1QUSA

1.7 a resolution structure of the soluble lytic transglycosylase slt35 from escherichia coli
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
publication title Crystal structure of Escherichia coli lytic transglycosylase Slt35 reveals a lysozyme-like catalytic domain with an EF-hand.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 110
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qusA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qusA02
1KIPC 5LXWA 4II8A 193LA 5KXXA 1RE2A 1GFVA 3ULRA 1NDGC 3A3RX 1G7JC 1OQMA 2I26L 1FLWA 4H9CA 3QE8A 5KXPA 5HMVA 5IHGA 2BQHA 1GF5A 4J7VA 1GXV2 2YBNA 4WO9A 2BQLA 1GWDA 1GBSA 1GBYA 3W6BA 4H8ZA 1AZFA 3A90A 2IFFY 1VDQA 3A93A 3WXTA 4W96A 1WQQA 2W1MA 1PZYA 4OW1A 1VEDA 1LHIA 4TWSA 4Z46A 1LZNA 1TBYA 3W6AA 1VDSA 3WUAA 2BQMA 3LYZA 5KKIA 2DQCY 2EIZC 1LOZA 1IR7A 2A7FA 4ETCA 4HV1A 4OWAA 1BWIA 1BHZA 1LZYA 1OUGA 1LSPA 3CT1A 5E4PA 1C46A 1HELA 1XGUC 5EBHA 1GXXA 4NSHA 3AZ6A 4XJDA 1WQMA 4HV2A 3W6FA 1GBZA 1WQPA 4LGKA 4DWXA 1UUZC 1LMNA 2FYCA 4HP0A 1QDTA 1JWRA 1LMCA 2FBBA 3P68A 3KAMA 4XJGA 4B4EA 4BAFA 2AUBA 4XENA 5JENB 3TXJA 1OUFA 1UC0A 1XGPC 1GDWA 1YANA 4LFPA 1DZBX 1LHKA 4L41A 4B1AA 4H9HA 4KT3A 5B1FA 3FE0A 1HF4A 4HJZA 5KXSA 1LZEA 1LZTA 1YL1X 4GCBA 5F16A 3ZVQB 2D4KA 1LSDA 2GV0A 133LA 1GFTA 1HEPA 4H9AA 3A92A 2NWDX 1HEOA 2HU3A 4NFVA 5LYTA 1I20A 1LYSA 1YL0X 4TX7A 4ANRA 5KXRA 2H9JA 1C43A 1GE0A 1LSZA 1QTKA 4QDNA 1XGTC 1GF7A 2I25L 1IY3A 1UACY 1GBXA 4WG7A 4WM2A 3D3DA 4YEOA 135LA 4IASA 4HTKA 2ZQ4A 3RZ4A 1TDYA 4DD9A 2BQKA 2HEEA 1B7SA 2G4NA 1FBIX 2XTHA 2D91A 1LZGA 3T36A 5I4WA 4N9RA 1IR8A 4MR1A 5A3EA 1LJEA 3EO5A 1QIOA 1GB8A 4RW2A 1SQ2L 4IATA 1LHLA 1YAOA 2C8PA 5A3ZA 1LSNA 1WVVA 5LVIA 1YIKA 1JHLA 3A6BY 1GF8A 5B59A 5HNCA 3RT5X 3LN2A 1GB0A 1BVKC 4G9SA 2WARA 194LA 2I6ZA 3HBDA 1DI5A 4AGAA 1GF0A 5HLLA 2Z12A 1LZ9A 1IWUA 2PC2A 1B7PA 1VATA 3W3EA 1Z55A 2A7DA 4J0LA 4PGJB 3AZ5A 5APEA 4NHTA 4QGZA 3HBEX 2HU1A 3RNXA 2BQJA 1JKAA 1IO5A 5L9JA 1UIEA 2FBDA 4PPOA 3A34A 1B0DA 2YBJA 4NHPA 2F4GA 1UCOA 1LJ3A 2X0AA 3IJUA 1BB7A 4LFXA 1GBOA 1PS5A 1REZA 4NY5A 1LMOA 1REXA 4CFOA 1CJ7A 4WLTA 3AGGG 4HTQA 4WM6A 1WTNA 3A6CY 1D9UA 5B05A 1GFRA 1DKJA 4WL7A 1HNLA 1AM7A 5C6IA 3TMVA 5KJ9A 1LHJA 2YBLA 3M3UA 4NSGA 1A4VA 4H92A 2BQFA 3G3BB 4H90A 2CWIA 1O23A 3TXDA 4XJIA 1V7SA 4Z98A 1KXWA 5IDDA 208LA 2DQEY 1GFJA 1V7TA 3ZVQA 1HMLA 1TAYA 1WQOA 2D4JA 4XJBA 1I1ZA 2ZYPA 2BQIA 4NG1A 1ZMYL 5DL9A 1OUAA 1DPXA 2XBSA 2Z19A 4GN5C 4N8ZA 1CKCA 1WTMA 1AKIA 4GCFA 1LHHA 4B4JA 3AYQA 4NHIA 2Y8PA 1B7NA 6LYZA 5KXMA 1GE1A 3TXHA 4H9IA 4ET9A 3AW7A 3AZ7A 1HEQA 1LZAA 2DQAA 3D9AC 1RJCB 1XGRC 4WG1A 1DI3A 1GB7A 4BAPA 2DBTA 4DYGA 1DI4A 4H9EA 1IWTA 4GCEA 4H9BA 4H91A 5LINA 1B7MA 2G4PA 1LJJA 4IJ4A 4NGJA 3CQLA 3EBAB 5I54A 3WPKA 1BWJA 1LSYA 5C6LA 3LZTA 4UWVA 1OUDA 1JTOL 4GCDA 4WO6A 3MGWA 1LZRA 1YAQA 5KXOA 3CSZA 4YF2A 4NGKA 1KXYA 3G3AB 4ETBA 2YBMA 1GAYA 3WU8A 1IP2A 1LKSA 5FCPA 1CJ6A 1LPIA 1H6MA 4NGVA 1OUEA 2EQLA 4PHIA 4J1AA 1INUA 3B6LA 4LZTA 1B5YA 4YENA 1B7LA 4OWEA 1IR9A 1WQNA 1LZCA 3WUNA 1QQYA 4LYZA 4ML7A 5B1GA 3WW5A 4BS7A 4ZIXA 2VB1A 3WL2A 5LVHA 4GN4A 4E3UA 5M1YA 4HJVA 4DDCA 4B4IA 4N1EI 4NWHA 1VDTA 1DPWA 3A94A 1BB6A 2XJWA 3TXEA 5KXTA 1IWZA 4WMGA 5F9XA 5K7OA 4W94A 2Z18A 4CGEA 4DT3A 3WPLA 1IP7A 3P64A 1GB2A 1QSAA 1UIGA 3HBHA 4R0FA 5KXZA 5ILCA 4EMNA 2Z2FA 3B0OA 1LSBA 4LT0A 1B7RA 4DD0A 1LZ5A 2BQBA 4OOTA 1UA6Y 2CJLA 4D9ZA 4DDBA 4I8SA 1EQEA 1B9OA 1GEZA 1RCMA 1CJ9A 2Z2EA 3WVXA 1IVMA 4KXIA 4LYMA 2MEDA 1CJ8A 1LCNA 5J7CA 1GF9A 1HENA 4XJHA 132LA 1IC7Y 4GN3A 153LA 5KXYA 5DN4A 3OJPA 5L3IA 3B72A 4H93A 5HQ1A 1GFAA 3QNGA 3BKHA 3WH1A 4NGWA 3HFMY 4X3BA 1IIZA 134LA 2MEEA 4NSJA 1YQVY 2MEAA 3CSRA 5HNLA 1BB5A 1NBYC 5F14A 2Z39A 5IELA 1BQLY 1FLUA 1OUJA 4WL6A 4ETDA 5LYMA 4C3WA 1GFGA 1NKHA 2DQHY 3AZ4A 5APCA 3WXUA 5B06A 2C8OA 2BQGA 1J1OY 3BKVA 4XN6A 7LYZA 1IOQA 1RFPA 3TXIA 1KIRC 1IWVA 1DXJA 4PRUA 2F30A 2ZNWY 3WULA 3EMSA 4TSCA 4GCCA 1UIAA 4UWUA 5LA5A 3CSQA 2Z37A 3IJVA 3LYMA 5FELA 2LYZA 1HSXA 4NG8A 5DM9A 1NF5A 1D0KA 1MLCE 1JUGA 2BPUA 4KL7A 5LVKA 3A91A 5I4YA 1JISA 5B07A 4G4CA 1QDRA 4UWNA 4N0JA 3A3QA 1H87A 2ZILA 3ZEKA 5LVJA 1DQJC 1CKDA 1NBZC 3TMXA 4DD7A 1CNSA 4TSBA 4NGIA 1HERA 5LAGA 1IOCA 4LYBA 3VWOA 1XEKA 2DQJY 3K3TA 4MSTA 4NGOA 1FKVA 1JKDA 4OWHA 1LHMA 4YEMA 1JSEA 1GE3A 3T6UA 1D0MA 4NGZA 3EXDA 3LZ2A 4PJ2C 1YKYX 4YM8A 2YBIA 5AMYA 5KKJA 1IP4A 1LSFA 4RLMA 1TEWA 1GB3A 2LHMA 2LZTA 4BADA 1IORA 2H9KA 2F2NA 3A8ZA 1B5VA 1F6RA 2YBHA 3B0IA 1BGIA 1TCYA 3WYHA 1GF6A 4HTNA 3TMWA 4NHSA 1LKRA 4YOPA 3W6EA 5LVGA 5LYZA 4HJYA 1D6QA 2MEIA 5KXWA 1LJNA 4G4BA 2IHLA 2ZYCA 1QTEA 4WLDA 1G7LC 4GLVA 2CDSA 1LZSA 4Z3MA 4XJFA 2MEHA 3WU7A 1LYOA 1XEJA 2HEAA 1QSWA 2MEFA 9LYZA 1LJKA 1GF3A 3WMKA 1GF4A 3WUMA 3A96A 1REYA 1VFBC 4G49A 4RDSA 1G7HC 1OUBA 4CFPA 1WVUA 4PRQA 5FDJA 1IP3A 5DLAA 5APFA 1HFZA 1QUSA 1GBWA 4DC4A 3RU5A 1C10A 1LZ6A 1JSFA 4OWCA 1JJ1A 5F81A 5FEKA 1LZDA 1B5ZA 1LSCA 2YSSC 3QY4A 5HMJA 2EKSC 1CKGA 5D5FA 1UIHA 5T3FA 1B2KA 2BAAA 1REMA 5APDA 1KXXA 5LA8A 1QUTA 1FKQA 4MCKA 1CKHA 4DD2A 3IWRA 1LMTA 1IWXA 1ZVYB 1HC0A 2XBRA 1BB3A 1JITA 1ZVHL 4GLAA 3AB6A 4FDYA 1XEIA 1B5WA 1C7PA 2FYDA 4M4OA 4N1CC 1J1PY 1YILA 1IC4Y 1GFHA 5LAFA 1D6PA 5I53A 3P65A 5FSTA 4O34A 4CJ2A 1LJGA 2HECA 2Q0MX 1UIFA 1KIQC 1RI8B 4NGYA 2MEGA 207LA 5I5QA 4NGLA 2W1LA 4DDAA 2G4QA 2D4IA 1VDPA 1NMMA 3TXKA 2DQIY 3AJNA 3CB7A 3WPJA 4C5FA 1B7OA 1VAUA 4DD3A 1DKKA 1YKXX 1JKBA 1T3PA 1JJ3A 1JTPL 2MEBA 4LT2A 2EPEA 6LYTA 2ZQ3A 4CHXA 2BLYA 1LJFA 1LSGA 4J1BA 3LYTA 3J4GA 4LYTA 1IWYA 3GXRA 2HUBA 1EL1A 2DQGY 2HTXA 4H8XA 4QEQA 4ETAA 1IWWA 4WLYA 3M18B 4FJRA 3AGIA 4ET8A 4ZEEA 1JEFA 3GXKA 3N9EA 1GE4A 3A67Y 1XFPL 4RLNA 1F10A 4RW1A 5KXLA 1LMPA 1GB9A 3TXBA 4WM5A 1LSAA 1NDMC 1GFUA 3TXGA 1B7QA 1GB6A 4H9FA 2BQEA 1OUIA 3F6ZA 1BB4A 4H1PA 1ALCA 4WOAA 4OWBA 4LT3A 1LSMA 3CT0A 4G4HA 4LYOA 1XSFA 3WW6A 1LZ8A 5KXKA 1HEMA 1C08C 1GAZA 1FLYA 3J6KA 1T6VL 1IOSA 1I56A 4HPEA 5I4XA 4NIJA 5LIOA 3E3DA 1IY4A 4TUNA 5C6JA 154LA 4N5RA 4I0CA 1W6ZA 5E9RA 1NQIA 1HEWA 4HPIA 3P4ZA 1ZV5L 5D5CA 1HMKA 5FHWA 3N9CA 5DN5A 1D0LA 4ZFPA 4P2EA 3FI7A 3ATOA 3WU9A 1LTMA 1A2YC 1JPOA 3SP3A 5F9UA 2HEDA 4DD1A 4NSIA 4WM3A 2W1YA 5L3HA 1GDXA 1AT5A 2DKVA 2LYMA 1IP5A 3B0KA 1IC5Y 1JTTL 1J1XY 2DQFC 1FLQA 2RSCA 1HFXA 2Z38A 3P66A 2BQCA 1NHEA 1G7IC 2H5ZA 1WQRA 2MECA 1XGQC 4H8YA 3N9AA 4LYCA 1GPQC 1LYZA 2BQNA 1FDLY 2YDGA 3OK0A 1GFEA 2HEFA 4HSFA 1SLYA 4KPMA 4B49A 1UIBA 3AGHA 1LZ1A 1OUHA 1OP9B 1BVXA 1E8LA 1LJ4A 1LJIA 4WM1A 1CKFA 2W1XA 3W6CA 1LYYA 4TTDA 5ILFA 2BLXA 1W08A 4ETEA 1HSWA 2DQDY 3WVYA 4QY9A 1B5UA 3AW6A 1JIYA 2BQOA 2YVBA 2LYOA 2ZIKA 5KXNA 1UICA 3TMUA 3TXFA 4Z41A 1BWHA 5KY1A 1GFKA 8LYZA 1IX0A 1GB5A 1YROA 4AXTA 1C45A 1GE2A 1B5XA 2HEBA 3CT5A 2BQAA 2BQDA 4A7DA 4NWEA 1P2CC 4WLXA 1AT6A 1NWGA 1F0WA 4XYYA 1EQ5A 1FN5A 1UIDA 2N5ZA 4H94A 3ATNA 3W6DA 1IP6A 1HFYA 2ZNXY 1LMAA 1YAPA 2F4AA 1HHLA 4U3XB 2ZWBA 1G7MC 1LZ4A 1EQ4A 4R6CA 3A95A 3RW8A 1JKCA 1GHLA 1GEVA 1LMQA 1IOTA 2CGIA 1YAMA 1YKZX 1UBZA 4OOOA 5II3A 4NHQA 4M6DA 1LAAA 1JJ0A 4NEBA 4XADA 2B5ZA 1GD6A 2ZIJA 2LZ2A 1MELL 1N4FA 4WM4A 3LHMA 4EOFA 4LT1A 3LYOA 1F6SA 4B0DA 2D6BA 1OUCA 1LJHA 1LZBA 1LSEA 1IP1A 1IEEA
chains in the Genus database with same CATH superfamily
4PK0A 2B6XA 1KIPC 3U6PA 4II8A 1RE2A 1NDGC 3A3RX 2O25A 2I26L 1L61A 108LA 1CU2A 1GXV2 1VEKA 2JY6B 2BQLA 1Z5CA 3W6BA 2LHCA 1L0KA 1AZFA 3J80S 4W96A 1WQQA 4OW1A 4ARQB 5DYIA 248LA 1XXHA 2DAKA 1YLAA 4RNAA 1V92A 5IT9S 1GXXA 3CDRA 2OQ4A 1QT7A 4I7OA 1WQPA 1NNJA 3HT9A 1LMNA 2FYCA 2R44A 4B4EA 1P46A 2MH8A 1XNQM 4BAFA 2ANXA 4LDEA 3HTBA 1OUFA 1UC0A 1XGPC 4B1AA 4H9HA 4KT3A 1Q39A 4LG2A 3FUXA 1LZTA 3I4YA 3ZVQB 1KFVA 3DKEX 2Y20A 2GV0A 1GFTA 3GRUA 4H9AA 4MGHA 1I20A 1YL0X 4BB9A 2X49A 1SXJD 3PFIA 1L66A 1C43A 4Q7JA 4B7FA 3SYKA 3DMVA 3HDFA 4A3VB 4WG7A 4WM2A 4YEOA 1T6HA 135LA 4XK8F 3OTOM 2RB0X 3C80A 5IWAM 1B7SA 4ARMB 3T36A 1ZWNA 5A3EA 1C60A 1LJEA 2B6WA 4QNMA 1WR1B 4IATA 1TLAA 2C8PA 1YAOA 1WVVA 5LVIA 5B59A 3A6BY 2L7HA 254LA 2ZAOA 4G9SA 1GB0A 4AGAA 1DGBA 1LZ9A 3TWMA 2QNJA 1XJUA 1F4IA 3AZ5A 2G5GX 1KW5A 5FTKA 5APEA 4I7PA 2HU1A 5L9JA 2RAZX 4PPOA 3TWKA 2D7HA 4I7QA 3GRVA 3IJUA 1R6BX 1GBOA 1G8PA 4NY5A 4F2LA 2LVPC 3AGGG 5H37D 2QB0B 1WTNA 3A6CY 2YR0A 5B05A 1DKJA 5LZMA 1D3NA 1L81A 1HNLA 244LA 4WL7A 3TMVA 4NSGA 219LA 4H92A 4H90A 1O23A 4JXJA 1KXWA 2DQEY 1GFJA 1QZMA 1LLHA 1V7TA 1HMLA 3ZVQA 2D4JA 1I1ZA 5KXTA 2D7EA 2XBSA 2Z19A 4N8ZA 3CF2A 3GQ5A 1L21A 1L54A 1L44A 1XB2B 1KS3A 2RBNA 3AZ7A 1HEQA 1Q02A 3D9AC 1XGRC 1GB7A 3HUKA 159LA 4GKKM 5KQ8A 4DYGA 1DI4A 4G3OA 1SG9A 4MGKE 1P7SA 1L64A 3GLGA 224LA 5I54A 2EJSA 1JTOL 3CSZA 3UZUA 3HJ8A 3GLIB 1OV7A 2YBMA 1GAYA 5FCPA 1DO0A 4IBJA 1CJ6A 4YY3M 2LHGA 5LMNM 2KEBA 3OE9A 4LZTA 1SWYA 232LA 3WUNA 1LZCA 4ZIXA 4LYZA 2F32A 2Z4RA 4D80A 2F5QA 2VB1A 4RF1A 4DDCA 1L79A 1VDTA 1BB6A 3TXEA 1IWZA 2Z18A 4DT3A 2F47A 4NRVA 1IP7A 3P64A 1GB2A 1UIGA 2Q9EA 3HBHA 3T38A 5KXZA 5ILCA 3UONA 1B7RA 4II7A 4DD0A 1P36A 2RGHA 4JN6A 2BQBA 4OOTA 4DDBA 2Z2EA 1B9OA 1B6IA 4LYMA 1IQPA 2MEDA 1TH4A 4IIWA 2WSFF 3AFHA 1LCNA 4JI2M 2K6BA 1HQYE 132LA 1C67A 1IC7Y 2IGCA 4DQJA 5KXYA 5DN4A 5L3IA 3U61B 3E4RA 144LA 3WH1A 4NGWA 120LA 1L72A 134LA 2MEEA 4NSJA 3CSRA 1NBYC 2Z39A 5IELA 3HU3A 3IG8A 1IBLM 2DQHY 5APCA 2LBCA 1C6AA 4W55A 4IJEA 2CV0A 1G41A 1L90A 3HKPA 1IWVA 1DXJA 2F30A 1ZURA 3FYDA 4CGYB 3EMSA 4UWUA 1G0LA 4L4UA 3Q8XA 3IJVA 1QVRA 3FADA 4DR6M 4NG8A 1NF5A 1D0KA 1QQWA 1OVJA 1JUGA 1K82A 1G0QA 152LA 4G4CA 1QDRA 3GLIA 1DQJC 4LJAA 1IM2A 4KO8A 4NGIA 1IOCA 1XEKA 2DQJY 4NGOA 4PT5A 3U6EA 3QYEA 4LF5M 5KKJA 4RLMA 4WP2A 4BADA 1VEGA 1IN5A 1IORA 2JUJA 181LA 1C6PA 4XBOA 3W6EA 1L83A 4HJYA 2O01F 4CHTB 1IXRC 3L26A 2KRUA 3WMKA 1IXZA 1GF4A 1QS9A 230LA 4RDSA 184LA 1G7HC 1OUBA 2ZBKB 5FDJA 5DLAA 3U61A 1GBWA 3FTCA 1C10A 1LZDA 5HMJA 1G0KA 1L43A 1L84A 1QYRA 1UIHA 2FNAA 1L04A 1NJFA 1REMA 1KXXA 1DYGA 1EFUB 1FKQA 3FKEA 1CKHA 3DN1A 1TGUA 3IWRA 1LMTA 1OJLA 1L60A 1BB3A 4GLAA 2DHRA 3AB6A 2ZM6M 1L11A 4W56A 1IFYA 1DYAA 191LA 3HJSA 2KRKA 4FVMA 3P65A 236LA 3C81A 1QAMA 2HUKA 3VFDA 207LA 5FSWA 2Q9DA 4NGLA 5I5QA 1NMMA 2DQIY 3U6SA 3WPJA 4FW9A 1DKKA 1CV1A 3C8QA 3GPYA 4R3DA 1MJGM 1LSGA 3J4GA 1IWYA 2HUBA 3KSXA 3J81S 2HTXA 3AGIA 2XLJA 1JEFA 1LI3A 2DAGA 3N9EA 1F10A 2VIIA 2Y0QA 1QT6A 212LA 4W54A 1OKSA 1P3NA 4H9FA 1SSWA 2RB1X 3F6ZA 4W52A 1TH2A 2VF7A 4GITA 1L00A 1XSFA 1W5TA 1HEMA 3GUJA 1T6VL 2D7GA 3PXGA 4P17A 2WSCF 1L69A 3HT7A 4TUNA 5C6JA 154LA 5E9RA 2G8LA 1NQIA 1HEWA 4GIPA 4CIZA 2B75A 2R65A 1L03A 1D0LA 4ZFPA 3ATOA 5EP2A 2ERCA 3U6OA 1A2YC 1JPOA 2HEDA 4DD1A 2E5LM 3PBLA 3C8SA 3MHVC 2F4VM 1QSBA 1NV9A 2DQFC 1L93A 1P5CA 3KVWA 2BQCA 1WQRA 2MECA 1L30A 1LYZA 2JY8A 2YDGA 4HSFA 4B49A 3AGHA 2C99A 3ZCBB 128LA 4DV1M 1SWZA 228LA 1E8LA 4WW0A 1LJ4A 3W6CA 1CKFA 1ZAEA 3PNYA 1LYYA 4TTDA 3RFWA 4ETEA 2DQDY 3WVYA 4LFCM 1JIYA 1BVSA 3W0FA 2LYOA 151LA 1CV6A 1IX0A 2Y0TA 3DNAA 1YROA 4AXTA 1GE2A 3CT5A 4S0WA 5I14A 2BQDA 4WLXA 1WJ7A 1NWGA 3SB5A 1UIDA 2L09A 2RAYX 3ATNA 1IP6A 1N78A 3GLIE 2EO2A 2ZNXY 3IECA 5ITXE 1LMAA 2OU8A 2O4WA 1EQ4A 3VKHA 3SBJA 3A95A 4OO9A 4AG6A 1GEVA 3W0LB 1L32A 2CUUA 1YKZX 4IBFA 4OOOA 2KNAA 1C64A 1LAAA 3C9PA 2B5ZA 2LZ2A 1MELL 4WM4A 1WTHA 4H9CA 4W5WA 4I7RA 4EPIA 1LSEA 3M3UA 167LA 1IEEA 1CTWA 1LYIA 4MGZE 193LA 5KXXA 1GFVA 1NJGA 4NXMM 259LA 2Q2EB 1G7JC 1SSYA 1CX7A 217LA 3FRHA 2K0BX 1HNZM 2RBQA 3G3XA 1TTEA 4Z8XA 1OFIA 4WO9A 3KS4A 2UXBM 4UN2B 1GBSA 4H8ZA 1PZYA 1VEDA 4LFBM 1L71A 1LHIA 4Z46A 175LA 4LDOA 3OE6A 258LA 4WURA 2L7IA 1LOZA 3K1JA 1IR7A 2L2DA 1LGXA 4W57A 1BWIA 1LGUA 1LZYA 3CT1A 4B7HA 1LSPA 246LA 4JI7M 2QQ8A 4B08A 111LA 3VDUA 1L27A 1C6JA 1L77A 3C7YA 4DWXA 1N33M 1UUZC 1E94E 1QDTA 1WGNA 2FBBA 5E6JA 3KAMA 4XJGA 1C6NA 4DV4M 4AG5A 251LA 4LFPA 1DZBX 1LHKA 4L41A 1L09A 1QT3A 3NY9A 4IBBA 4S12A 3DZDA 1I94M 1LSDA 3U60B 1L8QA 4MM3B 3GLHB 2WZJA 3A92A 233LA 4NFVA 5LYTA 2OTYX 5KXRA 4IBGA 1QTVA 4QDNA 1XGTC 2VQEM 2K47A 1UACY 1ZMVA 3AKZA 1L29A 3D3DA 1ORYB 2FH0A 1K28A 4IBDA 4OX9M 1TDYA 2HEEA 1NY6A 3EO5A 4D82A 130LA 1C6CA 5FLXS 1GB8A 1SQ2L 4PDGA 1XXHB 1LHLA 3DA1A 3LN2A 1BVKC 4JI5M 3HBDA 2I6ZA 1DI5A 4I5SA 1X37A 2ZANA 5A2QS 2PC2A 7LZMA 1Z55A 4RF0A 3HBEX 1LV7A 1FNNA 3SHFA 3GRRA 4JI1M 1L08A 1UIEA 2QPAA 3PDSA 2YBJA 4NHPA 1D2NA 2F4GA 1L89A 1LJ3A 5EQTA 173LA 1REZA 1JTMA 3AOEC 4CFOA 1CJ7A 4WLTA 4EKRA 1CUQA 4WM6A 2KXEA 5C18A 3AOEA 1L45A 4G6ZA 1PJIA 1A5TA 1R4GA 4LJ9A 3ZQJA 3G3WA 4IJFA 3LVWA 3GRYA 1IN4A 137LA 4XJIA 1HT1E 2R4JA 3A45A 4MB7A 208LA 4W53A 4XJBA 3U60A 4ARPA 1C6IA 1ZMYL 1DPXA 4B4JA 4GCFA 1LHHA 4LDLA 4IAPA 2R46A 5EP4A 3JR6A 1GE1A 3TXHA 4H9IA 4FD2A 3J7AS 2KHHA 4LF6M 1E32A 1YSYA 4FWHA 2DBTA 3GUIA 2EUCA 3BBZA 4H9EA 4H91A 4GCEA 2JY5A 4H9BA 2G4PA 1G4AE 4NGJA 4R71A 166LA 5GKNA 1BWJA 3WPKA 3VKGA 238LA 1OUDA 3CDVA 3MGWA 5KPTA 2O79A 3HTFA 4YF2A 2CUZA 4EKPA 4ETBA 1LPIA 1H6MA 2H1RA 4PHIA 1INUA 1LYGA 2ZTDA 118LA 1LI6A 1NY5A 4YENA 1B7LA 5KPZA 4OWEA 4LF7M 4ML7A 5B1GA 1SXJC 3WW5A 5LVHA 4GN4A 1NNUC 3DMZA 1SXJA 4B3MM 4NWHA 3W67A 3L2XA 1L05A 2JY7A 1L35A 261LA 5K7OA 4W94A 229LA 2UUCM 214LA 4OVZA 2Z2FA 3B0OA 2DVWB 1EPYA 4DR1M 113LA 2CJLA 4D9ZA 3K9PA 1L18A 1GEZA 1IVMA 2LWXA 1GF9A 4EJ4A 3TE6A 1L55A 4GN3A 153LA 2C96A 4FCTA 1C65A 2DWLA 2LCBA 3QNGA 2K9DA 2OEAX 1L24A 1IIZA 1YQVY 2MEAA 1BB5A 5F14A 3GLGB 4ETDA 4GRVA 182LA 1GFGA 1L06A 2C8OA 2NQ8C 1J1OY 3BKVA 7LYZA 4DBGB 1XHBA 2FFJA 4QOSA 2ZNWY 1L23A 3WULA 4NSOB 3H4MA 4TSCA 2OTZX 2JA2A 4DV5M 5LA5A 5EP1A 1NO1A 1G0GA 2O5RA 1L67A 2LYZA 127LA 3GP1A 1MLCE 4KL7A 1Z6TA 5B07A 3DN2A 4N0JA 1T97A 3ZEKA 3FYCA 4REZA 4I7SA 4ARLA 1CUPA 242LA 3CDQA 4LYBA 3VWOA 1JKDA 4YEMA 2OU0X 3T6UA 1D0MA 201LA 4YM8A 4GC9A 4P16A 1GB3A 1C68A 3A8ZA 1OFHA 1B5VA 1F6RA 1T8GA 2YBHA 1LGWA 3B0IA 2DKLA 138LA 4NHSA 4YOPA 4GH9A 2XFSA 1D6QA 5KXWA 3HU8A 3K2LA 2IHLA 2ZYCA 1OIZA 131LA 4G4BA 4WLDA 1P6YA 2C5RA 4I7NA 4DV0M 2CDSA 1LZSA 4Z3MA 4XJFA 4L6V6 3HTGA 2HEAA 1IXSB 4DR4M 1GF3A 3SN6R 1WXQA 4AI6A 3WUMA 2B73A 3A96A 1REYA 3D8BA 239LA 3CDTA 1QUDA 4CFPA 1R2YA 1IP3A 1HFZA 2GQFA 4M9ZA 1LZ6A 240LA 1JSFA 4OWCA 5EXTA 1C6BA 5F81A 5FEKA 1PJQA 1B5ZA 2YSSC 1L97A 1L2BA 5D5FA 5T3FA 4LF8M 3KOYE 5LA8A 2HULA 3V2WA 3AOGA 1OVHA 1T3TA 2OE9X 2XBRA 250LA 1XEIA 3I4VA 1C7PA 4M4OA 1DYFA 226LA 5LAFA 4ZPXA 5I53A 4O34A 4CJ2A 2HUMA 1GL7A 2MR9A 2BWEA 3SB9A 4XGIA 2G4QA 1VDPA 1L01A 3GLHE 3CB7A 4DD3A 146LA 1YKXX 1SX2A 4Z6YA 1JKBA 1T3PA 4I7KA 6LYTA 2R4EA 4J1BA 1Q3BA 1L41A 4LYTA 5EP3A 3HT8A 5DFLA 3M18B 4ZEEA 4JI8M 1HNXM 4MGYE 1J7KA 4RLNA 2GNOA 183LA 1L96A 2DAEA 1C6KA 1GFUA 3V2YA 1DYCA 1XXHE 1LYHA 4NL4H 1PJTA 1ALCA 4OWBA 2RGOA 4LT3A 1LSMA 1G71A 2XF3A 3CTWB 198LA 4LYOA 1IXSA 3HGIA 3Q8GA 1L94A 2BJWA 2DHYA 2KW0A 3LQQA 1VG5A 3LVVA 1IOSA 4HPEA 4NIJA 4I0CA 1W6ZA 3HUAA 3JAMS 215LA 2JZ1A 174LA 1P37A 4HPIA 3P4ZA 5D5CA 2Z4SA 2AHMA 3HH5A 3SC3A 3SAVA 3FI7A 1LTMA 3DN6A 1L2CA 5ITQA 4NSIA 4WM3A 5L3HA 1GDXA 2DKVA 3GUNA 2JP7A 2DZOB 205LA 140LA 256LA 2JXNA 2Z38A 3P66A 1G7IC 4MH0E 1DYEA 1DGHB 4LYCA 1L49A 1L20A 1XNRM 1UIBA 1LZ1A 1OUHA 1C61A 2RH1A 1BVXA 186LA 3MMPA 5ILFA 2BLXA 1W08A 1GVNA 1C63A 1B5UA 3QAKA 2BQOA 2ZIKA 3C58A 3TXFA 206LA 1BWHA 1GFKA 3KP1E 1GB5A 4DV3M 2VDBB 197LA 1B5XA 187LA 2KNVA 114LA 2HEBA 4PCZA 185LA 2BQAA 1L95A 1HT2E 4XYYA 3W6DA 2N5ZA 3RGPA 3SASA 2F4AA 1HHLA 1L88A 3D8LA 4R6CA 3RW8A 1GHLA 1VDLA 1UBZA 3WHLA 1YUBA 3K2RA 4M6DA 1LYEA 4XADA 2Z7JA 4LF4M 1AUAA 4X65M 3LHMA 4EOFA 2J5YA 1ZV1A 1L37A 1LJHA 1LZBA 5LXWA 1NHBA 2QENA 3NBIA 4I8OA 1OQMA 1C6TA 1FLWA 5KXPA 3QE8A 5HMVA 3HH4A 1GF5A 1CU0A 4J7VA 1QSQA 4X66M 2F5SA 1GWDA 3A90A 3WXTA 2MJ5B 1EE8A 3OE0A 2OPFA 4TWSA 4ARJA 3HHYA 1LZNA 1TBYA 222LA 3EMLA 3WUAA 2BQMA 4FCVA 3LYZA 1LW9A 2DQCY 1OQYA 1DGHA 1QAQA 3VK7A 2A7FA 4ETCA 3TQSA 4NOOB 3EIEA 3GLGE 4HV1A 1BHZA 1OUGA 1C46A 190LA 5EBHA 4DUZM 1QAOA 4XJDA 1WQMA 4HV2A 3M6AA 1GBZA 1QT8A 4LGKA 1GABA 158LA 4LZZA 2HKJA 1NV8A 4XENA 5JENB 2KDLA 3TXJA 2VF8A 2XEPA 2F5PA 1QTZA 3KOWE 3A42A 5KXSA 4HJZA 3ILKA 1LZEA 2KA6B 5F16A 3C82A 1C6DA 133LA 2OU9A 1HEPA 2NWDX 3UGJA 5DNYA 1HEOA 2HU3A 2UU9M 1CV5A 4I7MA 3HWLA 234LA 1W5SA 1PJJA 4PDIA 2WSEF 1GE0A 4KHPM 2R18A 1IY3A 2Z6BA 1GBXA 1L62A 2KNZA 4IASA 3RZ4A 4K5YA 1OAIA 129LA 4DD9A 2BQKA 1QUHA 4EIWA 1FBIX 3CGWA 164LA 2NTGA 1IR8A 4N9RA 1QIOA 143LA 4RW2A 1L13A 5HNCA 1JHLA 4DV7M 2Z12A 2Z8YM 2B7XA 231LA 1B7PA 1JR3A 1VATA 3W3EA 2A7DA 1NVMA 3GPPA 247LA 4PGJB 6LZMA 1IN8A 1JKAA 2DZNB 3E46A 3DN3A 2FBDA 122LA 4LRSA 3A34A 1B0DA 2F2QA 2CWBA 1UCOA 1BB7A 3F8VA 4LFXA 1PS5A 4IBEA 1LMOA 4M9SA 1REXA 2V1UA 1L0JA 3QYBA 2DAMA 3FTFA 2Z3XA 2NTHA 1L42A 4LGYA 5ITRA 3NYAA 1GFRA 1CU6A 3AV0A 1L14A 1JR3D 5C6IA 3VW7A 1LHJA 223LA 3CF0A 4LY6A 1A4VA 1GL6A 1C6MA 2L6OA 2CWIA 165LA 5IZ7D 176LA 2JZ0A 2YQZA 4Z98A 1R2ZA 1C6QA 2DXIA 1G59A 1IY0A 2ZYPA 2BQIA 4F1IA 1L82A 5DL9A 3K8ZA 2B6TA 4AKHA 3B7ZA 3F9LA 2Y8PA 1B7NA 1L58A 2OE7X 6LYZA 160LA 4L8RC 4ET9A 2C9CA 1C6FA 1LZAA 2DQAA 1CV4A 4BAPA 4B3RM 1DI3A 1LWKA 1OIPA 3I04M 3HU2A 2A4TA 2XH9A 2XSZD 1B7MA 3CQLA 5C6LA 3LZTA 2ANVA 2QBYA 4OU7A 4WO6A 4M0WA 1LZRA 4IBIA 1UFZA 5EXSA 1N34M 4LFAM 1KXYA 4NGKA 3FRIA 3WU8A 2QZ4A 1IP2A 243LA 3SBBC 1LKSA 2RB2X 3DMXA 4LJ6A 142LA 195LA 4GHAA 1C6GA 4PJZA 1DYDA 1OUEA 2Y21A 3FD9A 2EQLA 2J7NA 4QOZC 4J1AA 1J09A 2C98A 3JR5A 4EPFA 1IR9A 1WQNA 5M1YA 4E3UA 1L85A 4B4IA 1G06A 5KQDA 1DPWA 1E9RA 2XJWA 3DOAA 1AIPC 3F92A 4JV5M 177LA 1QSAA 1WHCA 4TUWA 3LQRA 2DENA 1RCMA 1CJ9A 3WVXA 3QWLA 4KODA 221LA 4KXIA 1C6LA 3AJIB 5FTJA 1HENA 1V34A 150LA 169LA 3GULA 1PJSA 3B72A 4H93A 1LWGA 1P56A 4K0KM 3BKHA 1XC8A 4X3BA 3K9OA 2UUAM 1P64A 2JNHA 4DQ7A 1BQLY 4WL6A 5LYMA 4C3WA 3AZ4A 3I01M 1L26A 1MN3A 3THGA 1CX6A 1T8FA 2BQGA 3TXIA 235LA 1GKIA 1L68A 1C66A 1P2RA 107LA 4GCCA 1E9SA 3HHWA 2Z37A 3R9XB 3LZMA 5FELA 5DM9A 1L98A 4OW0A 2DWMA 2BPUA 4EKSA 2MGWA 3A91A 1PQMA 5I4YA 1ZMWA 188LA 1JISA 3HU1A 4NRWA 4B3SM 1L28A 3A3QA 1SXJB 1D9WA 5LVJA 3TMXA 4DD7A 4L78A 1CNSA 4TSBA 1HERA 3NY8A 4JI4M 1LHMA 1XWIA 4OVZB 2V1CA 2A5YB 1GE3A 260LA 1QT4A 227LA 1YKYX 2YBIA 5AMYA 2M60A 1IP4A 1LSFA 3CDOA 1TEWA 4LF9M 2LHMA 2LZTA 4Y28F 3RUNA 1HR0M 1TCYA 1GF6A 4I7TA 2B3TA 3TMWA 1L87A 1L91A 5LVGA 5LYZA 2QCUA 2XZUA 3SARA 1LJNA 1HNWM 1QTEA 4GLVA 4W59A 7CATA 9LYZA 1QSWA 1LJKA 3UK6A 1LYJA 2HL7A 3B9PA 1K3WA 3PNVA 1VFBC 4G49A 1KW7A 1WVUA 189LA 211LA 5APFA 3B7NA 2F5OA 1GJTA 1OVKA 1QUOA 2CP8A 3FA0A 1CKGA 3KOXE 4AKIA 1B2KA 5APDA 1PQOA 1DO2A 2YNMD 4MCKA 126LA 1LPYA 5ITUA 1ZVYB 3K92A 1HC0A 3H4JA 1ZVHL 1L33A 4FDYA 1D2WA 4B7GA 2I7PA 4NXNM 4N1CC 3HTDA 3BXWA 1ZMUA 1GFHA 1IC4Y 1D6PA 3JR4A 4YXAC 5FSTA 1D3FA 3A46A 2LC9A 2APLA 2Q0MX 1UIFA 4CJ6A 1KIQC 1RI8B 4NGYA 115LA 4DDAA 5EXXA 2W1LA 2G3QA 3MJ5A 4G4OA 2D4IA 1HQCA 3TXKA 1GJSA 4C5FA 4G4QA 1B7OA 1VAUA 2OOAA 3J7BA 1DYBA 1JJ3A 4QNRA 1LJFA 3E21A 1N32M 155LA 1EL1A 2DQGY 4QEQA 4GMQA 1PQIA 4ET8A 2CHQA 1TDZA 3GXKA 3PVSA 3A67Y 3KDSE 1XFPL 1JB0F 4RW1A 5KXLA 1OWYA 2VQFM 4WM5A 4JI0M 1LSAA 3L2AA 1P3QQ 1NDMC 1L86A 2FS1A 3TXGA 196LA 1B7QA 180LA 2I7NA 1C6EA 2BQEA 4H1PA 1BB4A 2UUBM 3KXEC 4WOAA 1L50A 4I7JA 1IBMM 3RGSA 218LA 2F5NA 3SFZA 1LZ8A 1QANA 1C08C 3LW5F 1GAZA 1FLYA 2BWBA 1OAOC 5LIOA 3E3DA 3M0EA 1C62A 4DV6M 1I4WA 3HHXA 4LJ7A 4IBKA 1ZV5L 1HMKA 5FHWA 5DN5A 2H5XA 1XMOM 4P2EA 1IN6A 3WU9A 1TR8A 168LA 4AKGA 3SP3A 3SBAA 1L59A 1L56A 3KS8A 2CV1A 123LA 1PM5A 1PRBA 1CU5A 1Q3CA 2LH0A 4DAJA 1HFXA 1PQKA 1Z5AA 1JQJC 1XGQC 2RKOA 1GPQC 2C9OA 1FDLY 1KY0A 3BOSA 2HEFA 1SLYA 3DN8A 1Z5BA 1QTHA 1L40A 1L46A 2R6FA 1OP9B 1LJIA 4ARQA 2EKKA 1DGGA 2CE7A 4QY9A 255LA 3AW6A 3TMUA 2YVBA 4Z41A 5KY1A 1UICA 3B89A 3TL4X 3UJNA 3U6MA 8LYZA 1D3JA 5ITTA 1C45A 4A7DA 3HH3A 4NWEA 3DN4A 3V76A 1AT6A 3TXDA 252LA 4H94A 2P5TA 5ITYA 3FUWA 2ZWBA 3VLFB 5BPVA 2HWJA 2RRUA 1JTNA 3GO8A 2CGIA 5LMUM 4NHQA 2UXCM 1QTBA 1JJ0A 4W58A 3D4SA 2ZIJA 2CEAA 2DWZB 1L34A 1N4FA 3HH6A 3LYOA 2D6BA 1IOTA 3B74A 1LJJA 3R8FA 1XMQM 3SB8A 3HJQA 3GUKA 3ULRA 5E26A 3FUVA 5IHGA 145LA 2BQHA 4JYAM 1S3SA 2FE8A 2YBNA 1T43A 4QHTA 5KPRA 2CFOA 2J7OA 1C6HA 1L16A 4FCWA 2OOBA 1GBYA 2LVQD 4GBRB 1L36A 2IFFY 4ARMA 170LA 3T1YM 1VDQA 3A93A 2W1MA 3W6AA 3W68A 1VDSA 2LNHC 5KKIA 148LE 2EIZC 2UXDM 2X8AA 4FWGA 4LJ4A 4OWAA 5JI3E 2B70A 5E4PA 4PD2A 4B3TM 1IY1A 1HELA 1XGUC 2W82A 1C1KA 4NSHA 3AZ6A 1L52A 109LA 3W6FA 1RU3A 1L73A 4HP0A 1JWRA 1LMCA 3P68A 3DFZA 2AUBA 3KOZE 2JWSA 2R0IA 3B7QA 2ZAMA 1GDWA 1YANA 5B1FA 2XQOA 1IN7A 1HF4A 2LTUA 156LA 1YL1X 3FE0A 4GCBA 4R7GA 2D4KA 141LA 1SXJE 3L25A 4LRTA 5KO3A 1G0PA 1LYSA 2EA0A 4M0DA 3LCUA 4HLQA 4X62M 4TX7A 4ANRA 2H9JA 3U6DA 1LSZA 1QTKA 5F3WA 4RKUF 1L75A 1GF7A 2I25L 3GUPA 2LXEA 1T8AA 4HTKA 2ZQ4A 2M5ZA 3HDEA 2G4NA 2XTHA 2D91A 1LZGA 4DR7M 5I4WA 2CRUA 4MR1A 4ITQA 4GRIA 3C3EA 5A3ZA 1L76A 1LSNA 1YIKA 3T1HM 1GF8A 3GLFB 1G1WA 3RT5X 2WARA 194LA 1GF0A 4DUYM 5HLLA 1L25A 4L16A 1L15A 1L31A 1IWUA 1GLNA 3L27A 2R62A 4J0LA 3GPXA 3FTDA 4NHTA 4QGZA 1KY1A 5ITXA 1OYUA 2BQJA 2YFQA 1IO5A 1TF0B 3RNXA 4AW4A 3HX3A 1QT5A 1CU3A 2X0AA 1L17A 1L19A 1C69A 4EKQA 2O7AA 3U6QA 3U5ZB 4HTQA 171LA 1G07A 2XGNA 3SAWA 1D9UA 2DI0A 2MROB 245LA 161LA 2EKFA 1UM8A 3KFUG 1AM7A 3GUMA 1L99A 5KJ9A 2YBLA 3A98B 1L80A 2B6ZA 5EJCA 119LA 1FJGM 2BQFA 3G3BB 4D81A 1J5EM 3IG5A 3KSJA 1V7SA 5IDDA 1TAYA 1WQOA 4DKLA 3T6PA 3SMPA 5IREB 139LA 4NG1A 1XEPA 1OUAA 4GN5C 3HUQA 1CKCA 1WTMA 1AKIA 4G4RA 4YXCA 3AYQA 1GO5A 4NHIA 1WGLA 3KW6A 5KXMA 3AW7A 1RJCB 3SYLA 4WG1A 1XJTA 4DQ5A 5LINA 3L29A 1IWTA 4AZFA 4IJ4A 1L39A 3EBAB 4I81A 1LSYA 4UWVA 1L2DA 4GCDA 1TH3A 1YAQA 5KXOA 220LA 178LA 3LMMA 4X64M 1QUGA 3G3AB 199LA 4YX7C 3GLFA 4NGVA 3OE8A 3RE8A 1G0JA 3C8RA 257LA 3J27B 3B6LA 3KP0E 4LJ8A 1B5YA 4BS7A 1QQYA 1QTCA 3WL2A 2L78A 4HJVA 3C7WA 4MGIE 1N77A 4N1EI 3A94A 4WMGA 4NSRA 1MU5A 5F9XA 5FTNA 4CGEA 3WPLA 4R0FA 3GPUA 1L74A 4EMNA 1L57A 2BNKA 1CVKA 1LSBA 4LT0A 3U5ZA 3NBXX 1LZ5A 2RBRA 1UA6Y 4I8SA 2CHVA 1EQEA 1CUKA 4BBAA 3U6CA 1CJ8A 5J7CA 4XJHA 1OWZA 1DV0A 3OJPA 1V33A 1GFAA 4JI3M 5HQ1A 4GKJM 2RBSA 3HFMY 3ZC7B 5HNLA 2LVAA 1G3IA 1L48A 1FLUA 1OUJA 3GQ3A 2QBYB 192LA 1Z59A 1EIJA 1NKHA 3WXUA 110LA 5B06A 1PGYA 157LA 4XN6A 1IOQA 1OTRA 1RFPA 1KIRC 3SB6A 4PRUA 1NHWC 172LA 1CV3A 1ZQ9A 1LI2A 1UIAA 3CSQA 3LYMA 1HSXA 1VEJA 3LCVB 1L07A 4ZPUA 1HJPA 2LVNC 5LVKA 1IY2A 2B6YA 1L38A 4UWNA 1N75A 1H87A 2B74A 2HHHM 4GHLA 2ZILA 4DJHA 3VDPA 1NBZC 1CKDA 4JI6M 1L10A 5LAGA 241LA 3K3TA 4MSTA 147LA 1FKVA 4OWHA 3C3DA 1JSEA 4NGZA 3EXDA 3LZ2A 4PJ2C 2OO9A 3MK6A 2LVOC 1I6SA 3SMSA 1L12A 2H9KA 2F2NA 5FTLA 3WYHA 1BGIA 216LA 4HTNA 2XSZA 2N35A 1LKRA 4LZJA 2MEIA 102LA 1CV0A 1G7LC 1NHGC 4L15A 3G3VA 8CATA 262LA 5C1BA 2MEHA 3WU7A 1LYOA 1XEJA 2MEFA 2CHGA 209LA 2HCBA 3FUTA 1C7YA 1PQJA 3C83A 4W51A 3HY5A 4PRQA 1R5LA 2L4EA 103LA 1QUSA 4DC4A 3RU5A 1DGFA 2DWNA 1JJ1A 2QHOB 1L92A 1QTDA 1LSCA 3QY4A 3TWLA 2EKSC 1SX7A 2QSFX 2BAAA 2RBPA 1QUTA 1T6OA 4M9XA 1LYFA 4E97A 1WIVA 5L8RF 1L70A 4DD2A 5EXPA 225LA 1IWXA 2QARC 1QZEA 1JITA 1MX0A 1ZYTA 1G0MA 1VQ1A 3WHKA 1B5WA 2FYDA 1J1PY 1YILA 1P2LA 3E9SA 3NWLA 2XFTA 5JI2E 3CF6E 162LA 1R7RA 2DAIA 1LJGA 3RZEA 2HAKA 1L1ZA 1G1VA 2HECA 1D2YA 2MEGA 3ODUA 3L28A 2DNAA 3AJNA 1JQUA 3GQ4A 163LA 1JTPL 2MEBA 2X4AA 2EPEA 4LT2A 1LYDA 2ZQ3A 4CHXA 2BLYA 3LYTA 3GXRA 4NC6A 4H8XA 4AQNA 1NSFA 4ETAA 237LA 1IWWA 4WLYA 4FJRA 1GE4A 3HT6A 1LMPA 4G4NA 1GB9A 3TXBA 2FOIC 125LA 2KZUA 1GB6A 1L22A 2ZTCA 3IHPA 1OUIA 2V6ZM 3GLFE 4LCBA 2XZFA 1N36M 3QAUA 3HHZA 3TPZA 3U6LA 3CT0A 5BR8M 4G4HA 4DR2M 3FI5A 4LZMA 3WW6A 5KXKA 4DR5M 4DR3M 3J6KA 3FUUA 3HWSA 1I56A 5I4XA 1D3MA 1KSFX 3SAUA 4CISA 1IY4A 2R45A 4N5RA 3GUOA 1OV5A 4AQYM 4KT0F 3N9CA 1K3XA 1L02A 200LA 3UMMA 1L65A 3AL0C 5F9UA 4QHSA 4EXMA 3J2PB 2W1YA 1AT5A 2LYMA 4IBCA 1IP5A 3B0KA 1IC5Y 213LA 3EIHA 2DZLA 1J1XY 1FLQA 1JTTL 2RSCA 2RBOA 4HL4A 1NHEA 3T15A 2H5ZA 1TDHA 3HZJA 4H8YA 3N9AA 1H6UA 1L1TA 3SHGB 2BQNA 4HEOA 3OK0A 1GFEA 4LGMA 112LA 4KPMA 4YHHM 1Y8GA 1PQDA 2LZMA 4WM1A 2W1XA 3FTEA 4FWDA 1HSWA 3HU9A 5KXNA 1L51A 2B72A 1KYIA 2BJVA 4KLNA 1JR3E 1L47A 1L53A 3ZH9B 4I4LA 1P2CC 1F0WA 2CV2A 1EQ5A 1FN5A 4BLCA 5DYGA 2OE4X 1HFYA 4GC5A 3I51A 1L63A 1YAPA 4U3XB 3L64A 1G7MC 4LJ5A 5FTMA 2L4FA 1LZ4A 1JKCA 1QS5A 3DN0A 4GEWA 1LMQA 2QP9X 3FE3A 1YAMA 149LA 210LA 2KZSA 5II3A 1YE9A 4I7LA 3SB7A 4NEBA 4DV2M 3M7GA 3VK8A 1GD6A 249LA 253LA 3SATA 3GLHA 1VDDA 104LA 4LT1A 1F6SA 4B0DA 1KNIA 1OUCA 3C7ZA 1IP1A 1IBKM
chains in the Genus database with same CATH topology
4PK0A 2B6XA 1KIPC 4II8A 1RE2A 1NDGC 3A3RX 2I26L 1L61A 108LA 1CU2A 1GXV2 2BQLA 3W6BA 1L0KA 1AZFA 4W96A 1WQQA 4OW1A 4ARQB 248LA 1GXXA 3CDRA 1QT7A 4I7OA 1WQPA 3HT9A 1LMNA 2FYCA 4B4EA 1P46A 4BAFA 2ANXA 4LDEA 3HTBA 1OUFA 1UC0A 1XGPC 4B1AA 4H9HA 4KT3A 1LZTA 3ZVQB 3DKEX 2GV0A 1GFTA 4H9AA 1I20A 1YL0X 1L66A 1C43A 3DMVA 3HDFA 4WG7A 4WM2A 4YEOA 1T6HA 135LA 3C80A 2RB0X 1B7SA 4ARMB 3T36A 1ZWNA 5A3EA 1C60A 1LJEA 2B6WA 4IATA 1TLAA 2C8PA 1YAOA 1WVVA 5LVIA 5B59A 3A6BY 254LA 4G9SA 1GB0A 4AGAA 1LZ9A 1XJUA 3AZ5A 1KW5A 5APEA 4I7PA 2HU1A 5L9JA 2RAZX 4PPOA 4I7QA 3IJUA 1GBOA 4NY5A 3AGGG 2QB0B 1WTNA 3A6CY 5B05A 1DKJA 5LZMA 1D3NA 1L81A 1HNLA 244LA 4WL7A 3TMVA 4NSGA 219LA 4H92A 4H90A 1O23A 1KXWA 2DQEY 1GFJA 1LLHA 1V7TA 1HMLA 3ZVQA 2D4JA 1I1ZA 5KXTA 2XBSA 2Z19A 4N8ZA 1L21A 1L54A 1L44A 1KS3A 2RBNA 3AZ7A 1HEQA 3D9AC 1XGRC 1GB7A 3HUKA 159LA 4DYGA 1DI4A 224LA 1P7SA 5I54A 1L64A 1JTOL 3CSZA 1OV7A 2YBMA 1GAYA 5FCPA 1CJ6A 3OE9A 4LZTA 1SWYA 232LA 3WUNA 1LZCA 4ZIXA 4LYZA 2F32A 2VB1A 4DDCA 1L79A 1VDTA 1BB6A 3TXEA 1IWZA 2Z18A 4DT3A 2F47A 1IP7A 3P64A 1GB2A 1UIGA 2Q9EA 3HBHA 5ILCA 5KXZA 3UONA 1B7RA 4DD0A 1P36A 2BQBA 4OOTA 4DDBA 2Z2EA 1B9OA 1B6IA 4LYMA 2MEDA 1LCNA 132LA 1C67A 1IC7Y 2IGCA 4DQJA 5KXYA 5DN4A 5L3IA 144LA 3WH1A 4NGWA 120LA 1L72A 134LA 2MEEA 4NSJA 3CSRA 1NBYC 2Z39A 5IELA 2DQHY 5APCA 1C6AA 4W55A 1L90A 1IWVA 1DXJA 2F30A 1ZURA 3EMSA 4UWUA 1G0LA 3IJVA 3FADA 4NG8A 1NF5A 1D0KA 1OVJA 1JUGA 1G0QA 152LA 4G4CA 1QDRA 1DQJC 4NGIA 1IOCA 1XEKA 2DQJY 4NGOA 5KKJA 4RLMA 4BADA 1IORA 181LA 1C6PA 3W6EA 1L83A 4HJYA 3WMKA 1GF4A 1QS9A 230LA 4RDSA 184LA 1G7HC 1OUBA 5FDJA 5DLAA 1GBWA 1C10A 1LZDA 5HMJA 1G0KA 1L43A 1L84A 1UIHA 1L04A 1REMA 1KXXA 1DYGA 1FKQA 1CKHA 3DN1A 3IWRA 1LMTA 1L60A 1BB3A 4GLAA 3AB6A 1L11A 4W56A 1DYAA 191LA 3P65A 236LA 3C81A 2HUKA 207LA 5I5QA 2Q9DA 4NGLA 1NMMA 2DQIY 3WPJA 1DKKA 1CV1A 3C8QA 1LSGA 3J4GA 1IWYA 2HUBA 2HTXA 3AGIA 1JEFA 1LI3A 3N9EA 1F10A 1QT6A 212LA 4W54A 1P3NA 4H9FA 1SSWA 2RB1X 3F6ZA 4W52A 1L00A 1XSFA 1HEMA 3GUJA 1T6VL 1L69A 4TUNA 3HT7A 5C6JA 154LA 5E9RA 1NQIA 1HEWA 2B75A 1L03A 1D0LA 4ZFPA 3ATOA 1A2YC 1JPOA 2HEDA 4DD1A 3PBLA 3C8SA 1QSBA 2DQFC 1L93A 1P5CA 2BQCA 1WQRA 2MECA 1L30A 1LYZA 2YDGA 4HSFA 4B49A 3AGHA 128LA 1SWZA 228LA 1E8LA 1LJ4A 3W6CA 1CKFA 1LYYA 4TTDA 4ETEA 2DQDY 3WVYA 1JIYA 2LYOA 151LA 1CV6A 1IX0A 3DNAA 1YROA 4AXTA 1GE2A 3CT5A 4S0WA 5I14A 2BQDA 4WLXA 1NWGA 3SB5A 1UIDA 2RAYX 3ATNA 1IP6A 2ZNXY 1LMAA 2OU8A 2O4WA 1EQ4A 3A95A 4OO9A 1GEVA 1L32A 2CUUA 1YKZX 4OOOA 1C64A 1LAAA 2B5ZA 2LZ2A 1MELL 4WM4A 1WTHA 4H9CA 4I7RA 4EPIA 1LSEA 3M3UA 1LYIA 1IEEA 1CTWA 167LA 193LA 5KXXA 1GFVA 259LA 1G7JC 1SSYA 1CX7A 217LA 3G3XA 2RBQA 4WO9A 1GBSA 4H8ZA 1PZYA 1VEDA 1L71A 1LHIA 4Z46A 175LA 4LDOA 3OE6A 258LA 1LOZA 1IR7A 1LGXA 4W57A 1BWIA 1LGUA 1LZYA 3CT1A 1LSPA 246LA 111LA 1L27A 1C6JA 1L77A 3C7YA 4DWXA 1UUZC 1QDTA 2FBBA 3KAMA 4XJGA 1C6NA 251LA 4LFPA 1DZBX 1LHKA 4L41A 1L09A 1QT3A 3NY9A 1LSDA 3A92A 233LA 4NFVA 5LYTA 2OTYX 5KXRA 1QTVA 4QDNA 1XGTC 1UACY 3D3DA 1L29A 1K28A 1TDYA 2HEEA 3EO5A 130LA 1C6CA 1GB8A 1SQ2L 1LHLA 3LN2A 1BVKC 3HBDA 2I6ZA 1DI5A 7LZMA 2PC2A 1Z55A 3HBEX 1L08A 1UIEA 3PDSA 2YBJA 4NHPA 2F4GA 1L89A 1LJ3A 173LA 1REZA 1JTMA 4CFOA 1CJ7A 4WLTA 4EKRA 1CUQA 4WM6A 1L45A 3G3WA 137LA 4XJIA 208LA 4W53A 4XJBA 4ARPA 1C6IA 1ZMYL 1DPXA 4B4JA 4GCFA 1LHHA 4LDLA 4IAPA 3JR6A 1GE1A 3TXHA 4H9IA 2DBTA 3GUIA 4H9EA 4H91A 4GCEA 4H9BA 2G4PA 4NGJA 166LA 3WPKA 1BWJA 238LA 1OUDA 3CDVA 3MGWA 2O79A 3HTFA 4YF2A 4EKPA 4ETBA 1LPIA 1H6MA 4PHIA 1INUA 1LYGA 118LA 1LI6A 4YENA 1B7LA 4OWEA 5B1GA 4ML7A 3WW5A 5LVHA 4GN4A 3DMZA 4NWHA 3L2XA 1L05A 1L35A 261LA 5K7OA 4W94A 229LA 214LA 2Z2FA 3B0OA 1EPYA 2CJLA 113LA 4D9ZA 1L18A 1GEZA 1IVMA 1GF9A 4EJ4A 1L55A 4GN3A 153LA 1C65A 2LCBA 3QNGA 2OEAX 1L24A 1IIZA 1YQVY 2MEAA 1BB5A 5F14A 4ETDA 4GRVA 182LA 1GFGA 1L06A 2C8OA 1J1OY 3BKVA 7LYZA 2ZNWY 1L23A 3WULA 4TSCA 2OTZX 5LA5A 1G0GA 2LYZA 1L67A 127LA 1MLCE 4KL7A 5B07A 3DN2A 4N0JA 1T97A 3ZEKA 4I7SA 4ARLA 1CUPA 242LA 3CDQA 4LYBA 3VWOA 1JKDA 4YEMA 2OU0X 3T6UA 1D0MA 201LA 4YM8A 1GB3A 1C68A 3A8ZA 3B0IA 1B5VA 1F6RA 1T8GA 1LGWA 2YBHA 138LA 4NHSA 4YOPA 1D6QA 5KXWA 3HU8A 4G4BA 2IHLA 2ZYCA 131LA 4WLDA 1P6YA 4I7NA 2CDSA 1LZSA 4Z3MA 4XJFA 3HTGA 2HEAA 1GF3A 3SN6R 3WUMA 2B73A 3A96A 1REYA 239LA 3CDTA 1QUDA 4CFPA 1IP3A 1HFZA 1LZ6A 240LA 1JSFA 4OWCA 1C6BA 5F81A 5FEKA 2YSSC 1B5ZA 1L97A 5D5FA 5T3FA 5LA8A 2HULA 3V2WA 1OVHA 2OE9X 2XBRA 250LA 1XEIA 1C7PA 4M4OA 1DYFA 226LA 5LAFA 5I53A 4O34A 4CJ2A 2HUMA 3SB9A 2G4QA 1VDPA 1L01A 3CB7A 4DD3A 146LA 1YKXX 1SX2A 1JKBA 1T3PA 4I7KA 6LYTA 4J1BA 1L41A 4LYTA 3HT8A 3M18B 4ZEEA 4RLNA 183LA 1L96A 1C6KA 1GFUA 3V2YA 1DYCA 1LYHA 1ALCA 4OWBA 4LT3A 1LSMA 198LA 4LYOA 1L94A 1IOSA 4HPEA 4NIJA 4I0CA 1W6ZA 3HUAA 215LA 174LA 1P37A 4HPIA 3P4ZA 5D5CA 3HH5A 3FI7A 1LTMA 3DN6A 4NSIA 4WM3A 5L3HA 1GDXA 2DKVA 3GUNA 205LA 140LA 256LA 2Z38A 3P66A 1G7IC 1DYEA 4LYCA 1L49A 1L20A 1UIBA 1LZ1A 1OUHA 1C61A 2RH1A 1BVXA 186LA 5ILFA 2BLXA 1W08A 1C63A 1B5UA 3QAKA 2BQOA 2ZIKA 3TXFA 206LA 1BWHA 1GFKA 1GB5A 197LA 1B5XA 187LA 114LA 2HEBA 185LA 2BQAA 1L95A 4XYYA 3W6DA 2N5ZA 2F4AA 1HHLA 1L88A 4R6CA 3RW8A 1GHLA 1UBZA 3K2RA 4M6DA 1LYEA 4XADA 3LHMA 4EOFA 1L37A 1LJHA 1LZBA 5LXWA 1NHBA 1OQMA 1C6TA 1FLWA 5KXPA 3QE8A 5HMVA 3HH4A 1GF5A 1CU0A 4J7VA 1QSQA 1GWDA 3A90A 3WXTA 3OE0A 4TWSA 4ARJA 1LZNA 1TBYA 222LA 3EMLA 3WUAA 2BQMA 3LYZA 1LW9A 2DQCY 2A7FA 4ETCA 4HV1A 1BHZA 1OUGA 1C46A 190LA 5EBHA 4XJDA 1WQMA 4HV2A 1GBZA 1QT8A 4LGKA 158LA 4XENA 5JENB 3TXJA 1QTZA 5KXSA 4HJZA 1LZEA 5F16A 3C82A 1C6DA 133LA 2OU9A 1HEPA 2NWDX 1HEOA 2HU3A 1CV5A 4I7MA 3HWLA 234LA 1GE0A 1IY3A 2Z6BA 1GBXA 1L62A 4IASA 3RZ4A 4K5YA 129LA 4DD9A 2BQKA 1QUHA 1FBIX 164LA 2NTGA 1IR8A 4N9RA 1QIOA 143LA 4RW2A 1L13A 5HNCA 1JHLA 2Z12A 2B7XA 231LA 1B7PA 1VATA 3W3EA 2A7DA 4PGJB 247LA 6LZMA 1JKAA 3DN3A 2FBDA 122LA 3A34A 1B0DA 2F2QA 1UCOA 1BB7A 3F8VA 4LFXA 1PS5A 1LMOA 1REXA 1L0JA 2NTHA 1L42A 3NYAA 1GFRA 1CU6A 1L14A 5C6IA 3VW7A 1LHJA 223LA 1A4VA 1C6MA 2CWIA 165LA 176LA 4Z98A 1C6QA 2ZYPA 2BQIA 5DL9A 1L82A 2B6TA 3F9LA 2Y8PA 1B7NA 1L58A 2OE7X 6LYZA 160LA 4ET9A 1C6FA 1LZAA 2DQAA 1CV4A 4BAPA 1DI3A 1LWKA 2A4TA 1B7MA 3CQLA 5C6LA 3LZTA 2ANVA 4WO6A 1LZRA 4NGKA 1KXYA 3WU8A 1IP2A 243LA 3SBBC 1LKSA 2RB2X 3DMXA 142LA 195LA 1C6GA 4PJZA 1DYDA 1OUEA 2EQLA 4J1AA 4EPFA 1IR9A 1WQNA 5M1YA 4E3UA 1L85A 4B4IA 1G06A 1DPWA 2XJWA 177LA 1QSAA 1RCMA 1CJ9A 3WVXA 221LA 4KXIA 1C6LA 1HENA 150LA 169LA 3GULA 3B72A 4H93A 1LWGA 1P56A 3BKHA 4X3BA 1P64A 4DQ7A 1BQLY 4WL6A 5LYMA 4C3WA 3AZ4A 1L26A 1CX6A 1T8FA 2BQGA 3TXIA 235LA 1L68A 1C66A 1P2RA 107LA 4GCCA 2Z37A 3LZMA 5FELA 5DM9A 1L98A 2BPUA 4EKSA 3A91A 1PQMA 5I4YA 1JISA 188LA 1L28A 3A3QA 1D9WA 5LVJA 3TMXA 4DD7A 1CNSA 4TSBA 1HERA 3NY8A 1LHMA 1GE3A 260LA 1QT4A 227LA 1YKYX 2YBIA 5AMYA 1IP4A 1LSFA 3CDOA 1TEWA 2LHMA 2LZTA 3RUNA 1TCYA 4I7TA 1GF6A 3TMWA 1L87A 1L91A 5LVGA 5LYZA 1LJNA 1QTEA 4GLVA 4W59A 9LYZA 1QSWA 1LJKA 1LYJA 1VFBC 4G49A 1KW7A 1WVUA 189LA 211LA 5APFA 1OVKA 1QUOA 3FA0A 1CKGA 1B2KA 5APDA 1PQOA 4MCKA 126LA 1LPYA 1ZVYB 1HC0A 1ZVHL 1L33A 4FDYA 1D2WA 4N1CC 3HTDA 1IC4Y 1GFHA 1D6PA 4YXAC 5FSTA 1D3FA 2LC9A 2Q0MX 1UIFA 1KIQC 1RI8B 4NGYA 115LA 4DDAA 2W1LA 2D4IA 3TXKA 4C5FA 1B7OA 1VAUA 1DYBA 1JJ3A 1LJFA 1EL1A 155LA 2DQGY 4QEQA 1PQIA 4ET8A 3GXKA 3A67Y 1XFPL 4RW1A 5KXLA 1OWYA 4WM5A 1LSAA 1NDMC 1L86A 3TXGA 196LA 1B7QA 180LA 1C6EA 2BQEA 4H1PA 1BB4A 4WOAA 1L50A 4I7JA 218LA 1LZ8A 1C08C 1GAZA 1FLYA 5LIOA 3E3DA 1C62A 1ZV5L 1HMKA 5FHWA 5DN5A 4P2EA 3WU9A 168LA 3SP3A 3SBAA 1L59A 1L56A 123LA 1CU5A 4DAJA 1HFXA 1PQKA 1XGQC 1GPQC 1FDLY 1KY0A 2HEFA 1SLYA 3DN8A 1QTHA 1L40A 1L46A 1OP9B 1LJIA 4ARQA 4QY9A 255LA 3AW6A 3TMUA 2YVBA 4Z41A 5KY1A 1UICA 8LYZA 1D3JA 1C45A 4A7DA 3HH3A 4NWEA 3DN4A 1AT6A 3TXDA 252LA 4H94A 2ZWBA 1JTNA 2CGIA 4NHQA 1QTBA 1JJ0A 4W58A 3D4SA 2ZIJA 1L34A 1N4FA 3HH6A 3LYOA 2D6BA 1LJJA 1IOTA 3SB8A 3GUKA 3ULRA 5IHGA 145LA 2BQHA 2YBNA 1L16A 1C6HA 1GBYA 4GBRB 1L36A 2IFFY 4ARMA 170LA 1VDQA 3A93A 2W1MA 3W6AA 1VDSA 5KKIA 148LE 2EIZC 4OWAA 2B70A 5E4PA 1HELA 1XGUC 4NSHA 3AZ6A 1L52A 109LA 3W6FA 1L73A 4HP0A 1JWRA 1LMCA 3P68A 2AUBA 1GDWA 1YANA 5B1FA 2XQOA 1HF4A 3FE0A 156LA 1YL1X 4GCBA 2D4KA 141LA 1G0PA 1LYSA 4TX7A 4ANRA 2H9JA 1LSZA 1QTKA 1L75A 1GF7A 2I25L 3GUPA 1T8AA 4HTKA 2ZQ4A 3HDEA 2G4NA 2XTHA 2D91A 1LZGA 5I4WA 4MR1A 5A3ZA 1L76A 1LSNA 1YIKA 1GF8A 1G1WA 3RT5X 2WARA 194LA 1GF0A 5HLLA 1L25A 1L15A 1L31A 1IWUA 4J0LA 4NHTA 4QGZA 1KY1A 3RNXA 1OYUA 2BQJA 1IO5A 1QT5A 1CU3A 2X0AA 1L17A 1L19A 1C69A 4EKQA 2O7AA 4HTQA 171LA 1G07A 1D9UA 245LA 161LA 1AM7A 3GUMA 1L99A 5KJ9A 2YBLA 1L80A 2B6ZA 119LA 2BQFA 3G3BB 1V7SA 5IDDA 1TAYA 1WQOA 4DKLA 139LA 4NG1A 1XEPA 1OUAA 4GN5C 3HUQA 1CKCA 1WTMA 1AKIA 4YXCA 3AYQA 4NHIA 5KXMA 3AW7A 1RJCB 4WG1A 1XJTA 4DQ5A 5LINA 1IWTA 4IJ4A 1L39A 3EBAB 1LSYA 4UWVA 4GCDA 1YAQA 5KXOA 220LA 178LA 1QUGA 3G3AB 199LA 4YX7C 4NGVA 3OE8A 1G0JA 3C8RA 257LA 3B6LA 1B5YA 4BS7A 1QQYA 1QTCA 3WL2A 2L78A 4HJVA 3C7WA 4N1EI 3A94A 4WMGA 5F9XA 4CGEA 3WPLA 4R0FA 1L74A 4EMNA 1L57A 1CVKA 1LSBA 4LT0A 1LZ5A 2RBRA 1UA6Y 4I8SA 1EQEA 1CJ8A 5J7CA 4XJHA 1OWZA 3OJPA 5HQ1A 1GFAA 2RBSA 3HFMY 5HNLA 1L48A 1FLUA 1OUJA 192LA 1NKHA 3WXUA 110LA 5B06A 157LA 4XN6A 1IOQA 1RFPA 3SB6A 1KIRC 4PRUA 172LA 1CV3A 1LI2A 1UIAA 3CSQA 3LYMA 1HSXA 1L07A 4ZPUA 5LVKA 2B6YA 1L38A 4UWNA 1H87A 2B74A 2ZILA 4DJHA 1NBZC 1CKDA 1L10A 5LAGA 241LA 3K3TA 4MSTA 147LA 1FKVA 4OWHA 1JSEA 4NGZA 3EXDA 3LZ2A 4PJ2C 1I6SA 1L12A 2H9KA 2F2NA 3WYHA 1BGIA 216LA 4HTNA 1LKRA 2MEIA 102LA 1CV0A 1G7LC 3G3VA 262LA 2MEHA 3WU7A 1LYOA 1XEJA 2MEFA 209LA 1PQJA 3C83A 4W51A 4PRQA 103LA 1QUSA 4DC4A 3RU5A 1L92A 1JJ1A 1QTDA 1LSCA 3QY4A 2EKSC 1SX7A 2BAAA 2RBPA 1QUTA 1LYFA 4E97A 1L70A 4DD2A 225LA 1IWXA 2QARC 1JITA 1ZYTA 1G0MA 1B5WA 2FYDA 1J1PY 1YILA 1P2LA 162LA 1LJGA 3RZEA 1G1VA 2HECA 1D2YA 2MEGA 3ODUA 3AJNA 1JQUA 163LA 1JTPL 2MEBA 4LT2A 2EPEA 1LYDA 2ZQ3A 4CHXA 2BLYA 3LYTA 3GXRA 4H8XA 4AQNA 4ETAA 237LA 1IWWA 4WLYA 4FJRA 1GE4A 3HT6A 1LMPA 1GB9A 3TXBA 125LA 1GB6A 1L22A 1OUIA 3CT0A 4G4HA 3FI5A 4LZMA 3WW6A 5KXKA 3J6KA 1I56A 5I4XA 1D3MA 1IY4A 4N5RA 3GUOA 1OV5A 3N9CA 1L02A 200LA 1L65A 5F9UA 4EXMA 2W1YA 1AT5A 2LYMA 1IP5A 3B0KA 1IC5Y 213LA 1JTTL 1J1XY 1FLQA 2RSCA 2RBOA 1NHEA 2H5ZA 4H8YA 3N9AA 2BQNA 3OK0A 1GFEA 4KPMA 112LA 1PQDA 2LZMA 4WM1A 2W1XA 1HSWA 3HU9A 5KXNA 1L51A 2B72A 1L47A 1L53A 1P2CC 1F0WA 1EQ5A 1FN5A 2OE4X 1HFYA 1L63A 1YAPA 4U3XB 3L64A 1G7MC 1LZ4A 1JKCA 1QS5A 3DN0A 1LMQA 1YAMA 149LA 210LA 5II3A 4I7LA 3SB7A 4NEBA 1GD6A 249LA 253LA 104LA 4LT1A 1F6SA 4B0DA 1KNIA 1OUCA 3C7ZA 1IP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIP C;  5LXW A;  4II8 A;  193L A;  5KXX A;  1RE2 A;  1GFV A;  3ULR A;  1NDG C;  3A3R X;  1G7J C;  1OQM A;  2I26 L;  1FLW A;  4H9C A;  3QE8 A;  5KXP A;  5HMV A;  5IHG A;  2BQH A;  1GF5 A;  4J7V A;  1GXV 2;  2YBN A;  4WO9 A;  2BQL A;  1GWD A;  1GBS A;  1GBY A;  3W6B A;  4H8Z A;  1AZF A;  3A90 A;  2IFF Y;  1VDQ A;  3A93 A;  3WXT A;  4W96 A;  1WQQ A;  2W1M A;  1PZY A;  4OW1 A;  1VED A;  1LHI A;  4TWS A;  4Z46 A;  1LZN A;  1TBY A;  3W6A A;  1VDS A;  3WUA A;  2BQM A;  3LYZ A;  5KKI A;  2DQC Y;  2EIZ C;  1LOZ A;  1IR7 A;  2A7F A;  4ETC A;  4HV1 A;  4OWA A;  1BWI A;  1BHZ A;  1LZY A;  1OUG A;  1LSP A;  3CT1 A;  5E4P A;  1C46 A;  1HEL A;  1XGU C;  5EBH A;  1GXX A;  4NSH A;  3AZ6 A;  4XJD A;  1WQM A;  4HV2 A;  3W6F A;  1GBZ A;  1WQP A;  4LGK A;  4DWX A;  1UUZ C;  1LMN A;  2FYC A;  4HP0 A;  1QDT A;  1JWR A;  1LMC A;  2FBB A;  3P68 A;  3KAM A;  4XJG A;  4B4E A;  4BAF A;  2AUB A;  4XEN A;  5JEN B;  3TXJ A;  1OUF A;  1UC0 A;  1XGP C;  1GDW A;  1YAN A;  4LFP A;  1DZB X;  1LHK A;  4L41 A;  4B1A A;  4H9H A;  4KT3 A;  5B1F A;  3FE0 A;  1HF4 A;  4HJZ A;  5KXS A;  1LZE A;  1LZT A;  1YL1 X;  4GCB A;  5F16 A;  3ZVQ B;  2D4K A;  1LSD A;  2GV0 A;  133L A;  1GFT A;  1HEP A;  4H9A A;  3A92 A;  2NWD X;  1HEO A;  2HU3 A;  4NFV A;  5LYT A;  1I20 A;  1LYS A;  1YL0 X;  4TX7 A;  4ANR A;  5KXR A;  2H9J A;  1C43 A;  1GE0 A;  1LSZ A;  1QTK A;  4QDN A;  1XGT C;  1GF7 A;  2I25 L;  1IY3 A;  1UAC Y;  1GBX A;  4WG7 A;  4WM2 A;  3D3D A;  4YEO A;  135L A;  4IAS A;  4HTK A;  2ZQ4 A;  3RZ4 A;  1TDY A;  4DD9 A;  2BQK A;  2HEE A;  1B7S A;  2G4N A;  1FBI X;  2XTH A;  2D91 A;  1LZG A;  3T36 A;  5I4W A;  4N9R A;  1IR8 A;  4MR1 A;  5A3E A;  1LJE A;  3EO5 A;  1QIO A;  1GB8 A;  4RW2 A;  1SQ2 L;  4IAT A;  1LHL A;  1YAO A;  2C8P A;  5A3Z A;  1LSN A;  1WVV A;  5LVI A;  1YIK A;  1JHL A;  3A6B Y;  1GF8 A;  5B59 A;  5HNC A;  3RT5 X;  3LN2 A;  1GB0 A;  1BVK C;  4G9S A;  2WAR A;  194L A;  2I6Z A;  3HBD A;  1DI5 A;  4AGA A;  1GF0 A;  5HLL A;  2Z12 A;  1LZ9 A;  1IWU A;  2PC2 A;  1B7P A;  1VAT A;  3W3E A;  1Z55 A;  2A7D A;  4J0L A;  4PGJ B;  3AZ5 A;  5APE A;  4NHT A;  4QGZ A;  3HBE X;  2HU1 A;  3RNX A;  2BQJ A;  1JKA A;  1IO5 A;  5L9J A;  1UIE A;  2FBD A;  4PPO A;  3A34 A;  1B0D A;  2YBJ A;  4NHP A;  2F4G A;  1UCO A;  1LJ3 A;  2X0A A;  3IJU A;  1BB7 A;  4LFX A;  1GBO A;  1PS5 A;  1REZ A;  4NY5 A;  1LMO A;  1REX A;  4CFO A;  1CJ7 A;  4WLT A;  3AGG G;  4HTQ A;  4WM6 A;  1WTN A;  3A6C Y;  1D9U A;  5B05 A;  1GFR A;  1DKJ A;  4WL7 A;  1HNL A;  1AM7 A;  5C6I A;  3TMV A;  5KJ9 A;  1LHJ A;  2YBL A;  3M3U A;  4NSG A;  1A4V A;  4H92 A;  2BQF A;  3G3B B;  4H90 A;  2CWI A;  1O23 A;  3TXD A;  4XJI A;  1V7S A;  4Z98 A;  1KXW A;  5IDD A;  208L A;  2DQE Y;  1GFJ A;  1V7T A;  3ZVQ A;  1HML A;  1TAY A;  1WQO A;  2D4J A;  4XJB A;  1I1Z A;  2ZYP A;  2BQI A;  4NG1 A;  1ZMY L;  5DL9 A;  1OUA A;  1DPX A;  2XBS A;  2Z19 A;  4GN5 C;  4N8Z A;  1CKC A;  1WTM A;  1AKI A;  4GCF A;  1LHH A;  4B4J A;  3AYQ A;  4NHI A;  2Y8P A;  1B7N A;  6LYZ A;  5KXM A;  1GE1 A;  3TXH A;  4H9I A;  4ET9 A;  3AW7 A;  3AZ7 A;  1HEQ A;  1LZA A;  2DQA A;  3D9A C;  1RJC B;  1XGR C;  4WG1 A;  1DI3 A;  1GB7 A;  4BAP A;  2DBT A;  4DYG A;  1DI4 A;  4H9E A;  1IWT A;  4GCE A;  4H9B A;  4H91 A;  5LIN A;  1B7M A;  2G4P A;  1LJJ A;  4IJ4 A;  4NGJ A;  3CQL A;  3EBA B;  5I54 A;  3WPK A;  1BWJ A;  1LSY A;  5C6L A;  3LZT A;  4UWV A;  1OUD A;  1JTO L;  4GCD A;  4WO6 A;  3MGW A;  1LZR A;  1YAQ A;  5KXO A;  3CSZ A;  4YF2 A;  4NGK A;  1KXY A;  3G3A B;  4ETB A;  2YBM A;  1GAY A;  3WU8 A;  1IP2 A;  1LKS A;  5FCP A;  1CJ6 A;  1LPI A;  1H6M A;  4NGV A;  1OUE A;  2EQL A;  4PHI A;  4J1A A;  1INU A;  3B6L A;  4LZT A;  1B5Y A;  4YEN A;  1B7L A;  4OWE A;  1IR9 A;  1WQN A;  1LZC A;  3WUN A;  1QQY A;  4LYZ A;  4ML7 A;  5B1G A;  3WW5 A;  4BS7 A;  4ZIX A;  2VB1 A;  3WL2 A;  5LVH A;  4GN4 A;  4E3U A;  5M1Y A;  4HJV A;  4DDC A;  4B4I A;  4N1E I;  4NWH A;  1VDT A;  1DPW A;  3A94 A;  1BB6 A;  2XJW A;  3TXE A;  5KXT A;  1IWZ A;  4WMG A;  5F9X A;  5K7O A;  4W94 A;  2Z18 A;  4CGE A;  4DT3 A;  3WPL A;  1IP7 A;  3P64 A;  1GB2 A;  1QSA A;  1UIG A;  3HBH A;  4R0F A;  5KXZ A;  5ILC A;  4EMN A;  2Z2F A;  3B0O A;  1LSB A;  4LT0 A;  1B7R A;  4DD0 A;  1LZ5 A;  2BQB A;  4OOT A;  1UA6 Y;  2CJL A;  4D9Z A;  4DDB A;  4I8S A;  1EQE A;  1B9O A;  1GEZ A;  1RCM A;  1CJ9 A;  2Z2E A;  3WVX A;  1IVM A;  4KXI A;  4LYM A;  2MED A;  1CJ8 A;  1LCN A;  5J7C A;  1GF9 A;  1HEN A;  4XJH A;  132L A;  1IC7 Y;  4GN3 A;  153L A;  5KXY A;  5DN4 A;  3OJP A;  5L3I A;  3B72 A;  4H93 A;  5HQ1 A;  1GFA A;  3QNG A;  3BKH A;  3WH1 A;  4NGW A;  3HFM Y;  4X3B A;  1IIZ A;  134L A;  2MEE A;  4NSJ A;  1YQV Y;  2MEA A;  3CSR A;  5HNL A;  1BB5 A;  1NBY C;  5F14 A;  2Z39 A;  5IEL A;  1BQL Y;  1FLU A;  1OUJ A;  4WL6 A;  4ETD A;  5LYM A;  4C3W A;  1GFG A;  1NKH A;  2DQH Y;  3AZ4 A;  5APC A;  3WXU A;  5B06 A;  2C8O A;  2BQG A;  1J1O Y;  3BKV A;  4XN6 A;  7LYZ A;  1IOQ A;  1RFP A;  3TXI A;  1KIR C;  1IWV A;  1DXJ A;  4PRU A;  2F30 A;  2ZNW Y;  3WUL A;  3EMS A;  4TSC A;  4GCC A;  1UIA A;  4UWU A;  5LA5 A;  3CSQ A;  2Z37 A;  3IJV A;  3LYM A;  5FEL A;  2LYZ A;  1HSX A;  4NG8 A;  5DM9 A;  1NF5 A;  1D0K A;  1MLC E;  1JUG A;  2BPU A;  4KL7 A;  5LVK A;  3A91 A;  5I4Y A;  1JIS A;  5B07 A;  4G4C A;  1QDR A;  4UWN A;  4N0J A;  3A3Q A;  1H87 A;  2ZIL A;  3ZEK A;  5LVJ A;  1DQJ C;  1CKD A;  1NBZ C;  3TMX A;  4DD7 A;  1CNS A;  4TSB A;  4NGI A;  1HER A;  5LAG A;  1IOC A;  4LYB A;  3VWO A;  1XEK A;  2DQJ Y;  3K3T A;  4MST A;  4NGO A;  1FKV A;  1JKD A;  4OWH A;  1LHM A;  4YEM A;  1JSE A;  1GE3 A;  3T6U A;  1D0M A;  4NGZ A;  3EXD A;  3LZ2 A;  4PJ2 C;  1YKY X;  4YM8 A;  2YBI A;  5AMY A;  5KKJ A;  1IP4 A;  1LSF A;  4RLM A;  1TEW A;  1GB3 A;  2LHM A;  2LZT A;  4BAD A;  1IOR A;  2H9K A;  2F2N A;  3A8Z A;  1B5V A;  1F6R A;  2YBH A;  3B0I A;  1BGI A;  1TCY A;  3WYH A;  1GF6 A;  4HTN A;  3TMW A;  4NHS A;  1LKR A;  4YOP A;  3W6E A;  5LVG A;  5LYZ A;  4HJY A;  1D6Q A;  2MEI A;  5KXW A;  1LJN A;  4G4B A;  2IHL A;  2ZYC A;  1QTE A;  4WLD A;  1G7L C;  4GLV A;  2CDS A;  1LZS A;  4Z3M A;  4XJF A;  2MEH A;  3WU7 A;  1LYO A;  1XEJ A;  2HEA A;  1QSW A;  2MEF A;  9LYZ A;  1LJK A;  1GF3 A;  3WMK A;  1GF4 A;  3WUM A;  3A96 A;  1REY A;  1VFB C;  4G49 A;  4RDS A;  1G7H C;  1OUB A;  4CFP A;  1WVU A;  4PRQ A;  5FDJ A;  1IP3 A;  5DLA A;  5APF A;  1HFZ A;  1QUS A;  1GBW A;  4DC4 A;  3RU5 A;  1C10 A;  1LZ6 A;  1JSF A;  4OWC A;  1JJ1 A;  5F81 A;  5FEK A;  1LZD A;  1B5Z A;  1LSC A;  2YSS C;  3QY4 A;  5HMJ A;  2EKS C;  1CKG A;  5D5F A;  1UIH A;  5T3F A;  1B2K A;  2BAA A;  1REM A;  5APD A;  1KXX A;  5LA8 A;  1QUT A;  1FKQ A;  4MCK A;  1CKH A;  4DD2 A;  3IWR A;  1LMT A;  1IWX A;  1ZVY B;  1HC0 A;  2XBR A;  1BB3 A;  1JIT A;  1ZVH L;  4GLA A;  3AB6 A;  4FDY A;  1XEI A;  1B5W A;  1C7P A;  2FYD A;  4M4O A;  4N1C C;  1J1P Y;  1YIL A;  1IC4 Y;  1GFH A;  5LAF A;  1D6P A;  5I53 A;  3P65 A;  5FST A;  4O34 A;  4CJ2 A;  1LJG A;  2HEC A;  2Q0M X;  1UIF A;  1KIQ C;  1RI8 B;  4NGY A;  2MEG A;  207L A;  5I5Q A;  4NGL A;  2W1L A;  4DDA A;  2G4Q A;  2D4I A;  1VDP A;  1NMM A;  3TXK A;  2DQI Y;  3AJN A;  3CB7 A;  3WPJ A;  4C5F A;  1B7O A;  1VAU A;  4DD3 A;  1DKK A;  1YKX X;  1JKB A;  1T3P A;  1JJ3 A;  1JTP L;  2MEB A;  4LT2 A;  2EPE A;  6LYT A;  2ZQ3 A;  4CHX A;  2BLY A;  1LJF A;  1LSG A;  4J1B A;  3LYT A;  3J4G A;  4LYT A;  1IWY A;  3GXR A;  2HUB A;  1EL1 A;  2DQG Y;  2HTX A;  4H8X A;  4QEQ A;  4ETA A;  1IWW A;  4WLY A;  3M18 B;  4FJR A;  3AGI A;  4ET8 A;  4ZEE A;  1JEF A;  3GXK A;  3N9E A;  1GE4 A;  3A67 Y;  1XFP L;  4RLN A;  1F10 A;  4RW1 A;  5KXL A;  1LMP A;  1GB9 A;  3TXB A;  4WM5 A;  1LSA A;  1NDM C;  1GFU A;  3TXG A;  1B7Q A;  1GB6 A;  4H9F A;  2BQE A;  1OUI A;  3F6Z A;  1BB4 A;  4H1P A;  1ALC A;  4WOA A;  4OWB A;  4LT3 A;  1LSM A;  3CT0 A;  4G4H A;  4LYO A;  1XSF A;  3WW6 A;  1LZ8 A;  5KXK A;  1HEM A;  1C08 C;  1GAZ A;  1FLY A;  3J6K A;  1T6V L;  1IOS A;  1I56 A;  4HPE A;  5I4X A;  4NIJ A;  5LIO A;  3E3D A;  1IY4 A;  4TUN A;  5C6J A;  154L A;  4N5R A;  4I0C A;  1W6Z A;  5E9R A;  1NQI A;  1HEW A;  4HPI A;  3P4Z A;  1ZV5 L;  5D5C A;  1HMK A;  5FHW A;  3N9C A;  5DN5 A;  1D0L A;  4ZFP A;  4P2E A;  3FI7 A;  3ATO A;  3WU9 A;  1LTM A;  1A2Y C;  1JPO A;  3SP3 A;  5F9U A;  2HED A;  4DD1 A;  4NSI A;  4WM3 A;  2W1Y A;  5L3H A;  1GDX A;  1AT5 A;  2DKV A;  2LYM A;  1IP5 A;  3B0K A;  1IC5 Y;  1JTT L;  1J1X Y;  2DQF C;  1FLQ A;  2RSC A;  1HFX A;  2Z38 A;  3P66 A;  2BQC A;  1NHE A;  1G7I C;  2H5Z A;  1WQR A;  2MEC A;  1XGQ C;  4H8Y A;  3N9A A;  4LYC A;  1GPQ C;  1LYZ A;  2BQN A;  1FDL Y;  2YDG A;  3OK0 A;  1GFE A;  2HEF A;  4HSF A;  1SLY A;  4KPM A;  4B49 A;  1UIB A;  3AGH A;  1LZ1 A;  1OUH A;  1OP9 B;  1BVX A;  1E8L A;  1LJ4 A;  1LJI A;  4WM1 A;  1CKF A;  2W1X A;  3W6C A;  1LYY A;  4TTD A;  5ILF A;  2BLX A;  1W08 A;  4ETE A;  1HSW A;  2DQD Y;  3WVY A;  4QY9 A;  1B5U A;  3AW6 A;  1JIY A;  2BQO A;  2YVB A;  2LYO A;  2ZIK A;  5KXN A;  1UIC A;  3TMU A;  3TXF A;  4Z41 A;  1BWH A;  5KY1 A;  1GFK A;  8LYZ A;  1IX0 A;  1GB5 A;  1YRO A;  4AXT A;  1C45 A;  1GE2 A;  1B5X A;  2HEB A;  3CT5 A;  2BQA A;  2BQD A;  4A7D A;  4NWE A;  1P2C C;  4WLX A;  1AT6 A;  1NWG A;  1F0W A;  4XYY A;  1EQ5 A;  1FN5 A;  1UID A;  2N5Z A;  4H94 A;  3ATN A;  3W6D A;  1IP6 A;  1HFY A;  2ZNX Y;  1LMA A;  1YAP A;  2F4A A;  1HHL A;  4U3X B;  2ZWB A;  1G7M C;  1LZ4 A;  1EQ4 A;  4R6C A;  3A95 A;  3RW8 A;  1JKC A;  1GHL A;  1GEV A;  1LMQ A;  1IOT A;  2CGI A;  1YAM A;  1YKZ X;  1UBZ A;  4OOO A;  5II3 A;  4NHQ A;  4M6D A;  1LAA A;  1JJ0 A;  4NEB A;  4XAD A;  2B5Z A;  1GD6 A;  2ZIJ A;  2LZ2 A;  1MEL L;  1N4F A;  4WM4 A;  3LHM A;  4EOF A;  4LT1 A;  3LYO A;  1F6S A;  4B0D A;  2D6B A;  1OUC A;  1LJH A;  1LZB A;  1LSE A;  1IP1 A;  1IEE A; 
#chains in the Genus database with same CATH topology
 4PK0 A;  2B6X A;  1KIP C;  3U6P A;  4II8 A;  1RE2 A;  1NDG C;  3A3R X;  2O25 A;  2I26 L;  1L61 A;  108L A;  1CU2 A;  1GXV 2;  1VEK A;  2JY6 B;  2BQL A;  1Z5C A;  3W6B A;  2LHC A;  1L0K A;  1AZF A;  3J80 S;  4W96 A;  1WQQ A;  4OW1 A;  4ARQ B;  5DYI A;  248L A;  1XXH A;  2DAK A;  1YLA A;  4RNA A;  1V92 A;  5IT9 S;  1GXX A;  3CDR A;  2OQ4 A;  1QT7 A;  4I7O A;  1WQP A;  1NNJ A;  3HT9 A;  1LMN A;  2FYC A;  2R44 A;  4B4E A;  1P46 A;  2MH8 A;  1XNQ M;  4BAF A;  2ANX A;  4LDE A;  3HTB A;  1OUF A;  1UC0 A;  1XGP C;  4B1A A;  4H9H A;  4KT3 A;  1Q39 A;  4LG2 A;  3FUX A;  1LZT A;  3I4Y A;  3ZVQ B;  1KFV A;  3DKE X;  2Y20 A;  2GV0 A;  1GFT A;  3GRU A;  4H9A A;  4MGH A;  1I20 A;  1YL0 X;  4BB9 A;  2X49 A;  1SXJ D;  3PFI A;  1L66 A;  1C43 A;  4Q7J A;  4B7F A;  3SYK A;  3DMV A;  3HDF A;  4A3V B;  4WG7 A;  4WM2 A;  4YEO A;  1T6H A;  135L A;  4XK8 F;  3OTO M;  2RB0 X;  3C80 A;  5IWA M;  1B7S A;  4ARM B;  3T36 A;  1ZWN A;  5A3E A;  1C60 A;  1LJE A;  2B6W A;  4QNM A;  1WR1 B;  4IAT A;  1TLA A;  2C8P A;  1YAO A;  1WVV A;  5LVI A;  5B59 A;  3A6B Y;  2L7H A;  254L A;  2ZAO A;  4G9S A;  1GB0 A;  4AGA A;  1DGB A;  1LZ9 A;  3TWM A;  2QNJ A;  1XJU A;  1F4I A;  3AZ5 A;  2G5G X;  1KW5 A;  5FTK A;  5APE A;  4I7P A;  2HU1 A;  5L9J A;  2RAZ X;  4PPO A;  3TWK A;  2D7H A;  4I7Q A;  3GRV A;  3IJU A;  1R6B X;  1GBO A;  1G8P A;  4NY5 A;  4F2L A;  2LVP C;  3AGG G;  5H37 D;  2QB0 B;  1WTN A;  3A6C Y;  2YR0 A;  5B05 A;  1DKJ A;  5LZM A;  1D3N A;  1L81 A;  1HNL A;  244L A;  4WL7 A;  3TMV A;  4NSG A;  219L A;  4H92 A;  4H90 A;  1O23 A;  4JXJ A;  1KXW A;  2DQE Y;  1GFJ A;  1QZM A;  1LLH A;  1V7T A;  1HML A;  3ZVQ A;  2D4J A;  1I1Z A;  5KXT A;  2D7E A;  2XBS A;  2Z19 A;  4N8Z A;  3CF2 A;  3GQ5 A;  1L21 A;  1L54 A;  1L44 A;  1XB2 B;  1KS3 A;  2RBN A;  3AZ7 A;  1HEQ A;  1Q02 A;  3D9A C;  1XGR C;  1GB7 A;  3HUK A;  159L A;  4GKK M;  5KQ8 A;  4DYG A;  1DI4 A;  4G3O A;  1SG9 A;  4MGK E;  1P7S A;  1L64 A;  3GLG A;  224L A;  5I54 A;  2EJS A;  1JTO L;  3CSZ A;  3UZU A;  3HJ8 A;  3GLI B;  1OV7 A;  2YBM A;  1GAY A;  5FCP A;  1DO0 A;  4IBJ A;  1CJ6 A;  4YY3 M;  2LHG A;  5LMN M;  2KEB A;  3OE9 A;  4LZT A;  1SWY A;  232L A;  3WUN A;  1LZC A;  4ZIX A;  4LYZ A;  2F32 A;  2Z4R A;  4D80 A;  2F5Q A;  2VB1 A;  4RF1 A;  4DDC A;  1L79 A;  1VDT A;  1BB6 A;  3TXE A;  1IWZ A;  2Z18 A;  4DT3 A;  2F47 A;  4NRV A;  1IP7 A;  3P64 A;  1GB2 A;  1UIG A;  2Q9E A;  3HBH A;  3T38 A;  5KXZ A;  5ILC A;  3UON A;  1B7R A;  4II7 A;  4DD0 A;  1P36 A;  2RGH A;  4JN6 A;  2BQB A;  4OOT A;  4DDB A;  2Z2E A;  1B9O A;  1B6I A;  4LYM A;  1IQP A;  2MED A;  1TH4 A;  4IIW A;  2WSF F;  3AFH A;  1LCN A;  4JI2 M;  2K6B A;  1HQY E;  132L A;  1C67 A;  1IC7 Y;  2IGC A;  4DQJ A;  5KXY A;  5DN4 A;  5L3I A;  3U61 B;  3E4R A;  144L A;  3WH1 A;  4NGW A;  120L A;  1L72 A;  134L A;  2MEE A;  4NSJ A;  3CSR A;  1NBY C;  2Z39 A;  5IEL A;  3HU3 A;  3IG8 A;  1IBL M;  2DQH Y;  5APC A;  2LBC A;  1C6A A;  4W55 A;  4IJE A;  2CV0 A;  1G41 A;  1L90 A;  3HKP A;  1IWV A;  1DXJ A;  2F30 A;  1ZUR A;  3FYD A;  4CGY B;  3EMS A;  4UWU A;  1G0L A;  4L4U A;  3Q8X A;  3IJV A;  1QVR A;  3FAD A;  4DR6 M;  4NG8 A;  1NF5 A;  1D0K A;  1QQW A;  1OVJ A;  1JUG A;  1K82 A;  1G0Q A;  152L A;  4G4C A;  1QDR A;  3GLI A;  1DQJ C;  4LJA A;  1IM2 A;  4KO8 A;  4NGI A;  1IOC A;  1XEK A;  2DQJ Y;  4NGO A;  4PT5 A;  3U6E A;  3QYE A;  4LF5 M;  5KKJ A;  4RLM A;  4WP2 A;  4BAD A;  1VEG A;  1IN5 A;  1IOR A;  2JUJ A;  181L A;  1C6P A;  4XBO A;  3W6E A;  1L83 A;  4HJY A;  2O01 F;  4CHT B;  1IXR C;  3L26 A;  2KRU A;  3WMK A;  1IXZ A;  1GF4 A;  1QS9 A;  230L A;  4RDS A;  184L A;  1G7H C;  1OUB A;  2ZBK B;  5FDJ A;  5DLA A;  3U61 A;  1GBW A;  3FTC A;  1C10 A;  1LZD A;  5HMJ A;  1G0K A;  1L43 A;  1L84 A;  1QYR A;  1UIH A;  2FNA A;  1L04 A;  1NJF A;  1REM A;  1KXX A;  1DYG A;  1EFU B;  1FKQ A;  3FKE A;  1CKH A;  3DN1 A;  1TGU A;  3IWR A;  1LMT A;  1OJL A;  1L60 A;  1BB3 A;  4GLA A;  2DHR A;  3AB6 A;  2ZM6 M;  1L11 A;  4W56 A;  1IFY A;  1DYA A;  191L A;  3HJS A;  2KRK A;  4FVM A;  3P65 A;  236L A;  3C81 A;  1QAM A;  2HUK A;  3VFD A;  207L A;  5FSW A;  2Q9D A;  4NGL A;  5I5Q A;  1NMM A;  2DQI Y;  3U6S A;  3WPJ A;  4FW9 A;  1DKK A;  1CV1 A;  3C8Q A;  3GPY A;  4R3D A;  1MJG M;  1LSG A;  3J4G A;  1IWY A;  2HUB A;  3KSX A;  3J81 S;  2HTX A;  3AGI A;  2XLJ A;  1JEF A;  1LI3 A;  2DAG A;  3N9E A;  1F10 A;  2VII A;  2Y0Q A;  1QT6 A;  212L A;  4W54 A;  1OKS A;  1P3N A;  4H9F A;  1SSW A;  2RB1 X;  3F6Z A;  4W52 A;  1TH2 A;  2VF7 A;  4GIT A;  1L00 A;  1XSF A;  1W5T A;  1HEM A;  3GUJ A;  1T6V L;  2D7G A;  3PXG A;  4P17 A;  2WSC F;  1L69 A;  3HT7 A;  4TUN A;  5C6J A;  154L A;  5E9R A;  2G8L A;  1NQI A;  1HEW A;  4GIP A;  4CIZ A;  2B75 A;  2R65 A;  1L03 A;  1D0L A;  4ZFP A;  3ATO A;  5EP2 A;  2ERC A;  3U6O A;  1A2Y C;  1JPO A;  2HED A;  4DD1 A;  2E5L M;  3PBL A;  3C8S A;  3MHV C;  2F4V M;  1QSB A;  1NV9 A;  2DQF C;  1L93 A;  1P5C A;  3KVW A;  2BQC A;  1WQR A;  2MEC A;  1L30 A;  1LYZ A;  2JY8 A;  2YDG A;  4HSF A;  4B49 A;  3AGH A;  2C99 A;  3ZCB B;  128L A;  4DV1 M;  1SWZ A;  228L A;  1E8L A;  4WW0 A;  1LJ4 A;  3W6C A;  1CKF A;  1ZAE A;  3PNY A;  1LYY A;  4TTD A;  3RFW A;  4ETE A;  2DQD Y;  3WVY A;  4LFC M;  1JIY A;  1BVS A;  3W0F A;  2LYO A;  151L A;  1CV6 A;  1IX0 A;  2Y0T A;  3DNA A;  1YRO A;  4AXT A;  1GE2 A;  3CT5 A;  4S0W A;  5I14 A;  2BQD A;  4WLX A;  1WJ7 A;  1NWG A;  3SB5 A;  1UID A;  2L09 A;  2RAY X;  3ATN A;  1IP6 A;  1N78 A;  3GLI E;  2EO2 A;  2ZNX Y;  3IEC A;  5ITX E;  1LMA A;  2OU8 A;  2O4W A;  1EQ4 A;  3VKH A;  3SBJ A;  3A95 A;  4OO9 A;  4AG6 A;  1GEV A;  3W0L B;  1L32 A;  2CUU A;  1YKZ X;  4IBF A;  4OOO A;  2KNA A;  1C64 A;  1LAA A;  3C9P A;  2B5Z A;  2LZ2 A;  1MEL L;  4WM4 A;  1WTH A;  4H9C A;  4W5W A;  4I7R A;  4EPI A;  1LSE A;  3M3U A;  167L A;  1IEE A;  1CTW A;  1LYI A;  4MGZ E;  193L A;  5KXX A;  1GFV A;  1NJG A;  4NXM M;  259L A;  2Q2E B;  1G7J C;  1SSY A;  1CX7 A;  217L A;  3FRH A;  2K0B X;  1HNZ M;  2RBQ A;  3G3X A;  1TTE A;  4Z8X A;  1OFI A;  4WO9 A;  3KS4 A;  2UXB M;  4UN2 B;  1GBS A;  4H8Z A;  1PZY A;  1VED A;  4LFB M;  1L71 A;  1LHI A;  4Z46 A;  175L A;  4LDO A;  3OE6 A;  258L A;  4WUR A;  2L7I A;  1LOZ A;  3K1J A;  1IR7 A;  2L2D A;  1LGX A;  4W57 A;  1BWI A;  1LGU A;  1LZY A;  3CT1 A;  4B7H A;  1LSP A;  246L A;  4JI7 M;  2QQ8 A;  4B08 A;  111L A;  3VDU A;  1L27 A;  1C6J A;  1L77 A;  3C7Y A;  4DWX A;  1N33 M;  1UUZ C;  1E94 E;  1QDT A;  1WGN A;  2FBB A;  5E6J A;  3KAM A;  4XJG A;  1C6N A;  4DV4 M;  4AG5 A;  251L A;  4LFP A;  1DZB X;  1LHK A;  4L41 A;  1L09 A;  1QT3 A;  3NY9 A;  4IBB A;  4S12 A;  3DZD A;  1I94 M;  1LSD A;  3U60 B;  1L8Q A;  4MM3 B;  3GLH B;  2WZJ A;  3A92 A;  233L A;  4NFV A;  5LYT A;  2OTY X;  5KXR A;  4IBG A;  1QTV A;  4QDN A;  1XGT C;  2VQE M;  2K47 A;  1UAC Y;  1ZMV A;  3AKZ A;  1L29 A;  3D3D A;  1ORY B;  2FH0 A;  1K28 A;  4IBD A;  4OX9 M;  1TDY A;  2HEE A;  1NY6 A;  3EO5 A;  4D82 A;  130L A;  1C6C A;  5FLX S;  1GB8 A;  1SQ2 L;  4PDG A;  1XXH B;  1LHL A;  3DA1 A;  3LN2 A;  1BVK C;  4JI5 M;  3HBD A;  2I6Z A;  1DI5 A;  4I5S A;  1X37 A;  2ZAN A;  5A2Q S;  2PC2 A;  7LZM A;  1Z55 A;  4RF0 A;  3HBE X;  1LV7 A;  1FNN A;  3SHF A;  3GRR A;  4JI1 M;  1L08 A;  1UIE A;  2QPA A;  3PDS A;  2YBJ A;  4NHP A;  1D2N A;  2F4G A;  1L89 A;  1LJ3 A;  5EQT A;  173L A;  1REZ A;  1JTM A;  3AOE C;  4CFO A;  1CJ7 A;  4WLT A;  4EKR A;  1CUQ A;  4WM6 A;  2KXE A;  5C18 A;  3AOE A;  1L45 A;  4G6Z A;  1PJI A;  1A5T A;  1R4G A;  4LJ9 A;  3ZQJ A;  3G3W A;  4IJF A;  3LVW A;  3GRY A;  1IN4 A;  137L A;  4XJI A;  1HT1 E;  2R4J A;  3A45 A;  4MB7 A;  208L A;  4W53 A;  4XJB A;  3U60 A;  4ARP A;  1C6I A;  1ZMY L;  1DPX A;  4B4J A;  4GCF A;  1LHH A;  4LDL A;  4IAP A;  2R46 A;  5EP4 A;  3JR6 A;  1GE1 A;  3TXH A;  4H9I A;  4FD2 A;  3J7A S;  2KHH A;  4LF6 M;  1E32 A;  1YSY A;  4FWH A;  2DBT A;  3GUI A;  2EUC A;  3BBZ A;  4H9E A;  4H91 A;  4GCE A;  2JY5 A;  4H9B A;  2G4P A;  1G4A E;  4NGJ A;  4R71 A;  166L A;  5GKN A;  1BWJ A;  3WPK A;  3VKG A;  238L A;  1OUD A;  3CDV A;  3MGW A;  5KPT A;  2O79 A;  3HTF A;  4YF2 A;  2CUZ A;  4EKP A;  4ETB A;  1LPI A;  1H6M A;  2H1R A;  4PHI A;  1INU A;  1LYG A;  2ZTD A;  118L A;  1LI6 A;  1NY5 A;  4YEN A;  1B7L A;  5KPZ A;  4OWE A;  4LF7 M;  4ML7 A;  5B1G A;  1SXJ C;  3WW5 A;  5LVH A;  4GN4 A;  1NNU C;  3DMZ A;  1SXJ A;  4B3M M;  4NWH A;  3W67 A;  3L2X A;  1L05 A;  2JY7 A;  1L35 A;  261L A;  5K7O A;  4W94 A;  229L A;  2UUC M;  214L A;  4OVZ A;  2Z2F A;  3B0O A;  2DVW B;  1EPY A;  4DR1 M;  113L A;  2CJL A;  4D9Z A;  3K9P A;  1L18 A;  1GEZ A;  1IVM A;  2LWX A;  1GF9 A;  4EJ4 A;  3TE6 A;  1L55 A;  4GN3 A;  153L A;  2C96 A;  4FCT A;  1C65 A;  2DWL A;  2LCB A;  3QNG A;  2K9D A;  2OEA X;  1L24 A;  1IIZ A;  1YQV Y;  2MEA A;  1BB5 A;  5F14 A;  3GLG B;  4ETD A;  4GRV A;  182L A;  1GFG A;  1L06 A;  2C8O A;  2NQ8 C;  1J1O Y;  3BKV A;  7LYZ A;  4DBG B;  1XHB A;  2FFJ A;  4QOS A;  2ZNW Y;  1L23 A;  3WUL A;  4NSO B;  3H4M A;  4TSC A;  2OTZ X;  2JA2 A;  4DV5 M;  5LA5 A;  5EP1 A;  1NO1 A;  1G0G A;  2O5R A;  1L67 A;  2LYZ A;  127L A;  3GP1 A;  1MLC E;  4KL7 A;  1Z6T A;  5B07 A;  3DN2 A;  4N0J A;  1T97 A;  3ZEK A;  3FYC A;  4REZ A;  4I7S A;  4ARL A;  1CUP A;  242L A;  3CDQ A;  4LYB A;  3VWO A;  1JKD A;  4YEM A;  2OU0 X;  3T6U A;  1D0M A;  201L A;  4YM8 A;  4GC9 A;  4P16 A;  1GB3 A;  1C68 A;  3A8Z A;  1OFH A;  1B5V A;  1F6R A;  1T8G A;  2YBH A;  1LGW A;  3B0I A;  2DKL A;  138L A;  4NHS A;  4YOP A;  4GH9 A;  2XFS A;  1D6Q A;  5KXW A;  3HU8 A;  3K2L A;  2IHL A;  2ZYC A;  1OIZ A;  131L A;  4G4B A;  4WLD A;  1P6Y A;  2C5R A;  4I7N A;  4DV0 M;  2CDS A;  1LZS A;  4Z3M A;  4XJF A;  4L6V 6;  3HTG A;  2HEA A;  1IXS B;  4DR4 M;  1GF3 A;  3SN6 R;  1WXQ A;  4AI6 A;  3WUM A;  2B73 A;  3A96 A;  1REY A;  3D8B A;  239L A;  3CDT A;  1QUD A;  4CFP A;  1R2Y A;  1IP3 A;  1HFZ A;  2GQF A;  4M9Z A;  1LZ6 A;  240L A;  1JSF A;  4OWC A;  5EXT A;  1C6B A;  5F81 A;  5FEK A;  1PJQ A;  1B5Z A;  2YSS C;  1L97 A;  1L2B A;  5D5F A;  5T3F A;  4LF8 M;  3KOY E;  5LA8 A;  2HUL A;  3V2W A;  3AOG A;  1OVH A;  1T3T A;  2OE9 X;  2XBR A;  250L A;  1XEI A;  3I4V A;  1C7P A;  4M4O A;  1DYF A;  226L A;  5LAF A;  4ZPX A;  5I53 A;  4O34 A;  4CJ2 A;  2HUM A;  1GL7 A;  2MR9 A;  2BWE A;  3SB9 A;  4XGI A;  2G4Q A;  1VDP A;  1L01 A;  3GLH E;  3CB7 A;  4DD3 A;  146L A;  1YKX X;  1SX2 A;  4Z6Y A;  1JKB A;  1T3P A;  4I7K A;  6LYT A;  2R4E A;  4J1B A;  1Q3B A;  1L41 A;  4LYT A;  5EP3 A;  3HT8 A;  5DFL A;  3M18 B;  4ZEE A;  4JI8 M;  1HNX M;  4MGY E;  1J7K A;  4RLN A;  2GNO A;  183L A;  1L96 A;  2DAE A;  1C6K A;  1GFU A;  3V2Y A;  1DYC A;  1XXH E;  1LYH A;  4NL4 H;  1PJT A;  1ALC A;  4OWB A;  2RGO A;  4LT3 A;  1LSM A;  1G71 A;  2XF3 A;  3CTW B;  198L A;  4LYO A;  1IXS A;  3HGI A;  3Q8G A;  1L94 A;  2BJW A;  2DHY A;  2KW0 A;  3LQQ A;  1VG5 A;  3LVV A;  1IOS A;  4HPE A;  4NIJ A;  4I0C A;  1W6Z A;  3HUA A;  3JAM S;  215L A;  2JZ1 A;  174L A;  1P37 A;  4HPI A;  3P4Z A;  5D5C A;  2Z4S A;  2AHM A;  3HH5 A;  3SC3 A;  3SAV A;  3FI7 A;  1LTM A;  3DN6 A;  1L2C A;  5ITQ A;  4NSI A;  4WM3 A;  5L3H A;  1GDX A;  2DKV A;  3GUN A;  2JP7 A;  2DZO B;  205L A;  140L A;  256L A;  2JXN A;  2Z38 A;  3P66 A;  1G7I C;  4MH0 E;  1DYE A;  1DGH B;  4LYC A;  1L49 A;  1L20 A;  1XNR M;  1UIB A;  1LZ1 A;  1OUH A;  1C61 A;  2RH1 A;  1BVX A;  186L A;  3MMP A;  5ILF A;  2BLX A;  1W08 A;  1GVN A;  1C63 A;  1B5U A;  3QAK A;  2BQO A;  2ZIK A;  3C58 A;  3TXF A;  206L A;  1BWH A;  1GFK A;  3KP1 E;  1GB5 A;  4DV3 M;  2VDB B;  197L A;  1B5X A;  187L A;  2KNV A;  114L A;  2HEB A;  4PCZ A;  185L A;  2BQA A;  1L95 A;  1HT2 E;  4XYY A;  3W6D A;  2N5Z A;  3RGP A;  3SAS A;  2F4A A;  1HHL A;  1L88 A;  3D8L A;  4R6C A;  3RW8 A;  1GHL A;  1VDL A;  1UBZ A;  3WHL A;  1YUB A;  3K2R A;  4M6D A;  1LYE A;  4XAD A;  2Z7J A;  4LF4 M;  1AUA A;  4X65 M;  3LHM A;  4EOF A;  2J5Y A;  1ZV1 A;  1L37 A;  1LJH A;  1LZB A;  5LXW A;  1NHB A;  2QEN A;  3NBI A;  4I8O A;  1OQM A;  1C6T A;  1FLW A;  5KXP A;  3QE8 A;  5HMV A;  3HH4 A;  1GF5 A;  1CU0 A;  4J7V A;  1QSQ A;  4X66 M;  2F5S A;  1GWD A;  3A90 A;  3WXT A;  2MJ5 B;  1EE8 A;  3OE0 A;  2OPF A;  4TWS A;  4ARJ A;  3HHY A;  1LZN A;  1TBY A;  222L A;  3EML A;  3WUA A;  2BQM A;  4FCV A;  3LYZ A;  1LW9 A;  2DQC Y;  1OQY A;  1DGH A;  1QAQ A;  3VK7 A;  2A7F A;  4ETC A;  3TQS A;  4NOO B;  3EIE A;  3GLG E;  4HV1 A;  1BHZ A;  1OUG A;  1C46 A;  190L A;  5EBH A;  4DUZ M;  1QAO A;  4XJD A;  1WQM A;  4HV2 A;  3M6A A;  1GBZ A;  1QT8 A;  4LGK A;  1GAB A;  158L A;  4LZZ A;  2HKJ A;  1NV8 A;  4XEN A;  5JEN B;  2KDL A;  3TXJ A;  2VF8 A;  2XEP A;  2F5P A;  1QTZ A;  3KOW E;  3A42 A;  5KXS A;  4HJZ A;  3ILK A;  1LZE A;  2KA6 B;  5F16 A;  3C82 A;  1C6D A;  133L A;  2OU9 A;  1HEP A;  2NWD X;  3UGJ A;  5DNY A;  1HEO A;  2HU3 A;  2UU9 M;  1CV5 A;  4I7M A;  3HWL A;  234L A;  1W5S A;  1PJJ A;  4PDI A;  2WSE F;  1GE0 A;  4KHP M;  2R18 A;  1IY3 A;  2Z6B A;  1GBX A;  1L62 A;  2KNZ A;  4IAS A;  3RZ4 A;  4K5Y A;  1OAI A;  129L A;  4DD9 A;  2BQK A;  1QUH A;  4EIW A;  1FBI X;  3CGW A;  164L A;  2NTG A;  1IR8 A;  4N9R A;  1QIO A;  143L A;  4RW2 A;  1L13 A;  5HNC A;  1JHL A;  4DV7 M;  2Z12 A;  2Z8Y M;  2B7X A;  231L A;  1B7P A;  1JR3 A;  1VAT A;  3W3E A;  2A7D A;  1NVM A;  3GPP A;  247L A;  4PGJ B;  6LZM A;  1IN8 A;  1JKA A;  2DZN B;  3E46 A;  3DN3 A;  2FBD A;  122L A;  4LRS A;  3A34 A;  1B0D A;  2F2Q A;  2CWB A;  1UCO A;  1BB7 A;  3F8V A;  4LFX A;  1PS5 A;  4IBE A;  1LMO A;  4M9S A;  1REX A;  2V1U A;  1L0J A;  3QYB A;  2DAM A;  3FTF A;  2Z3X A;  2NTH A;  1L42 A;  4LGY A;  5ITR A;  3NYA A;  1GFR A;  1CU6 A;  3AV0 A;  1L14 A;  1JR3 D;  5C6I A;  3VW7 A;  1LHJ A;  223L A;  3CF0 A;  4LY6 A;  1A4V A;  1GL6 A;  1C6M A;  2L6O A;  2CWI A;  165L A;  5IZ7 D;  176L A;  2JZ0 A;  2YQZ A;  4Z98 A;  1R2Z A;  1C6Q A;  2DXI A;  1G59 A;  1IY0 A;  2ZYP A;  2BQI A;  4F1I A;  1L82 A;  5DL9 A;  3K8Z A;  2B6T A;  4AKH A;  3B7Z A;  3F9L A;  2Y8P A;  1B7N A;  1L58 A;  2OE7 X;  6LYZ A;  160L A;  4L8R C;  4ET9 A;  2C9C A;  1C6F A;  1LZA A;  2DQA A;  1CV4 A;  4BAP A;  4B3R M;  1DI3 A;  1LWK A;  1OIP A;  3I04 M;  3HU2 A;  2A4T A;  2XH9 A;  2XSZ D;  1B7M A;  3CQL A;  5C6L A;  3LZT A;  2ANV A;  2QBY A;  4OU7 A;  4WO6 A;  4M0W A;  1LZR A;  4IBI A;  1UFZ A;  5EXS A;  1N34 M;  4LFA M;  1KXY A;  4NGK A;  3FRI A;  3WU8 A;  2QZ4 A;  1IP2 A;  243L A;  3SBB C;  1LKS A;  2RB2 X;  3DMX A;  4LJ6 A;  142L A;  195L A;  4GHA A;  1C6G A;  4PJZ A;  1DYD A;  1OUE A;  2Y21 A;  3FD9 A;  2EQL A;  2J7N A;  4QOZ C;  4J1A A;  1J09 A;  2C98 A;  3JR5 A;  4EPF A;  1IR9 A;  1WQN A;  5M1Y A;  4E3U A;  1L85 A;  4B4I A;  1G06 A;  5KQD A;  1DPW A;  1E9R A;  2XJW A;  3DOA A;  1AIP C;  3F92 A;  4JV5 M;  177L A;  1QSA A;  1WHC A;  4TUW A;  3LQR A;  2DEN A;  1RCM A;  1CJ9 A;  3WVX A;  3QWL A;  4KOD A;  221L A;  4KXI A;  1C6L A;  3AJI B;  5FTJ A;  1HEN A;  1V34 A;  150L A;  169L A;  3GUL A;  1PJS A;  3B72 A;  4H93 A;  1LWG A;  1P56 A;  4K0K M;  3BKH A;  1XC8 A;  4X3B A;  3K9O A;  2UUA M;  1P64 A;  2JNH A;  4DQ7 A;  1BQL Y;  4WL6 A;  5LYM A;  4C3W A;  3AZ4 A;  3I01 M;  1L26 A;  1MN3 A;  3THG A;  1CX6 A;  1T8F A;  2BQG A;  3TXI A;  235L A;  1GKI A;  1L68 A;  1C66 A;  1P2R A;  107L A;  4GCC A;  1E9S A;  3HHW A;  2Z37 A;  3R9X B;  3LZM A;  5FEL A;  5DM9 A;  1L98 A;  4OW0 A;  2DWM A;  2BPU A;  4EKS A;  2MGW A;  3A91 A;  1PQM A;  5I4Y A;  1ZMW A;  188L A;  1JIS A;  3HU1 A;  4NRW A;  4B3S M;  1L28 A;  3A3Q A;  1SXJ B;  1D9W A;  5LVJ A;  3TMX A;  4DD7 A;  4L78 A;  1CNS A;  4TSB A;  1HER A;  3NY8 A;  4JI4 M;  1LHM A;  1XWI A;  4OVZ B;  2V1C A;  2A5Y B;  1GE3 A;  260L A;  1QT4 A;  227L A;  1YKY X;  2YBI A;  5AMY A;  2M60 A;  1IP4 A;  1LSF A;  3CDO A;  1TEW A;  4LF9 M;  2LHM A;  2LZT A;  4Y28 F;  3RUN A;  1HR0 M;  1TCY A;  1GF6 A;  4I7T A;  2B3T A;  3TMW A;  1L87 A;  1L91 A;  5LVG A;  5LYZ A;  2QCU A;  2XZU A;  3SAR A;  1LJN A;  1HNW M;  1QTE A;  4GLV A;  4W59 A;  7CAT A;  9LYZ A;  1QSW A;  1LJK A;  3UK6 A;  1LYJ A;  2HL7 A;  3B9P A;  1K3W A;  3PNV A;  1VFB C;  4G49 A;  1KW7 A;  1WVU A;  189L A;  211L A;  5APF A;  3B7N A;  2F5O A;  1GJT A;  1OVK A;  1QUO A;  2CP8 A;  3FA0 A;  1CKG A;  3KOX E;  4AKI A;  1B2K A;  5APD A;  1PQO A;  1DO2 A;  2YNM D;  4MCK A;  126L A;  1LPY A;  5ITU A;  1ZVY B;  3K92 A;  1HC0 A;  3H4J A;  1ZVH L;  1L33 A;  4FDY A;  1D2W A;  4B7G A;  2I7P A;  4NXN M;  4N1C C;  3HTD A;  3BXW A;  1ZMU A;  1GFH A;  1IC4 Y;  1D6P A;  3JR4 A;  4YXA C;  5FST A;  1D3F A;  3A46 A;  2LC9 A;  2APL A;  2Q0M X;  1UIF A;  4CJ6 A;  1KIQ C;  1RI8 B;  4NGY A;  115L A;  4DDA A;  5EXX A;  2W1L A;  2G3Q A;  3MJ5 A;  4G4O A;  2D4I A;  1HQC A;  3TXK A;  1GJS A;  4C5F A;  4G4Q A;  1B7O A;  1VAU A;  2OOA A;  3J7B A;  1DYB A;  1JJ3 A;  4QNR A;  1LJF A;  3E21 A;  1N32 M;  155L A;  1EL1 A;  2DQG Y;  4QEQ A;  4GMQ A;  1PQI A;  4ET8 A;  2CHQ A;  1TDZ A;  3GXK A;  3PVS A;  3A67 Y;  3KDS E;  1XFP L;  1JB0 F;  4RW1 A;  5KXL A;  1OWY A;  2VQF M;  4WM5 A;  4JI0 M;  1LSA A;  3L2A A;  1P3Q Q;  1NDM C;  1L86 A;  2FS1 A;  3TXG A;  196L A;  1B7Q A;  180L A;  2I7N A;  1C6E A;  2BQE A;  4H1P A;  1BB4 A;  2UUB M;  3KXE C;  4WOA A;  1L50 A;  4I7J A;  1IBM M;  3RGS A;  218L A;  2F5N A;  3SFZ A;  1LZ8 A;  1QAN A;  1C08 C;  3LW5 F;  1GAZ A;  1FLY A;  2BWB A;  1OAO C;  5LIO A;  3E3D A;  3M0E A;  1C62 A;  4DV6 M;  1I4W A;  3HHX A;  4LJ7 A;  4IBK A;  1ZV5 L;  1HMK A;  5FHW A;  5DN5 A;  2H5X A;  1XMO M;  4P2E A;  1IN6 A;  3WU9 A;  1TR8 A;  168L A;  4AKG A;  3SP3 A;  3SBA A;  1L59 A;  1L56 A;  3KS8 A;  2CV1 A;  123L A;  1PM5 A;  1PRB A;  1CU5 A;  1Q3C A;  2LH0 A;  4DAJ A;  1HFX A;  1PQK A;  1Z5A A;  1JQJ C;  1XGQ C;  2RKO A;  1GPQ C;  2C9O A;  1FDL Y;  1KY0 A;  3BOS A;  2HEF A;  1SLY A;  3DN8 A;  1Z5B A;  1QTH A;  1L40 A;  1L46 A;  2R6F A;  1OP9 B;  1LJI A;  4ARQ A;  2EKK A;  1DGG A;  2CE7 A;  4QY9 A;  255L A;  3AW6 A;  3TMU A;  2YVB A;  4Z41 A;  5KY1 A;  1UIC A;  3B89 A;  3TL4 X;  3UJN A;  3U6M A;  8LYZ A;  1D3J A;  5ITT A;  1C45 A;  4A7D A;  3HH3 A;  4NWE A;  3DN4 A;  3V76 A;  1AT6 A;  3TXD A;  252L A;  4H94 A;  2P5T A;  5ITY A;  3FUW A;  2ZWB A;  3VLF B;  5BPV A;  2HWJ A;  2RRU A;  1JTN A;  3GO8 A;  2CGI A;  5LMU M;  4NHQ A;  2UXC M;  1QTB A;  1JJ0 A;  4W58 A;  3D4S A;  2ZIJ A;  2CEA A;  2DWZ B;  1L34 A;  1N4F A;  3HH6 A;  3LYO A;  2D6B A;  1IOT A;  3B74 A;  1LJJ A;  3R8F A;  1XMQ M;  3SB8 A;  3HJQ A;  3GUK A;  3ULR A;  5E26 A;  3FUV A;  5IHG A;  145L A;  2BQH A;  4JYA M;  1S3S A;  2FE8 A;  2YBN A;  1T43 A;  4QHT A;  5KPR A;  2CFO A;  2J7O A;  1C6H A;  1L16 A;  4FCW A;  2OOB A;  1GBY A;  2LVQ D;  4GBR B;  1L36 A;  2IFF Y;  4ARM A;  170L A;  3T1Y M;  1VDQ A;  3A93 A;  2W1M A;  3W6A A;  3W68 A;  1VDS A;  2LNH C;  5KKI A;  148L E;  2EIZ C;  2UXD M;  2X8A A;  4FWG A;  4LJ4 A;  4OWA A;  5JI3 E;  2B70 A;  5E4P A;  4PD2 A;  4B3T M;  1IY1 A;  1HEL A;  1XGU C;  2W82 A;  1C1K A;  4NSH A;  3AZ6 A;  1L52 A;  109L A;  3W6F A;  1RU3 A;  1L73 A;  4HP0 A;  1JWR A;  1LMC A;  3P68 A;  3DFZ A;  2AUB A;  3KOZ E;  2JWS A;  2R0I A;  3B7Q A;  2ZAM A;  1GDW A;  1YAN A;  5B1F A;  2XQO A;  1IN7 A;  1HF4 A;  2LTU A;  156L A;  1YL1 X;  3FE0 A;  4GCB A;  4R7G A;  2D4K A;  141L A;  1SXJ E;  3L25 A;  4LRT A;  5KO3 A;  1G0P A;  1LYS A;  2EA0 A;  4M0D A;  3LCU A;  4HLQ A;  4X62 M;  4TX7 A;  4ANR A;  2H9J A;  3U6D A;  1LSZ A;  1QTK A;  5F3W A;  4RKU F;  1L75 A;  1GF7 A;  2I25 L;  3GUP A;  2LXE A;  1T8A A;  4HTK A;  2ZQ4 A;  2M5Z A;  3HDE A;  2G4N A;  2XTH A;  2D91 A;  1LZG A;  4DR7 M;  5I4W A;  2CRU A;  4MR1 A;  4ITQ A;  4GRI A;  3C3E A;  5A3Z A;  1L76 A;  1LSN A;  1YIK A;  3T1H M;  1GF8 A;  3GLF B;  1G1W A;  3RT5 X;  2WAR A;  194L A;  1GF0 A;  4DUY M;  5HLL A;  1L25 A;  4L16 A;  1L15 A;  1L31 A;  1IWU A;  1GLN A;  3L27 A;  2R62 A;  4J0L A;  3GPX A;  3FTD A;  4NHT A;  4QGZ A;  1KY1 A;  5ITX A;  1OYU A;  2BQJ A;  2YFQ A;  1IO5 A;  1TF0 B;  3RNX A;  4AW4 A;  3HX3 A;  1QT5 A;  1CU3 A;  2X0A A;  1L17 A;  1L19 A;  1C69 A;  4EKQ A;  2O7A A;  3U6Q A;  3U5Z B;  4HTQ A;  171L A;  1G07 A;  2XGN A;  3SAW A;  1D9U A;  2DI0 A;  2MRO B;  245L A;  161L A;  2EKF A;  1UM8 A;  3KFU G;  1AM7 A;  3GUM A;  1L99 A;  5KJ9 A;  2YBL A;  3A98 B;  1L80 A;  2B6Z A;  5EJC A;  119L A;  1FJG M;  2BQF A;  3G3B B;  4D81 A;  1J5E M;  3IG5 A;  3KSJ A;  1V7S A;  5IDD A;  1TAY A;  1WQO A;  4DKL A;  3T6P A;  3SMP A;  5IRE B;  139L A;  4NG1 A;  1XEP A;  1OUA A;  4GN5 C;  3HUQ A;  1CKC A;  1WTM A;  1AKI A;  4G4R A;  4YXC A;  3AYQ A;  1GO5 A;  4NHI A;  1WGL A;  3KW6 A;  5KXM A;  3AW7 A;  1RJC B;  3SYL A;  4WG1 A;  1XJT A;  4DQ5 A;  5LIN A;  3L29 A;  1IWT A;  4AZF A;  4IJ4 A;  1L39 A;  3EBA B;  4I81 A;  1LSY A;  4UWV A;  1L2D A;  4GCD A;  1TH3 A;  1YAQ A;  5KXO A;  220L A;  178L A;  3LMM A;  4X64 M;  1QUG A;  3G3A B;  199L A;  4YX7 C;  3GLF A;  4NGV A;  3OE8 A;  3RE8 A;  1G0J A;  3C8R A;  257L A;  3J27 B;  3B6L A;  3KP0 E;  4LJ8 A;  1B5Y A;  4BS7 A;  1QQY A;  1QTC A;  3WL2 A;  2L78 A;  4HJV A;  3C7W A;  4MGI E;  1N77 A;  4N1E I;  3A94 A;  4WMG A;  4NSR A;  1MU5 A;  5F9X A;  5FTN A;  4CGE A;  3WPL A;  4R0F A;  3GPU A;  1L74 A;  4EMN A;  1L57 A;  2BNK A;  1CVK A;  1LSB A;  4LT0 A;  3U5Z A;  3NBX X;  1LZ5 A;  2RBR A;  1UA6 Y;  4I8S A;  2CHV A;  1EQE A;  1CUK A;  4BBA A;  3U6C A;  1CJ8 A;  5J7C A;  4XJH A;  1OWZ A;  1DV0 A;  3OJP A;  1V33 A;  1GFA A;  4JI3 M;  5HQ1 A;  4GKJ M;  2RBS A;  3HFM Y;  3ZC7 B;  5HNL A;  2LVA A;  1G3I A;  1L48 A;  1FLU A;  1OUJ A;  3GQ3 A;  2QBY B;  192L A;  1Z59 A;  1EIJ A;  1NKH A;  3WXU A;  110L A;  5B06 A;  1PGY A;  157L A;  4XN6 A;  1IOQ A;  1OTR A;  1RFP A;  1KIR C;  3SB6 A;  4PRU A;  1NHW C;  172L A;  1CV3 A;  1ZQ9 A;  1LI2 A;  1UIA A;  3CSQ A;  3LYM A;  1HSX A;  1VEJ A;  3LCV B;  1L07 A;  4ZPU A;  1HJP A;  2LVN C;  5LVK A;  1IY2 A;  2B6Y A;  1L38 A;  4UWN A;  1N75 A;  1H87 A;  2B74 A;  2HHH M;  4GHL A;  2ZIL A;  4DJH A;  3VDP A;  1NBZ C;  1CKD A;  4JI6 M;  1L10 A;  5LAG A;  241L A;  3K3T A;  4MST A;  147L A;  1FKV A;  4OWH A;  3C3D A;  1JSE A;  4NGZ A;  3EXD A;  3LZ2 A;  4PJ2 C;  2OO9 A;  3MK6 A;  2LVO C;  1I6S A;  3SMS A;  1L12 A;  2H9K A;  2F2N A;  5FTL A;  3WYH A;  1BGI A;  216L A;  4HTN A;  2XSZ A;  2N35 A;  1LKR A;  4LZJ A;  2MEI A;  102L A;  1CV0 A;  1G7L C;  1NHG C;  4L15 A;  3G3V A;  8CAT A;  262L A;  5C1B A;  2MEH A;  3WU7 A;  1LYO A;  1XEJ A;  2MEF A;  2CHG A;  209L A;  2HCB A;  3FUT A;  1C7Y A;  1PQJ A;  3C83 A;  4W51 A;  3HY5 A;  4PRQ A;  1R5L A;  2L4E A;  103L A;  1QUS A;  4DC4 A;  3RU5 A;  1DGF A;  2DWN A;  1JJ1 A;  2QHO B;  1L92 A;  1QTD A;  1LSC A;  3QY4 A;  3TWL A;  2EKS C;  1SX7 A;  2QSF X;  2BAA A;  2RBP A;  1QUT A;  1T6O A;  4M9X A;  1LYF A;  4E97 A;  1WIV A;  5L8R F;  1L70 A;  4DD2 A;  5EXP A;  225L A;  1IWX A;  2QAR C;  1QZE A;  1JIT A;  1MX0 A;  1ZYT A;  1G0M A;  1VQ1 A;  3WHK A;  1B5W A;  2FYD A;  1J1P Y;  1YIL A;  1P2L A;  3E9S A;  3NWL A;  2XFT A;  5JI2 E;  3CF6 E;  162L A;  1R7R A;  2DAI A;  1LJG A;  3RZE A;  2HAK A;  1L1Z A;  1G1V A;  2HEC A;  1D2Y A;  2MEG A;  3ODU A;  3L28 A;  2DNA A;  3AJN A;  1JQU A;  3GQ4 A;  163L A;  1JTP L;  2MEB A;  2X4A A;  2EPE A;  4LT2 A;  1LYD A;  2ZQ3 A;  4CHX A;  2BLY A;  3LYT A;  3GXR A;  4NC6 A;  4H8X A;  4AQN A;  1NSF A;  4ETA A;  237L A;  1IWW A;  4WLY A;  4FJR A;  1GE4 A;  3HT6 A;  1LMP A;  4G4N A;  1GB9 A;  3TXB A;  2FOI C;  125L A;  2KZU A;  1GB6 A;  1L22 A;  2ZTC A;  3IHP A;  1OUI A;  2V6Z M;  3GLF E;  4LCB A;  2XZF A;  1N36 M;  3QAU A;  3HHZ A;  3TPZ A;  3U6L A;  3CT0 A;  5BR8 M;  4G4H A;  4DR2 M;  3FI5 A;  4LZM A;  3WW6 A;  5KXK A;  4DR5 M;  4DR3 M;  3J6K A;  3FUU A;  3HWS A;  1I56 A;  5I4X A;  1D3M A;  1KSF X;  3SAU A;  4CIS A;  1IY4 A;  2R45 A;  4N5R A;  3GUO A;  1OV5 A;  4AQY M;  4KT0 F;  3N9C A;  1K3X A;  1L02 A;  200L A;  3UMM A;  1L65 A;  3AL0 C;  5F9U A;  4QHS A;  4EXM A;  3J2P B;  2W1Y A;  1AT5 A;  2LYM A;  4IBC A;  1IP5 A;  3B0K A;  1IC5 Y;  213L A;  3EIH A;  2DZL A;  1J1X Y;  1FLQ A;  1JTT L;  2RSC A;  2RBO A;  4HL4 A;  1NHE A;  3T15 A;  2H5Z A;  1TDH A;  3HZJ A;  4H8Y A;  3N9A A;  1H6U A;  1L1T A;  3SHG B;  2BQN A;  4HEO A;  3OK0 A;  1GFE A;  4LGM A;  112L A;  4KPM A;  4YHH M;  1Y8G A;  1PQD A;  2LZM A;  4WM1 A;  2W1X A;  3FTE A;  4FWD A;  1HSW A;  3HU9 A;  5KXN A;  1L51 A;  2B72 A;  1KYI A;  2BJV A;  4KLN A;  1JR3 E;  1L47 A;  1L53 A;  3ZH9 B;  4I4L A;  1P2C C;  1F0W A;  2CV2 A;  1EQ5 A;  1FN5 A;  4BLC A;  5DYG A;  2OE4 X;  1HFY A;  4GC5 A;  3I51 A;  1L63 A;  1YAP A;  4U3X B;  3L64 A;  1G7M C;  4LJ5 A;  5FTM A;  2L4F A;  1LZ4 A;  1JKC A;  1QS5 A;  3DN0 A;  4GEW A;  1LMQ A;  2QP9 X;  3FE3 A;  1YAM A;  149L A;  210L A;  2KZS A;  5II3 A;  1YE9 A;  4I7L A;  3SB7 A;  4NEB A;  4DV2 M;  3M7G A;  3VK8 A;  1GD6 A;  249L A;  253L A;  3SAT A;  3GLH A;  1VDD A;  104L A;  4LT1 A;  1F6S A;  4B0D A;  1KNI A;  1OUC A;  3C7Z A;  1IP1 A;  1IBK M; 
#chains in the Genus database with same CATH homology
 4PK0 A;  2B6X A;  1KIP C;  4II8 A;  1RE2 A;  1NDG C;  3A3R X;  2I26 L;  1L61 A;  108L A;  1CU2 A;  1GXV 2;  2BQL A;  3W6B A;  1L0K A;  1AZF A;  4W96 A;  1WQQ A;  4OW1 A;  4ARQ B;  248L A;  1GXX A;  3CDR A;  1QT7 A;  4I7O A;  1WQP A;  3HT9 A;  1LMN A;  2FYC A;  4B4E A;  1P46 A;  4BAF A;  2ANX A;  4LDE A;  3HTB A;  1OUF A;  1UC0 A;  1XGP C;  4B1A A;  4H9H A;  4KT3 A;  1LZT A;  3ZVQ B;  3DKE X;  2GV0 A;  1GFT A;  4H9A A;  1I20 A;  1YL0 X;  1L66 A;  1C43 A;  3DMV A;  3HDF A;  4WG7 A;  4WM2 A;  4YEO A;  1T6H A;  135L A;  3C80 A;  2RB0 X;  1B7S A;  4ARM B;  3T36 A;  1ZWN A;  5A3E A;  1C60 A;  1LJE A;  2B6W A;  4IAT A;  1TLA A;  2C8P A;  1YAO A;  1WVV A;  5LVI A;  5B59 A;  3A6B Y;  254L A;  4G9S A;  1GB0 A;  4AGA A;  1LZ9 A;  1XJU A;  3AZ5 A;  1KW5 A;  5APE A;  4I7P A;  2HU1 A;  5L9J A;  2RAZ X;  4PPO A;  4I7Q A;  3IJU A;  1GBO A;  4NY5 A;  3AGG G;  2QB0 B;  1WTN A;  3A6C Y;  5B05 A;  1DKJ A;  5LZM A;  1D3N A;  1L81 A;  1HNL A;  244L A;  4WL7 A;  3TMV A;  4NSG A;  219L A;  4H92 A;  4H90 A;  1O23 A;  1KXW A;  2DQE Y;  1GFJ A;  1LLH A;  1V7T A;  1HML A;  3ZVQ A;  2D4J A;  1I1Z A;  5KXT A;  2XBS A;  2Z19 A;  4N8Z A;  1L21 A;  1L54 A;  1L44 A;  1KS3 A;  2RBN A;  3AZ7 A;  1HEQ A;  3D9A C;  1XGR C;  1GB7 A;  3HUK A;  159L A;  4DYG A;  1DI4 A;  224L A;  1P7S A;  5I54 A;  1L64 A;  1JTO L;  3CSZ A;  1OV7 A;  2YBM A;  1GAY A;  5FCP A;  1CJ6 A;  3OE9 A;  4LZT A;  1SWY A;  232L A;  3WUN A;  1LZC A;  4ZIX A;  4LYZ A;  2F32 A;  2VB1 A;  4DDC A;  1L79 A;  1VDT A;  1BB6 A;  3TXE A;  1IWZ A;  2Z18 A;  4DT3 A;  2F47 A;  1IP7 A;  3P64 A;  1GB2 A;  1UIG A;  2Q9E A;  3HBH A;  5ILC A;  5KXZ A;  3UON A;  1B7R A;  4DD0 A;  1P36 A;  2BQB A;  4OOT A;  4DDB A;  2Z2E A;  1B9O A;  1B6I A;  4LYM A;  2MED A;  1LCN A;  132L A;  1C67 A;  1IC7 Y;  2IGC A;  4DQJ A;  5KXY A;  5DN4 A;  5L3I A;  144L A;  3WH1 A;  4NGW A;  120L A;  1L72 A;  134L A;  2MEE A;  4NSJ A;  3CSR A;  1NBY C;  2Z39 A;  5IEL A;  2DQH Y;  5APC A;  1C6A A;  4W55 A;  1L90 A;  1IWV A;  1DXJ A;  2F30 A;  1ZUR A;  3EMS A;  4UWU A;  1G0L A;  3IJV A;  3FAD A;  4NG8 A;  1NF5 A;  1D0K A;  1OVJ A;  1JUG A;  1G0Q A;  152L A;  4G4C A;  1QDR A;  1DQJ C;  4NGI A;  1IOC A;  1XEK A;  2DQJ Y;  4NGO A;  5KKJ A;  4RLM A;  4BAD A;  1IOR A;  181L A;  1C6P A;  3W6E A;  1L83 A;  4HJY A;  3WMK A;  1GF4 A;  1QS9 A;  230L A;  4RDS A;  184L A;  1G7H C;  1OUB A;  5FDJ A;  5DLA A;  1GBW A;  1C10 A;  1LZD A;  5HMJ A;  1G0K A;  1L43 A;  1L84 A;  1UIH A;  1L04 A;  1REM A;  1KXX A;  1DYG A;  1FKQ A;  1CKH A;  3DN1 A;  3IWR A;  1LMT A;  1L60 A;  1BB3 A;  4GLA A;  3AB6 A;  1L11 A;  4W56 A;  1DYA A;  191L A;  3P65 A;  236L A;  3C81 A;  2HUK A;  207L A;  5I5Q A;  2Q9D A;  4NGL A;  1NMM A;  2DQI Y;  3WPJ A;  1DKK A;  1CV1 A;  3C8Q A;  1LSG A;  3J4G A;  1IWY A;  2HUB A;  2HTX A;  3AGI A;  1JEF A;  1LI3 A;  3N9E A;  1F10 A;  1QT6 A;  212L A;  4W54 A;  1P3N A;  4H9F A;  1SSW A;  2RB1 X;  3F6Z A;  4W52 A;  1L00 A;  1XSF A;  1HEM A;  3GUJ A;  1T6V L;  1L69 A;  4TUN A;  3HT7 A;  5C6J A;  154L A;  5E9R A;  1NQI A;  1HEW A;  2B75 A;  1L03 A;  1D0L A;  4ZFP A;  3ATO A;  1A2Y C;  1JPO A;  2HED A;  4DD1 A;  3PBL A;  3C8S A;  1QSB A;  2DQF C;  1L93 A;  1P5C A;  2BQC A;  1WQR A;  2MEC A;  1L30 A;  1LYZ A;  2YDG A;  4HSF A;  4B49 A;  3AGH A;  128L A;  1SWZ A;  228L A;  1E8L A;  1LJ4 A;  3W6C A;  1CKF A;  1LYY A;  4TTD A;  4ETE A;  2DQD Y;  3WVY A;  1JIY A;  2LYO A;  151L A;  1CV6 A;  1IX0 A;  3DNA A;  1YRO A;  4AXT A;  1GE2 A;  3CT5 A;  4S0W A;  5I14 A;  2BQD A;  4WLX A;  1NWG A;  3SB5 A;  1UID A;  2RAY X;  3ATN A;  1IP6 A;  2ZNX Y;  1LMA A;  2OU8 A;  2O4W A;  1EQ4 A;  3A95 A;  4OO9 A;  1GEV A;  1L32 A;  2CUU A;  1YKZ X;  4OOO A;  1C64 A;  1LAA A;  2B5Z A;  2LZ2 A;  1MEL L;  4WM4 A;  1WTH A;  4H9C A;  4I7R A;  4EPI A;  1LSE A;  3M3U A;  1LYI A;  1IEE A;  1CTW A;  167L A;  193L A;  5KXX A;  1GFV A;  259L A;  1G7J C;  1SSY A;  1CX7 A;  217L A;  3G3X A;  2RBQ A;  4WO9 A;  1GBS A;  4H8Z A;  1PZY A;  1VED A;  1L71 A;  1LHI A;  4Z46 A;  175L A;  4LDO A;  3OE6 A;  258L A;  1LOZ A;  1IR7 A;  1LGX A;  4W57 A;  1BWI A;  1LGU A;  1LZY A;  3CT1 A;  1LSP A;  246L A;  111L A;  1L27 A;  1C6J A;  1L77 A;  3C7Y A;  4DWX A;  1UUZ C;  1QDT A;  2FBB A;  3KAM A;  4XJG A;  1C6N A;  251L A;  4LFP A;  1DZB X;  1LHK A;  4L41 A;  1L09 A;  1QT3 A;  3NY9 A;  1LSD A;  3A92 A;  233L A;  4NFV A;  5LYT A;  2OTY X;  5KXR A;  1QTV A;  4QDN A;  1XGT C;  1UAC Y;  3D3D A;  1L29 A;  1K28 A;  1TDY A;  2HEE A;  3EO5 A;  130L A;  1C6C A;  1GB8 A;  1SQ2 L;  1LHL A;  3LN2 A;  1BVK C;  3HBD A;  2I6Z A;  1DI5 A;  7LZM A;  2PC2 A;  1Z55 A;  3HBE X;  1L08 A;  1UIE A;  3PDS A;  2YBJ A;  4NHP A;  2F4G A;  1L89 A;  1LJ3 A;  173L A;  1REZ A;  1JTM A;  4CFO A;  1CJ7 A;  4WLT A;  4EKR A;  1CUQ A;  4WM6 A;  1L45 A;  3G3W A;  137L A;  4XJI A;  208L A;  4W53 A;  4XJB A;  4ARP A;  1C6I A;  1ZMY L;  1DPX A;  4B4J A;  4GCF A;  1LHH A;  4LDL A;  4IAP A;  3JR6 A;  1GE1 A;  3TXH A;  4H9I A;  2DBT A;  3GUI A;  4H9E A;  4H91 A;  4GCE A;  4H9B A;  2G4P A;  4NGJ A;  166L A;  3WPK A;  1BWJ A;  238L A;  1OUD A;  3CDV A;  3MGW A;  2O79 A;  3HTF A;  4YF2 A;  4EKP A;  4ETB A;  1LPI A;  1H6M A;  4PHI A;  1INU A;  1LYG A;  118L A;  1LI6 A;  4YEN A;  1B7L A;  4OWE A;  5B1G A;  4ML7 A;  3WW5 A;  5LVH A;  4GN4 A;  3DMZ A;  4NWH A;  3L2X A;  1L05 A;  1L35 A;  261L A;  5K7O A;  4W94 A;  229L A;  214L A;  2Z2F A;  3B0O A;  1EPY A;  2CJL A;  113L A;  4D9Z A;  1L18 A;  1GEZ A;  1IVM A;  1GF9 A;  4EJ4 A;  1L55 A;  4GN3 A;  153L A;  1C65 A;  2LCB A;  3QNG A;  2OEA X;  1L24 A;  1IIZ A;  1YQV Y;  2MEA A;  1BB5 A;  5F14 A;  4ETD A;  4GRV A;  182L A;  1GFG A;  1L06 A;  2C8O A;  1J1O Y;  3BKV A;  7LYZ A;  2ZNW Y;  1L23 A;  3WUL A;  4TSC A;  2OTZ X;  5LA5 A;  1G0G A;  2LYZ A;  1L67 A;  127L A;  1MLC E;  4KL7 A;  5B07 A;  3DN2 A;  4N0J A;  1T97 A;  3ZEK A;  4I7S A;  4ARL A;  1CUP A;  242L A;  3CDQ A;  4LYB A;  3VWO A;  1JKD A;  4YEM A;  2OU0 X;  3T6U A;  1D0M A;  201L A;  4YM8 A;  1GB3 A;  1C68 A;  3A8Z A;  3B0I A;  1B5V A;  1F6R A;  1T8G A;  1LGW A;  2YBH A;  138L A;  4NHS A;  4YOP A;  1D6Q A;  5KXW A;  3HU8 A;  4G4B A;  2IHL A;  2ZYC A;  131L A;  4WLD A;  1P6Y A;  4I7N A;  2CDS A;  1LZS A;  4Z3M A;  4XJF A;  3HTG A;  2HEA A;  1GF3 A;  3SN6 R;  3WUM A;  2B73 A;  3A96 A;  1REY A;  239L A;  3CDT A;  1QUD A;  4CFP A;  1IP3 A;  1HFZ A;  1LZ6 A;  240L A;  1JSF A;  4OWC A;  1C6B A;  5F81 A;  5FEK A;  2YSS C;  1B5Z A;  1L97 A;  5D5F A;  5T3F A;  5LA8 A;  2HUL A;  3V2W A;  1OVH A;  2OE9 X;  2XBR A;  250L A;  1XEI A;  1C7P A;  4M4O A;  1DYF A;  226L A;  5LAF A;  5I53 A;  4O34 A;  4CJ2 A;  2HUM A;  3SB9 A;  2G4Q A;  1VDP A;  1L01 A;  3CB7 A;  4DD3 A;  146L A;  1YKX X;  1SX2 A;  1JKB A;  1T3P A;  4I7K A;  6LYT A;  4J1B A;  1L41 A;  4LYT A;  3HT8 A;  3M18 B;  4ZEE A;  4RLN A;  183L A;  1L96 A;  1C6K A;  1GFU A;  3V2Y A;  1DYC A;  1LYH A;  1ALC A;  4OWB A;  4LT3 A;  1LSM A;  198L A;  4LYO A;  1L94 A;  1IOS A;  4HPE A;  4NIJ A;  4I0C A;  1W6Z A;  3HUA A;  215L A;  174L A;  1P37 A;  4HPI A;  3P4Z A;  5D5C A;  3HH5 A;  3FI7 A;  1LTM A;  3DN6 A;  4NSI A;  4WM3 A;  5L3H A;  1GDX A;  2DKV A;  3GUN A;  205L A;  140L A;  256L A;  2Z38 A;  3P66 A;  1G7I C;  1DYE A;  4LYC A;  1L49 A;  1L20 A;  1UIB A;  1LZ1 A;  1OUH A;  1C61 A;  2RH1 A;  1BVX A;  186L A;  5ILF A;  2BLX A;  1W08 A;  1C63 A;  1B5U A;  3QAK A;  2BQO A;  2ZIK A;  3TXF A;  206L A;  1BWH A;  1GFK A;  1GB5 A;  197L A;  1B5X A;  187L A;  114L A;  2HEB A;  185L A;  2BQA A;  1L95 A;  4XYY A;  3W6D A;  2N5Z A;  2F4A A;  1HHL A;  1L88 A;  4R6C A;  3RW8 A;  1GHL A;  1UBZ A;  3K2R A;  4M6D A;  1LYE A;  4XAD A;  3LHM A;  4EOF A;  1L37 A;  1LJH A;  1LZB A;  5LXW A;  1NHB A;  1OQM A;  1C6T A;  1FLW A;  5KXP A;  3QE8 A;  5HMV A;  3HH4 A;  1GF5 A;  1CU0 A;  4J7V A;  1QSQ A;  1GWD A;  3A90 A;  3WXT A;  3OE0 A;  4TWS A;  4ARJ A;  1LZN A;  1TBY A;  222L A;  3EML A;  3WUA A;  2BQM A;  3LYZ A;  1LW9 A;  2DQC Y;  2A7F A;  4ETC A;  4HV1 A;  1BHZ A;  1OUG A;  1C46 A;  190L A;  5EBH A;  4XJD A;  1WQM A;  4HV2 A;  1GBZ A;  1QT8 A;  4LGK A;  158L A;  4XEN A;  5JEN B;  3TXJ A;  1QTZ A;  5KXS A;  4HJZ A;  1LZE A;  5F16 A;  3C82 A;  1C6D A;  133L A;  2OU9 A;  1HEP A;  2NWD X;  1HEO A;  2HU3 A;  1CV5 A;  4I7M A;  3HWL A;  234L A;  1GE0 A;  1IY3 A;  2Z6B A;  1GBX A;  1L62 A;  4IAS A;  3RZ4 A;  4K5Y A;  129L A;  4DD9 A;  2BQK A;  1QUH A;  1FBI X;  164L A;  2NTG A;  1IR8 A;  4N9R A;  1QIO A;  143L A;  4RW2 A;  1L13 A;  5HNC A;  1JHL A;  2Z12 A;  2B7X A;  231L A;  1B7P A;  1VAT A;  3W3E A;  2A7D A;  4PGJ B;  247L A;  6LZM A;  1JKA A;  3DN3 A;  2FBD A;  122L A;  3A34 A;  1B0D A;  2F2Q A;  1UCO A;  1BB7 A;  3F8V A;  4LFX A;  1PS5 A;  1LMO A;  1REX A;  1L0J A;  2NTH A;  1L42 A;  3NYA A;  1GFR A;  1CU6 A;  1L14 A;  5C6I A;  3VW7 A;  1LHJ A;  223L A;  1A4V A;  1C6M A;  2CWI A;  165L A;  176L A;  4Z98 A;  1C6Q A;  2ZYP A;  2BQI A;  5DL9 A;  1L82 A;  2B6T A;  3F9L A;  2Y8P A;  1B7N A;  1L58 A;  2OE7 X;  6LYZ A;  160L A;  4ET9 A;  1C6F A;  1LZA A;  2DQA A;  1CV4 A;  4BAP A;  1DI3 A;  1LWK A;  2A4T A;  1B7M A;  3CQL A;  5C6L A;  3LZT A;  2ANV A;  4WO6 A;  1LZR A;  4NGK A;  1KXY A;  3WU8 A;  1IP2 A;  243L A;  3SBB C;  1LKS A;  2RB2 X;  3DMX A;  142L A;  195L A;  1C6G A;  4PJZ A;  1DYD A;  1OUE A;  2EQL A;  4J1A A;  4EPF A;  1IR9 A;  1WQN A;  5M1Y A;  4E3U A;  1L85 A;  4B4I A;  1G06 A;  1DPW A;  2XJW A;  177L A;  1QSA A;  1RCM A;  1CJ9 A;  3WVX A;  221L A;  4KXI A;  1C6L A;  1HEN A;  150L A;  169L A;  3GUL A;  3B72 A;  4H93 A;  1LWG A;  1P56 A;  3BKH A;  4X3B A;  1P64 A;  4DQ7 A;  1BQL Y;  4WL6 A;  5LYM A;  4C3W A;  3AZ4 A;  1L26 A;  1CX6 A;  1T8F A;  2BQG A;  3TXI A;  235L A;  1L68 A;  1C66 A;  1P2R A;  107L A;  4GCC A;  2Z37 A;  3LZM A;  5FEL A;  5DM9 A;  1L98 A;  2BPU A;  4EKS A;  3A91 A;  1PQM A;  5I4Y A;  1JIS A;  188L A;  1L28 A;  3A3Q A;  1D9W A;  5LVJ A;  3TMX A;  4DD7 A;  1CNS A;  4TSB A;  1HER A;  3NY8 A;  1LHM A;  1GE3 A;  260L A;  1QT4 A;  227L A;  1YKY X;  2YBI A;  5AMY A;  1IP4 A;  1LSF A;  3CDO A;  1TEW A;  2LHM A;  2LZT A;  3RUN A;  1TCY A;  4I7T A;  1GF6 A;  3TMW A;  1L87 A;  1L91 A;  5LVG A;  5LYZ A;  1LJN A;  1QTE A;  4GLV A;  4W59 A;  9LYZ A;  1QSW A;  1LJK A;  1LYJ A;  1VFB C;  4G49 A;  1KW7 A;  1WVU A;  189L A;  211L A;  5APF A;  1OVK A;  1QUO A;  3FA0 A;  1CKG A;  1B2K A;  5APD A;  1PQO A;  4MCK A;  126L A;  1LPY A;  1ZVY B;  1HC0 A;  1ZVH L;  1L33 A;  4FDY A;  1D2W A;  4N1C C;  3HTD A;  1IC4 Y;  1GFH A;  1D6P A;  4YXA C;  5FST A;  1D3F A;  2LC9 A;  2Q0M X;  1UIF A;  1KIQ C;  1RI8 B;  4NGY A;  115L A;  4DDA A;  2W1L A;  2D4I A;  3TXK A;  4C5F A;  1B7O A;  1VAU A;  1DYB A;  1JJ3 A;  1LJF A;  1EL1 A;  155L A;  2DQG Y;  4QEQ A;  1PQI A;  4ET8 A;  3GXK A;  3A67 Y;  1XFP L;  4RW1 A;  5KXL A;  1OWY A;  4WM5 A;  1LSA A;  1NDM C;  1L86 A;  3TXG A;  196L A;  1B7Q A;  180L A;  1C6E A;  2BQE A;  4H1P A;  1BB4 A;  4WOA A;  1L50 A;  4I7J A;  218L A;  1LZ8 A;  1C08 C;  1GAZ A;  1FLY A;  5LIO A;  3E3D A;  1C62 A;  1ZV5 L;  1HMK A;  5FHW A;  5DN5 A;  4P2E A;  3WU9 A;  168L A;  3SP3 A;  3SBA A;  1L59 A;  1L56 A;  123L A;  1CU5 A;  4DAJ A;  1HFX A;  1PQK A;  1XGQ C;  1GPQ C;  1FDL Y;  1KY0 A;  2HEF A;  1SLY A;  3DN8 A;  1QTH A;  1L40 A;  1L46 A;  1OP9 B;  1LJI A;  4ARQ A;  4QY9 A;  255L A;  3AW6 A;  3TMU A;  2YVB A;  4Z41 A;  5KY1 A;  1UIC A;  8LYZ A;  1D3J A;  1C45 A;  4A7D A;  3HH3 A;  4NWE A;  3DN4 A;  1AT6 A;  3TXD A;  252L A;  4H94 A;  2ZWB A;  1JTN A;  2CGI A;  4NHQ A;  1QTB A;  1JJ0 A;  4W58 A;  3D4S A;  2ZIJ A;  1L34 A;  1N4F A;  3HH6 A;  3LYO A;  2D6B A;  1LJJ A;  1IOT A;  3SB8 A;  3GUK A;  3ULR A;  5IHG A;  145L A;  2BQH A;  2YBN A;  1L16 A;  1C6H A;  1GBY A;  4GBR B;  1L36 A;  2IFF Y;  4ARM A;  170L A;  1VDQ A;  3A93 A;  2W1M A;  3W6A A;  1VDS A;  5KKI A;  148L E;  2EIZ C;  4OWA A;  2B70 A;  5E4P A;  1HEL A;  1XGU C;  4NSH A;  3AZ6 A;  1L52 A;  109L A;  3W6F A;  1L73 A;  4HP0 A;  1JWR A;  1LMC A;  3P68 A;  2AUB A;  1GDW A;  1YAN A;  5B1F A;  2XQO A;  1HF4 A;  3FE0 A;  156L A;  1YL1 X;  4GCB A;  2D4K A;  141L A;  1G0P A;  1LYS A;  4TX7 A;  4ANR A;  2H9J A;  1LSZ A;  1QTK A;  1L75 A;  1GF7 A;  2I25 L;  3GUP A;  1T8A A;  4HTK A;  2ZQ4 A;  3HDE A;  2G4N A;  2XTH A;  2D91 A;  1LZG A;  5I4W A;  4MR1 A;  5A3Z A;  1L76 A;  1LSN A;  1YIK A;  1GF8 A;  1G1W A;  3RT5 X;  2WAR A;  194L A;  1GF0 A;  5HLL A;  1L25 A;  1L15 A;  1L31 A;  1IWU A;  4J0L A;  4NHT A;  4QGZ A;  1KY1 A;  3RNX A;  1OYU A;  2BQJ A;  1IO5 A;  1QT5 A;  1CU3 A;  2X0A A;  1L17 A;  1L19 A;  1C69 A;  4EKQ A;  2O7A A;  4HTQ A;  171L A;  1G07 A;  1D9U A;  245L A;  161L A;  1AM7 A;  3GUM A;  1L99 A;  5KJ9 A;  2YBL A;  1L80 A;  2B6Z A;  119L A;  2BQF A;  3G3B B;  1V7S A;  5IDD A;  1TAY A;  1WQO A;  4DKL A;  139L A;  4NG1 A;  1XEP A;  1OUA A;  4GN5 C;  3HUQ A;  1CKC A;  1WTM A;  1AKI A;  4YXC A;  3AYQ A;  4NHI A;  5KXM A;  3AW7 A;  1RJC B;  4WG1 A;  1XJT A;  4DQ5 A;  5LIN A;  1IWT A;  4IJ4 A;  1L39 A;  3EBA B;  1LSY A;  4UWV A;  4GCD A;  1YAQ A;  5KXO A;  220L A;  178L A;  1QUG A;  3G3A B;  199L A;  4YX7 C;  4NGV A;  3OE8 A;  1G0J A;  3C8R A;  257L A;  3B6L A;  1B5Y A;  4BS7 A;  1QQY A;  1QTC A;  3WL2 A;  2L78 A;  4HJV A;  3C7W A;  4N1E I;  3A94 A;  4WMG A;  5F9X A;  4CGE A;  3WPL A;  4R0F A;  1L74 A;  4EMN A;  1L57 A;  1CVK A;  1LSB A;  4LT0 A;  1LZ5 A;  2RBR A;  1UA6 Y;  4I8S A;  1EQE A;  1CJ8 A;  5J7C A;  4XJH A;  1OWZ A;  3OJP A;  5HQ1 A;  1GFA A;  2RBS A;  3HFM Y;  5HNL A;  1L48 A;  1FLU A;  1OUJ A;  192L A;  1NKH A;  3WXU A;  110L A;  5B06 A;  157L A;  4XN6 A;  1IOQ A;  1RFP A;  3SB6 A;  1KIR C;  4PRU A;  172L A;  1CV3 A;  1LI2 A;  1UIA A;  3CSQ A;  3LYM A;  1HSX A;  1L07 A;  4ZPU A;  5LVK A;  2B6Y A;  1L38 A;  4UWN A;  1H87 A;  2B74 A;  2ZIL A;  4DJH A;  1NBZ C;  1CKD A;  1L10 A;  5LAG A;  241L A;  3K3T A;  4MST A;  147L A;  1FKV A;  4OWH A;  1JSE A;  4NGZ A;  3EXD A;  3LZ2 A;  4PJ2 C;  1I6S A;  1L12 A;  2H9K A;  2F2N A;  3WYH A;  1BGI A;  216L A;  4HTN A;  1LKR A;  2MEI A;  102L A;  1CV0 A;  1G7L C;  3G3V A;  262L A;  2MEH A;  3WU7 A;  1LYO A;  1XEJ A;  2MEF A;  209L A;  1PQJ A;  3C83 A;  4W51 A;  4PRQ A;  103L A;  1QUS A;  4DC4 A;  3RU5 A;  1L92 A;  1JJ1 A;  1QTD A;  1LSC A;  3QY4 A;  2EKS C;  1SX7 A;  2BAA A;  2RBP A;  1QUT A;  1LYF A;  4E97 A;  1L70 A;  4DD2 A;  225L A;  1IWX A;  2QAR C;  1JIT A;  1ZYT A;  1G0M A;  1B5W A;  2FYD A;  1J1P Y;  1YIL A;  1P2L A;  162L A;  1LJG A;  3RZE A;  1G1V A;  2HEC A;  1D2Y A;  2MEG A;  3ODU A;  3AJN A;  1JQU A;  163L A;  1JTP L;  2MEB A;  4LT2 A;  2EPE A;  1LYD A;  2ZQ3 A;  4CHX A;  2BLY A;  3LYT A;  3GXR A;  4H8X A;  4AQN A;  4ETA A;  237L A;  1IWW A;  4WLY A;  4FJR A;  1GE4 A;  3HT6 A;  1LMP A;  1GB9 A;  3TXB A;  125L A;  1GB6 A;  1L22 A;  1OUI A;  3CT0 A;  4G4H A;  3FI5 A;  4LZM A;  3WW6 A;  5KXK A;  3J6K A;  1I56 A;  5I4X A;  1D3M A;  1IY4 A;  4N5R A;  3GUO A;  1OV5 A;  3N9C A;  1L02 A;  200L A;  1L65 A;  5F9U A;  4EXM A;  2W1Y A;  1AT5 A;  2LYM A;  1IP5 A;  3B0K A;  1IC5 Y;  213L A;  1JTT L;  1J1X Y;  1FLQ A;  2RSC A;  2RBO A;  1NHE A;  2H5Z A;  4H8Y A;  3N9A A;  2BQN A;  3OK0 A;  1GFE A;  4KPM A;  112L A;  1PQD A;  2LZM A;  4WM1 A;  2W1X A;  1HSW A;  3HU9 A;  5KXN A;  1L51 A;  2B72 A;  1L47 A;  1L53 A;  1P2C C;  1F0W A;  1EQ5 A;  1FN5 A;  2OE4 X;  1HFY A;  1L63 A;  1YAP A;  4U3X B;  3L64 A;  1G7M C;  1LZ4 A;  1JKC A;  1QS5 A;  3DN0 A;  1LMQ A;  1YAM A;  149L A;  210L A;  5II3 A;  4I7L A;  3SB7 A;  4NEB A;  1GD6 A;  249L A;  253L A;  104L A;  4LT1 A;  1F6S A;  4B0D A;  1KNI A;  1OUC A;  3C7Z A;  1IP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...