXJA 2F2NA 3WW5A 2ZNWY 246LA 4PPOA 6LYZA 1UIHA 3AGHA 4TSBA 5E4PA 1BVKC 3SP3A 1VATA 191LA 234LA 2ZIKA 4I7TA 1UACY 1HERA 2EPEA 4LZTA 3CT1A 1CJ7A 178LA 185LA 5B1FA 194LA 5KXTA 3A96A 1UC0A 2QARC 1L11A 1JISA 3V2YA 1GBOA 1XEKA 1KY0A 1OVJA 3RU5A 2B70A 235LA 1OV7A 1LGWA 1LYDA 1GE1A 226LA 1P6YA 5C6IA 192LA 1L84A 1L75A 1IWXA 188LA 1L51A 1DZBX 213LA 4W56A 2YBLA 1IC5Y 1QUHA 4NGVA 1D6PA 232LA 1C6QA 4LYMA 1CV1A 1JJ0A 3TXGA 1B7OA 1F6SA 3TXIA 4NGJA 109LA 1QUGA 1W08A 1BWJA 3OE9A 2YBNA 1YILA 1WQNA 1L30A 1C6LA 4GBRB 4YOPA 3DN2A 5LYZA 1T8GA 4XENA 3LZTA 5JENB 2BQGA 1NBZC 1KIRC 1FKVA 2CWIA 2HECA 2Q9EA 5FDJA 4II8A 2BQHA 4BAFA 1OP9B 3RT5X 4WLDA 4DDCA 1C6JA 4N0JA 3WW6A 3W6BA 115LA 2YBJA 1GF4A 4R0FA 4NGKA 1XGUC 4QGZA 1L40A 1CJ6A 5ILFA 1LLHA 1P56A 1CJ9A 102LA 5I4XA 2LYMA 1PQOA 3RNXA 222LA 1I1ZA 4EKRA 1C6AA 197LA 1TBYA 1L73A 249LA 1L98A 3IWRA 4B49A 1UIBA 2DQGY 2CJLA 1GB8A 5IELA 3A92A 153LA 1B7NA 1DYCA 4C5FA 1QTVA 1UIAA 1L96A 5HMJA 2FYCA 125LA 4DAJA 3FE0A 3TMUA 214LA 1O23A 1YL0X 3A34A 1KY1A 2L78A 1L36A 215LA 1C60A 5LAGA 3OE6A 1UCOA 1LHIA 4R6CA 1IWUA 4XYYA 3WU9A 1NBYC 2MEAA 3A3QA 1L42A 3UONA 5DL9A 1P5CA 1YIKA 1IP3A 2F30A 2HEEA 1C46A 4QDNA 1L31A 4YX7C 1RE2A 3P66A 4WOAA 3HDFA 1CKCA 1C6KA 2B6WA 4ET9A 2BQEA 1QSAA 4UWUA 3HH4A 4M6DA 1OUDA 4H92A 4XJIA 1QIOA 3ZVQB 2X0AA 2BQBA 2Q0MX 2ZQ3A 3G3VA 1D3FA 1FKQA 4DD0A 1VDTA 3EBAB 1L12A 1LJNA 1INUA 2I6ZA 2DQHY 1LZ5A 2BQAA 3G3BB 4EOFA 2A7DA 1L66A 1GFHA 4DDAA 1LKSA 1LMPA 2LCBA 1L15A 1L28A 5APEA 1LTMA 1XEPA 4NEBA 1T3PA 4BAPA 3HTGA 4G4HA 1SWZA 1Z55A 258LA 4NWEA 2ZYCA 2EQLA 1LMAA 3HUQA 1LZCA 3HUKA 3HTFA 5APCA 1BB6A 1JJ1A 1XGRC 1WQRA 1LCNA 1OUJA 1LZRA 3LYZA 2HTXA 2RSCA 247LA 2CDSA 3GUNA 1YAQA 1IR9A 3ATOA 2D4IA 1JKBA 2YBMA 1KXYA 3P64A 3OJPA 1IWWA 1G0KA 1L20A 3DN1A 4I8SA 1G7HC 3K2RA 1PQKA 1HHLA 122LA 7LZMA 4NHQA 123LA 4WLXA 6LZMA 1QDRA 1OVKA 5A3ZA 2DKVA 3C81A 4ARMA 1CU3A 2B72A 4GCFA 1JTPL 1OUEA 4PK0A 4QY9A 229LA 4O34A 1C67A 1HF4A 1LZ8A 233LA 1LSCA 4ARQB 1SX7A 3E3DA 5EBHA 4HTKA 4LDOA 1ZVHL 2RH1A 5T3FA 1UIEA 2BQIA 1CUPA 127LA 1WTMA 4EPFA 1LHKA 1IOSA 1V7SA 189LA 1LHLA 1CKGA 205LA 7LYZA 4I7SA 4B1AA 111LA 1L52A 1GBZA 4ET8A 2G4NA 1LYOA 2RBSA 2Q9DA 3F9LA 2B7XA 169LA 4TWSA 3CDRA 1D3NA 5KXXA 1IY3A 2ZQ4A 1G07A 3SB5A 1NHBA 1G0JA 4H9EA 4CJ2A 2YSSC 3GULA 5C6LA 1D0MA 3GUPA 230LA 4NG1A 1NMMA 2DQFC 3C7ZA 4ETCA 4HJZA 1C45A 1AM7A 167LA 1BB5A 4XJFA 190LA 1L80A 2XQOA 4FDYA 4ARMB 1HEPA 2XBRA 4N1CC 4HV1A 3OE8A 2G4QA 1LZBA 1L64A 1L24A 3T6UA 1B6IA 1SWYA 5LVGA 4DT3A 4DWXA 2FBDA 1LGXA 4MR1A 3P68A 180LA 5APFA 2QB0B 2MEIA 206LA 2OTYX 3HH5A 1LSYA 3WUMA 1L38A 1QT6A 2OU9A 3G3XA 3WH1A 4XJDA 177LA 1CX6A 1C6BA 1LHHA 5F81A 1GF5A 1QTKA 3CDTA 4IAPA 3EMLA 1LMOA 1QT5A 2LHMA 1B5XA 1WVVA 5LAFA 1L03A 5HMVA 1P36A 3C7YA 4H8YA 3TXFA 207LA 4LYZA 4RLNA 3L2XA 1L58A 1HFXA 5KXSA 1GF6A 5F9XA 3WL2A 4NSIA 3WU8A 174LA 3W6AA 2ANXA 2XTHA 3WPJA 5F16A 1VFBC 1L87A 4RLMA 1P46A 1P7SA 1L59A 5DN5A 4NFVA 1BWIA 1L33A 4W96A 2HEAA 3W6DA 1L92A 4W52A 2IHLA 2HU1A 1D0KA 4H9CA 2HUMA 216LA 1CV0A 4OWAA 4XN6A 1QUTA 1GB5A 1L44A 4ML7A 1LYHA 2Z19A 4J7VA 3HBHA 5D5CA 3LZMA 3KAMA 1XGTC 4WM5A 3TXBA 1JIYA 4AGAA 2I25L 4QEQA 1L35A 1T8AA 3LYOA 175LA 4N1EI 240LA 1K28A 3HH3A 5APDA 238LA 4NGZA 3D3DA 1DYEA 1CV3A 4NSGA 3AJNA 4NHPA 1B5WA 1HMLA 1L49A 1WQQA 2BAAA 4CHXA 1D3MA 1L0KA 1LZSA 183LA 1GFKA 1PQMA 1LYZA 1G7JC 1HSXA 1B5ZA 4W55A 1DYGA 2Z39A 2B6ZA 1LYGA 1LJJA 1REZA 1LHMA 3ULRA 4WLYA 132LA 3T36A 4DD3A 228LA 2F4AA 152LA 199LA 4RW2A 1N4FA 1YAPA 1LZNA 1L34A 140LA 3HUAA 4OOTA 3DMVA 1L82A 4LFPA 4W58A 1GFRA 4PJ2C 1EQ5A 5E9RA 1L13A 5KXKA 1QS5A 1L01A 221LA 2RAYX 1LOZA 5ILCA 186LA 4H9HA 1IEEA 1KIPC 3TXEA 1XSFA 1DI4A 135LA 3HFMY 4EKQA 241LA 1LYIA 1L81A 4XADA 4B4IA 3C8QA 2PC2A 1L21A 2W1LA 2MEDA 3DMXA 4G9SA 3WYHA 1C69A 1G06A 4LGKA 4I7QA 2ZIJA 1CX7A 5KXOA 2LYOA 2DQCY 5DLAA 1C66A 1JJ3A 4DDBA 1IC7Y 9LYZA 3TXHA 5FELA 3B0IA 1C43A 1LW9A 1LI2A 1GE2A 151LA 1JWRA 1L05A 1LHJA 2BQNA 154LA 4EXMA 1B5YA 4XJBA 2MEHA 1LYJA 1IP5A 1P2RA 2I26L 3BKHA 3N9EA 3AYQA 1CU0A 1DQJC 5AMYA 1IOTA 1KNIA 3C7WA 1LSEA 1T6VL 1XEJA 2MEEA 4BADA 1L95A 4G49A 2D4JA 5HQ1A 1SLYA 1HENA 4KT3A 4H8XA 1LMTA 1L50A 4NHTA 1L77A 4WM6A 3GXRA 4I7OA 1L08A 1GB0A 1P37A 2EKSC 5FEKA 1D6QA 1B7SA 1B7LA 1QTHA 1OUHA 1L79A 1LI3A 4NWHA 1L39A 1KXXA 1C6IA 1LZ4A 1JKAA 1L06A 2B5ZA 1L18A 1LSNA 1BWHA 5KJ9A 4I7MA 1W6ZA 3VWOA 4HPEA 1L90A 3CQLA 176LA 3DN4A 218LA 1WTHA 4X3BA 4WL6A 2LC9A 1RJCB 1IWYA 1OUIA 3HTBA 2Z6BA 1L86A 4LYBA 3IJVA 1BB4A 1G7IC 1ALCA 6LYTA 4NSHA 1G1WA 1HEQA 4RDSA 4LZMA 3GUMA 211LA 1GD6A 2HEDA 1C6MA 2OTZX 4Z46A 4IATA 1UIGA 4YXCA 4GCCA 1LJKA 1GDXA 1I6SA 2G4PA 3K3TA 1CV6A 5LA8A 1HSWA 1C6CA 1QSWA 2Y8PA 1L32A 130LA 4L41A 4GRVA 4H94A 3HT7A 2RBOA 3WULA 4LT1A 1TEWA 4YXAC 1L60A 4IASA 4W53A 1QT3A 3A95A 3DKEX 1G0PA 5F14A 4TSCA 1XJTA 3GXKA 2DBTA 4NSJA 1L54A 1UIFA 1L17A 3GUOA 4XJGA 1L72A 1QTZA 1GBXA 2LYZA 5KKIA 1IO5A 3DN6A 3B72A 3WU7A 3TMXA 1LJ3A 3A91A 4UWVA 4N8ZA 1L04A 1L63A 2W1YA 5IDDA 155LA 4NIJA 1L68A 193LA 1QDTA 1IOQA 1UICA 2HUBA 157LA 4U3XB 1CJ8A 3WVXA 104LA 3W6FA 1WTNA 1GPQC 181LA 4I7LA 2Z2FA 1C6GA 1C6DA 4WG7A 1G0MA 4LDLA 131LA 3MGWA 1LZDA 4HSFA 1PZYA 4HTQA 3ZVQA 2OU8A 5C6JA 2YBHA 1C62A 5IHGA 2HULA 3DN0A 1L02A 5HNCA 3P65A 2Z12A 3HBEX 3WXUA 1DYDA 1REXA 3OK0A 4OO9A 4N9RA 1BGIA 1FLWA 2MEGA 5B05A 1NQIA 2ZWBA 4DQJA 1GXV2 1L41A 171LA 1GBYA 3HDEA 1VDQA 1ZMYL 4GLVA 5HLLA 1REYA 1FLQA 1OUCA 212LA 2B73A 4BS7A 5LA5A 1B2KA 1B7MA 5I4WA 4WLTA 198LA 1YKZX 4NY5A 3D9AC 5F9UA 1CV5A 1JHLA 1L71A 1FDLY 4DKLA 1C65A 1GBWA 3M18B 1YQVY 1L47A 5KXRA 1EPYA 4TTDA 8LYZA 1IX0A 2O79A 1GHLA 3C83A 3AZ6A 257LA 2VB1A 4ARLA 4PRUA 4ARQA 1LMNA 168LA 1UUZC 2F32A 2F2QA 2B6YA 1T6HA 4OWBA 3SB8A 4S0WA 2ZILA 1CU6A 1L76A 1IP2A 3LN2A 1F0WA 5B1GA 4E3UA 1P2LA 1VDSA 1OVHA 1YL1X 3LYMA 137LA 5I4YA 2GV0A 1L29A 1FN5A 3QNGA 4A7DA 3CDQA 1L83A 4HJVA 1G0GA 5L9JA 1DI5A 5LZMA 1C6EA 1L07A 2A7FA 128LA 1QT8A 1WQOA 1D9UA 1LYYA 4W51A 1L62A 1KXWA 4WM1A 1H87A 5K7OA 149LA 1CTWA 3HT6A 1JUGA 2IFFY 1L70A 4PGJB 1CU5A 1GF7A 1L67A 1BQLY 1G7MC 3QAKA 3ZEKA 4NGWA 4ANRA 1LYFA 1L00A 1LZGA 4H9BA 1L89A 2N5ZA 1LJHA 2BQLA 1DI3A 1JSFA 3WUNA 2B75A 1L16A 1VDPA 2YVBA 110LA 1C6NA 1HEMA 1VAUA 1CV4A 4G4BA 262LA 4NHSA 1XFPL 1LSBA 2RAZX 2Z37A 4DYGA 1XGQC 1KS3A 173LA 4J0LA 1P3NA 1G0QA 1ZURA 4B4EA 138LA 1L99A 3QE8A 118LA 1OV5A 2B6XA 3AZ4A 261LA 4CGEA 3J4GA 2BQFA 1FLYA 1LYEA 3WPKA 3DN8A 2DQIY 4HTNA 150LA 3WVYA 1G1VA 1B9OA 1QSBA 4H8ZA 119LA 1PQDA 3LYTA 1SSYA 1HNLA 1LZ1A 5I14A 1CKDA 2Z38A 4GCEA 1L91A 1L37A 4ARJA 3G3WA 1L43A 139LA 1YKYX 107LA 3WMKA 3A67Y 2BPUA 2BQJA 3FI7A 5B07A 1RFPA 1IC4Y 4DD9A 3CDVA 2RBRA 3B0OA 1BB3A 4PHIA 1D3JA 5KXMA 1IP4A 3IJUA 1GE3A 1GF8A 239LA 1C68A 170LA 1AKIA 3EMSA 3RZ4A 1LAAA 1GF3A 256LA 2RB1X 145LA 1LJ4A 1BHZA 4LT3A 3A93A 3HBDA 2W1MA 1D0LA 4M4OA 3A94A 1V7TA 1SQ2L 3CT0A 1L10A 1L45A 1LSGA 4OOOA 4WM2A 4ZIXA 5KXPA 1LGUA 2FBBA 1LSDA 4EMNA 4HJYA 5LXWA 3RW8A 210LA 3L64A 1A2YC 1JPOA 209LA 4H90A 5LVJA 5LVIA 3C82A 1HELA 1JTOL 187LA 2DQDY 1LPYA 4GCBA 3A3RX 1TAYA 4DD7A 4WL7A 2CUUA 1L85A 3AB6A 4KPMA 5A3EA 1UA6Y 2CGIA 4GN4A 5II3A 1F10A 1C61A 4LFXA 1LZAA 2Z2EA 1GXXA 4GN3A 108LA 1ZV5L 2OE7X 1DYBA 2RBQA 1RCMA 1IP7A 3NYAA 159LA 2ZNXY 4ETEA 4H9AA 1GFTA 1L19A 3QY4A 3CB7A 260LA 1MLCE 4WO6A 1QUDA 3HH6A 1OUGA 3SBAA 1REMA 1MELL 2AUBA 4Z3MA 1PS5A 4G4CA 1LPIA 3TXKA 1B5UA 1EQEA 4YM8A 3P4ZA 4AXTA 1P64A 1L25A 4LYOA 3G3AB 4B4JA 1FBIX 1YROA 3WPLA 1NDMC 5LVKA 3CSZA 1SX2A 1SSWA 253LA 1QTDA 236LA 3VW7A 1GB6A 2F47A 1OQMA 259LA 4XJHA 200LA 5KXZA 4ETDA 5KXNA 1QS9A 4W59A 3AGGG 4ETBA 4CFPA 1UBZA 1JEFA 4OW1A 1GDWA 3DNAA 1AT6A 243LA 244LA 4I7KA 1QUOA 5FSTA 1GB2A 3SB9A 3ATNA 1IORA 1NHEA 1L14A 1GBSA 1TLAA 4MSTA 4PJZA 1LSPA 4DQ7A 4RW1A 1GB9A 1L46A 2HUKA 1L26A 4J1BA 223LA 237LA 1CKFA 3SB6A 2BQMA 1C6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKD A;  1C7P A;  1BGI A;  1FLW A;  2MEG A;  1JSE A;  2MEI A;  5B59 A;  4OWC A;  5B05 A;  4WM3 A;  1NQI A;  1JKC A;  2D4K A;  2ZWB A;  1GXV 2;  1GBY A;  5LIO A;  1QQY A;  1LSY A;  1GFU A;  133L A;  3CSR A;  1HFY A;  2H9K A;  3WUM A;  2HU3 A;  4GLV A;  1QUS A;  1GEV A;  1VDQ A;  1ZMY L;  5HLL A;  3WH1 A;  5KY1 A;  1REY A;  1FLQ A;  4XJD A;  1OUC A;  1BVX A;  4YEM A;  3WUA A;  1OUA A;  1LHH A;  4YEO A;  4BS7 A;  3TXJ A;  5LA5 A;  5F81 A;  2F2N A;  1B2K A;  1GF5 A;  2MEC A;  1QTK A;  3WW5 A;  1B7M A;  2ZNW Y;  2WAR A;  1OUB A;  1LMO A;  1OUF A;  5I4W A;  4PPO A;  4WLT A;  2LHM A;  1B5X A;  1WVV A;  1YKZ X;  5LAF A;  4D9Z A;  6LYZ A;  1UIH A;  4NY5 A;  3D9A C;  5HMV A;  1GE0 A;  3AGH A;  4TSB A;  5E4P A;  1BVK C;  5F9U A;  3SP3 A;  4H8Y A;  1VAT A;  3TXF A;  207L A;  4LYZ A;  4RLN A;  5KKJ A;  1JHL A;  1E8L A;  2ZIK A;  1FDL Y;  1UAC Y;  1HER A;  2EPE A;  1GBW A;  1HFX A;  3M18 B;  4LZT A;  5KXS A;  1YQV Y;  1GF6 A;  5F9X A;  3CT1 A;  3WL2 A;  4NSI A;  3WU8 A;  1CJ7 A;  5KXY A;  5KXR A;  3W6A A;  4TTD A;  2XTH A;  1LZ9 A;  4OWH A;  5B1F A;  3WPJ A;  8LYZ A;  4NGO A;  1DPX A;  1NWG A;  5F16 A;  1IX0 A;  1VFB C;  1NDG C;  194L A;  4RLM A;  5KXT A;  1IWV A;  3BKV A;  1GHL A;  3A96 A;  3AZ6 A;  5DN5 A;  4NFV A;  2VB1 A;  1UC0 A;  1BWI A;  4NHI A;  4PRU A;  1H6M A;  1JIS A;  1LMN A;  1IR7 A;  4W96 A;  1GBO A;  2HEA A;  3W6D A;  1UUZ C;  1XEK A;  3AGI A;  1C08 C;  4OWB A;  4UWN A;  3RU5 A;  2IHL A;  2ZIL A;  5B1G A;  1IP2 A;  3LN2 A;  1F0W A;  1G7L C;  2HU1 A;  1GE1 A;  4E3U A;  1D0K A;  4H9C A;  1LYS A;  5C6I A;  1AZF A;  1VDS A;  1YL1 X;  3LYM A;  1HC0 A;  4LT0 A;  4OWA A;  4XN6 A;  4KXI A;  5I4Y A;  1IR8 A;  1QUT A;  1IWX A;  1GB5 A;  2GV0 A;  1LJF A;  4P2E A;  1FN5 A;  4ML7 A;  1DZB X;  3QNG A;  4A7D A;  1J1X Y;  3W3E A;  2YBL A;  1IY4 A;  1IC5 Y;  4NGV A;  5KXW A;  2Z19 A;  2D6B A;  1D6P A;  4J7V A;  3HBH A;  5D5C A;  4HJV A;  3KAM A;  1XGT C;  4WM5 A;  5L9J A;  1DI5 A;  4LYM A;  1JJ0 A;  3TXG A;  1B7O A;  1AT5 A;  1B7R A;  3W6C A;  3TXB A;  1F6S A;  1JIY A;  4NGJ A;  3TXI A;  4AGA A;  2I25 L;  4QEQ A;  1W08 A;  2A7F A;  3LYO A;  4WM4 A;  4HV2 A;  5J7C A;  4N1E I;  5DN4 A;  1BWJ A;  5LYT A;  1WQO A;  1D9U A;  3EO5 A;  1LYY A;  4NGZ A;  5APD A;  3D3D A;  2YBN A;  1YIL A;  4NSG A;  1KXW A;  3J6K A;  1H87 A;  2LZT A;  4WM1 A;  5K7O A;  1WQN A;  3AJN A;  4NHP A;  1JUG A;  5I54 A;  4YOP A;  5LYZ A;  1LSZ A;  2IFF Y;  1B5W A;  134L A;  4PGJ B;  3LZT A;  4XEN A;  4ZEE A;  1LJE A;  1HML A;  3A90 A;  5JEN B;  1GF7 A;  2BQG A;  1NBZ C;  1KIR C;  1FKV A;  2CWI A;  1WQQ A;  2HEC A;  1BQL Y;  2BAA A;  5DM9 A;  4CHX A;  5FDJ A;  1G7M C;  3ZEK A;  2XBS A;  4II8 A;  4NGW A;  4WG1 A;  4ANR A;  3CT5 A;  1GB3 A;  4H91 A;  1CNS A;  1LZG A;  2BQH A;  4BAF A;  1DXJ A;  1OP9 B;  4H9B A;  2N5Z A;  1LJH A;  1LZS A;  3N9A A;  4WLD A;  3RT5 X;  4DDC A;  1GFK A;  2BQL A;  2DQJ Y;  1LYZ A;  1XEI A;  2FYD A;  4N0J A;  3WW6 A;  1G7J C;  3W6B A;  1HSX A;  1DI3 A;  1B5Z A;  1JSF A;  3WUN A;  2YBJ A;  5M1Y A;  1GFE A;  1GF4 A;  5L3H A;  5LVH A;  2C8O A;  4R0F A;  4CFO A;  4NGK A;  1XGU C;  4QGZ A;  1CJ6 A;  2Z39 A;  5ILF A;  1LJJ A;  1REZ A;  1VDP A;  1LHM A;  4KL7 A;  2YVB A;  3ULR A;  4WLY A;  3WMK A;  132L A;  1CJ9 A;  2HEB A;  5I4X A;  3T36 A;  3N9C A;  2LYM A;  4DD3 A;  1HEM A;  1LMQ A;  1VAU A;  2F4A A;  3RNX A;  4RW2 A;  1N4F A;  1I1Z A;  1YAP A;  1IP1 A;  1LZN A;  4G4B A;  4NHS A;  4GCD A;  4OOT A;  1XFP L;  1DPW A;  1TBY A;  4LFP A;  1LSB A;  1GFR A;  1J1O Y;  1DKK A;  4PJ2 C;  1EQ5 A;  2Z37 A;  4DYG A;  4J1A A;  3IWR A;  5E9R A;  4B49 A;  5KXK A;  4GN5 C;  1XGQ C;  4PRQ A;  1UIB A;  5D5F A;  1GFJ A;  4J0L A;  2DQG Y;  2CJL A;  1LOZ A;  1GB8 A;  5B06 A;  4C3W A;  5IEL A;  1CKH A;  3A92 A;  4FJR A;  153L A;  5ILC A;  1B7N A;  4B0D A;  3A6B Y;  1P2C C;  1UIA A;  4C5F A;  4H9H A;  1IEE A;  5HMJ A;  3F6Z A;  1KIP C;  3TXE A;  2FYC A;  4B4E A;  1XSF A;  1B7Q A;  3FE0 A;  1DI4 A;  4Z41 A;  135L A;  3HFM Y;  3TMU A;  1LJG A;  2BQC A;  3AW7 A;  1LZY A;  1O23 A;  1YAN A;  1YL0 X;  5FCP A;  3A34 A;  1IOC A;  4H9I A;  1B0D A;  1GFA A;  4XAD A;  4B4I A;  3QE8 A;  4TX7 A;  2PC2 A;  2W1L A;  2MED A;  4G9S A;  5LAG A;  4H1P A;  3AZ4 A;  3WYH A;  1UCO A;  1GWD A;  1LHI A;  4LGK A;  4R6C A;  4CGE A;  5L3I A;  1IWU A;  3J4G A;  2ZIJ A;  4XYY A;  3WU9 A;  4NGI A;  1NBY C;  2BQF A;  5KXO A;  1GAZ A;  1FLY A;  3WPK A;  2LYO A;  2MEA A;  2DQI Y;  2DQC Y;  3A3Q A;  4HTN A;  5DLA A;  3WVY A;  5DL9 A;  1XGP C;  1B9O A;  1IP3 A;  1YIK A;  2F30 A;  1C46 A;  1JJ3 A;  2HEE A;  1B7P A;  4H8Z A;  4DDB A;  1C10 A;  1GF9 A;  2HEF A;  4QDN A;  1IC7 Y;  1RE2 A;  1YKX X;  3AZ7 A;  3TXH A;  9LYZ A;  1HFZ A;  3P66 A;  4WOA A;  1CKC A;  3LYT A;  5FEL A;  4ET9 A;  1HNL A;  4YF2 A;  2BQE A;  1LZ1 A;  1QSA A;  3B0I A;  4UWU A;  1C43 A;  4M6D A;  1OUD A;  1CKD A;  3AZ5 A;  4H92 A;  1GE2 A;  1A4V A;  1JWR A;  2BQN A;  1LHJ A;  4XJI A;  154L A;  1QIO A;  2Z38 A;  1LJI A;  3ZVQ B;  4GCE A;  3TXD A;  2X0A A;  2BQB A;  2Z18 A;  1B5Y A;  2Q0M X;  2ZQ3 A;  4XJB A;  2MEH A;  1YKY X;  2W1X A;  3CSQ A;  1UID A;  1IP5 A;  1FKQ A;  1LZT A;  2I26 L;  3A67 Y;  1IIZ A;  1VED A;  3BKH A;  1WQP A;  2BPU A;  2BQJ A;  3AYQ A;  3FI7 A;  4DD0 A;  1YAO A;  5B07 A;  1DQJ C;  1VDT A;  5AMY A;  1IOT A;  1RFP A;  1IC4 Y;  3EBA B;  4DD9 A;  3A8Z A;  3B0O A;  1BB3 A;  1LJN A;  2DQE Y;  1INU A;  4PHI A;  2I6Z A;  1B5V A;  4LT2 A;  2DQH Y;  3N9E A;  3W6E A;  1LZ5 A;  1LSE A;  2BQA A;  5KXM A;  1IP4 A;  3G3B B;  1T6V L;  3IJU A;  4EOF A;  1XEJ A;  1GE3 A;  4NG8 A;  1GF8 A;  2A7D A;  2MEE A;  4BAD A;  1GFH A;  4G49 A;  2D4J A;  2C8P A;  4DDA A;  5HQ1 A;  1JTT L;  5LIN A;  1AKI A;  1LKS A;  1SLY A;  1LMP A;  3EMS A;  1HEN A;  208L A;  3RZ4 A;  3A6C Y;  1LAA A;  1GF3 A;  4KT3 A;  4H8X A;  1LKR A;  1LMT A;  5APE A;  1LTM A;  1GAY A;  1LJ4 A;  1LSF A;  2BQD A;  1BHZ A;  4NEB A;  4LT3 A;  3A93 A;  1ZVY B;  4NHT A;  4YEN A;  1T3P A;  4IJ4 A;  4WM6 A;  4BAP A;  4G4H A;  3HBD A;  3GXR A;  1Z55 A;  2W1M A;  1D0L A;  1GB0 A;  4M4O A;  4NWE A;  2EKS C;  3A94 A;  5FEK A;  1V7T A;  1LMC A;  2ZYC A;  1SQ2 L;  1HEW A;  1D6Q A;  1B7S A;  1LMA A;  2EQL A;  1WVU A;  3CT0 A;  1LZC A;  5APC A;  1B7L A;  1BB6 A;  1JJ1 A;  1XGR C;  4H93 A;  1OUH A;  1GF0 A;  1WQR A;  1LCN A;  1OUJ A;  1IWT A;  1LSG A;  4NWH A;  4OOO A;  1FLU A;  4WM2 A;  4ZIX A;  1KXX A;  1LZR A;  3B0K A;  3LYZ A;  5KXP A;  2HTX A;  2RSC A;  4DC4 A;  4NGL A;  2FBB A;  1LSD A;  1LZ4 A;  1JKA A;  2B5Z A;  4HJY A;  4EMN A;  5LXW A;  3RW8 A;  2CDS A;  4I0C A;  1LSN A;  1BWH A;  1A2Y C;  5KJ9 A;  4WMG A;  1YAQ A;  1IR9 A;  1W6Z A;  2YDG A;  3ATO A;  1JPO A;  4HPE A;  3VWO A;  2H9J A;  3CQL A;  4H90 A;  1EL1 A;  2D4I A;  5LVJ A;  1JKB A;  2YBM A;  4DD2 A;  1KXY A;  5LVI A;  2NWD X;  2ZYP A;  3OJP A;  3P64 A;  3WXT A;  1IWW A;  1HEL A;  4HPI A;  4X3B A;  4WL6 A;  5KXL A;  1JTO L;  1RJC B;  1IWY A;  1OUI A;  4I8S A;  1G7H C;  2DQD Y;  3TMW A;  1NF5 A;  4LYB A;  1HHL A;  4GCB A;  3IJV A;  2BLY A;  1TAY A;  3A3R X;  1BB4 A;  4HP0 A;  1G7I C;  1GEZ A;  4DD7 A;  1ALC A;  4WL7 A;  4NHQ A;  6LYT A;  4LYC A;  4NSH A;  2BQK A;  4WLX A;  4LYT A;  1HEQ A;  1QDR A;  4RDS A;  1DKJ A;  5A3Z A;  2DKV A;  1GD6 A;  3M3U A;  1WQM A;  1F6R A;  3AB6 A;  1JIT A;  2HED A;  4KPM A;  4Z98 A;  5A3E A;  1UA6 Y;  3TMV A;  2CGI A;  1QTE A;  4GN4 A;  4GCF A;  4Z46 A;  1JTP L;  5II3 A;  1F10 A;  1OUE A;  2LZ2 A;  4IAT A;  1UIG A;  4LFX A;  4QY9 A;  4GCC A;  1LZA A;  2Z2E A;  4O34 A;  1IVM A;  1HF4 A;  2EIZ C;  1LZ8 A;  1GXX A;  4GN3 A;  1LJK A;  1LSC A;  1GDX A;  1ZV5 L;  3E3D A;  5EBH A;  2G4P A;  3K3T A;  1RCM A;  4HTK A;  1GFG A;  4MCK A;  1IP7 A;  5HNL A;  1ZVH L;  4GLA A;  5LA8 A;  2ZNX Y;  5T3F A;  1HEO A;  4ETE A;  4H9A A;  1GFT A;  3QY4 A;  3CB7 A;  5FHW A;  1LSM A;  1HSW A;  1J1P Y;  1MLC E;  3EXD A;  1UIE A;  2BQI A;  4WO6 A;  1TCY A;  1OUG A;  1QSW A;  2Y8P A;  1REM A;  1MEL L;  1WTM A;  1LHK A;  4L41 A;  2AUB A;  1IOS A;  4H94 A;  4Z3M A;  1PS5 A;  1V7S A;  4G4C A;  4ZFP A;  1KIQ C;  2H5Z A;  1LPI A;  4LT1 A;  1IP6 A;  1TEW A;  3TXK A;  1B5U A;  1EQE A;  1LHL A;  4TUN A;  3WUL A;  3P4Z A;  4YM8 A;  4AXT A;  1BB7 A;  1CKG A;  4IAS A;  3A95 A;  7LYZ A;  5F14 A;  4TSC A;  4B1A A;  3GXK A;  2DBT A;  4NSJ A;  4LYO A;  3G3A B;  1UIF A;  4XJG A;  1GBZ A;  2BLX A;  4B4J A;  1FBI X;  1YRO A;  4ET8 A;  1GBX A;  2G4N A;  4ETA A;  3WPL A;  1LYO A;  2LYZ A;  1NDM C;  4OWE A;  5KKI A;  1IO5 A;  1NKH A;  1LZ6 A;  2BQO A;  5LVK A;  3B72 A;  3WU7 A;  3TMX A;  2DQA A;  3CSZ A;  4N5R A;  2D91 A;  2YBI A;  1LJ3 A;  3A91 A;  1GB6 A;  4UWV A;  4N8Z A;  4TWS A;  2MEB A;  1YAM A;  2W1Y A;  5IDD A;  5KXX A;  4NIJ A;  1OQM A;  1IY3 A;  2ZQ4 A;  193L A;  1QDT A;  3B6L A;  4XJH A;  1IOQ A;  1IWZ A;  1UIC A;  2HUB A;  1GB7 A;  4U3X B;  5KXZ A;  4ETD A;  5KXN A;  1CJ8 A;  4H9F A;  5I5Q A;  3WVX A;  1I20 A;  3W6F A;  4H9E A;  1WTN A;  4CJ2 A;  2YSS C;  3AGG G;  1GPQ C;  4ETB A;  1EQ4 A;  5C6L A;  1D0M A;  1LZE A;  2Z2F A;  4CFP A;  1UBZ A;  1LSA A;  1JEF A;  1NMM A;  1GDW A;  4NG1 A;  4OW1 A;  2DQF C;  4NGY A;  4WG7 A;  4W94 A;  1AT6 A;  2MEF A;  4ETC A;  3AW6 A;  4HJZ A;  1C45 A;  3MGW A;  3LHM A;  1LZD A;  1AM7 A;  1TDY A;  1PZY A;  4HSF A;  4HTQ A;  5FST A;  1RI8 B;  3ZVQ A;  1BB5 A;  1GB2 A;  4XJF A;  5C6J A;  3LZ2 A;  3ATN A;  1IOR A;  1NHE A;  4WO9 A;  1GBS A;  2YBH A;  4FDY A;  4MST A;  5IHG A;  1HEP A;  1LSP A;  2XJW A;  1HMK A;  4DD1 A;  5HNC A;  2XBR A;  4RW1 A;  3P65 A;  1GB9 A;  4N1C C;  1GFV A;  4HV1 A;  5I53 A;  2G4Q A;  1LZB A;  4J1B A;  3T6U A;  5LVG A;  4DT3 A;  2Z12 A;  1I56 A;  4DWX A;  2F4G A;  2FBD A;  3HBE X;  1CKF A;  3WXU A;  5LYM A;  1GE4 A;  4MR1 A;  1REX A;  3OK0 A;  2BQM A;  3P68 A;  4N9R A;  5APF A; 
#chains in the Genus database with same CATH topology
 4DR2 M;  1JKD A;  4M0W A;  4OWC A;  1L57 A;  4PDI A;  4WM3 A;  4LJ6 A;  1JKC A;  242L A;  1KW5 A;  2D4K A;  3KOW E;  5LIO A;  4QOS A;  1QQY A;  2KNZ A;  114L A;  3NY8 A;  3CSR A;  3HU8 A;  3B74 A;  2H9K A;  4I7P A;  3FI5 A;  1GEV A;  3T6P A;  141L A;  113L A;  1D2Y A;  1OUA A;  4W54 A;  231L A;  164L A;  4YEO A;  3J81 S;  1WHC A;  2MEC A;  1HJP A;  1ZYT A;  1OUB A;  2O4W A;  2WAR A;  2OOA A;  1DGH B;  1OUF A;  1IN7 A;  4D9Z A;  3FA0 A;  3SAS A;  4IIW A;  5EXX A;  1GL7 A;  1GE0 A;  3HWS A;  1E8L A;  5KKJ A;  1UFZ A;  1L69 A;  250L A;  1TTE A;  3DOA A;  2BWB A;  2LZM A;  4MGZ E;  4DJH A;  1NSF A;  3GLH B;  5KXY A;  251L A;  1LZ9 A;  4OWH A;  4NGO A;  1DPX A;  1NWG A;  1NDG C;  2XSZ D;  1IWV A;  3CDO A;  2JZ0 A;  3BKV A;  1H6U A;  143L A;  3CGW A;  158L A;  4NHI A;  2HWJ A;  3DN3 A;  1H6M A;  4LJ8 A;  1IXR C;  1IR7 A;  2ZTC A;  3V76 A;  3AL0 C;  1L53 A;  1VDL A;  129L A;  3AGI A;  1AUA A;  1C08 C;  1PQI A;  4UWN A;  156L A;  3HT9 A;  1G7L C;  2B3T A;  4EJ4 A;  2BJV A;  1LYS A;  1AZF A;  2B6T A;  1OWZ A;  1HC0 A;  1L94 A;  4LT0 A;  4KXI A;  2H5X A;  144L A;  1IR8 A;  2CEA A;  2UXC M;  1CVK A;  1LJF A;  4P2E A;  245L A;  1ZMU A;  1PJI A;  1J1X Y;  3W3E A;  5KXW A;  1IY4 A;  3SBB C;  2JY7 A;  2D6B A;  3ODU A;  2C9O A;  3GUK A;  3TWK A;  4MM3 B;  1AT5 A;  2JWS A;  1B7R A;  3W6C A;  1L8Q A;  3JR6 A;  2JUJ A;  1C6H A;  4WM4 A;  4HV2 A;  4I7J A;  4JI4 M;  1D9W A;  1C63 A;  5DN4 A;  5J7C A;  5GKN A;  5LYT A;  3EO5 A;  2O7A A;  1XJU A;  4GHL A;  1JR3 D;  1JTM A;  3J6K A;  2LZT A;  5I54 A;  5ITX E;  3UK6 A;  1LSZ A;  4AKG A;  1QTB A;  1BVS A;  134L A;  1OIZ A;  1C6P A;  4ZEE A;  1LJE A;  3A90 A;  2ANV A;  3U5Z A;  2YFQ A;  5DM9 A;  1LI6 A;  2XBS A;  4WG1 A;  5JI2 E;  3PBL A;  4H91 A;  3CT5 A;  1GB3 A;  3FTF A;  1J5E M;  4QNM A;  1CNS A;  1DXJ A;  3N9A A;  4NRV A;  2DQJ Y;  1XEI A;  2FYD A;  3C80 A;  3HU1 A;  4DR3 M;  5M1Y A;  3GLF B;  1GFE A;  5L3H A;  1X37 A;  5LVH A;  2C8O A;  4CFO A;  1NV8 A;  2EO2 A;  1N33 M;  3E4R A;  3M6A A;  5LMU M;  1QTC A;  4F1I A;  4KL7 A;  225L A;  4RF0 A;  2BJW A;  4NXM M;  3HY5 A;  3KP1 E;  2HEB A;  3W67 A;  4LF4 M;  3N9C A;  3GUJ A;  1L74 A;  2OE4 X;  4MGK E;  1LMQ A;  1LWK A;  1DYF A;  1IP1 A;  3C8S A;  1DO0 A;  4GCD A;  1ZWN A;  4I8O A;  1DPW A;  1J1O Y;  1DKK A;  1CUK A;  4J1A A;  4GN5 C;  5FTJ A;  3OE0 A;  4PRQ A;  5D5F A;  1GFJ A;  1QT7 A;  4L78 A;  1L27 A;  4EIW A;  5B06 A;  4C3W A;  1CKH A;  4FJR A;  162L A;  2G8L A;  4B0D A;  3A6B Y;  1G71 A;  1P2C C;  3F6Z A;  2ZAN A;  4LFA M;  2C99 A;  1PQJ A;  1B7Q A;  4Z41 A;  1IFY A;  1LJG A;  1IBM M;  195L A;  2BQC A;  248L A;  3AW7 A;  1LZY A;  1YAN A;  5FCP A;  1IOC A;  4H9I A;  2A4T A;  1B0D A;  1GFA A;  1C6T A;  3HTD A;  1CU2 A;  4TX7 A;  4AQY M;  4H1P A;  1UM8 A;  4BLC A;  5E26 A;  1OYU A;  1GWD A;  4DV0 M;  5L3I A;  219L A;  1F4I A;  2RB0 X;  4NGI A;  254L A;  1GAZ A;  1T8F A;  1L55 A;  2KA6 B;  4ZPU A;  3FAD A;  3U6L A;  1XGP C;  2V1U A;  1B7P A;  1S3S A;  1C10 A;  1IXS A;  1GF9 A;  2HEF A;  1YKX X;  3AZ7 A;  1L93 A;  1HFZ A;  4D80 A;  4YF2 A;  1FJG M;  3IHP A;  2RBN A;  4FWD A;  3AZ5 A;  1A4V A;  1LJI A;  2KZS A;  2ZBK B;  5ITX A;  3TXD A;  217L A;  1QVR A;  2Z18 A;  3PDS A;  1TR8 A;  3SAU A;  1L09 A;  3CSQ A;  2W1X A;  2JY5 A;  1UID A;  1LZT A;  1IIZ A;  1VED A;  3HU9 A;  1WQP A;  3LVW A;  3V2W A;  5H37 D;  2DZO B;  1YAO A;  3C58 A;  3VFD A;  1QSQ A;  3PVS A;  3HT8 A;  3A8Z A;  252L A;  2WSF F;  2Y20 A;  2DQE Y;  4LGM A;  1B5V A;  2RGH A;  4LT2 A;  3W6E A;  3RZE A;  182L A;  4NG8 A;  1R7R A;  1I94 M;  4DV6 M;  172L A;  3RUN A;  5FTL A;  3TWM A;  2C8P A;  1JTT L;  1T43 A;  5LIN A;  4JXJ A;  1MN3 A;  208L A;  1C64 A;  4P17 A;  3A6C Y;  1LKR A;  1GAY A;  5JI3 E;  1LSF A;  2BQD A;  1ZVY B;  4YEN A;  3BOS A;  4IJ4 A;  3B7Q A;  3RGS A;  163L A;  1LMC A;  1L48 A;  4EKP A;  1HEW A;  4NL4 H;  2L09 A;  1L1T A;  1WVU A;  112L A;  166L A;  4H93 A;  1GF0 A;  1IWT A;  4LG2 A;  1XHB A;  184L A;  224L A;  1FLU A;  4DQ5 A;  1N75 A;  103L A;  3B0K A;  4IBI A;  4DC4 A;  1D2N A;  3A45 A;  3U5Z B;  4NGL A;  1QAQ A;  1KW7 A;  4I0C A;  2OE9 X;  4WMG A;  2YDG A;  4GC9 A;  3NWL A;  2H9J A;  2L4E A;  2KW0 A;  4KT0 F;  1EL1 A;  4MGI E;  1V34 A;  3HJS A;  4DD2 A;  165L A;  2NWD X;  2ZYP A;  1N32 M;  3WXT A;  4HPI A;  3GUI A;  4BB9 A;  5KXL A;  1PJS A;  3WHK A;  2R45 A;  1NV9 A;  160L A;  3TMW A;  4IBG A;  1NF5 A;  2K6B A;  2DHY A;  2BLY A;  2NTH A;  4HP0 A;  1GEZ A;  4LYC A;  3SB7 A;  2BQK A;  4LYT A;  1QAN A;  3L26 A;  3PNV A;  1L22 A;  4AQN A;  1DKJ A;  3HJ8 A;  1WQM A;  2OU0 X;  1F6R A;  3M3U A;  1JIT A;  4Z98 A;  3U6M A;  3L27 A;  3TMV A;  1QTE A;  1LWG A;  1IY0 A;  3FUT A;  2LZ2 A;  4CIS A;  1T97 A;  1IVM A;  3Q8G A;  2EIZ C;  4Z6Y A;  4FCT A;  3SYL A;  2Z4R A;  4EKS A;  3D4S A;  1OQY A;  4MCK A;  4HEO A;  1GFG A;  2OEA X;  5HNL A;  4JI8 M;  3SAV A;  2O25 A;  4GLA A;  196L A;  2HAK A;  3KDS E;  1HEO A;  146L A;  2JXN A;  5FHW A;  1LSM A;  2VF8 A;  4JYA M;  1J1P Y;  3EXD A;  4W57 A;  2HHH M;  1TCY A;  3GLH A;  2F5S A;  2K0B X;  3DMZ A;  2HL7 A;  1L88 A;  4JV5 M;  2RBP A;  4ZFP A;  2KDL A;  1KIQ C;  2H5Z A;  1IP6 A;  4TUN A;  1BB7 A;  1L0J A;  4EPI A;  2IGC A;  3SMS A;  2BLX A;  3GPX A;  4DV4 M;  2B74 A;  4ETA A;  1C7Y A;  3NBI A;  1I4W A;  2D7G A;  4OWE A;  4LZZ A;  1NKH A;  3NY9 A;  1LZ6 A;  2BQO A;  1L97 A;  220L A;  2DQA A;  2QEN A;  4I7R A;  2D91 A;  4N5R A;  2YBI A;  3OTO M;  3E21 A;  4I7N A;  3DZD A;  4LDE A;  2KRU A;  1DYA A;  2MEB A;  3C3E A;  4IBK A;  4D82 A;  1YAM A;  126L A;  147L A;  2DVW B;  3GLI A;  1QT4 A;  3KFU G;  3B6L A;  3RGP A;  1IWZ A;  4LGY A;  161L A;  1GB7 A;  4H9F A;  1OFH A;  5I5Q A;  148L E;  1I20 A;  2R62 A;  1GJT A;  120L A;  2DAG A;  1EQ4 A;  4KLN A;  4AG6 A;  5A2Q S;  1LZE A;  255L A;  142L A;  1JTN A;  1VDD A;  1LSA A;  4NGY A;  4W94 A;  3J7B A;  2RB2 X;  1L61 A;  1GJS A;  2MEF A;  2XFT A;  3AW6 A;  2QBY B;  4ARP A;  2DXI A;  3LHM A;  1TDY A;  3VDP A;  1RI8 B;  3C8R A;  3LZ2 A;  1G0L A;  1L65 A;  4WO9 A;  2DAE A;  3ILK A;  3TQS A;  4B7G A;  2QHO B;  2XJW A;  1HMK A;  4DD1 A;  3F8V A;  1L23 A;  1L56 A;  3IG8 A;  1GFV A;  5I53 A;  5E6J A;  4K5Y A;  3I01 M;  1DV0 A;  5EP2 A;  1ZMV A;  1I56 A;  5KPT A;  2F4G A;  3GLF E;  5LYM A;  1GE4 A;  3ZQJ A;  4XGI A;  4ZPX A;  1C7P A;  3GPY A;  3SN6 R;  1JSE A;  3K2L A;  4G3O A;  5B59 A;  4XK8 F;  5ITU A;  4GHA A;  1CUQ A;  1GFU A;  133L A;  2NTG A;  1HFY A;  1ZAE A;  1JQU A;  227L A;  2HU3 A;  3HWL A;  1QUS A;  5KY1 A;  1PJJ A;  1BVX A;  4YEM A;  3WUA A;  1OWY A;  1D2W A;  4E97 A;  3SAT A;  201L A;  3TXJ A;  2F2N A;  3WW5 A;  4MH0 E;  3LQQ A;  4M9S A;  2LVN C;  2ZNW Y;  2LHG A;  246L A;  4PPO A;  3GRU A;  2L2D A;  6LYZ A;  1UIH A;  1OFI A;  3AGH A;  4TSB A;  5E4P A;  4B3T M;  3NBX X;  1BVK C;  3SP3 A;  1VAT A;  1XXH E;  191L A;  234L A;  1MU5 A;  2ZIK A;  3K92 A;  3D8B A;  4R71 A;  3LMM A;  3W68 A;  4I7T A;  1UAC Y;  1HER A;  2EPE A;  4LZT A;  4D81 A;  3CT1 A;  3AOG A;  1CJ7 A;  3A98 B;  178L A;  185L A;  5B1F A;  4IBF A;  4LCB A;  194L A;  1OTR A;  5KXT A;  4JI5 M;  3JAM S;  3LQR A;  1KFV A;  3A96 A;  1UC0 A;  2QAR C;  2V6Z M;  1L11 A;  1JIS A;  3V2Y A;  4WUR A;  1GBO A;  1XEK A;  4JI6 M;  1SXJ A;  1KY0 A;  1OVJ A;  3RU5 A;  235L A;  2B70 A;  1OAI A;  1LGW A;  1LYD A;  1OV7 A;  1GE1 A;  5ITQ A;  226L A;  1WXQ A;  1P6Y A;  5C6I A;  2EJS A;  192L A;  1L84 A;  1NY6 A;  4DV5 M;  1XNR M;  1L75 A;  1TGU A;  1IWX A;  188L A;  1L51 A;  1DZB X;  213L A;  4W56 A;  2YBL A;  1IC5 Y;  1QUH A;  4NGV A;  3SHG B;  1D6P A;  232L A;  5EJC A;  3FD9 A;  2QBY A;  1C6Q A;  1WGL A;  4LYM A;  1CV1 A;  1JJ0 A;  3TXG A;  1B7O A;  4B08 A;  1F6S A;  3TXI A;  4NGJ A;  109L A;  1QUG A;  1W08 A;  2W82 A;  3A42 A;  5EXS A;  1BWJ A;  1TDH A;  4NSO B;  3OE9 A;  3M0E A;  2YBN A;  4JI3 M;  1YIL A;  7CAT A;  1WQN A;  1L30 A;  1C6L A;  5EP4 A;  4GBR B;  2DKL A;  3DN2 A;  4YOP A;  5LYZ A;  1T8G A;  4FCW A;  4XEN A;  3LZT A;  5JEN B;  2BQG A;  1NBZ C;  1KIR C;  1FKV A;  2CWI A;  2HEC A;  2Q9E A;  5FDJ A;  4II8 A;  1ZV1 A;  4CIZ A;  1K3X A;  4FCV A;  2BQH A;  4RKU F;  5FLX S;  4BAF A;  1OP9 B;  3RT5 X;  4WLD A;  4DDC A;  1C6J A;  4N0J A;  2RGO A;  3WW6 A;  3W6B A;  4FWG A;  115L A;  2YBJ A;  1GF4 A;  4R0F A;  3I4Y A;  4NGK A;  1XGU C;  5EP1 A;  4QGZ A;  3QYE A;  1L40 A;  1CJ6 A;  2OOB A;  5ILF A;  1LLH A;  1NO1 A;  1P56 A;  1CJ9 A;  2R4E A;  102L A;  5I4X A;  2LYM A;  1ZMW A;  3SC3 A;  2A5Y B;  2R6F A;  1PQO A;  3RNX A;  2WZJ A;  222L A;  4DR1 M;  2DWL A;  1I1Z A;  4EKR A;  1C6A A;  197L A;  2M5Z A;  2L7I A;  2Z8Y M;  1TBY A;  1L73 A;  249L A;  1L98 A;  3IWR A;  4B49 A;  4OW0 A;  2MH8 A;  4GMQ A;  1LV7 A;  2Z4S A;  1UIB A;  2DQG Y;  2CJL A;  3QAU A;  1P3Q Q;  1ZQ9 A;  1GB8 A;  4QHS A;  3GQ5 A;  5IEL A;  3A92 A;  153L A;  2LBC A;  1B7N A;  1DYC A;  1K82 A;  4C5F A;  1QTV A;  1UIA A;  1L96 A;  5HMJ A;  3VK8 A;  3WHL A;  2FYC A;  125L A;  2R65 A;  4DAJ A;  3FE0 A;  5DNY A;  3TMU A;  2LH0 A;  1NJF A;  3KXE C;  214L A;  1O23 A;  1YL0 X;  3A34 A;  3D8L A;  4F2L A;  1KY1 A;  3GLH E;  2L78 A;  1L36 A;  215L A;  3HU2 A;  1C60 A;  5LAG A;  3OE6 A;  1UCO A;  1LHI A;  4R6C A;  1IWU A;  4XYY A;  3WU9 A;  2D7H A;  2QQ8 A;  2WSE F;  1NBY C;  3GPU A;  2MEA A;  3A3Q A;  1L42 A;  2Z3X A;  3UON A;  5DL9 A;  1P5C A;  1YIK A;  1IP3 A;  2F30 A;  2HEE A;  1C46 A;  4QDN A;  1L31 A;  4YX7 C;  1RE2 A;  3P66 A;  4WOA A;  3HDF A;  1CKC A;  1C6K A;  2B6W A;  4ET9 A;  2BQE A;  1QSA A;  4UWU A;  3HH4 A;  4M6D A;  1OUD A;  4H92 A;  2K9D A;  4XJI A;  1QIO A;  3ZVQ B;  3U61 A;  2CV1 A;  2X0A A;  2BQB A;  1L2D A;  4NXN M;  2Q0M X;  2ZQ3 A;  3G3V A;  1D3F A;  1FKQ A;  1YE9 A;  2UXB M;  1Z59 A;  4DD0 A;  4B7H A;  1VDT A;  3EBA B;  1L12 A;  1GKI A;  1LJN A;  1INU A;  2I6Z A;  2DEN A;  2DQH Y;  1LZ5 A;  1QAO A;  3R9X B;  4CGY B;  2BQA A;  3G3B B;  4EOF A;  1Q3C A;  1GAB A;  3GLG E;  2A7D A;  4HL4 A;  1L66 A;  4KOD A;  1GFH A;  3KP0 E;  4DDA A;  1LKS A;  1OAO C;  1LMP A;  2LCB A;  1L15 A;  1L28 A;  3FRH A;  4AG5 A;  3SHF A;  4AI6 A;  2R0I A;  5APE A;  1JR3 A;  1LTM A;  3SYK A;  1XEP A;  4NEB A;  2LNH C;  1T3P A;  2XEP A;  4BAP A;  3HTG A;  3J27 B;  1SWZ A;  1Z55 A;  4G4H A;  1WR1 B;  258L A;  4NWE A;  3RFW A;  2ZYC A;  3GQ4 A;  2EQL A;  2ZM6 M;  1IBK M;  1LMA A;  3HUQ A;  1LZC A;  3HUK A;  3HTF A;  5APC A;  1BB6 A;  1JJ1 A;  1XGR C;  1WQR A;  1LCN A;  1OUJ A;  1LZR A;  5C1B A;  4DR5 M;  3LYZ A;  2HTX A;  2RSC A;  3JR4 A;  247L A;  1EFU B;  3KW6 A;  3C3D A;  4JI1 M;  4G4N A;  2CDS A;  3GUN A;  2YR0 A;  1YAQ A;  1IR9 A;  3ATO A;  3ZCB B;  3HHY A;  3K1J A;  2E5L M;  2D4I A;  1JKB A;  2YBM A;  1KYI A;  1KXY A;  3P64 A;  3OJP A;  1IWW A;  1G0K A;  1L20 A;  3FUX A;  3DN1 A;  1G7H C;  4I8S A;  1SG9 A;  4KHP M;  2DNA A;  3IEC A;  3K2R A;  1PQK A;  1HHL A;  3SFZ A;  4G4Q A;  122L A;  2VF7 A;  7LZM A;  4NHQ A;  123L A;  4WLX A;  4OVZ A;  5L8R F;  4W5W A;  6LZM A;  3FYD A;  2L4F A;  1QDR A;  1OVK A;  5A3Z A;  2DKV A;  3C81 A;  1IBL M;  4ARM A;  1CU3 A;  2FOI C;  2B72 A;  4IBE A;  1G4A E;  3CF2 A;  4GCF A;  1JTP L;  1OUE A;  2R18 A;  4PK0 A;  4QY9 A;  229L A;  4O34 A;  1C67 A;  1HF4 A;  1LZ8 A;  233L A;  4FVM A;  1J09 A;  1LSC A;  4ARQ B;  1SX7 A;  3E3D A;  5EBH A;  1N34 M;  4ITQ A;  2EKK A;  4HTK A;  4LDO A;  2C98 A;  1ZVH L;  2O5R A;  2RH1 A;  5T3F A;  4I5S A;  3UZU A;  1UIE A;  3PFI A;  2BQI A;  1CUP A;  127L A;  5F3W A;  1WTM A;  4EPF A;  2M60 A;  1LHK A;  4I81 A;  1IOS A;  5BR8 M;  1V7S A;  3ZC7 B;  3GLG A;  189L A;  1LHL A;  1OKS A;  1CKG A;  2HKJ A;  3FE3 A;  2FS1 A;  3U6C A;  205L A;  7LYZ A;  4I7S A;  1IXZ A;  3VLF B;  4B1A A;  111L A;  1RU3 A;  1L52 A;  1GBZ A;  4DUZ M;  1C1K A;  4ET8 A;  3VK7 A;  2G4N A;  1IN5 A;  1LYO A;  3U61 B;  1QAM A;  1G59 A;  2RBS A;  3HX3 A;  2Q9D A;  3F9L A;  2B7X A;  169L A;  3KOX E;  3AFH A;  3CDR A;  4TWS A;  5KO3 A;  1D3N A;  5KXX A;  1IY3 A;  2ZQ4 A;  1G07 A;  2FFJ A;  3SB5 A;  4WW0 A;  1NHB A;  1G0J A;  4H9E A;  4X66 M;  4CJ2 A;  2YSS C;  3GUL A;  5C6L A;  2J7O A;  1D0M A;  1XXH A;  1TH3 A;  3GUP A;  230L A;  3FUW A;  4IBC A;  4NG1 A;  1NMM A;  2DQF C;  1PGY A;  2I7P A;  3C7Z A;  1IM2 A;  4ETC A;  4HJZ A;  1C45 A;  1L2B A;  1AM7 A;  167L A;  3TE6 A;  3C9P A;  1BB5 A;  4XJF A;  5EXT A;  1HNX M;  190L A;  2JZ1 A;  4AW4 A;  1L80 A;  2XQO A;  1E9S A;  4FDY A;  4ARM B;  1HEP A;  3JR5 A;  3TL4 X;  5DFL A;  5DYG A;  1XC8 A;  3SAR A;  2XBR A;  4N1C C;  4HV1 A;  3KVW A;  3OE8 A;  4OVZ B;  3L29 A;  2G4Q A;  1LZB A;  1L64 A;  4RNA A;  1XB2 B;  1B6I A;  1L24 A;  1SWY A;  3T6U A;  4DT3 A;  5LVG A;  3K8Z A;  2XGN A;  1XMQ M;  4DWX A;  2FBD A;  4LJ5 A;  2LWX A;  1LGX A;  4MR1 A;  2KEB A;  3P68 A;  180L A;  2DWN A;  5APF A;  2QB0 B;  1PJT A;  2MEI A;  206L A;  2OTY X;  3HH5 A;  2F4V M;  1LSY A;  3WUM A;  1L38 A;  1QT6 A;  2OU9 A;  3G3X A;  3WH1 A;  4XJD A;  177L A;  1CX6 A;  3HHW A;  2DWZ B;  1MJG M;  1C6B A;  1LHH A;  1Z5C A;  4Q7J A;  5F81 A;  1GF5 A;  1QTK A;  1GL6 A;  2K47 A;  3CDT A;  4IAP A;  3EML A;  1LMO A;  1QT5 A;  2LHM A;  4M0D A;  1G41 A;  2RRU A;  1B5X A;  2UUC M;  1L03 A;  1WVV A;  5LAF A;  5HMV A;  3MMP A;  2JNH A;  1P36 A;  2BWE A;  3C7Y A;  4H8Y A;  3TXF A;  4REZ A;  3HHX A;  2CV2 A;  207L A;  4LYZ A;  4RLN A;  3KSX A;  2LHC A;  3L2X A;  1L58 A;  1HFX A;  5KXS A;  1GF6 A;  5F9X A;  2C96 A;  3WL2 A;  3U60 A;  4NSI A;  3WU8 A;  174L A;  1NY5 A;  3W6A A;  2ANX A;  2XTH A;  3WPJ A;  5F16 A;  1VFB C;  5LMN M;  1L87 A;  3AOE A;  4RLM A;  1P46 A;  1P7S A;  1L59 A;  5DN5 A;  3DFZ A;  4NFV A;  1NJG A;  1BWI A;  1L33 A;  1DGG A;  3SMP A;  4W96 A;  2HEA A;  3W6D A;  2G5G X;  1L92 A;  4W52 A;  2IHL A;  2CP8 A;  2HU1 A;  4GIP A;  1D0K A;  4H9C A;  3HHZ A;  2HUM A;  4LY6 A;  1K3W A;  216L A;  1CV0 A;  4OWA A;  4XN6 A;  4MGH A;  3GPP A;  1QUT A;  1GB5 A;  1L44 A;  5KPR A;  4ML7 A;  1LYH A;  2Z19 A;  4XBO A;  5FTN A;  4J7V A;  3HBH A;  5D5C A;  3L28 A;  3LZM A;  3KAM A;  3GRY A;  1XGT C;  4WM5 A;  4LJA A;  3FTD A;  3TPZ A;  3TXB A;  1JIY A;  1A5T A;  4AGA A;  2I25 L;  4QEQ A;  1L35 A;  1T8A A;  3LYO A;  175L A;  4N1E I;  240L A;  1WJ7 A;  1K28 A;  3HH3 A;  5APD A;  4LF5 M;  238L A;  4NGZ A;  3IG5 A;  3D3D A;  1DYE A;  1CV3 A;  4NSG A;  3AJN A;  4NHP A;  2C9C A;  5EXP A;  1B5W A;  1HML A;  2CWB A;  1XWI A;  2R4J A;  1HNZ M;  1L49 A;  1WQQ A;  2BAA A;  4X65 M;  4CHX A;  1TDZ A;  2XFS A;  4IBB A;  3KS8 A;  1D3M A;  1L0K A;  1TH4 A;  1LZS A;  2NQ8 C;  183L A;  1GFK A;  1PQM A;  1LYZ A;  4LFC M;  1G7J C;  1HSX A;  2OO9 A;  1B5Z A;  4W55 A;  2I7N A;  1R4G A;  1DYG A;  4L16 A;  2Z39 A;  2B6Z A;  1LYG A;  1LJJ A;  1REZ A;  1LHM A;  3ULR A;  4WLY A;  1XNQ M;  4FWH A;  132L A;  4JI0 M;  5KQ8 A;  3T36 A;  4L15 A;  4DD3 A;  3U60 B;  228L A;  2F4A A;  152L A;  199L A;  4RW2 A;  1N4F A;  1YAP A;  1TF0 B;  1LZN A;  1L34 A;  140L A;  3HUA A;  4AKI A;  4OOT A;  3DMV A;  1L82 A;  4LFP A;  4W58 A;  1GFR A;  4PJ2 C;  1EQ5 A;  3AV0 A;  5E9R A;  1L13 A;  5KXK A;  1QS5 A;  1NHG C;  1L01 A;  221L A;  2RAY X;  1DO2 A;  4DV3 M;  1J7K A;  1LOZ A;  4TUW A;  2DI0 A;  4YY3 M;  5ILC A;  186L A;  4H9H A;  1IEE A;  1KIP C;  3E46 A;  3TXE A;  1XSF A;  2LVP C;  2GQF A;  2CFO A;  1DI4 A;  135L A;  4G6Z A;  3HFM Y;  4EKQ A;  5KPZ A;  4LF7 M;  241L A;  1LYI A;  2MGW A;  1L81 A;  4XAD A;  4B4I A;  3C8Q A;  2PC2 A;  1L21 A;  2W1L A;  1IN8 A;  2MED A;  3DMX A;  4G9S A;  3WYH A;  1C69 A;  1G06 A;  1EE8 A;  4LGK A;  2R46 A;  4I7Q A;  2ZIJ A;  1CX7 A;  5KXO A;  3ZH9 B;  2LYO A;  2DQC Y;  5DLA A;  3AJI B;  1C66 A;  4LF8 M;  2CHQ A;  1JJ3 A;  4DDB A;  1VG5 A;  2KRK A;  5DYI A;  3VDU A;  4WP2 A;  1IC7 Y;  9LYZ A;  3TXH A;  2XF3 A;  2ZAO A;  2LVA A;  5FEL A;  2X4A A;  3B0I A;  1QZE A;  1C43 A;  1LW9 A;  1LI2 A;  2CV0 A;  1GE2 A;  151L A;  1JWR A;  1L05 A;  1LHJ A;  2BQN A;  1W5S A;  4NSR A;  154L A;  4EXM A;  1YLA A;  3CTW B;  1B5Y A;  4XJB A;  2MEH A;  1LYJ A;  4B3R M;  1IP5 A;  1P2R A;  2I26 L;  3BKH A;  3N9E A;  4BBA A;  3AYQ A;  1CU0 A;  1SXJ B;  1DQJ C;  5AMY A;  1IOT A;  2UUA M;  1KNI A;  3C7W A;  3MHV C;  3BBZ A;  2KZU A;  1LSE A;  1T6V L;  3THG A;  1XEJ A;  2MEE A;  2F5N A;  4BAD A;  1L95 A;  1V92 A;  4G49 A;  2D4J A;  4GRI A;  5HQ1 A;  1SLY A;  2LTU A;  2JY6 B;  1GLN A;  1HEN A;  1JB0 F;  1OIP A;  2KNA A;  3HJQ A;  2Y0T A;  2CRU A;  2FE8 A;  4KT3 A;  4H8X A;  1LMT A;  1L50 A;  1IY1 A;  4NHT A;  4M9X A;  1E9R A;  4UN2 B;  1L77 A;  4WM6 A;  3GXR A;  4I7O A;  1G8P A;  1L08 A;  4L4U A;  1GB0 A;  1P37 A;  2EKS C;  5FEK A;  4DV7 M;  1D6Q A;  1B7S A;  1B7L A;  1R2Z A;  2QZ4 A;  1QTH A;  1OUH A;  1L79 A;  2FNA A;  4OU7 A;  1LI3 A;  1OJL A;  4NWH A;  1L39 A;  1KXX A;  3SAW A;  3B7N A;  1C6I A;  1LZ4 A;  1JKA A;  1L06 A;  2B5Z A;  3CF0 A;  2ERC A;  4JI2 M;  1T6O A;  1L18 A;  1Q02 A;  1LSN A;  1BWH A;  3K9P A;  5KJ9 A;  4I7M A;  3A46 A;  1W6Z A;  3VWO A;  4HPE A;  4QOZ C;  1L90 A;  3CQL A;  1QZM A;  176L A;  3LCU A;  3DN4 A;  218L A;  1WTH A;  4X3B A;  4WL6 A;  2LC9 A;  1RJC B;  1IWY A;  1OUI A;  3HTB A;  2VDB B;  2Z6B A;  1L86 A;  4LYB A;  1MX0 A;  2DAM A;  3IJV A;  4L8R C;  1BB4 A;  2X8A A;  1G7I C;  1ALC A;  3HU3 A;  6LYT A;  3MK6 A;  4NSH A;  1G1W A;  1HEQ A;  4RDS A;  2R44 A;  4LZM A;  3GUM A;  2G3Q A;  2APL A;  4A3V B;  211L A;  1GD6 A;  2HED A;  3UJN A;  3FUV A;  1C6M A;  4GKJ M;  2OTZ X;  4Z46 A;  1V33 A;  4PCZ A;  4IAT A;  1UIG A;  4YXC A;  1HT2 E;  1E32 A;  4GCC A;  4FW9 A;  2DAK A;  4GIT A;  1LJK A;  1GDX A;  1I6S A;  2MJ5 B;  2G4P A;  4AZF A;  3K3T A;  2CUZ A;  1CV6 A;  3FRI A;  4DV1 M;  5LA8 A;  3J2P B;  1HSW A;  1C6C A;  3B7Z A;  3GLI B;  1QSW A;  2Y8P A;  1L32 A;  1DGF A;  4QHT A;  4X64 M;  1SXJ D;  130L A;  4GRV A;  4L41 A;  4H94 A;  3HT7 A;  2RBO A;  2MRO B;  3WUL A;  4LT1 A;  1TEW A;  4YXA C;  1L60 A;  4IAS A;  3PXG A;  4W53 A;  1QT3 A;  3A95 A;  3DKE X;  1G0P A;  5F14 A;  4LRS A;  4AKH A;  1XJT A;  4TSC A;  3GXK A;  2DBT A;  4NSJ A;  4PD2 A;  1L54 A;  1UIF A;  1L17 A;  3GUO A;  4XJG A;  1GVN A;  4II7 A;  1L72 A;  4CJ6 A;  1QTZ A;  1GBX A;  2LYZ A;  3HKP A;  4MGY E;  5KKI A;  3U6P A;  1IO5 A;  3DN6 A;  3B72 A;  3WU7 A;  3TMX A;  1NNJ A;  2DZL A;  1LJ3 A;  3A91 A;  2EA0 A;  2DZN B;  4UWV A;  4N8Z A;  1QQW A;  1L04 A;  1VEK A;  1L63 A;  2W1Y A;  5IDD A;  155L A;  4NIJ A;  1L68 A;  1Q3B A;  3KOY E;  4GH9 A;  193L A;  1IXS B;  1QDT A;  1IOQ A;  1UIC A;  2HUB A;  4M9Z A;  3T15 A;  157L A;  4U3X B;  1CJ8 A;  4R3D A;  3WVX A;  1L1Z A;  104L A;  3W6F A;  1HT1 E;  1R6B X;  1WTN A;  4DUY M;  1GPQ C;  2QSF X;  181L A;  4I7L A;  2Z2F A;  2CE7 A;  3GLF A;  1C6G A;  1C6D A;  4WG7 A;  1G0M A;  4LDL A;  131L A;  3MGW A;  1LZD A;  4HSF A;  3U6S A;  1PZY A;  4HTQ A;  3ZVQ A;  4K0K M;  2OU8 A;  4I4L A;  5C6J A;  5IWA M;  4Y28 F;  2D7E A;  2YBH A;  1C62 A;  4DR7 M;  3GRV A;  5IHG A;  4CHT B;  2HUL A;  3DN0 A;  1L02 A;  5HNC A;  3KS4 A;  5C18 A;  3P65 A;  5IZ7 D;  3U6Q A;  8CAT A;  1WGN A;  2YNM D;  3I4V A;  1VQ1 A;  1T3T A;  2Z12 A;  4JI7 M;  3J80 S;  3HBE X;  3WXU A;  1DYD A;  1REX A;  3OK0 A;  4OO9 A;  1XXH B;  4N9R A;  2JY8 A;  1BGI A;  1FLW A;  2MEG A;  3GLI E;  5B05 A;  1NQI A;  2ZWB A;  4DQJ A;  2AHM A;  1NNU C;  1GXV 2;  1L41 A;  171L A;  1GBY A;  2KNV A;  2F5P A;  3HDE A;  1VDQ A;  1ZMY L;  4GLV A;  5HLL A;  1REY A;  1FLQ A;  1OUC A;  212L A;  2B73 A;  3QWL A;  4BS7 A;  5LA5 A;  1B2K A;  3MJ5 A;  1B7M A;  2LVQ D;  2ZTD A;  5I4W A;  4WLT A;  4DR6 M;  198L A;  1YKZ X;  4NY5 A;  2ZAM A;  1NVM A;  3AKZ A;  3D9A C;  3T38 A;  5F9U A;  1Y8G A;  1CV5 A;  1JHL A;  3UGJ A;  3GLG B;  1L71 A;  1FDL Y;  4DKL A;  1C65 A;  1GBW A;  4LJ7 A;  3M18 B;  4PDG A;  1YQV Y;  3B9P A;  1L47 A;  4OX9 M;  5KXR A;  1EPY A;  4TTD A;  8LYZ A;  3LVV A;  1IX0 A;  3UMM A;  2LXE A;  1GHL A;  2O79 A;  3AZ6 A;  3C83 A;  2J5Y A;  4DV2 M;  257L A;  2VB1 A;  3QYB A;  4ARL A;  4PRU A;  4ARQ A;  4GC5 A;  4B3S M;  1LMN A;  168L A;  1UUZ C;  2F32 A;  3M7G A;  2F2Q A;  2B6Y A;  1T6H A;  4OWB A;  3SB8 A;  4S0W A;  2ZIL A;  1CU6 A;  1L76 A;  1IP2 A;  3GP1 A;  1F0W A;  3LN2 A;  5B1G A;  4E3U A;  1P2L A;  1VDS A;  4IBJ A;  3Q8X A;  1OVH A;  1YL1 X;  3LYM A;  137L A;  4YHH M;  3B89 A;  5I4Y A;  2GV0 A;  1L29 A;  1FN5 A;  2UUB M;  3F92 A;  3QNG A;  5ITY A;  4A7D A;  1HNW M;  3CDQ A;  3AOE C;  2XLJ A;  4G4O A;  1L83 A;  4HJV A;  2QPA A;  1G0G A;  5L9J A;  1DI5 A;  1R5L A;  2VII A;  5LZM A;  1C6E A;  1L07 A;  2A7F A;  128L A;  1QT8 A;  2GNO A;  1WQO A;  1D9U A;  1LYY A;  4W51 A;  1L62 A;  1KXW A;  4WM1 A;  1H87 A;  5K7O A;  2OQ4 A;  149L A;  1CTW A;  2OPF A;  1HQY E;  3HT6 A;  1JUG A;  1E94 E;  2IFF Y;  1L70 A;  4PGJ B;  4KO8 A;  1CU5 A;  1GF7 A;  2P5T A;  1L67 A;  1BQL Y;  1G7M C;  3QAK A;  3ZEK A;  4NGW A;  2H1R A;  1TH2 A;  4ANR A;  1LYF A;  1L00 A;  2N35 A;  1LZG A;  2VQF M;  4H9B A;  1L89 A;  3SBJ A;  1LJH A;  2N5Z A;  2BQL A;  3E9S A;  3GQ3 A;  1DGH A;  1DI3 A;  1JSF A;  3WUN A;  2B75 A;  2L7H A;  1L16 A;  1IN6 A;  1VDP A;  2YVB A;  4LZJ A;  2UXD M;  1Q39 A;  1WIV A;  2L6O A;  110L A;  1FNN A;  2X49 A;  1C6N A;  3HGI A;  1HEM A;  1VAU A;  3W0L B;  4DR4 M;  1CV4 A;  5ITR A;  2F5Q A;  4G4B A;  1Z6T A;  262L A;  4NHS A;  3W0F A;  1XFP L;  1LSB A;  2RAZ X;  2Z37 A;  4DYG A;  1EIJ A;  4B3M M;  1XGQ C;  1VEG A;  1KS3 A;  4FD2 A;  173L A;  4J0L A;  2Q2E B;  3FYC A;  1P3N A;  4LF6 M;  5KQD A;  1G0Q A;  1ZUR A;  4B4E A;  2KXE A;  138L A;  2J7N A;  1L99 A;  4P16 A;  1R2Y A;  3QE8 A;  118L A;  3FTE A;  1W5T A;  1OV5 A;  2B6X A;  4NOO B;  3AZ4 A;  2O01 F;  261L A;  3L25 A;  4CGE A;  1AIP C;  3J4G A;  3FUU A;  3RE8 A;  4QNR A;  2BQF A;  1FLY A;  1LYE A;  3WPK A;  3DN8 A;  2DQI Y;  4HTN A;  150L A;  3WVY A;  1JR3 E;  1G1V A;  1B9O A;  1QSB A;  4H8Z A;  3BXW A;  3FKE A;  119L A;  1PQD A;  3LYT A;  1SSY A;  3J7A S;  1HNL A;  1LZ1 A;  5I14 A;  1CKD A;  2BNK A;  2Z38 A;  4GCE A;  1L91 A;  5IT9 S;  1L37 A;  4ARJ A;  2F5O A;  3G3W A;  1L43 A;  139L A;  3KOZ E;  2XZF A;  1YKY X;  107L A;  3LCV B;  3WMK A;  3A67 Y;  5EP3 A;  2BPU A;  2BQJ A;  3FI7 A;  5B07 A;  1RFP A;  1IC4 Y;  4DD9 A;  1IY2 A;  3CDV A;  2RBR A;  3B0O A;  1DGB A;  1BB3 A;  4PHI A;  1D3J A;  5KXM A;  2Y21 A;  1IP4 A;  3IJU A;  1GE3 A;  1GF8 A;  4PT5 A;  1QYR A;  4S12 A;  239L A;  1C68 A;  170L A;  1AKI A;  2Z7J A;  3GRR A;  3EMS A;  4LF9 M;  2DAI A;  2V1C A;  1PRB A;  2DHR A;  3RZ4 A;  1LAA A;  1XMO M;  1GF3 A;  3DA1 A;  3HZJ A;  256L A;  2RB1 X;  145L A;  4L6V 6;  4LJ4 A;  1LJ4 A;  2CHG A;  1BHZ A;  4LT3 A;  3A93 A;  2VQE M;  3HBD A;  4RF1 A;  2W1M A;  1D0L A;  5FSW A;  4M4O A;  1IN4 A;  3A94 A;  1V7T A;  4LJ9 A;  4JN6 A;  1G3I A;  2HCB A;  1SQ2 L;  2JP7 A;  3CT0 A;  5FTM A;  1L10 A;  3VKH A;  1L45 A;  3U6D A;  1LSG A;  4OOO A;  4WM2 A;  4ZIX A;  5KXP A;  1LGU A;  2FBB A;  1LSD A;  1PM5 A;  4EMN A;  2CHV A;  4HJY A;  2Y0Q A;  4GEW A;  3RW8 A;  1KSF X;  210L A;  5LXW A;  3L64 A;  3U6O A;  1A2Y C;  5IRE B;  2EKF A;  1JPO A;  209L A;  4X62 M;  4H90 A;  3U6E A;  2EUC A;  5LVJ A;  1HR0 M;  5LVI A;  3C82 A;  2JA2 A;  1HEL A;  1JTO L;  187L A;  2DQD Y;  4IJE A;  1LPY A;  4R7G A;  3GO8 A;  4GCB A;  3A3R X;  1TAY A;  4DD7 A;  2XSZ A;  4WL7 A;  2CUU A;  3R8F A;  4LRT A;  1L85 A;  4MB7 A;  1YSY A;  4NC6 A;  3LW5 F;  3PNY A;  3AB6 A;  4KPM A;  5A3E A;  1UA6 Y;  2CGI A;  1JQJ C;  4GN4 A;  5II3 A;  1F10 A;  1C61 A;  3T1H M;  4LFX A;  1LZA A;  2Z2E A;  2MR9 A;  3T1Y M;  2DWM A;  1GXX A;  4GN3 A;  3L2A A;  108L A;  1ZV5 L;  2OE7 X;  1GO5 A;  2QP9 X;  1DYB A;  2RBQ A;  4NRW A;  5BPV A;  1RCM A;  1IP7 A;  3NYA A;  3CF6 E;  159L A;  1Z5B A;  3EIE A;  2FH0 A;  2ZNX Y;  4ETE A;  4H9A A;  1GFT A;  1L19 A;  3QY4 A;  3CB7 A;  260L A;  1MLC E;  4WO6 A;  1QUD A;  3HH6 A;  1OUG A;  4B7F A;  3SBA A;  1YUB A;  1REM A;  1MEL L;  4IJF A;  1N77 A;  2AUB A;  2LVO C;  1VEJ A;  3TWL A;  4Z3M A;  1PS5 A;  4G4C A;  2QCU A;  1LPI A;  3TXK A;  1B5U A;  1EQE A;  4YM8 A;  3P4Z A;  1N78 A;  4AXT A;  1P64 A;  1L25 A;  3H4J A;  4LYO A;  3G3A B;  1ORY B;  4B4J A;  2QNJ A;  1FBI X;  1YRO A;  3K9O A;  4Z8X A;  2KHH A;  3WPL A;  4GKK M;  1NDM C;  5LVK A;  3CSZ A;  1SX2 A;  1SSW A;  253L A;  1QTD A;  236L A;  3FTC A;  3VW7 A;  1GB6 A;  2F47 A;  1HQC A;  1NHW C;  1OQM A;  5EQT A;  259L A;  4XJH A;  1Z5A A;  200L A;  3I04 M;  5KXZ A;  2XZU A;  1SXJ E;  5KXN A;  4ETD A;  1QS9 A;  5ITT A;  4W59 A;  3AGG G;  4ETB A;  1PJQ A;  3KSJ A;  3VKG A;  1L2C A;  4CFP A;  1UBZ A;  2WSC F;  1JEF A;  1GDW A;  4OW1 A;  2C5R A;  3DNA A;  4G4R A;  4LFB M;  1AT6 A;  243L A;  244L A;  1SXJ C;  2YQZ A;  4I7K A;  1QUO A;  5FST A;  1GB2 A;  3SB9 A;  3ATN A;  2RKO A;  1IOR A;  5FTK A;  4DBG B;  1L14 A;  1NHE A;  1IQP A;  3H4M A;  1GBS A;  4IBD A;  1TLA A;  4MST A;  4PJZ A;  4HLQ A;  1LSP A;  4DQ7 A;  2XH9 A;  3EIH A;  4RW1 A;  1GB9 A;  1L46 A;  2HUK A;  1L26 A;  4J1B A;  2UU9 M;  223L A;  237L A;  1N36 M;  1CKF A;  3SB6 A;  2BQM A;  1C6F A;  3I51 A; 
#chains in the Genus database with same CATH homology
 1JKD A;  4OWC A;  1L57 A;  4WM3 A;  1JKC A;  242L A;  2D4K A;  1KW5 A;  5LIO A;  1QQY A;  3NY8 A;  114L A;  3CSR A;  3HU8 A;  2H9K A;  4I7P A;  3FI5 A;  1GEV A;  141L A;  113L A;  1D2Y A;  1OUA A;  4W54 A;  231L A;  164L A;  4YEO A;  2MEC A;  1ZYT A;  1OUB A;  2O4W A;  2WAR A;  1OUF A;  4D9Z A;  3FA0 A;  1GE0 A;  1E8L A;  5KKJ A;  1L69 A;  250L A;  2LZM A;  4DJH A;  5KXY A;  251L A;  1LZ9 A;  4OWH A;  4NGO A;  1DPX A;  1NWG A;  1NDG C;  1IWV A;  3CDO A;  3BKV A;  143L A;  158L A;  4NHI A;  3DN3 A;  1H6M A;  1IR7 A;  1L53 A;  129L A;  3AGI A;  1C08 C;  1PQI A;  4UWN A;  156L A;  3HT9 A;  1G7L C;  4EJ4 A;  1LYS A;  1AZF A;  2B6T A;  1OWZ A;  1HC0 A;  1L94 A;  4LT0 A;  4KXI A;  144L A;  1IR8 A;  1CVK A;  1LJF A;  4P2E A;  245L A;  1J1X Y;  3W3E A;  5KXW A;  1IY4 A;  3SBB C;  2D6B A;  3ODU A;  3GUK A;  1AT5 A;  1B7R A;  3W6C A;  3JR6 A;  1C6H A;  4WM4 A;  4HV2 A;  4I7J A;  1D9W A;  5J7C A;  1C63 A;  5DN4 A;  5LYT A;  3EO5 A;  2O7A A;  1XJU A;  1JTM A;  3J6K A;  2LZT A;  5I54 A;  1LSZ A;  1QTB A;  4ZEE A;  134L A;  1C6P A;  1LJE A;  3A90 A;  2ANV A;  5DM9 A;  1LI6 A;  2XBS A;  4WG1 A;  3PBL A;  4H91 A;  3CT5 A;  1GB3 A;  1CNS A;  1DXJ A;  3N9A A;  2DQJ Y;  1XEI A;  2FYD A;  3C80 A;  5M1Y A;  1GFE A;  5L3H A;  5LVH A;  2C8O A;  4CFO A;  1QTC A;  4KL7 A;  225L A;  2HEB A;  3N9C A;  3GUJ A;  1L74 A;  2OE4 X;  1LMQ A;  1LWK A;  1DYF A;  1IP1 A;  3C8S A;  4GCD A;  1ZWN A;  1DPW A;  1J1O Y;  1DKK A;  4J1A A;  4GN5 C;  3OE0 A;  4PRQ A;  5D5F A;  1GFJ A;  1QT7 A;  1L27 A;  5B06 A;  4C3W A;  1CKH A;  4FJR A;  162L A;  4B0D A;  3A6B Y;  1P2C C;  3F6Z A;  1PQJ A;  1B7Q A;  4Z41 A;  1LJG A;  195L A;  2BQC A;  248L A;  3AW7 A;  1LZY A;  1YAN A;  5FCP A;  1IOC A;  4H9I A;  2A4T A;  1B0D A;  1GFA A;  1C6T A;  3HTD A;  1CU2 A;  4TX7 A;  4H1P A;  1OYU A;  1GWD A;  5L3I A;  219L A;  2RB0 X;  4NGI A;  254L A;  1GAZ A;  1T8F A;  1L55 A;  4ZPU A;  3FAD A;  1XGP C;  1B7P A;  1C10 A;  1GF9 A;  2HEF A;  1YKX X;  3AZ7 A;  1L93 A;  1HFZ A;  4YF2 A;  2RBN A;  3AZ5 A;  1A4V A;  1LJI A;  3TXD A;  217L A;  2Z18 A;  3PDS A;  1L09 A;  3CSQ A;  2W1X A;  1UID A;  1LZT A;  1IIZ A;  1VED A;  3HU9 A;  1WQP A;  3V2W A;  1YAO A;  1QSQ A;  3HT8 A;  3A8Z A;  252L A;  2DQE Y;  1B5V A;  4LT2 A;  3W6E A;  3RZE A;  182L A;  4NG8 A;  172L A;  3RUN A;  2C8P A;  1JTT L;  5LIN A;  208L A;  1C64 A;  3A6C Y;  1LKR A;  1GAY A;  2BQD A;  1LSF A;  1ZVY B;  4YEN A;  4IJ4 A;  163L A;  1LMC A;  1L48 A;  4EKP A;  1HEW A;  1WVU A;  112L A;  166L A;  4H93 A;  1GF0 A;  1IWT A;  184L A;  224L A;  1FLU A;  4DQ5 A;  103L A;  3B0K A;  4DC4 A;  4NGL A;  1KW7 A;  4I0C A;  2OE9 X;  4WMG A;  2YDG A;  2H9J A;  1EL1 A;  4DD2 A;  165L A;  2NWD X;  2ZYP A;  3WXT A;  4HPI A;  3GUI A;  5KXL A;  3TMW A;  160L A;  1NF5 A;  2BLY A;  2NTH A;  4HP0 A;  1GEZ A;  4LYC A;  3SB7 A;  2BQK A;  4LYT A;  1L22 A;  4AQN A;  1DKJ A;  2OU0 X;  1WQM A;  3M3U A;  1F6R A;  1JIT A;  4Z98 A;  3TMV A;  1QTE A;  1LWG A;  2LZ2 A;  1T97 A;  1IVM A;  2EIZ C;  4EKS A;  3D4S A;  4MCK A;  1GFG A;  2OEA X;  5HNL A;  4GLA A;  196L A;  1HEO A;  146L A;  5FHW A;  1LSM A;  3EXD A;  1J1P Y;  4W57 A;  1TCY A;  3DMZ A;  1L88 A;  2RBP A;  4ZFP A;  1KIQ C;  2H5Z A;  1IP6 A;  4TUN A;  1BB7 A;  1L0J A;  4EPI A;  2IGC A;  2BLX A;  2B74 A;  4ETA A;  4OWE A;  1NKH A;  3NY9 A;  1LZ6 A;  2BQO A;  1L97 A;  220L A;  2DQA A;  4I7R A;  4N5R A;  2D91 A;  2YBI A;  4LDE A;  4I7N A;  1DYA A;  2MEB A;  1YAM A;  126L A;  147L A;  1QT4 A;  3B6L A;  1IWZ A;  161L A;  1GB7 A;  4H9F A;  5I5Q A;  148L E;  1I20 A;  120L A;  255L A;  1EQ4 A;  1LZE A;  142L A;  1JTN A;  1LSA A;  4NGY A;  4W94 A;  2RB2 X;  1L61 A;  2MEF A;  3AW6 A;  4ARP A;  3LHM A;  1TDY A;  1RI8 B;  3C8R A;  3LZ2 A;  1G0L A;  1L65 A;  4WO9 A;  2XJW A;  1HMK A;  4DD1 A;  3F8V A;  1L23 A;  1L56 A;  1GFV A;  5I53 A;  4K5Y A;  1I56 A;  2F4G A;  5LYM A;  1GE4 A;  1C7P A;  3SN6 R;  1JSE A;  5B59 A;  1CUQ A;  1GFU A;  133L A;  2NTG A;  1HFY A;  1JQU A;  227L A;  2HU3 A;  3HWL A;  1QUS A;  5KY1 A;  1BVX A;  4YEM A;  3WUA A;  1OWY A;  1D2W A;  4E97 A;  201L A;  3TXJ A;  2F2N A;  3WW5 A;  2ZNW Y;  246L A;  4PPO A;  6LYZ A;  1UIH A;  3AGH A;  4TSB A;  5E4P A;  1BVK C;  3SP3 A;  1VAT A;  191L A;  234L A;  2ZIK A;  4I7T A;  1UAC Y;  1HER A;  2EPE A;  4LZT A;  3CT1 A;  1CJ7 A;  178L A;  185L A;  5B1F A;  194L A;  5KXT A;  3A96 A;  1UC0 A;  2QAR C;  1L11 A;  1JIS A;  3V2Y A;  1GBO A;  1XEK A;  1KY0 A;  1OVJ A;  3RU5 A;  2B70 A;  235L A;  1OV7 A;  1LGW A;  1LYD A;  1GE1 A;  226L A;  1P6Y A;  5C6I A;  192L A;  1L84 A;  1L75 A;  1IWX A;  188L A;  1L51 A;  1DZB X;  213L A;  4W56 A;  2YBL A;  1IC5 Y;  1QUH A;  4NGV A;  1D6P A;  232L A;  1C6Q A;  4LYM A;  1CV1 A;  1JJ0 A;  3TXG A;  1B7O A;  1F6S A;  3TXI A;  4NGJ A;  109L A;  1QUG A;  1W08 A;  1BWJ A;  3OE9 A;  2YBN A;  1YIL A;  1WQN A;  1L30 A;  1C6L A;  4GBR B;  4YOP A;  3DN2 A;  5LYZ A;  1T8G A;  4XEN A;  3LZT A;  5JEN B;  2BQG A;  1NBZ C;  1KIR C;  1FKV A;  2CWI A;  2HEC A;  2Q9E A;  5FDJ A;  4II8 A;  2BQH A;  4BAF A;  1OP9 B;  3RT5 X;  4WLD A;  4DDC A;  1C6J A;  4N0J A;  3WW6 A;  3W6B A;  115L A;  2YBJ A;  1GF4 A;  4R0F A;  4NGK A;  1XGU C;  4QGZ A;  1L40 A;  1CJ6 A;  5ILF A;  1LLH A;  1P56 A;  1CJ9 A;  102L A;  5I4X A;  2LYM A;  1PQO A;  3RNX A;  222L A;  1I1Z A;  4EKR A;  1C6A A;  197L A;  1TBY A;  1L73 A;  249L A;  1L98 A;  3IWR A;  4B49 A;  1UIB A;  2DQG Y;  2CJL A;  1GB8 A;  5IEL A;  3A92 A;  153L A;  1B7N A;  1DYC A;  4C5F A;  1QTV A;  1UIA A;  1L96 A;  5HMJ A;  2FYC A;  125L A;  4DAJ A;  3FE0 A;  3TMU A;  214L A;  1O23 A;  1YL0 X;  3A34 A;  1KY1 A;  2L78 A;  1L36 A;  215L A;  1C60 A;  5LAG A;  3OE6 A;  1UCO A;  1LHI A;  4R6C A;  1IWU A;  4XYY A;  3WU9 A;  1NBY C;  2MEA A;  3A3Q A;  1L42 A;  3UON A;  5DL9 A;  1P5C A;  1YIK A;  1IP3 A;  2F30 A;  2HEE A;  1C46 A;  4QDN A;  1L31 A;  4YX7 C;  1RE2 A;  3P66 A;  4WOA A;  3HDF A;  1CKC A;  1C6K A;  2B6W A;  4ET9 A;  2BQE A;  1QSA A;  4UWU A;  3HH4 A;  4M6D A;  1OUD A;  4H92 A;  4XJI A;  1QIO A;  3ZVQ B;  2X0A A;  2BQB A;  2Q0M X;  2ZQ3 A;  3G3V A;  1D3F A;  1FKQ A;  4DD0 A;  1VDT A;  3EBA B;  1L12 A;  1LJN A;  1INU A;  2I6Z A;  2DQH Y;  1LZ5 A;  2BQA A;  3G3B B;  4EOF A;  2A7D A;  1L66 A;  1GFH A;  4DDA A;  1LKS A;  1LMP A;  2LCB A;  1L15 A;  1L28 A;  5APE A;  1LTM A;  1XEP A;  4NEB A;  1T3P A;  4BAP A;  3HTG A;  4G4H A;  1SWZ A;  1Z55 A;  258L A;  4NWE A;  2ZYC A;  2EQL A;  1LMA A;  3HUQ A;  1LZC A;  3HUK A;  3HTF A;  5APC A;  1BB6 A;  1JJ1 A;  1XGR C;  1WQR A;  1LCN A;  1OUJ A;  1LZR A;  3LYZ A;  2HTX A;  2RSC A;  247L A;  2CDS A;  3GUN A;  1YAQ A;  1IR9 A;  3ATO A;  2D4I A;  1JKB A;  2YBM A;  1KXY A;  3P64 A;  3OJP A;  1IWW A;  1G0K A;  1L20 A;  3DN1 A;  4I8S A;  1G7H C;  3K2R A;  1PQK A;  1HHL A;  122L A;  7LZM A;  4NHQ A;  123L A;  4WLX A;  6LZM A;  1QDR A;  1OVK A;  5A3Z A;  2DKV A;  3C81 A;  4ARM A;  1CU3 A;  2B72 A;  4GCF A;  1JTP L;  1OUE A;  4PK0 A;  4QY9 A;  229L A;  4O34 A;  1C67 A;  1HF4 A;  1LZ8 A;  233L A;  1LSC A;  4ARQ B;  1SX7 A;  3E3D A;  5EBH A;  4HTK A;  4LDO A;  1ZVH L;  2RH1 A;  5T3F A;  1UIE A;  2BQI A;  1CUP A;  127L A;  1WTM A;  4EPF A;  1LHK A;  1IOS A;  1V7S A;  189L A;  1LHL A;  1CKG A;  205L A;  7LYZ A;  4I7S A;  4B1A A;  111L A;  1L52 A;  1GBZ A;  4ET8 A;  2G4N A;  1LYO A;  2RBS A;  2Q9D A;  3F9L A;  2B7X A;  169L A;  4TWS A;  3CDR A;  1D3N A;  5KXX A;  1IY3 A;  2ZQ4 A;  1G07 A;  3SB5 A;  1NHB A;  1G0J A;  4H9E A;  4CJ2 A;  2YSS C;  3GUL A;  5C6L A;  1D0M A;  3GUP A;  230L A;  4NG1 A;  1NMM A;  2DQF C;  3C7Z A;  4ETC A;  4HJZ A;  1C45 A;  1AM7 A;  167L A;  1BB5 A;  4XJF A;  190L A;  1L80 A;  2XQO A;  4FDY A;  4ARM B;  1HEP A;  2XBR A;  4N1C C;  4HV1 A;  3OE8 A;  2G4Q A;  1LZB A;  1L64 A;  1L24 A;  3T6U A;  1B6I A;  1SWY A;  5LVG A;  4DT3 A;  4DWX A;  2FBD A;  1LGX A;  4MR1 A;  3P68 A;  180L A;  5APF A;  2QB0 B;  2MEI A;  206L A;  2OTY X;  3HH5 A;  1LSY A;  3WUM A;  1L38 A;  1QT6 A;  2OU9 A;  3G3X A;  3WH1 A;  4XJD A;  177L A;  1CX6 A;  1C6B A;  1LHH A;  5F81 A;  1GF5 A;  1QTK A;  3CDT A;  4IAP A;  3EML A;  1LMO A;  1QT5 A;  2LHM A;  1B5X A;  1WVV A;  5LAF A;  1L03 A;  5HMV A;  1P36 A;  3C7Y A;  4H8Y A;  3TXF A;  207L A;  4LYZ A;  4RLN A;  3L2X A;  1L58 A;  1HFX A;  5KXS A;  1GF6 A;  5F9X A;  3WL2 A;  4NSI A;  3WU8 A;  174L A;  3W6A A;  2ANX A;  2XTH A;  3WPJ A;  5F16 A;  1VFB C;  1L87 A;  4RLM A;  1P46 A;  1P7S A;  1L59 A;  5DN5 A;  4NFV A;  1BWI A;  1L33 A;  4W96 A;  2HEA A;  3W6D A;  1L92 A;  4W52 A;  2IHL A;  2HU1 A;  1D0K A;  4H9C A;  2HUM A;  216L A;  1CV0 A;  4OWA A;  4XN6 A;  1QUT A;  1GB5 A;  1L44 A;  4ML7 A;  1LYH A;  2Z19 A;  4J7V A;  3HBH A;  5D5C A;  3LZM A;  3KAM A;  1XGT C;  4WM5 A;  3TXB A;  1JIY A;  4AGA A;  2I25 L;  4QEQ A;  1L35 A;  1T8A A;  3LYO A;  175L A;  4N1E I;  240L A;  1K28 A;  3HH3 A;  5APD A;  238L A;  4NGZ A;  3D3D A;  1DYE A;  1CV3 A;  4NSG A;  3AJN A;  4NHP A;  1B5W A;  1HML A;  1L49 A;  1WQQ A;  2BAA A;  4CHX A;  1D3M A;  1L0K A;  1LZS A;  183L A;  1GFK A;  1PQM A;  1LYZ A;  1G7J C;  1HSX A;  1B5Z A;  4W55 A;  1DYG A;  2Z39 A;  2B6Z A;  1LYG A;  1LJJ A;  1REZ A;  1LHM A;  3ULR A;  4WLY A;  132L A;  3T36 A;  4DD3 A;  228L A;  2F4A A;  152L A;  199L A;  4RW2 A;  1N4F A;  1YAP A;  1LZN A;  1L34 A;  140L A;  3HUA A;  4OOT A;  3DMV A;  1L82 A;  4LFP A;  4W58 A;  1GFR A;  4PJ2 C;  1EQ5 A;  5E9R A;  1L13 A;  5KXK A;  1QS5 A;  1L01 A;  221L A;  2RAY X;  1LOZ A;  5ILC A;  186L A;  4H9H A;  1IEE A;  1KIP C;  3TXE A;  1XSF A;  1DI4 A;  135L A;  3HFM Y;  4EKQ A;  241L A;  1LYI A;  1L81 A;  4XAD A;  4B4I A;  3C8Q A;  2PC2 A;  1L21 A;  2W1L A;  2MED A;  3DMX A;  4G9S A;  3WYH A;  1C69 A;  1G06 A;  4LGK A;  4I7Q A;  2ZIJ A;  1CX7 A;  5KXO A;  2LYO A;  2DQC Y;  5DLA A;  1C66 A;  1JJ3 A;  4DDB A;  1IC7 Y;  9LYZ A;  3TXH A;  5FEL A;  3B0I A;  1C43 A;  1LW9 A;  1LI2 A;  1GE2 A;  151L A;  1JWR A;  1L05 A;  1LHJ A;  2BQN A;  154L A;  4EXM A;  1B5Y A;  4XJB A;  2MEH A;  1LYJ A;  1IP5 A;  1P2R A;  2I26 L;  3BKH A;  3N9E A;  3AYQ A;  1CU0 A;  1DQJ C;  5AMY A;  1IOT A;  1KNI A;  3C7W A;  1LSE A;  1T6V L;  1XEJ A;  2MEE A;  4BAD A;  1L95 A;  4G49 A;  2D4J A;  5HQ1 A;  1SLY A;  1HEN A;  4KT3 A;  4H8X A;  1LMT A;  1L50 A;  4NHT A;  1L77 A;  4WM6 A;  3GXR A;  4I7O A;  1L08 A;  1GB0 A;  1P37 A;  2EKS C;  5FEK A;  1D6Q A;  1B7S A;  1B7L A;  1QTH A;  1OUH A;  1L79 A;  1LI3 A;  4NWH A;  1L39 A;  1KXX A;  1C6I A;  1LZ4 A;  1JKA A;  1L06 A;  2B5Z A;  1L18 A;  1LSN A;  1BWH A;  5KJ9 A;  4I7M A;  1W6Z A;  3VWO A;  4HPE A;  1L90 A;  3CQL A;  176L A;  3DN4 A;  218L A;  1WTH A;  4X3B A;  4WL6 A;  2LC9 A;  1RJC B;  1IWY A;  1OUI A;  3HTB A;  2Z6B A;  1L86 A;  4LYB A;  3IJV A;  1BB4 A;  1G7I C;  1ALC A;  6LYT A;  4NSH A;  1G1W A;  1HEQ A;  4RDS A;  4LZM A;  3GUM A;  211L A;  1GD6 A;  2HED A;  1C6M A;  2OTZ X;  4Z46 A;  4IAT A;  1UIG A;  4YXC A;  4GCC A;  1LJK A;  1GDX A;  1I6S A;  2G4P A;  3K3T A;  1CV6 A;  5LA8 A;  1HSW A;  1C6C A;  1QSW A;  2Y8P A;  1L32 A;  130L A;  4L41 A;  4GRV A;  4H94 A;  3HT7 A;  2RBO A;  3WUL A;  4LT1 A;  1TEW A;  4YXA C;  1L60 A;  4IAS A;  4W53 A;  1QT3 A;  3A95 A;  3DKE X;  1G0P A;  5F14 A;  4TSC A;  1XJT A;  3GXK A;  2DBT A;  4NSJ A;  1L54 A;  1UIF A;  1L17 A;  3GUO A;  4XJG A;  1L72 A;  1QTZ A;  1GBX A;  2LYZ A;  5KKI A;  1IO5 A;  3DN6 A;  3B72 A;  3WU7 A;  3TMX A;  1LJ3 A;  3A91 A;  4UWV A;  4N8Z A;  1L04 A;  1L63 A;  2W1Y A;  5IDD A;  155L A;  4NIJ A;  1L68 A;  193L A;  1QDT A;  1IOQ A;  1UIC A;  2HUB A;  157L A;  4U3X B;  1CJ8 A;  3WVX A;  104L A;  3W6F A;  1WTN A;  1GPQ C;  181L A;  4I7L A;  2Z2F A;  1C6G A;  1C6D A;  4WG7 A;  1G0M A;  4LDL A;  131L A;  3MGW A;  1LZD A;  4HSF A;  1PZY A;  4HTQ A;  3ZVQ A;  2OU8 A;  5C6J A;  2YBH A;  1C62 A;  5IHG A;  2HUL A;  3DN0 A;  1L02 A;  5HNC A;  3P65 A;  2Z12 A;  3HBE X;  3WXU A;  1DYD A;  1REX A;  3OK0 A;  4OO9 A;  4N9R A;  1BGI A;  1FLW A;  2MEG A;  5B05 A;  1NQI A;  2ZWB A;  4DQJ A;  1GXV 2;  1L41 A;  171L A;  1GBY A;  3HDE A;  1VDQ A;  1ZMY L;  4GLV A;  5HLL A;  1REY A;  1FLQ A;  1OUC A;  212L A;  2B73 A;  4BS7 A;  5LA5 A;  1B2K A;  1B7M A;  5I4W A;  4WLT A;  198L A;  1YKZ X;  4NY5 A;  3D9A C;  5F9U A;  1CV5 A;  1JHL A;  1L71 A;  1FDL Y;  4DKL A;  1C65 A;  1GBW A;  3M18 B;  1YQV Y;  1L47 A;  5KXR A;  1EPY A;  4TTD A;  8LYZ A;  1IX0 A;  2O79 A;  1GHL A;  3C83 A;  3AZ6 A;  257L A;  2VB1 A;  4ARL A;  4PRU A;  4ARQ A;  1LMN A;  168L A;  1UUZ C;  2F32 A;  2F2Q A;  2B6Y A;  1T6H A;  4OWB A;  3SB8 A;  4S0W A;  2ZIL A;  1CU6 A;  1L76 A;  1IP2 A;  3LN2 A;  1F0W A;  5B1G A;  4E3U A;  1P2L A;  1VDS A;  1OVH A;  1YL1 X;  3LYM A;  137L A;  5I4Y A;  2GV0 A;  1L29 A;  1FN5 A;  3QNG A;  4A7D A;  3CDQ A;  1L83 A;  4HJV A;  1G0G A;  5L9J A;  1DI5 A;  5LZM A;  1C6E A;  1L07 A;  2A7F A;  128L A;  1QT8 A;  1WQO A;  1D9U A;  1LYY A;  4W51 A;  1L62 A;  1KXW A;  4WM1 A;  1H87 A;  5K7O A;  149L A;  1CTW A;  3HT6 A;  1JUG A;  2IFF Y;  1L70 A;  4PGJ B;  1CU5 A;  1GF7 A;  1L67 A;  1BQL Y;  1G7M C;  3QAK A;  3ZEK A;  4NGW A;  4ANR A;  1LYF A;  1L00 A;  1LZG A;  4H9B A;  1L89 A;  2N5Z A;  1LJH A;  2BQL A;  1DI3 A;  1JSF A;  3WUN A;  2B75 A;  1L16 A;  1VDP A;  2YVB A;  110L A;  1C6N A;  1HEM A;  1VAU A;  1CV4 A;  4G4B A;  262L A;  4NHS A;  1XFP L;  1LSB A;  2RAZ X;  2Z37 A;  4DYG A;  1XGQ C;  1KS3 A;  173L A;  4J0L A;  1P3N A;  1G0Q A;  1ZUR A;  4B4E A;  138L A;  1L99 A;  3QE8 A;  118L A;  1OV5 A;  2B6X A;  3AZ4 A;  261L A;  4CGE A;  3J4G A;  2BQF A;  1FLY A;  1LYE A;  3WPK A;  3DN8 A;  2DQI Y;  4HTN A;  150L A;  3WVY A;  1G1V A;  1B9O A;  1QSB A;  4H8Z A;  119L A;  1PQD A;  3LYT A;  1SSY A;  1HNL A;  1LZ1 A;  5I14 A;  1CKD A;  2Z38 A;  4GCE A;  1L91 A;  1L37 A;  4ARJ A;  3G3W A;  1L43 A;  139L A;  1YKY X;  107L A;  3WMK A;  3A67 Y;  2BPU A;  2BQJ A;  3FI7 A;  5B07 A;  1RFP A;  1IC4 Y;  4DD9 A;  3CDV A;  2RBR A;  3B0O A;  1BB3 A;  4PHI A;  1D3J A;  5KXM A;  1IP4 A;  3IJU A;  1GE3 A;  1GF8 A;  239L A;  1C68 A;  170L A;  1AKI A;  3EMS A;  3RZ4 A;  1LAA A;  1GF3 A;  256L A;  2RB1 X;  145L A;  1LJ4 A;  1BHZ A;  4LT3 A;  3A93 A;  3HBD A;  2W1M A;  1D0L A;  4M4O A;  3A94 A;  1V7T A;  1SQ2 L;  3CT0 A;  1L10 A;  1L45 A;  1LSG A;  4OOO A;  4WM2 A;  4ZIX A;  5KXP A;  1LGU A;  2FBB A;  1LSD A;  4EMN A;  4HJY A;  5LXW A;  3RW8 A;  210L A;  3L64 A;  1A2Y C;  1JPO A;  209L A;  4H90 A;  5LVJ A;  5LVI A;  3C82 A;  1HEL A;  1JTO L;  187L A;  2DQD Y;  1LPY A;  4GCB A;  3A3R X;  1TAY A;  4DD7 A;  4WL7 A;  2CUU A;  1L85 A;  3AB6 A;  4KPM A;  5A3E A;  1UA6 Y;  2CGI A;  4GN4 A;  5II3 A;  1F10 A;  1C61 A;  4LFX A;  1LZA A;  2Z2E A;  1GXX A;  4GN3 A;  108L A;  1ZV5 L;  2OE7 X;  1DYB A;  2RBQ A;  1RCM A;  1IP7 A;  3NYA A;  159L A;  2ZNX Y;  4ETE A;  4H9A A;  1GFT A;  1L19 A;  3QY4 A;  3CB7 A;  260L A;  1MLC E;  4WO6 A;  1QUD A;  3HH6 A;  1OUG A;  3SBA A;  1REM A;  1MEL L;  2AUB A;  4Z3M A;  1PS5 A;  4G4C A;  1LPI A;  3TXK A;  1B5U A;  1EQE A;  4YM8 A;  3P4Z A;  4AXT A;  1P64 A;  1L25 A;  4LYO A;  3G3A B;  4B4J A;  1FBI X;  1YRO A;  3WPL A;  1NDM C;  5LVK A;  3CSZ A;  1SX2 A;  1SSW A;  253L A;  1QTD A;  236L A;  3VW7 A;  1GB6 A;  2F47 A;  1OQM A;  259L A;  4XJH A;  200L A;  5KXZ A;  4ETD A;  5KXN A;  1QS9 A;  4W59 A;  3AGG G;  4ETB A;  4CFP A;  1UBZ A;  1JEF A;  4OW1 A;  1GDW A;  3DNA A;  1AT6 A;  243L A;  244L A;  4I7K A;  1QUO A;  5FST A;  1GB2 A;  3SB9 A;  3ATN A;  1IOR A;  1NHE A;  1L14 A;  1GBS A;  1TLA A;  4MST A;  4PJZ A;  1LSP A;  4DQ7 A;  4RW1 A;  1GB9 A;  1L46 A;  2HUK A;  1L26 A;  4J1B A;  223L A;  237L A;  1CKF A;  3SB6 A;  2BQM A;  1C6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...