1QUTA

The soluble lytic transglycosylase slt35 from escherichia coli in complex with n-acetylglucosamine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
312
Chain Sequence
b'MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
molecule tags Hydrolase
source organism Escherichia coli
publication title Crystal structure of Escherichia coli lytic transglycosylase Slt35 reveals a lysozyme-like catalytic domain with an EF-hand.
pubmed doi rcsb
total genus 108
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qutA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qutA02
4H94A 1LSAA 2Z37A 4NGVA 5B05A 1XEKA 2D91A 4OWBA 4X3BA 2MEHA 2I6ZA 1D6QA 7LYZA 4WG1A 1HC0A 4HPEA 5FSTA 3GXKA 1GDWA 3IWRA 1IR8A 1J1PY 1D0LA 1B7SA 4I0CA 1HFYA 2LYOA 3LZ2A 3P64A 2XBSA 3M18B 4O34A 8LYZA 2XBRA 3D3DA 2DQHY 4H92A 5IELA 1LZRA 4E3UA 4LFXA 1UCOA 1IY4A 1LJJA 3A96A 3W6EA 1LZBA 1OUAA 4LYBA 2CDSA 4N0JA 1UIGA 5F81A 1LJ4A 1BB6A 3WW6A 3WH1A 1GPQC 3BKVA 1LSGA 5F9XA 1DPXA 1UBZA 5LAGA 3VWOA 1B7NA 1UC0A 1HSXA 4WL6A 1GFUA 1FDLY 1JHLA 1IP3A 4WM4A 4GLVA 3P66A 1GB0A 5LAFA 1LSFA 4J0LA 1LHLA 3P4ZA 2F4AA 2AUBA 1GB7A 4PHIA 2DQIY 4HV1A 4CJ2A 6LYZA 2YBLA 1GB3A 1LJEA 4G4BA 2EKSC 1QUSA 5APFA 2HU3A 4QEQA 3T6UA 4P2EA 3WYHA 1IR7A 1G7HC 1I1ZA 1WTNA 3A94A 1UACY 1IOSA 2A7DA 4IJ4A 1LJGA 2Z12A 4U3XB 2XJWA 4LT3A 3AGHA 3AGIA 1FBIX 1OP9B 4MCKA 3OJPA 4H1PA 4DD1A 3ATNA 3W6DA 2HEFA 9LYZA 5JENB 1LHMA 4LGKA 4QGZA 4GN3A 5EBHA 4DT3A 3WPJA 1DQJC 4AGAA 5LYMA 2F2NA 1UIBA 4LZTA 5LVIA 1YQVY 2BQGA 1GB5A 1UIEA 1GFJA 5I53A 1B5VA 3WU9A 5LA8A 1C46A 3A8ZA 5LVKA 1B7RA 3N9CA 4WO6A 1GBSA 4B4IA 3WMKA 1JJ1A 1IP4A 4XJDA 3A93A 1LHKA 4WM1A 194LA 2DQDY 1HNLA 3LYOA 1XGUC 5KXNA 1NDGC 4N1EI 1O23A 5C6IA 2BQBA 5B1GA 5LINA 1IWUA 2ZWBA 1I20A 1D0MA 1LJHA 1IWXA 3TXKA 4H8XA 4PGJB 1GF7A 1REMA 2ZQ4A 3ULRA 1LPIA 4DC4A 1QUTA 3A3QA 1FKQA 2FYDA 3HBHA 5HNLA 1KXXA 3CT1A 2BQFA 3AZ4A 4NSGA 1F6SA 1UIDA 3SP3A 1IX0A 1B7PA 4CHXA 1BWJA 1WQRA 4LYTA 2H9JA 1IWVA 1TDYA 5FDJA 3QNGA 1B5XA 1WVUA 1CKFA 5B59A 1PZYA 2EPEA 1WQMA 1AZFA 4I8SA 5I4WA 1YAMA 1GBXA 2YBIA 2Z18A 3AB6A 1GB8A 4WLYA 1BWIA 1CKHA 5KXSA 4IASA 3WVXA 1V7TA 5I4YA 1OUEA 1OQMA 1C7PA 1BVXA 5F14A 3TXHA 4B4EA 1LZGA 1YILA 3LHMA 5E9RA 1DI3A 2DQGY 1KIPC 1SQ2L 1WTMA 1HENA 1B5YA 4XN6A 4WM5A 5KXOA 1IP6A 1LZ8A 1GXV2 2Z38A 4C3WA 4NWEA 2D4KA 2VB1A 1HEMA 4KL7A 3A6CY 4RLNA 4HV2A 5LXWA 2LZ2A 2W1MA 5LYZA 1WQOA 3TXBA 1LKSA 1AT5A 4ET9A 3RU5A 1ALCA 5D5FA 3WU8A 1SLYA 2BQOA 4FDYA 2I26L 1J1OY 4NHSA 154LA 1T3PA 4N1CC 1JITA 3B0OA 2DQFC 1GFRA 193LA 3RT5X 2I25L 4NGWA 2FYCA 3TXEA 1FLWA 4BS7A 5KXRA 2HTXA 5DLAA 1GE1A 1KXWA 1YAPA 1C10A 2G4PA 2HEAA 3N9EA 4NGLA 1JTPL 4Z3MA 4PRUA 4H9HA 1C43A 1GDXA 1IWWA 2LZTA 2MECA 4YENA 1RCMA 4NHTA 4WLXA 3TMWA 1LZDA 5HLLA 1JJ3A 5B06A 1IOTA 1IY3A 1AKIA 1B5ZA 1HEPA 4MR1A 2A7FA 4KXIA 1XFPL 4NSJA 1WVVA 4XADA 2BQNA 2MEIA 1UUZC 1OUHA 5HMVA 2IFFY 3A67Y 1LAAA 2D6BA 4WG7A 5KY1A 1GWDA 1GBYA 1LJ3A 1LSNA 1B7QA 1HELA 1NBYC 5L9JA 1HFZA 3MGWA 1W08A 1VATA 5DL9A 1Z55A 1IOQA 1LSPA 1JISA 2BQMA 1TCYA 1IP7A 4WMGA 1EQ4A 2MEEA 2FBBA 1HERA 4GCEA 1F10A 1TAYA 1NWGA 4OOOA 4H93A 4EMNA 1NMMA 1LZNA 1IP2A 1CJ7A 2C8OA 4WO9A 2YDGA 5F16A 2HEBA 1GXXA 1JEFA 1JIYA 4DD0A 1GE3A 4CFPA 3T36A 2IHLA 1HEQA 3OK0A 5IDDA 2DQJY 3WW5A 4R0FA 1MELL 2BLYA 1IC4Y 4UWNA 2BQAA 5B07A 4YEMA 3W3EA 1HMKA 1FKVA 1QIOA 1HMLA 1LZSA 3LYZA 4UWVA 4LT0A 1DXJA 5LVGA 1GF6A 1IWYA 1DKKA 4ETBA 2ZILA 5B1FA 1ZVYB 2BQIA 1LSZA 2YSSC 1B5UA 1BQLY 3B0KA 3WPKA 5LYTA 3TXIA 1OUIA 2LHMA 1FLQA 4N8ZA 4DDBA 3TXGA 3TXFA 153LA 4H9FA 3WVYA 3N9AA 4HPIA 5FHWA 1EQ5A 1FLYA 1LZEA 5APEA 2YBJA 3J4GA 4ANRA 2CGIA 2ZQ3A 4HP0A 4GN5C 1LZTA 5DN5A 1YANA 5KXWA 2DQAA 1GFHA 1I56A 1LZYA 4YF2A 3QY4A 5II3A 1CKCA 1LCNA 5A3EA 5I54A 1W6ZA 1REZA 1QSWA 1XGTC 1YL0X 4L41A 4TSBA 4WLDA 3EXDA 4XJBA 5KXLA 207LA 2HECA 1B5WA 1LYZA 1RFPA 4HJZA 5KXPA 134LA 4QY9A 4AXTA 5D5CA 4WL7A 4CGEA 4NSHA 2ZIJA 4NGOA 2MEAA 4PRQA 4B1AA 1EQEA 4TTDA 3AZ5A 4EOFA 1VDTA 2BQEA 1LTMA 3G3AB 4H9IA 4MSTA 4J7VA 1GF4A 4OW1A 5KKIA 4XENA 3B72A 1IORA 3WPLA 1OUGA 2DQCY 1MLCE 4NHQA 1KIRC 2DQEY 2MEGA 3HBDA 4NGYA 4WLTA 4Z41A 1YAQA 3A3RX 4YM8A 1CJ9A 1LMPA 3B0IA 4WM6A 1GB6A 1CKDA 4W96A 1LSMA 3AGGG 5APCA 5LVHA 2ZNWY 3J6KA 1IR9A 4ZFPA 2BQLA 1ZMYL 2XTHA 1REXA 4B49A 1LZ4A 1IVMA 1IO5A 2Z19A 1LSYA 3FI7A 5AMYA 3HBEX 4H90A 1JSFA 1GB2A 3A6BY 4DD9A 1DI5A 1LZ9A 1BVKC 1CNSA 1GE4A 4NIJA 1JTOL 1LMNA 5K7OA 5E4PA 4NFVA 4TX7A 4PJ2C 1HF4A 1YL1X 1B9OA 4OOTA 3W6CA 2DBTA 2HUBA 1LHJA 1A2YC 1LKRA 5KXYA 3CT0A 3TXDA 3WUMA 3GXRA 1GF5A 1J1XY 1LSBA 1LZ5A 4RDSA 3CSQA 4NEBA 3WUAA 2Z2EA 1VEDA 4LYOA 1NF5A 2BLXA 4KPMA 1BGIA 1RI8B 1GFAA 1NKHA 2BQCA 1YKYX 1XEJA 4KT3A 3WU7A 1TEWA 2MEBA 3RNXA 1OUFA 4NHIA 1GFGA 3A34A 4H91A 4NG1A 1GF9A 1B7MA 3P68A 4DD2A 5KKJA 4RW1A 1NDMC 1JUGA 4DD3A 2H9KA 2HEDA 1A4VA 1G7IC 1V7SA 2B5ZA 4D9ZA 5F9UA 2W1LA 4NHPA 4UWUA 4XJGA 1GBOA 5M1YA 1JTTL 1LYSA 1XGQC 3G3BB 1HSWA 3ATOA 1IP1A 4ETAA 1QQYA 132LA 4NWHA 3TXJA 6LYTA 1LMAA 3CSZA 3LZTA 1LMTA 2MEFA 3KAMA 5I4XA 2LYZA 4ET8A 1VAUA 5C6JA 4GCBA 4OWCA 2Q0MX 3WULA 1LYOA 4HTNA 4BADA 3LYMA 4NGIA 1BWHA 1YROA 1GF3A 1GBZA 1LZAA 1QDRA 5L3IA 1OUDA 3CT5A 4HJVA 4NGKA 4N9RA 3TMUA 4II8A 2ZYCA 2GV0A 4LYZA 3IJUA 4J1AA 5ILCA 1FLUA 1RJCB 3WUNA 4NG8A 1UICA 4DDCA 1IOCA 1GFVA 4H9AA 4Z46A 5KXXA 1BB4A 1LZ1A 5LIOA 2YBMA 4G9SA 1BHZA 5LA5A 2RSCA 2PC2A 3CQLA 3M3UA 1OUJA 3RW8A 3K3TA 5I5QA 4CFOA 5IHGA 5HQ1A 2W1XA 4YOPA 1BB5A 2ZYPA 5HNCA 1GAYA 4WOAA 1LJFA 4GLAA 1IC5Y 5A3ZA 1GEVA 1GHLA 4GN4A 2F4GA 1JJ0A 1GF0A 4XJIA 1PS5A 4H8ZA 1LSEA 208LA 3W6BA 4ML7A 4OWHA 1H6MA 4LYCA 3ZVQA 4Z98A 5KJ9A 1F0WA 2N5ZA 3BKHA 1HEWA 2EQLA 1YKXX 1LHHA 2MEDA 3AZ6A 4GCFA 4DDAA 1LMCA 1QSAA 1YAOA 1ZV5L 1HHLA 1NHEA 3TMVA 1G7LC 1F6RA 5FEKA 4NSIA 3WXTA 1GAZA 1KIQC 4TUNA 1IEEA 1UIHA 4R6CA 1LMOA 4DWXA 4G49A 1C08C 2FBDA 4ETDA 5HMJA 1B7OA 1LSCA 3P65A 3WXUA 3FE0A 1LSDA 4XJFA 1QTEA 1IC7Y 5APDA 1LYYA 2BQKA 1WQQA 4NGZA 1INUA 2DKVA 4BAPA 1H87A 1VDPA 1GF8A 2D4JA 2EIZC 2YBHA 2ZNXY 4GCCA 1JKCA 3EBAB 4M6DA 4YEOA 1OUCA 3AZ7A 5ILFA 1RE2A 3AW7A 1KXYA 3A90A 2Y8PA 3ZVQB 3QE8A 3W6FA 4RLMA 1DZBX 4GCDA 2F30A 4ETCA 133LA 2BAAA 3F6ZA 3CSRA 1TBYA 3TMXA 1DI4A 4BAFA 3RZ4A 1YIKA 1CJ8A 1GFKA 1IIZA 2CWIA 2D4IA 4OWAA 1NQIA 4M4OA 4WM3A 3AYQA 5KXTA 1D6PA 1VDQA 4TSCA 1DKJA 1GD6A 1XEIA 1B2KA 4C5FA 4FJRA 3EO5A 1CKGA 135LA 2BQHA 3AJNA 4B0DA 2C8PA 4NY5A 4G4HA 4HTQA 4W94A 2BPUA 5L3HA 1GFTA 2G4QA 4A7DA 3A92A 4H9CA 4WM2A 3CB7A 1JPOA 5KXMA 2Z39A 4IATA 4B4JA 4ZEEA 1AM7A 3WL2A 1IWZA 2W1YA 4ETEA 3E3DA 5T3FA 5DN4A 1LJKA 3B6LA 1LZ6A 1YKZX 2HU1A 4H8YA 1GE2A 2ZIKA 1JKDA 1T6VL 5KXZA 3LYTA 1BB7A 1JWRA 1AT6A 1P2CC 1UA6Y 4G4CA 4OWEA 4PPOA 1NBZC 1FN5A 4XYYA 1E8LA 1G7MC 1B7LA 2BQJA 3IJVA 1OUBA 1GBWA 3ZEKA 5J7CA 1IP5A 1N4FA 1HFXA 3D9AC 1XGRC 5FELA 1HEOA 2H5ZA 1VDSA 1JSEA 2BQDA 1VFBC 2Z2FA 5DM9A 1XGPC 1B0DA 3HFMY 4HSFA 1D0KA 2YBNA 3LN2A 5LVJA 2YVBA 1QDTA 5FCPA 1LJIA 3W6AA 4QDNA 4LYMA 4DYGA 1C45A 2CJLA 1LHIA 4ZIXA 1DPWA 2LYMA 1JKBA 1XSFA 1IWTA 1WQNA 2G4NA 1GEZA 4XJHA 1GFEA 1LOZA 3A95A 5KXKA 2X0AA 1EL1A 4HJYA 1JKAA 1GE0A 4N5RA 4HTKA 1WQPA 1QTKA 1BB3A 4LT2A 2NWDX 1D9UA 1CJ6A 1UIFA 1G7JC 1UIAA 4TWSA 1LJNA 1ZVHL 4LFPA 1GB9A 1REYA 4J1BA 3AW6A 4H9EA 4DD7A 3A91A 2HEEA 4NGJA 2WARA 4LT1A 4RW2A 5C6LA 3EMSA 4H9BA 1LMQA 1LZCA
chains in the Genus database with same CATH superfamily
3HY5A 248LA 115LA 1LW9A 252LA 3RE8A 4WG1A 231LA 4LZZA 3FUTA 1CX7A 1GDWA 5JI2E 3IWRA 3DMXA 2LYOA 3LZ2A 1L71A 1R4GA 2XBSA 2XBRA 3TE6A 2DQHY 5FTJA 3GUNA 4LFXA 2MGWA 2CUZA 3W6EA 161LA 1L39A 4S12A 2JP7A 2C98A 2G5GX 5F9XA 2JY6B 1DPXA 1UBZA 4DBGB 1FDLY 172LA 3M6AA 1PM5A 1D2YA 1L01A 2QZ4A 4I7MA 2V6ZM 4J0LA 3P4ZA 4PHIA 1NHGC 4CJ2A 1RU3A 1WR1B 1LJEA 4IBGA 3ZQJA 1QUSA 3HKPA 4QEQA 3FRHA 1I1ZA 4I7QA 4FD2A 2Z12A 2XJWA 1SX7A 1NO1A 122LA 4YHHM 3AGIA 4GH9A 4MCKA 3U6CA 1NY5A 3ATNA 1GJTA 1NV9A 186LA 3D8LA 4ARJA 1LHMA 1DYGA 1OIPA 1UIBA 1JQUA 2BQGA 1GB5A 4B0DA 4QHSA 158LA 2DZNB 1B7RA 3JAMS 1GBSA 4B4IA 1HJPA 3WMKA 3M0EA 1G1WA 1JJ1A 3SB7A 3G3XA 4I81A 5KXNA 1NDGC 140LA 1L69A 3KSJA 5B1GA 1K3XA 249LA 2ZWBA 1I20A 1D0MA 3TXKA 1OKSA 2L78A 1REMA 1OWYA 3ULRA 3FRIA 1L20A 1LPIA 1P46A 189LA 3A3QA 3HBHA 5HNLA 110LA 1KXXA 4LDOA 2CV2A 3L64A 4GMQA 4M9ZA 170LA 1B7PA 1BWJA 4CHXA 5FDJA 1PQDA 201LA 1PZYA 5I4WA 1AZFA 2YBIA 4MGIE 4WLYA 1SWYA 4GRIA 1L53A 1QQWA 1WGNA 3A46A 3J7AS 1OQMA 4IBCA 2XZFA 1C7PA 3NYAA 4PDIA 5E9RA 2CWBA 1SQ2L 2O4WA 3CDTA 1W5TA 4XN6A 1LZ8A 1X37A 2DAIA 3SAVA 147LA 2D4KA 4RLNA 3GQ5A 3FD9A 5LYZA 225LA 4FWGA 3GUOA 1AT5A 3DFZA 3SN6R 2APLA 3QWLA 1IN8A 3C8QA 3THGA 3RGSA 1QTHA 1T3PA 1JITA 1L82A 1R6BX 103LA 242LA 2I25L 3GUMA 256LA 2DNAA 1KXWA 1OV7A 3C7ZA 1EFUB 2K47A 4Z3MA 1PJQA 4IBKA 1GDXA 1XWIA 2CUUA 4DJHA 1D3JA 3KS8A 232LA 3TMWA 5HLLA 4OVZB 1B5ZA 1IY3A 2A7FA 1XFPL 1WVVA 1G41A 4DV5M 5HMVA 2IFFY 3A67Y 4L8RC 1L72A 4LJ9A 3OE8A 2RGOA 1ZMWA 4LJ4A 1VATA 2JNHA 3GLHE 1IOQA 2BQMA 1LI2A 4II7A 4GCEA 2R44A 1IP2A 1CJ7A 1HQYE 128LA 2OEAX 1CU5A 1JIYA 1GE3A 1L31A 3LW5F 4CFPA 1GL7A 1XXHB 2BLYA 1G06A 3GRVA 1FKVA 5LMNM 2H1RA 1DKKA 4ETBA 5B1FA 1L67A 4G4RA 4GBRB 3I04M 3WPKA 153LA 2B6WA 163LA 1EQ5A 5APEA 2YBJA 3RZEA 4ANRA 2R4JA 2QENA 2ZQ3A 2Z8YM 4KLNA 2FH0A 1L18A 1LZYA 5A3EA 2QP9X 5KXLA 3TWMA 4XJBA 1S3SA 3KFUG 1LYZA 1IY2A 260LA 1SXJD 2JY8A 3SB5A 4QY9A 251LA 1L38A 3GPXA 4JI2M 1OYUA 2UUAM 1SX2A 259LA 1VDTA 1C6QA 2G8LA 4H9IA 4J7VA 2ZTDA 1GF4A 4OW1A 1QSBA 3HJSA 3GLHA 1IORA 4BBAA 3WPLA 3AFHA 2ERCA 1LYJA 1QS9A 3SBAA 2LC9A 3HBDA 1YAQA 1YUBA 3UK6A 1CKDA 4W96A 1C6NA 3J6KA 3HZJA 3IG8A 2CHQA 1LZ4A 3F92A 5E26A 1HQCA 1PGYA 3LQRA 3HUAA 3FKEA 2VF7A 166LA 4DD9A 3G3WA 2DWZB 1PJSA 2FFJA 4LF9M 1DI5A 2B74A 2VIIA 2ANVA 1CNSA 4FCWA 211LA 4ITQA 4PJ2C 3FYDA 3W67A 2DBTA 3HTFA 2OOBA 1Q3BA 2F4VM 4I7RA 1LKRA 2MH8A 1QVRA 3CT0A 1NV8A 1L77A 3GXRA 3BOSA 1LZ5A 1L33A 3CSQA 152LA 4NEBA 2Z2EA 4AKHA 2BLXA 4RF1A 1BGIA 1R2YA 2UXDM 2BQCA 1YKYX 3G3VA 1XEJA 4KT3A 3AOGA 3PXGA 3WU7A 3RNXA 1D3FA 212LA 4NHIA 4FWDA 2BJVA 4DD2A 4WW0A 5KKJA 4RW1A 1JUGA 2KNVA 2EA0A 1J5EM 4P17A 2W1LA 4NHPA 1IN5A 1L84A 4XJGA 5M1YA 1XGQC 3G3BB 175LA 3ATOA 1QQYA 132LA 3TXJA 1HT1E 4DV7M 2OQ4A 4EKRA 2Y21A 4NC6A 4JXJA 2MEFA 1QT5A 4GHAA 5C6JA 2R45A 4DR2M 2Q0MX 3WULA 4HTNA 3DN0A 3DN3A 3GLGB 4Z6YA 1GF3A 1DYEA 1CU3A 1QSQA 4N9RA 4NGKA 1XNQM 4II8A 1LI6A 4F1IA 125LA 1QTBA 2HUMA 2RBRA 148LE 4NG8A 4H9AA 4Z46A 4L6V6 2YBMA 2ZTCA 1JTNA 1NVMA 2RSCA 3NBIA 190LA 4G4NA 1L28A 2W1XA 4ARQA 1CUPA 4GLAA 1L59A 2O79A 1G59A 1JJ0A 5BPVA 1PS5A 2J7NA 4H8ZA 1LSEA 4S0WA 208LA 5KQDA 3W6BA 3U61A 4Z98A 1A5TA 4G6ZA 143LA 1HEWA 4DR4M 4ETCA 3AZ6A 4DDAA 150LA 1VDDA 1QUDA 3TMVA 169LA 1NHEA 2R46A 3WXTA 1GAZA 4TUNA 2HAKA 1UIHA 1IN4A 4DWXA 1C08C 3I01M 2FBDA 5FTLA 1LSCA 2AHMA 3WXUA 3FE0A 1D2NA 1LPYA 245LA 1DGHB 4NL4H 2ZNXY 2FOIC 3J80S 4YEOA 1OUCA 2DHYA 2QNJA 3GLGA 3GLFE 1C6PA 1C61A 2F5QA 4RLMA 2BAAA 1C67A 3CSRA 2K6BA 1MU5A 3TMXA 145LA 4AQNA 3DN6A 1YIKA 2WSEF 1IIZA 1ZQ9A 2CWIA 2D4IA 4WM3A 1D6PA 1VDQA 4OVZA 4LGYA 1TDHA 123LA 1CKGA 3AJNA 3NY9A 2L09A 2D7EA 3L2XA 4I7KA 1T6OA 2KZSA 1L75A 2G4QA 4A7DA 1JPOA 1L93A 4ZEEA 1P2RA 1SSYA 3WL2A 1QTZA 4DV3M 1ZURA 4ETEA 1G0PA 1L86A 5KXZA 5ITXE 1T6VL 4PPOA 4R71A 142LA 1L00A 1E8LA 1NBZC 4XYYA 2BQJA 1GL6A 3KSXA 3SFZA 2CV1A 5J7CA 3KP0E 4LY6A 4MGKE 3HU8A 1YLAA 1HEOA 1VDSA 2BQDA 165LA 3L25A 1VFBC 218LA 2Z2FA 1XGPC 1KSFX 4HSFA 1D0KA 5LVJA 164LA 1QDTA 1JKBA 4Z8XA 4QNRA 4DQJA 5EQTA 2KW0A 1LOZA 2ZBKB 5KXKA 1EL1A 1JKAA 1LYGA 4HTKA 2VDBB 3W68A 1BB3A 2QPAA 5EJCA 2B6ZA 4LT2A 4NSRA 2UXBM 162LA 1GB9A 3AW6A 258LA 2BNKA 2OOAA 2JY5A 3A91A 2WARA 4RW2A 2WSFF 4IBIA 2J7OA 1XHBA 237LA 3EMSA 4H9BA 1TDZA 1LMQA 4LFCM 2R62A 1LSAA 2Z37A 4NGVA 2MEHA 7LYZA 1DYCA 5FSTA 1FJGM 1IBKM 1L73A 2KNZA 4LDLA 3Q8GA 1D0LA 1B7SA 4I0CA 1HFYA 3P64A 4KHPM 4E3UA 2XLJA 3A96A 4I7JA 1T97A 1LZBA 1OUAA 2V1CA 2Y20A 4QHTA 4ARQB 1LJ4A 2R65A 1LSGA 1IY1A 5LAGA 1B7NA 4DV1M 4F2LA 1JHLA 1IP3A 1L34A 222LA 4B3SM 4REZA 5H37D 1LHLA 1JB0F 4XGIA 4OU7A 3DZDA 4HV1A 1R2ZA 4OO9A 6LYZA 2YBLA 2EKSC 1L94A 5APFA 2RKOA 4LF8M 3T6UA 1QTCA 1CX6A 1IR7A 2HCBA 1G7HC 3A94A 4P2EA 2I7NA 1P6YA 1LJGA 226LA 1L79A 1CUKA 4LT3A 1VG5A 3AGHA 3U5ZB 1OWZA 4W59A 1SXJE 1CVKA 1L21A 4DD1A 3IECA 3W6DA 1LGXA 1E94E 3WPJA 4LZTA 5LVIA 1KW7A 2C9CA 3FTFA 4BLCA 167LA 4WO6A 3E21A 4NRWA 3LVVA 4W5WA 3A93A 2B70A 234LA 3FTDA 1P56A 3HT7A 5A2QS 1L56A 1O23A 4N1EI 5C6IA 4MB7A 1IWUA 4L15A 1IWXA 4PGJB 1GF7A 1L63A 3DKEX 1C60A 4DC4A 1FKQA 1IFYA 4W51A 3PNYA 3HHWA 1UIDA 3C58A 4L16A 4AQYM 215LA 2ANXA 1DYAA 1XJTA 2H9JA 3QAUA 4I8SA 1QT3A 2EO2A 1BWIA 1QTDA 3KS4A 3WVXA 3HH6A 5ITXA 1AIPC 1V7TA 1OUEA 5EP2A 2HL7A 2XH9A 1L1TA 3TXHA 3KOYE 2OTZX 1LZGA 3LHMA 1DI3A 2DQGY 2RBSA 1KIPC 1WTMA 1B5YA 4MGHA 5KXOA 2OU9A 1HEMA 3A6CY 4KO8A 5LXWA 1GJSA 1L07A 2LVOC 2RB2X 254LA 2CP8A 3RU5A 3L29A 1L96A 1L99A 5D5FA 4HEOA 4JYAM 154LA 4N1CC 193LA 3ZC7B 1I4WA 2LH0A 4JI0M 2FYCA 2JXNA 4GHLA 5DLAA 4X66M 5IT9S 1JTPL 4H9HA 3W0LB 149LA 1IWWA 2LZTA 2MECA 4WLXA 5EP3A 1IOTA 1HEPA 1G0QA 4NSJA 2BQNA 2MEIA 1EIJA 2D6BA 3HX3A 4WG7A 2DZOB 3T38A 3DA1A 2B6TA 112LA 2XF3A 1GBYA 1L0KA 1LJ3A 1B7QA 3T6PA 1NBYC 1C6EA 1Y8GA 1HFZA 1BVSA 1OQYA 102LA 3DN4A 3MGWA 1W08A 1B6IA 3R8FA 1Z55A 5DL9A 1LSPA 3DOAA 2QHOB 1IP7A 3A98B 3HUKA 1HERA 1NHBA 1QS5A 2DAGA 2F5PA 3TPZA 5F16A 261LA 137LA 1JEFA 1C6HA 1HEQA 2BWBA 1L66A 3M7GA 1IC4Y 1HMKA 1QUHA 1QIOA 1L06A 4DR7M 4PDGA 1LZSA 3LYZA 1GF6A 2B6YA 1IWYA 4WURA 3SB6A 3MHVC 1G3IA 1ZVYB 3TWLA 2YSSC 1B5UA 1BQLY 3B0KA 4LZMA 1OUIA 113LA 1FLQA 2LHMA 1L11A 2ZAOA 3WVYA 3N9AA 1L49A 3FUXA 1LZEA 210LA 2A4TA 3C7YA 5DN5A 1LZTA 2K9DA 1N75A 3GLIB 191LA 1REZA 1YL0X 1L8QA 207LA 2OO9A 3WHLA 5KXPA 2HHHM 4EXMA 4AXTA 1L37A 4YY3M 4WL7A 5EXXA 253LA 2ZIJA 2VF8A 2FNAA 3AZ5A 3HU3A 2QQ8A 1H6UA 1L02A 3C80A 1L13A 2HWJA 2F5OA 2OE4X 4EPFA 2RBOA 1TH4A 2X4AA 1OUGA 1MLCE 1L14A 4NGYA 1IXRC 3CF0A 2NQ8C 1HNZM 3A3RX 2XFSA 4PCZA 1LSMA 3GRRA 5APCA 3SAWA 1L44A 4MGYE 4B49A 1VDLA 4EKPA 4JI8M 4AKGA 1R5LA 1L08A 3FI7A 5AMYA 1AUAA 1QT7A 2R4EA 3ILKA 1GB2A 1IBLM 1OAIA 4IBJA 3OE9A 4NIJA 1DV0A 1L36A 4W58A 4I7PA 4NFVA 1K28A 1C63A 1VEJA 1HR0M 1B9OA 3W6CA 2HUBA 4QNMA 4A3VB 2L2DA 1OAOC 3HWSA 3K1JA 1GF5A 1LSBA 1XNRM 3WUAA 1L47A 3Q8XA 4GKJM 4KPMA 5KPZA 1TH3A 3VDPA 1JR3A 1NKHA 1C6DA 2Y0TA 4LJ6A 3IHPA 1TEWA 2MEBA 1OUFA 1GFGA 2UUCM 235LA 1E32A 2XFTA 3LVWA 1L60A 1UFZA 3CTWB 1V7SA 1G7IC 2HEDA 156LA 5F9UA 4XBOA 1GBOA 4RKUF 4RF0A 1NJFA 1L58A 1IP1A 1LMTA 3K92A 5I4XA 4ET8A 2A5YB 5EP1A 141LA 2DKLA 1XEPA 3U60A 2RAYX 184LA 1LYOA 1LV7A 1QT4A 196LA 2NTGA 178LA 4NGIA 1KY1A 1L74A 1YROA 3VK8A 1JTMA 1QDRA 2C9OA 5L3IA 1L40A 2WSCF 1L45A 1OUDA 3TMUA 2L4EA 2EUCA 5DFLA 5KPTA 3U6PA 2GV0A 4AW4A 1RJCB 3WUNA 3CF6E 1IOCA 4B3RM 1DYDA 129LA 1LZ1A 4FW9A 1L57A 5LIOA 3DMVA 120LA 4G9SA 3M3UA 1L50A 2PC2A 3CQLA 5IHGA 3K3TA 209LA 1D2WA 1N77A 5FSWA 4YOPA 2ZYPA 5HNCA 4WOAA 1LJFA 4W54A 173LA 5ITUA 195LA 2JZ1A 4LRSA 111LA 1GEVA 2F4GA 4GN4A 3I51A 4MGZE 1CV0A 240LA 2RBPA 4LYCA 4M9SA 1ORYB 4LZJA 1C62A 5KJ9A 3SB8A 5EXTA 3SATA 4K5YA 2KNAA 3SHFA 2EQLA 1HHLA 4Q7JA 1G7LC 1F6RA 3HJQA 1TTEA 1NNUC 1L35A 1LMOA 4WP2A 2HUKA 3FUWA 3HDEA 1CV5A 2LHCA 1XJUA 2RGHA 4IJEA 4BAPA 5ITQA 1H87A 1VDPA 4GCCA 3FE3A 2DWMA 5ILFA 3AW7A 3SYKA 3SC3A 3A90A 2Y8PA 3QE8A 2Y0QA 4B08A 4GCDA 1CU2A 133LA 4D81A 3F6ZA 1TBYA 1DI4A 4BAFA 185LA 2LVPC 3AOEA 4M4OA 1L91A 1TGUA 3CDQA 1XMOM 1DKJA 1CU6A 1B2KA 144LA 138LA 1ZWNA 3A45A 4NY5A 1LYIA 1G0KA 1OVHA 1GFTA 5L3HA 4W52A 2HULA 1G0MA 5KXMA 4M0WA 4B4JA 5DYGA 1IWZA 2W1YA 104LA 2XSZD 2HU1A 4G4CA 1UA6Y 1AT6A 3B74A 1FN5A 198LA 4W55A 1KYIA 3IJVA 1XXHE 1L61A 1CV1A 1EPYA 1L0JA 1XGRC 3UZUA 2H5ZA 1XXHA 5DM9A 3AJIB 3J7BA 3GLFA 1E9RA 3LN2A 3A42A 3U61B 1L62A 3W6AA 1WIVA 2OPFA 1IWTA 2B72A 1GFEA 118LA 1Q3CA 4N5RA 4HJYA 2UUBM 1WQPA 1DO0A 1QTKA 1IXZA 4G4OA 3HJ8A 1LJNA 3GO8A 1P37A 1P36A 1G71A 244LA 2KDLA 2I7PA 2HEEA 4NGJA 1N33M 206LA 3UJNA 2DAEA 4LFBM 4AI6A 5B05A 1VQ1A 1XEKA 1XB2B 1QAOA 1D6QA 2I6ZA 1HC0A 2DZLA 1Z6TA 1K82A 3GXKA 3EIEA 4B7FA 2X8AA 4O34A 3GLIE 3LQQA 8LYZA 3D3DA 2O5RA 3FA0A 5F3WA 4H92A 5IELA 2B7XA 1MJGM 1UCOA 1IY4A 4BB9A 1LJJA 4I7OA 4LYBA 4W56A 4N0JA 4R7GA 2XQOA 5F81A 3FUVA 2XEPA 1BB6A 3WH1A 3BKVA 3VWOA 1GFUA 4DQ5A 4HLQA 1G0GA 4LDEA 4WM4A 5IREB 3HH3A 5LAFA 1LSFA 1L85A 2F4AA 1GB7A 2QB0B 3L28A 1L10A 155LA 2NTHA 3VDUA 1L09A 1PQOA 1WTNA 1C6CA 3AV0A 1UACY 4DR6M 1QT6A 2A7DA 4IJ4A 3UMMA 3VLFB 1FBIX 1IN6A 1OP9B 3GPPA 1D3NA 255LA 9LYZA 5JENB 4QGZA 4GN3A 5EBHA 3BXWA 3T1HM 1L83A 5LYMA 2F2NA 3K9OA 4DV2M 5I53A 3WU9A 1GFJA 4FWHA 223LA 2Q2EB 3A8ZA 5LA8A 3N9CA 5LVKA 1QAQA 1L95A 3MJ5A 4XJDA 1IP4A 4WM1A 194LA 2DQDY 1HNLA 3LYOA 1XGUC 3BBZA 3GRUA 1ZV1A 2L7HA 1KNIA 1LJHA 4H8XA 1TH2A 188LA 2OTYX 4IJFA 1L64A 1QUTA 1YE9A 2FYDA 4GITA 2YQZA 3AZ4A 3SP3A 3QYBA 1IX0A 3AL0C 4MM3B 4LYTA 1IWVA 1TDYA 4IIWA 1ZMVA 1B5XA 2GQFA 2F5NA 4K0KM 1CKFA 219LA 1MN3A 262LA 2EPEA 1YAMA 2Z18A 3AB6A 3SHGB 5KXSA 2Z3XA 4IASA 2W82A 1QAMA 5I4YA 1BVXA 4RNAA 5F14A 3HT8A 1GKIA 187LA 1HENA 4C3WA 4NWEA 2VB1A 1V34A 4DUZM 1KS3A 2OU0X 2O7AA 2F47A 3TXBA 213LA 3HH5A 1ALCA 3WU8A 4CHTB 4FDYA 4GIPA 4NHSA 1L88A 2DQFC 3KOZE 1C6AA 1GFRA 4G3OA 3HTBA 3RT5X 1LWKA 1FLWA 4BS7A 5KXRA 1GE1A 1YAPA 1C10A 2G4PA 3N9EA 3B89A 3TWKA 3B7QA 4PRUA 4YENA 2DAKA 1CU0A 1L05A 1L2CA 2KRUA 1GLNA 1LZDA 4ZPXA 1JJ3A 220LA 2QSFX 1AKIA 2JWSA 1OUHA 2DAMA 1N34M 1LAAA 1I6SA 1C65A 114LA 1L32A 3PDSA 1YSYA 1LYFA 1GWDA 1LSNA 127LA 5L9JA 1N36M 1SSWA 4LG2A 1GABA 146LA 1FNNA 1JISA 1L89A 168LA 2MEEA 1F10A 1NWGA 4B7HA 151LA 4HL4A 4EMNA 4DKLA 1PQIA 2C8OA 4WO9A 2YDGA 3GLGE 2HEBA 2KEBA 4DD0A 3OK0A 3GLIA 3WW5A 4R0FA 4UWNA 4YEMA 1F4IA 4GEWA 2B6XA 217LA 3W3EA 5IWAM 2DI0A 2BQIA 1LSZA 3WHKA 3U5ZA 3TXIA 3HHZA 3RUNA 4N8ZA 4DDBA 3TXGA 3TXFA 4H9FA 1NSFA 4HPIA 1L29A 2MR9A 4HP0A 4EKQA 1J7KA 1UM8A 4KODA 1L19A 3J27B 3GPYA 1QANA 3VKGA 3QY4A 5II3A 2OU8A 1CKCA 3K9PA 1LCNA 4GC9A 1K3WA 1C6GA 2KXEA 3GP1A 1L81A 1QSWA 1XGTC 4L41A 3EXDA 1PQJA 3H4JA 1RFPA 5DYIA 4HJZA 134LA 5D5CA 4CGEA 3FTCA 3CDVA 1D9WA 1L76A 1HT2E 3AOEC 4TTDA 4JI5M 1C1KA 221LA 2BQEA 4EOFA 4CJ6A 4ARMA 1LTMA 3G3AB 2XSZA 3GLHB 3W0FA 5C18A 3HTDA 5KKIA 1L15A 3B72A 4XENA 1DYBA 1LWGA 5ITTA 2DQCY 2FS1A 5C1BA 2DQEY 171LA 2LNHC 1GO5A 1CJ9A 1LMPA 3B0IA 4WM6A 1GB6A 2OE9X 3HTGA 4LF7M 5LVHA 1IR9A 4I8OA 1IVMA 1L51A 4FCVA 1LSYA 3KP1E 229LA 246LA 1T6HA 1QUOA 4E97A 4LGMA 176LA 1LZ9A 1GE4A 2D7HA 1JTOL 1LMNA 2YFQA 5E4PA 3I4VA 4TX7A 2CV0A 1YL1X 3HT6A 4OOTA 1VEGA 1GVNA 5KXYA 3OE6A 3WUMA 2LZMA 2VQFM 1J1XY 1L52A 109LA 3U6LA 1NF5A 3JR4A 1RI8B 3DMZA 3B7ZA 5E6JA 1QYRA 4LF4M 2O01F 4QOSA 1C66A 4NSOB 1B7MA 3C8SA 3P68A 3CF2A 4DD3A 1C7YA 2H9KA 2LVNC 1A4VA 1LGUA 4D9ZA 2KRKA 1L12A 2ZANA 3VK7A 4UWUA 2WZJA 5IZ7D 1L22A 1LYSA 1HSWA 3KOXE 4YXCA 6LYTA 3LZTA 4IAPA 5I14A 3KAMA 1HNXM 2YR0A 228LA 1J09A 4BADA 3B9PA 3LYMA 1T43A 1BWHA 1GBZA 126LA 4HJVA 1IBMM 4PD2A 3V76A 4JI4M 3HHXA 3IJUA 1FLUA 1QT8A 2LHGA 4DDCA 1GFVA 1G0JA 1PQMA 5KXXA 1BB4A 3C3EA 3GUIA 5LA5A 1BHZA 3RW8A 1L54A 5FTMA 200LA 5HQ1A 1BB5A 1G4AE 3ZH9B 1GAYA 3QYEA 1IC5Y 3JR5A 4XJIA 4IBDA 4ML7A 1H6MA 1KY0A 2CE7A 2N5ZA 1C69A 4DQ7A 1DYFA 7LZMA 1YKXX 1D3MA 1LHHA 4LF5M 4GCFA 1QSAA 1YAOA 2V1UA 3R9XB 5FEKA 4NSIA 1NY6A 1KIQC 1IEEA 4R6CA 4CIZA 1Q39A 1G1VA 2X49A 3B7NA 1B7OA 241LA 1LSDA 1Z5CA 1IC7Y 1LYYA 1CTWA 1WQQA 2BQKA 4NGZA 4MH0E 2YBHA 3PBLA 1JKCA 3EBAB 2CEAA 1CV4A 2DHRA 2H5XA 4M9XA 3AZ7A 4ARLA 3L27A 4PT5A 4ZPUA 1DZBX 2F30A 3HU1A 1IXSB 1Z59A 1CJ8A 2ZM6M 1G0LA 4I7SA 2N35A 5FTNA 2F5SA 2LCBA 4LJ5A 3GULA 5KXTA 2LXEA 4TSCA 4IBFA 1GD6A 3SARA 250LA 159LA 1NNJA 2C8PA 2LVQD 4HTQA 1OV5A 3LCUA 4H9CA 4DAJA 4R3DA 3KW6A 4DUYM 3CDOA 1C6FA 3GQ3A 2CFOA 157LA 2RH1A 3FUUA 5ITRA 238LA 3E3DA 5T3FA 5DN4A 1LJKA 2R0IA 1LZ6A 1YKZX 4H8YA 1GE2A 2DVWB 1JKDA 2ZIKA 2JZ0A 1JWRA 1L1ZA 3LYTA 3J81S 1B7LA 1TR8A 1OUBA 3ZEKA 3U6EA 1HFXA 5FELA 4YXAC 1KW5A 1JSEA 3NY8A 3E9SA 2Z7JA 1B0DA 5FCPA 4QDNA 4LYMA 3HWLA 247LA 2GNOA 1XSFA 1PJIA 239LA 1OJLA 1WQNA 1IQPA 3NWLA 177LA 2X0AA 3HHYA 1PQKA 192LA 1D9UA 4JI1M 1CJ6A 3OTOM 1L03A 224LA 1G7JC 1UIAA 1L17A 4TWSA 4LFPA 1REYA 4J1BA 4H9EA 1C6LA 1IN7A 4DD7A 3F8VA 1L04A 4LT1A 5C6LA 4LF6M 1BVKC 3AKZA 2C5RA 1LZCA 4H94A 3VKHA 4AKIA 2D91A 4OWBA 4X3BA 2F2QA 3V2WA 4HPEA 4FCTA 3D4SA 1IR8A 1J1PY 4CFOA 3M18B 1C68A 3T15A 1L25A 1LZRA 1L42A 1OVJA 2FE8A 3FADA 2CDSA 1UIGA 5FLXS 216LA 3WW6A 1GPQC 3U6QA 1L43A 4CISA 1UC0A 2VQEM 1HSXA 174LA 2R18A 4I4LA 4WL6A 4GLVA 1WJ7A 3P66A 4DR1M 1GB0A 4JI3M 2AUBA 3SBBC 2DQIY 3C9PA 3E46A 1GB3A 4G4BA 2DXIA 1G8PA 3TQSA 1MX0A 2HU3A 3WYHA 2D7GA 1XMQM 2B73A 4B7GA 4OW0A 1IOSA 2CHGA 3MMPA 1JQJC 2B75A 4U3XB 1DGHA 257LA 1L23A 3FYCA 1Z5AA 3D8BA 3OJPA 4H1PA 1OTRA 1DGBA 2HEFA 3SYLA 2K0BX 3TL4X 4LGKA 4DT3A 4AGAA 1DQJC 1Q02A 4IBBA 5FTKA 4OX9M 1YQVY 1UIEA 1B5VA 8CATA 1C46A 4L78A 199LA 2MROB 3OE0A 1LHKA 5BR8M 1C6BA 2BQBA 3NBXX 5LINA 2CRUA 4LRTA 230LA 2YNMD 1LYDA 2M60A 4DR3M 2QCUA 4AZFA 2ZQ4A 2EJSA 3PVSA 2Z4RA 3HH4A 1WGLA 4ARMB 3C83A 1WHCA 3CT1A 2BQFA 5JI3E 1L26A 4NSGA 1F6SA 2UXCM 4JI6M 2L4FA 1WQRA 3QNGA 1SG9A 3UGJA 4LJ7A 1WVUA 236LA 5B59A 2LTUA 1WQMA 197LA 2MJ5B 1GBXA 1GB8A 1CKHA 1HNWM 1L2BA 4IBEA 4G4QA 2QARC 1YILA 4B4EA 1LI3A 2RBNA 4WM5A 1IP6A 2Z38A 2DWNA 1GXV2 1CV3A 4KL7A 4HV2A 2LZ2A 1KFVA 3LMMA 1WQOA 2W1MA 6LZMA 1LKSA 2O25A 4DV4M 227LA 3U6MA 4ET9A 4P16A 1W5SA 3C81A 1SLYA 2BQOA 2I26L 1J1OY 3B0OA 1T8AA 4DR5M 4NGWA 1SXJA 3GUKA 3TXEA 4I7NA 1L70A 2HTXA 4EIWA 3L2AA 2HEAA 4NGLA 4DV6M 2BJWA 4FVMA 1C43A 2OE7X 2Z6BA 130LA 2Q9DA 1RCMA 4NHTA 3HU9A 5B06A 1Z5BA 4MR1A 4CGYB 4XADA 4KXIA 1UUZC 4JI7M 2JUJA 5KY1A 183LA 2C96A 4KT0F 4NRVA 1HELA 1P3NA 1QZEA 4I5SA 1L55A 1SXJB 1L65A 1L46A 4NXNM 1TCYA 3CDRA 3U6OA 1ZMUA 139LA 4WMGA 1EQ4A 2FBBA 4OOOA 1TAYA 5EXSA 4H93A 1NMMA 1LZNA 5EXPA 1GXXA 1CV6A 3KDSE 3QAKA 3T36A 2IHLA 5IDDA 2DQJY 1L87A 1IM2A 1MELL 1C6KA 5B07A 2BQAA 2G3QA 2RB1X 1HMLA 4UWVA 4LT0A 4PJZA 1DXJA 5LVGA 3U60B 2ZILA 3GQ4A 3V2YA 2ZAMA 2Q9EA 5LYTA 3SMSA 3H4MA 3LZMA 1XC8A 1C6MA 2BWEA 5FHWA 1FLYA 1T8GA 3J4GA 3RGPA 2CGIA 5KXWA 4GN5C 1ZAEA 1YANA 2DQAA 1GFHA 1I56A 4YF2A 5I54A 1W6ZA 3JR6A 2DWLA 3VW7A 4WLDA 4TSBA 1P5CA 3HT9A 2HECA 1B5WA 1VEKA 4B3TM 3HDFA 108LA 4LFAM 4NSHA 4LCBA 3GLFB 3FTEA 4NGOA 4JN6A 2MEAA 7CATA 4PRQA 1EQEA 3T1YM 4B1AA 1R7RA 5EP4A 2E5LM 1L92A 4JV5M 2EKFA 4MSTA 3K2LA 4M0DA 1C6TA 180LA 181LA 4NHQA 2J5YA 1KIRC 2MEGA 3SMPA 4WLTA 4Z41A 2DENA 3K8ZA 4YM8A 4D82A 3UONA 2UU9M 1L98A 1L48A 3AGGG 2ZNWY 3GUPA 4ZFPA 2BQLA 1ZMYL 2XTHA 1REXA 1QTVA 1IO5A 2Z19A 2M5ZA 3HBEX 4H90A 3HU2A 1JSFA 3A6BY 2LVAA 3GRYA 1ZYTA 2KA6B 5K7OA 3U6SA 1P7SA 1C6IA 1HF4A 5DNYA 1IY0A 1LHJA 1A2YC 4Y28F 5LMUM 3TXDA 1L27A 4LJ8A 2JA2A 4RDSA 5KQ8A 1VEDA 4GC5A 4LYOA 1OFHA 1GFAA 2RB0X 4NOOB 160LA 3A34A 4H91A 1P3QQ 1GF9A 4NG1A 1L97A 1NDMC 2HKJA 2B5ZA 131LA 1PJTA 1JTTL 3ODUA 1OIZA 4TUWA 1OFIA 2L7IA 1QZMA 3LCVB 4X62M 4ETAA 4NWHA 1LMAA 3CSZA 1L24A 1L16A 2LYZA 1VAUA 4GCBA 4OWCA 4AG6A 1TLAA 3PNVA 5ITYA 3C3DA 1T3TA 1LZAA 1V92A 2RBQA 2IGCA 3CT5A 3L26A 3HGIA 233LA 3DN2A 5ILCA 2ZYCA 4LYZA 1PRBA 2KZUA 4J1AA 3HUQA 3CGWA 3IG5A 1UICA 2Z4SA 243LA 3SAUA 1OUJA 1L68A 1TF0B 4I7TA 5I5QA 2RRUA 1LGWA 2L6OA 1E9SA 5A3ZA 3DN1A 3C82A 4EJ4A 1GHLA 1GF0A 4OWHA 3ZVQA 1F0WA 3GPUA 3BKHA 2R6FA 2MEDA 4LJAA 1WXQA 1LMCA 1ZV5L 3GUJA 1L30A 4GKKM 4AG5A 4UN2B 4G49A 4ETDA 5HMJA 2JY7A 3P65A 4XJFA 1EE8A 1QTEA 5APDA 3VFDA 1INUA 2DKVA 3KVWA 2D4JA 3K2RA 1GF8A 2EIZC 4NXMM 1LYHA 1DGFA 5KO3A 4M6DA 2CHVA 1RE2A 3SB9A 1P2LA 1T8FA 1KXYA 3ZVQB 3PFIA 3W6FA 3EIHA 1L41A 107LA 1IXSA 3RZ4A 4D80A 1GFKA 4X65M 2XGNA 4OWAA 1NQIA 214LA 3AYQA 1XEIA 4C5FA 4FJRA 3EO5A 4ARPA 3DNAA 1QUGA 5KPRA 135LA 1P64A 2BQHA 3FI5A 1PJJA 4G4HA 4W94A 3RFWA 2BPUA 2B3TA 3A92A 5LZMA 4WM2A 3CB7A 2Z39A 4QOZC 4IATA 5L8RF 1AM7A 3U6DA 4I7LA 2C99A 1N32M 3B6LA 1L2DA 1JR3E 3DN8A 4DV0M 4W57A 3J2PB 4OWEA 1BB7A 1P2CC 1L90A 4XK8F 4PK0A 3SASA 3MK6A 1G7MC 1OVKA 119LA 1GBWA 4W53A 1IP5A 1N4FA 1LLHA 5GKNA 2LBCA 2LWXA 3D9AC 1NHWC 1V33A 2XZUA 2QBYB 3C7WA 1I94M 205LA 1JR3D 1N78A 1WTHA 3HFMY 2P5TA 2YBNA 4EKSA 2YVBA 3F9LA 1LYEA 3C8RA 1LJIA 3EMLA 4GRVA 4DYGA 1C45A 2CJLA 2EKKA 1LHIA 4B3MM 4ZIXA 1DGGA 4L4UA 3KXEC 1C6JA 1SXJC 1DPWA 2LYMA 3KOWE 2G4NA 1GEZA 4XJHA 2F32A 1DO2A 3A95A 1GE0A 4EPIA 2RAZX 2NWDX 4YX7C 2QBYA 1CUQA 1UIFA 3SBJA 182LA 1ZVHL 4X64M 3I4YA 1SWZA 3ZCBB 3E4RA 2KHHA 1L80A 1C64A 1NJGA 1G07A
chains in the Genus database with same CATH topology
248LA 115LA 1LW9A 252LA 4WG1A 231LA 1CX7A 1GDWA 3IWRA 3DMXA 2LYOA 3LZ2A 1L71A 2XBSA 2XBRA 2DQHY 3GUNA 4LFXA 3W6EA 161LA 1L39A 5F9XA 1DPXA 1UBZA 1FDLY 172LA 1D2YA 1L01A 4I7MA 4J0LA 3P4ZA 4PHIA 4CJ2A 1LJEA 1QUSA 4QEQA 1I1ZA 4I7QA 2Z12A 2XJWA 1SX7A 122LA 3AGIA 4MCKA 3ATNA 186LA 4ARJA 1LHMA 1DYGA 1UIBA 1JQUA 2BQGA 1GB5A 4B0DA 158LA 1B7RA 1GBSA 4B4IA 3WMKA 1G1WA 1JJ1A 3SB7A 3G3XA 5KXNA 1NDGC 140LA 1L69A 5B1GA 249LA 2ZWBA 1I20A 1D0MA 3TXKA 2L78A 1REMA 1OWYA 3ULRA 1LPIA 1L20A 1P46A 189LA 3A3QA 3HBHA 5HNLA 110LA 1KXXA 4LDOA 3L64A 170LA 1B7PA 1BWJA 4CHXA 5FDJA 1PQDA 201LA 1PZYA 5I4WA 1AZFA 2YBIA 4WLYA 1SWYA 1L53A 1OQMA 1C7PA 3NYAA 5E9RA 1SQ2L 2O4WA 3CDTA 4XN6A 1LZ8A 147LA 2D4KA 4RLNA 5LYZA 225LA 3GUOA 1AT5A 3SN6R 3C8QA 1QTHA 1T3PA 1JITA 1L82A 103LA 242LA 2I25L 3GUMA 256LA 1KXWA 1OV7A 3C7ZA 4Z3MA 1GDXA 4DJHA 2CUUA 1D3JA 3TMWA 232LA 5HLLA 1B5ZA 1IY3A 2A7FA 1XFPL 1WVVA 5HMVA 2IFFY 3A67Y 1L72A 3OE8A 1VATA 1IOQA 2BQMA 1LI2A 4GCEA 1IP2A 1CJ7A 128LA 2OEAX 1CU5A 1JIYA 1GE3A 1L31A 4CFPA 2BLYA 1G06A 1FKVA 1DKKA 4ETBA 5B1FA 1L67A 4GBRB 3WPKA 153LA 2B6WA 163LA 1EQ5A 5APEA 2YBJA 3RZEA 4ANRA 2ZQ3A 1LZYA 1L18A 5A3EA 5KXLA 4XJBA 1LYZA 260LA 3SB5A 4QY9A 251LA 1L38A 1OYUA 259LA 1SX2A 1VDTA 1C6QA 4H9IA 4J7VA 1GF4A 4OW1A 1QSBA 1IORA 3WPLA 1LYJA 1QS9A 3SBAA 2LC9A 3HBDA 1YAQA 1CKDA 4W96A 1C6NA 3J6KA 1LZ4A 3HUAA 166LA 4DD9A 3G3WA 1DI5A 2B74A 2ANVA 1CNSA 211LA 4PJ2C 2DBTA 3HTFA 4I7RA 1LKRA 3CT0A 1L77A 3GXRA 1LZ5A 1L33A 3CSQA 152LA 4NEBA 2Z2EA 2BLXA 1BGIA 2BQCA 1YKYX 3G3VA 1XEJA 4KT3A 3WU7A 3RNXA 1D3FA 212LA 4NHIA 4DD2A 5KKJA 4RW1A 1JUGA 2W1LA 4NHPA 1L84A 4XJGA 5M1YA 1XGQC 3G3BB 175LA 3ATOA 1QQYA 132LA 3TXJA 4EKRA 2MEFA 1QT5A 5C6JA 2Q0MX 3WULA 4HTNA 3DN0A 3DN3A 1GF3A 1DYEA 1CU3A 4NGKA 4N9RA 1QSQA 4II8A 1LI6A 125LA 1QTBA 2HUMA 2RBRA 148LE 4NG8A 4H9AA 4Z46A 2YBMA 1JTNA 2RSCA 190LA 1L28A 2W1XA 4ARQA 1CUPA 4GLAA 1L59A 2O79A 1JJ0A 1PS5A 4H8ZA 1LSEA 4S0WA 208LA 3W6BA 4Z98A 143LA 1HEWA 4ETCA 3AZ6A 4DDAA 150LA 1QUDA 3TMVA 169LA 1NHEA 3WXTA 1GAZA 4TUNA 1UIHA 4DWXA 1C08C 2FBDA 1LSCA 3WXUA 3FE0A 1LPYA 245LA 2ZNXY 4YEOA 1OUCA 1C6PA 1C61A 4RLMA 2BAAA 1C67A 3CSRA 3TMXA 145LA 4AQNA 3DN6A 1YIKA 1IIZA 2CWIA 2D4IA 4WM3A 1D6PA 1VDQA 123LA 1CKGA 3AJNA 3NY9A 3L2XA 4I7KA 1L75A 2G4QA 4A7DA 1JPOA 1L93A 4ZEEA 1P2RA 1SSYA 3WL2A 1QTZA 1ZURA 4ETEA 1G0PA 1L86A 5KXZA 1T6VL 4PPOA 142LA 1L00A 1E8LA 1NBZC 4XYYA 2BQJA 5J7CA 3HU8A 1HEOA 1VDSA 2BQDA 165LA 1VFBC 218LA 2Z2FA 1XGPC 4HSFA 1D0KA 5LVJA 164LA 1QDTA 1JKBA 4DQJA 1LOZA 5KXKA 1EL1A 1JKAA 1LYGA 4HTKA 1BB3A 2B6ZA 4LT2A 162LA 1GB9A 3AW6A 258LA 3A91A 2WARA 4RW2A 237LA 3EMSA 4H9BA 1LMQA 1LSAA 2Z37A 4NGVA 2MEHA 7LYZA 1DYCA 5FSTA 1L73A 4LDLA 1D0LA 1B7SA 4I0CA 1HFYA 3P64A 4E3UA 3A96A 4I7JA 1T97A 1LZBA 1OUAA 4ARQB 1LJ4A 1LSGA 5LAGA 1B7NA 1JHLA 1IP3A 1L34A 222LA 1LHLA 4HV1A 4OO9A 6LYZA 2YBLA 2EKSC 1L94A 5APFA 3T6UA 1QTCA 1CX6A 1IR7A 1G7HC 3A94A 4P2EA 1P6YA 1LJGA 226LA 1L79A 4LT3A 3AGHA 1OWZA 4W59A 1CVKA 1L21A 4DD1A 3W6DA 1LGXA 3WPJA 4LZTA 5LVIA 1KW7A 167LA 4WO6A 3A93A 2B70A 234LA 1P56A 3HT7A 1L56A 1O23A 4N1EI 5C6IA 1IWUA 1IWXA 4PGJB 1GF7A 1L63A 3DKEX 1C60A 4DC4A 1FKQA 4W51A 1UIDA 2ANXA 215LA 1DYAA 1XJTA 2H9JA 4I8SA 1QT3A 1BWIA 1QTDA 3WVXA 3HH6A 1V7TA 1OUEA 3TXHA 2OTZX 1LZGA 3LHMA 1DI3A 2DQGY 2RBSA 1KIPC 1WTMA 1B5YA 5KXOA 2OU9A 1HEMA 3A6CY 5LXWA 1L07A 2RB2X 254LA 3RU5A 1L96A 1L99A 5D5FA 154LA 4N1CC 193LA 2FYCA 5DLAA 1JTPL 4H9HA 149LA 1IWWA 2LZTA 2MECA 4WLXA 1IOTA 1HEPA 1G0QA 4NSJA 2BQNA 2MEIA 2D6BA 4WG7A 2B6TA 112LA 1GBYA 1L0KA 1LJ3A 1B7QA 1NBYC 1C6EA 1HFZA 102LA 3DN4A 3MGWA 1W08A 1B6IA 5DL9A 1Z55A 1LSPA 1IP7A 3HUKA 1HERA 1NHBA 1QS5A 5F16A 261LA 137LA 1JEFA 1C6HA 1HEQA 1L66A 1IC4Y 1HMKA 1QUHA 1QIOA 1L06A 1LZSA 3LYZA 1GF6A 2B6YA 1IWYA 3SB6A 1ZVYB 2YSSC 1B5UA 1BQLY 3B0KA 4LZMA 1OUIA 113LA 1FLQA 2LHMA 1L11A 3WVYA 3N9AA 1L49A 1LZEA 210LA 2A4TA 3C7YA 5DN5A 1LZTA 191LA 1REZA 1YL0X 207LA 5KXPA 4EXMA 4AXTA 1L37A 4WL7A 253LA 2ZIJA 3AZ5A 1L02A 3C80A 1L13A 2OE4X 4EPFA 2RBOA 1OUGA 1MLCE 1L14A 4NGYA 3A3RX 1LSMA 5APCA 1L44A 4B49A 4EKPA 1L08A 3FI7A 5AMYA 1QT7A 1GB2A 3OE9A 4NIJA 1L36A 4W58A 4I7PA 4NFVA 1K28A 1C63A 1B9OA 3W6CA 2HUBA 1GF5A 1LSBA 3WUAA 1L47A 4KPMA 1NKHA 1C6DA 1TEWA 2MEBA 1OUFA 1GFGA 235LA 1L60A 2HEDA 1V7SA 1G7IC 156LA 5F9UA 1GBOA 1L58A 1IP1A 1LMTA 5I4XA 4ET8A 141LA 1XEPA 2RAYX 184LA 1LYOA 1QT4A 2NTGA 196LA 178LA 4NGIA 1KY1A 1L74A 1YROA 1JTMA 1QDRA 5L3IA 1L40A 1OUDA 1L45A 3TMUA 2GV0A 1RJCB 3WUNA 1IOCA 1DYDA 129LA 1LZ1A 1L57A 5LIOA 4G9SA 120LA 3DMVA 3M3UA 1L50A 2PC2A 3CQLA 5IHGA 3K3TA 209LA 1D2WA 4YOPA 2ZYPA 5HNCA 4WOAA 1LJFA 4W54A 173LA 195LA 1GEVA 111LA 4GN4A 2F4GA 1CV0A 240LA 2RBPA 4LYCA 5KJ9A 1C62A 3SB8A 4K5YA 2EQLA 1HHLA 1G7LC 1F6RA 1L35A 1LMOA 2HUKA 3HDEA 1CV5A 1XJUA 4BAPA 1H87A 1VDPA 4GCCA 5ILFA 3AW7A 3A90A 2Y8PA 3QE8A 4GCDA 1CU2A 133LA 3F6ZA 1TBYA 1DI4A 4BAFA 185LA 4M4OA 1L91A 3CDQA 1DKJA 1CU6A 1B2KA 144LA 138LA 1ZWNA 4NY5A 1LYIA 1G0KA 1OVHA 1GFTA 5L3HA 4W52A 2HULA 1G0MA 5KXMA 4B4JA 1IWZA 2W1YA 104LA 2HU1A 4G4CA 1UA6Y 1AT6A 1FN5A 198LA 4W55A 3IJVA 1L61A 1CV1A 1EPYA 1L0JA 1XGRC 2H5ZA 5DM9A 3LN2A 1L62A 3W6AA 1IWTA 2B72A 1GFEA 118LA 4N5RA 4HJYA 1WQPA 1QTKA 1LJNA 1P37A 1P36A 244LA 2HEEA 4NGJA 206LA 5B05A 1XEKA 2I6ZA 1D6QA 1HC0A 3GXKA 4O34A 8LYZA 3D3DA 3FA0A 4H92A 5IELA 2B7XA 1UCOA 1IY4A 1LJJA 4I7OA 4LYBA 4W56A 4N0JA 2XQOA 5F81A 1BB6A 3WH1A 3BKVA 3VWOA 1GFUA 4DQ5A 1G0GA 4LDEA 4WM4A 3HH3A 5LAFA 1LSFA 1L85A 2F4AA 1GB7A 2QB0B 1L10A 155LA 2NTHA 1L09A 1PQOA 1WTNA 1C6CA 1UACY 1QT6A 2A7DA 4IJ4A 1FBIX 1OP9B 1D3NA 255LA 9LYZA 5JENB 4QGZA 4GN3A 5EBHA 5LYMA 1L83A 2F2NA 5I53A 3WU9A 1GFJA 5LA8A 223LA 3A8ZA 5LVKA 3N9CA 1L95A 4XJDA 1IP4A 4WM1A 194LA 2DQDY 1HNLA 3LYOA 1XGUC 1KNIA 1LJHA 4H8XA 188LA 2OTYX 1L64A 1QUTA 2FYDA 3AZ4A 3SP3A 1IX0A 4LYTA 1IWVA 1TDYA 1B5XA 1CKFA 219LA 262LA 2EPEA 1YAMA 2Z18A 3AB6A 5KXSA 4IASA 5I4YA 1BVXA 5F14A 3HT8A 187LA 1HENA 4C3WA 4NWEA 2VB1A 1KS3A 2OU0X 2O7AA 2F47A 3TXBA 213LA 3HH5A 1ALCA 3WU8A 4FDYA 4NHSA 1L88A 2DQFC 1C6AA 1GFRA 3HTBA 3RT5X 1LWKA 1FLWA 4BS7A 5KXRA 1GE1A 1YAPA 1C10A 2G4PA 3N9EA 4PRUA 4YENA 1CU0A 1L05A 1LZDA 1JJ3A 220LA 1AKIA 1OUHA 1LAAA 1I6SA 1C65A 114LA 1L32A 3PDSA 1LYFA 1GWDA 1LSNA 127LA 5L9JA 1SSWA 146LA 1JISA 1L89A 168LA 2MEEA 1F10A 1NWGA 151LA 4EMNA 4DKLA 1PQIA 2C8OA 4WO9A 2YDGA 2HEBA 4DD0A 3OK0A 3WW5A 4R0FA 4UWNA 4YEMA 2B6XA 217LA 3W3EA 2BQIA 1LSZA 3TXIA 3RUNA 4N8ZA 4DDBA 3TXGA 3TXFA 4H9FA 4HPIA 1L29A 4HP0A 4EKQA 1L19A 5II3A 3QY4A 2OU8A 1CKCA 1LCNA 1C6GA 1L81A 1QSWA 1XGTC 4L41A 3EXDA 1PQJA 1RFPA 4HJZA 134LA 5D5CA 4CGEA 3CDVA 1D9WA 1L76A 4TTDA 221LA 2BQEA 4EOFA 4ARMA 1LTMA 3G3AB 3HTDA 5KKIA 1L15A 3B72A 4XENA 1DYBA 1LWGA 2DQCY 2DQEY 171LA 1CJ9A 1LMPA 3B0IA 4WM6A 1GB6A 2OE9X 3HTGA 5LVHA 1IR9A 1IVMA 1L51A 1LSYA 229LA 246LA 1T6HA 1QUOA 4E97A 176LA 1LZ9A 1GE4A 1JTOL 1LMNA 5E4PA 4TX7A 1YL1X 3HT6A 4OOTA 5KXYA 3OE6A 3WUMA 2LZMA 1J1XY 1L52A 109LA 1NF5A 1RI8B 3DMZA 1C66A 1B7MA 3P68A 3C8SA 4DD3A 2H9KA 1A4VA 1LGUA 4D9ZA 1L12A 4UWUA 1L22A 1LYSA 1HSWA 4YXCA 6LYTA 3LZTA 4IAPA 5I14A 3KAMA 228LA 4BADA 3LYMA 1BWHA 1GBZA 126LA 4HJVA 3IJUA 1FLUA 1QT8A 4DDCA 1GFVA 1G0JA 1PQMA 5KXXA 1BB4A 3GUIA 5LA5A 1BHZA 3RW8A 1L54A 200LA 5HQ1A 1BB5A 1GAYA 1IC5Y 4XJIA 4ML7A 1H6MA 1KY0A 2N5ZA 1C69A 4DQ7A 1DYFA 7LZMA 1YKXX 4GCFA 1D3MA 1LHHA 1QSAA 1YAOA 5FEKA 4NSIA 1KIQC 1IEEA 4R6CA 1G1VA 1B7OA 241LA 1LSDA 1IC7Y 1LYYA 1CTWA 1WQQA 2BQKA 4NGZA 2YBHA 3PBLA 1JKCA 3EBAB 1CV4A 4ARLA 3AZ7A 4ZPUA 1DZBX 2F30A 1CJ8A 1G0LA 4I7SA 2LCBA 3GULA 5KXTA 4TSCA 1GD6A 250LA 159LA 2C8PA 4HTQA 1OV5A 4H9CA 4DAJA 3CDOA 1C6FA 157LA 2RH1A 3E3DA 238LA 5T3FA 5DN4A 1LJKA 1LZ6A 1YKZX 4H8YA 1GE2A 2ZIKA 1JKDA 3LYTA 1JWRA 1B7LA 1OUBA 3ZEKA 1HFXA 5FELA 4YXAC 1KW5A 1JSEA 3NY8A 1B0DA 5FCPA 4QDNA 4LYMA 3HWLA 247LA 1XSFA 239LA 1WQNA 177LA 2X0AA 1PQKA 192LA 1D9UA 1CJ6A 1L03A 224LA 1G7JC 1UIAA 1L17A 4TWSA 4LFPA 1REYA 4J1BA 4H9EA 1C6LA 4DD7A 3F8VA 1L04A 4LT1A 5C6LA 1BVKC 1LZCA 4H94A 2D91A 4OWBA 4X3BA 2F2QA 3V2WA 4HPEA 3D4SA 1IR8A 1J1PY 4CFOA 3M18B 1C68A 1L25A 1LZRA 1L42A 1OVJA 3FADA 2CDSA 1UIGA 216LA 3WW6A 1GPQC 1L43A 1UC0A 1HSXA 174LA 4WL6A 4GLVA 3P66A 1GB0A 2AUBA 3SBBC 2DQIY 1GB3A 4G4BA 2HU3A 3WYHA 2B73A 1IOSA 2B75A 4U3XB 257LA 1L23A 3OJPA 4H1PA 2HEFA 4LGKA 4DT3A 4AGAA 1DQJC 1YQVY 1UIEA 1B5VA 1C46A 199LA 3OE0A 1LHKA 1C6BA 2BQBA 5LINA 230LA 1LYDA 2ZQ4A 3HH4A 4ARMB 3C83A 3CT1A 2BQFA 1L26A 4NSGA 1F6SA 1WQRA 3QNGA 1WVUA 236LA 5B59A 1WQMA 197LA 1GBXA 1GB8A 1CKHA 2QARC 1YILA 4B4EA 1LI3A 2RBNA 4WM5A 1IP6A 2Z38A 1GXV2 1CV3A 4KL7A 4HV2A 2LZ2A 2W1MA 1WQOA 6LZMA 1LKSA 227LA 4ET9A 3C81A 1SLYA 2BQOA 2I26L 1J1OY 3B0OA 1T8AA 4NGWA 3GUKA 3TXEA 4I7NA 1L70A 2HTXA 2HEAA 4NGLA 1C43A 2OE7X 2Z6BA 130LA 2Q9DA 1RCMA 4NHTA 3HU9A 5B06A 4MR1A 4XADA 4KXIA 1UUZC 5KY1A 183LA 1HELA 1P3NA 1L55A 1L65A 1L46A 1TCYA 3CDRA 4WMGA 139LA 1EQ4A 2FBBA 4OOOA 1TAYA 4H93A 1NMMA 1LZNA 1GXXA 1CV6A 3QAKA 3T36A 2IHLA 5IDDA 2DQJY 1L87A 1MELL 1C6KA 5B07A 2BQAA 2RB1X 1HMLA 4UWVA 4LT0A 4PJZA 1DXJA 5LVGA 2ZILA 3V2YA 2Q9EA 5LYTA 3LZMA 1C6MA 5FHWA 1FLYA 1T8GA 3J4GA 2CGIA 5KXWA 4GN5C 1YANA 2DQAA 1GFHA 1I56A 4YF2A 5I54A 1W6ZA 3JR6A 3VW7A 4WLDA 4TSBA 1P5CA 3HT9A 2HECA 1B5WA 3HDFA 108LA 4NSHA 4NGOA 2MEAA 4PRQA 4B1AA 1EQEA 1L92A 4MSTA 1C6TA 180LA 181LA 4NHQA 1KIRC 2MEGA 4WLTA 4Z41A 4YM8A 3UONA 1L98A 1L48A 3AGGG 2ZNWY 3GUPA 4ZFPA 2BQLA 1ZMYL 2XTHA 1REXA 1QTVA 1IO5A 2Z19A 3HBEX 4H90A 1JSFA 3A6BY 1ZYTA 5K7OA 1P7SA 1C6IA 1HF4A 1LHJA 1A2YC 3TXDA 1L27A 4RDSA 1VEDA 4LYOA 1GFAA 2RB0X 160LA 3A34A 4H91A 4NG1A 1GF9A 1L97A 1NDMC 2B5ZA 131LA 1JTTL 3ODUA 4ETAA 4NWHA 1LMAA 3CSZA 1L24A 1L16A 2LYZA 1VAUA 4GCBA 4OWCA 1TLAA 1LZAA 2RBQA 2IGCA 3CT5A 233LA 3DN2A 5ILCA 2ZYCA 4LYZA 4J1AA 3HUQA 1UICA 243LA 1OUJA 4I7TA 1L68A 5I5QA 1LGWA 5A3ZA 3DN1A 3C82A 4EJ4A 1GHLA 1GF0A 4OWHA 3ZVQA 1F0WA 3BKHA 2MEDA 1LMCA 1ZV5L 3GUJA 1L30A 4G49A 4ETDA 5HMJA 3P65A 4XJFA 1QTEA 5APDA 1INUA 2DKVA 2D4JA 3K2RA 1GF8A 2EIZC 1LYHA 4M6DA 1RE2A 3SB9A 1P2LA 1T8FA 1KXYA 3ZVQB 3W6FA 1L41A 107LA 3RZ4A 1GFKA 4OWAA 1NQIA 214LA 3AYQA 1XEIA 4C5FA 4FJRA 3EO5A 4ARPA 3DNAA 1QUGA 135LA 1P64A 2BQHA 3FI5A 4G4HA 4W94A 2BPUA 3A92A 5LZMA 4WM2A 3CB7A 2Z39A 4IATA 1AM7A 4I7LA 3B6LA 3DN8A 4W57A 4OWEA 1BB7A 1P2CC 1L90A 4PK0A 1G7MC 1OVKA 119LA 1GBWA 4W53A 1IP5A 1N4FA 1LLHA 3D9AC 3C7WA 205LA 1WTHA 3HFMY 2YBNA 4EKSA 2YVBA 3F9LA 1LYEA 3C8RA 1LJIA 3EMLA 4GRVA 4DYGA 1C45A 2CJLA 1LHIA 4ZIXA 1C6JA 1DPWA 2LYMA 2G4NA 1GEZA 4XJHA 2F32A 3A95A 1GE0A 4EPIA 2RAZX 2NWDX 4YX7C 1CUQA 1UIFA 182LA 1ZVHL 1SWZA 1L80A 1C64A 1G07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H94 A;  1LSA A;  2Z37 A;  4NGV A;  5B05 A;  1XEK A;  2D91 A;  4OWB A;  4X3B A;  2MEH A;  2I6Z A;  1D6Q A;  7LYZ A;  4WG1 A;  1HC0 A;  4HPE A;  5FST A;  3GXK A;  1GDW A;  3IWR A;  1IR8 A;  1J1P Y;  1D0L A;  1B7S A;  4I0C A;  1HFY A;  2LYO A;  3LZ2 A;  3P64 A;  2XBS A;  3M18 B;  4O34 A;  8LYZ A;  2XBR A;  3D3D A;  2DQH Y;  4H92 A;  5IEL A;  1LZR A;  4E3U A;  4LFX A;  1UCO A;  1IY4 A;  1LJJ A;  3A96 A;  3W6E A;  1LZB A;  1OUA A;  4LYB A;  2CDS A;  4N0J A;  1UIG A;  5F81 A;  1LJ4 A;  1BB6 A;  3WW6 A;  3WH1 A;  1GPQ C;  3BKV A;  1LSG A;  5F9X A;  1DPX A;  1UBZ A;  5LAG A;  3VWO A;  1B7N A;  1UC0 A;  1HSX A;  4WL6 A;  1GFU A;  1FDL Y;  1JHL A;  1IP3 A;  4WM4 A;  4GLV A;  3P66 A;  1GB0 A;  5LAF A;  1LSF A;  4J0L A;  1LHL A;  3P4Z A;  2F4A A;  2AUB A;  1GB7 A;  4PHI A;  2DQI Y;  4HV1 A;  4CJ2 A;  6LYZ A;  2YBL A;  1GB3 A;  1LJE A;  4G4B A;  2EKS C;  1QUS A;  5APF A;  2HU3 A;  4QEQ A;  3T6U A;  4P2E A;  3WYH A;  1IR7 A;  1G7H C;  1I1Z A;  1WTN A;  3A94 A;  1UAC Y;  1IOS A;  2A7D A;  4IJ4 A;  1LJG A;  2Z12 A;  4U3X B;  2XJW A;  4LT3 A;  3AGH A;  3AGI A;  1FBI X;  1OP9 B;  4MCK A;  3OJP A;  4H1P A;  4DD1 A;  3ATN A;  3W6D A;  2HEF A;  9LYZ A;  5JEN B;  1LHM A;  4LGK A;  4QGZ A;  4GN3 A;  5EBH A;  4DT3 A;  3WPJ A;  1DQJ C;  4AGA A;  5LYM A;  2F2N A;  1UIB A;  4LZT A;  5LVI A;  1YQV Y;  2BQG A;  1GB5 A;  1UIE A;  1GFJ A;  5I53 A;  1B5V A;  3WU9 A;  5LA8 A;  1C46 A;  3A8Z A;  5LVK A;  1B7R A;  3N9C A;  4WO6 A;  1GBS A;  4B4I A;  3WMK A;  1JJ1 A;  1IP4 A;  4XJD A;  3A93 A;  1LHK A;  4WM1 A;  194L A;  2DQD Y;  1HNL A;  3LYO A;  1XGU C;  5KXN A;  1NDG C;  4N1E I;  1O23 A;  5C6I A;  2BQB A;  5B1G A;  5LIN A;  1IWU A;  2ZWB A;  1I20 A;  1D0M A;  1LJH A;  1IWX A;  3TXK A;  4H8X A;  4PGJ B;  1GF7 A;  1REM A;  2ZQ4 A;  3ULR A;  1LPI A;  4DC4 A;  1QUT A;  3A3Q A;  1FKQ A;  2FYD A;  3HBH A;  5HNL A;  1KXX A;  3CT1 A;  2BQF A;  3AZ4 A;  4NSG A;  1F6S A;  1UID A;  3SP3 A;  1IX0 A;  1B7P A;  4CHX A;  1BWJ A;  1WQR A;  4LYT A;  2H9J A;  1IWV A;  1TDY A;  5FDJ A;  3QNG A;  1B5X A;  1WVU A;  1CKF A;  5B59 A;  1PZY A;  2EPE A;  1WQM A;  1AZF A;  4I8S A;  5I4W A;  1YAM A;  1GBX A;  2YBI A;  2Z18 A;  3AB6 A;  1GB8 A;  4WLY A;  1BWI A;  1CKH A;  5KXS A;  4IAS A;  3WVX A;  1V7T A;  5I4Y A;  1OUE A;  1OQM A;  1C7P A;  1BVX A;  5F14 A;  3TXH A;  4B4E A;  1LZG A;  1YIL A;  3LHM A;  5E9R A;  1DI3 A;  2DQG Y;  1KIP C;  1SQ2 L;  1WTM A;  1HEN A;  1B5Y A;  4XN6 A;  4WM5 A;  5KXO A;  1IP6 A;  1LZ8 A;  1GXV 2;  2Z38 A;  4C3W A;  4NWE A;  2D4K A;  2VB1 A;  1HEM A;  4KL7 A;  3A6C Y;  4RLN A;  4HV2 A;  5LXW A;  2LZ2 A;  2W1M A;  5LYZ A;  1WQO A;  3TXB A;  1LKS A;  1AT5 A;  4ET9 A;  3RU5 A;  1ALC A;  5D5F A;  3WU8 A;  1SLY A;  2BQO A;  4FDY A;  2I26 L;  1J1O Y;  4NHS A;  154L A;  1T3P A;  4N1C C;  1JIT A;  3B0O A;  2DQF C;  1GFR A;  193L A;  3RT5 X;  2I25 L;  4NGW A;  2FYC A;  3TXE A;  1FLW A;  4BS7 A;  5KXR A;  2HTX A;  5DLA A;  1GE1 A;  1KXW A;  1YAP A;  1C10 A;  2G4P A;  2HEA A;  3N9E A;  4NGL A;  1JTP L;  4Z3M A;  4PRU A;  4H9H A;  1C43 A;  1GDX A;  1IWW A;  2LZT A;  2MEC A;  4YEN A;  1RCM A;  4NHT A;  4WLX A;  3TMW A;  1LZD A;  5HLL A;  1JJ3 A;  5B06 A;  1IOT A;  1IY3 A;  1AKI A;  1B5Z A;  1HEP A;  4MR1 A;  2A7F A;  4KXI A;  1XFP L;  4NSJ A;  1WVV A;  4XAD A;  2BQN A;  2MEI A;  1UUZ C;  1OUH A;  5HMV A;  2IFF Y;  3A67 Y;  1LAA A;  2D6B A;  4WG7 A;  5KY1 A;  1GWD A;  1GBY A;  1LJ3 A;  1LSN A;  1B7Q A;  1HEL A;  1NBY C;  5L9J A;  1HFZ A;  3MGW A;  1W08 A;  1VAT A;  5DL9 A;  1Z55 A;  1IOQ A;  1LSP A;  1JIS A;  2BQM A;  1TCY A;  1IP7 A;  4WMG A;  1EQ4 A;  2MEE A;  2FBB A;  1HER A;  4GCE A;  1F10 A;  1TAY A;  1NWG A;  4OOO A;  4H93 A;  4EMN A;  1NMM A;  1LZN A;  1IP2 A;  1CJ7 A;  2C8O A;  4WO9 A;  2YDG A;  5F16 A;  2HEB A;  1GXX A;  1JEF A;  1JIY A;  4DD0 A;  1GE3 A;  4CFP A;  3T36 A;  2IHL A;  1HEQ A;  3OK0 A;  5IDD A;  2DQJ Y;  3WW5 A;  4R0F A;  1MEL L;  2BLY A;  1IC4 Y;  4UWN A;  2BQA A;  5B07 A;  4YEM A;  3W3E A;  1HMK A;  1FKV A;  1QIO A;  1HML A;  1LZS A;  3LYZ A;  4UWV A;  4LT0 A;  1DXJ A;  5LVG A;  1GF6 A;  1IWY A;  1DKK A;  4ETB A;  2ZIL A;  5B1F A;  1ZVY B;  2BQI A;  1LSZ A;  2YSS C;  1B5U A;  1BQL Y;  3B0K A;  3WPK A;  5LYT A;  3TXI A;  1OUI A;  2LHM A;  1FLQ A;  4N8Z A;  4DDB A;  3TXG A;  3TXF A;  153L A;  4H9F A;  3WVY A;  3N9A A;  4HPI A;  5FHW A;  1EQ5 A;  1FLY A;  1LZE A;  5APE A;  2YBJ A;  3J4G A;  4ANR A;  2CGI A;  2ZQ3 A;  4HP0 A;  4GN5 C;  1LZT A;  5DN5 A;  1YAN A;  5KXW A;  2DQA A;  1GFH A;  1I56 A;  1LZY A;  4YF2 A;  3QY4 A;  5II3 A;  1CKC A;  1LCN A;  5A3E A;  5I54 A;  1W6Z A;  1REZ A;  1QSW A;  1XGT C;  1YL0 X;  4L41 A;  4TSB A;  4WLD A;  3EXD A;  4XJB A;  5KXL A;  207L A;  2HEC A;  1B5W A;  1LYZ A;  1RFP A;  4HJZ A;  5KXP A;  134L A;  4QY9 A;  4AXT A;  5D5C A;  4WL7 A;  4CGE A;  4NSH A;  2ZIJ A;  4NGO A;  2MEA A;  4PRQ A;  4B1A A;  1EQE A;  4TTD A;  3AZ5 A;  4EOF A;  1VDT A;  2BQE A;  1LTM A;  3G3A B;  4H9I A;  4MST A;  4J7V A;  1GF4 A;  4OW1 A;  5KKI A;  4XEN A;  3B72 A;  1IOR A;  3WPL A;  1OUG A;  2DQC Y;  1MLC E;  4NHQ A;  1KIR C;  2DQE Y;  2MEG A;  3HBD A;  4NGY A;  4WLT A;  4Z41 A;  1YAQ A;  3A3R X;  4YM8 A;  1CJ9 A;  1LMP A;  3B0I A;  4WM6 A;  1GB6 A;  1CKD A;  4W96 A;  1LSM A;  3AGG G;  5APC A;  5LVH A;  2ZNW Y;  3J6K A;  1IR9 A;  4ZFP A;  2BQL A;  1ZMY L;  2XTH A;  1REX A;  4B49 A;  1LZ4 A;  1IVM A;  1IO5 A;  2Z19 A;  1LSY A;  3FI7 A;  5AMY A;  3HBE X;  4H90 A;  1JSF A;  1GB2 A;  3A6B Y;  4DD9 A;  1DI5 A;  1LZ9 A;  1BVK C;  1CNS A;  1GE4 A;  4NIJ A;  1JTO L;  1LMN A;  5K7O A;  5E4P A;  4NFV A;  4TX7 A;  4PJ2 C;  1HF4 A;  1YL1 X;  1B9O A;  4OOT A;  3W6C A;  2DBT A;  2HUB A;  1LHJ A;  1A2Y C;  1LKR A;  5KXY A;  3CT0 A;  3TXD A;  3WUM A;  3GXR A;  1GF5 A;  1J1X Y;  1LSB A;  1LZ5 A;  4RDS A;  3CSQ A;  4NEB A;  3WUA A;  2Z2E A;  1VED A;  4LYO A;  1NF5 A;  2BLX A;  4KPM A;  1BGI A;  1RI8 B;  1GFA A;  1NKH A;  2BQC A;  1YKY X;  1XEJ A;  4KT3 A;  3WU7 A;  1TEW A;  2MEB A;  3RNX A;  1OUF A;  4NHI A;  1GFG A;  3A34 A;  4H91 A;  4NG1 A;  1GF9 A;  1B7M A;  3P68 A;  4DD2 A;  5KKJ A;  4RW1 A;  1NDM C;  1JUG A;  4DD3 A;  2H9K A;  2HED A;  1A4V A;  1G7I C;  1V7S A;  2B5Z A;  4D9Z A;  5F9U A;  2W1L A;  4NHP A;  4UWU A;  4XJG A;  1GBO A;  5M1Y A;  1JTT L;  1LYS A;  1XGQ C;  3G3B B;  1HSW A;  3ATO A;  1IP1 A;  4ETA A;  1QQY A;  132L A;  4NWH A;  3TXJ A;  6LYT A;  1LMA A;  3CSZ A;  3LZT A;  1LMT A;  2MEF A;  3KAM A;  5I4X A;  2LYZ A;  4ET8 A;  1VAU A;  5C6J A;  4GCB A;  4OWC A;  2Q0M X;  3WUL A;  1LYO A;  4HTN A;  4BAD A;  3LYM A;  4NGI A;  1BWH A;  1YRO A;  1GF3 A;  1GBZ A;  1LZA A;  1QDR A;  5L3I A;  1OUD A;  3CT5 A;  4HJV A;  4NGK A;  4N9R A;  3TMU A;  4II8 A;  2ZYC A;  2GV0 A;  4LYZ A;  3IJU A;  4J1A A;  5ILC A;  1FLU A;  1RJC B;  3WUN A;  4NG8 A;  1UIC A;  4DDC A;  1IOC A;  1GFV A;  4H9A A;  4Z46 A;  5KXX A;  1BB4 A;  1LZ1 A;  5LIO A;  2YBM A;  4G9S A;  1BHZ A;  5LA5 A;  2RSC A;  2PC2 A;  3CQL A;  3M3U A;  1OUJ A;  3RW8 A;  3K3T A;  5I5Q A;  4CFO A;  5IHG A;  5HQ1 A;  2W1X A;  4YOP A;  1BB5 A;  2ZYP A;  5HNC A;  1GAY A;  4WOA A;  1LJF A;  4GLA A;  1IC5 Y;  5A3Z A;  1GEV A;  1GHL A;  4GN4 A;  2F4G A;  1JJ0 A;  1GF0 A;  4XJI A;  1PS5 A;  4H8Z A;  1LSE A;  208L A;  3W6B A;  4ML7 A;  4OWH A;  1H6M A;  4LYC A;  3ZVQ A;  4Z98 A;  5KJ9 A;  1F0W A;  2N5Z A;  3BKH A;  1HEW A;  2EQL A;  1YKX X;  1LHH A;  2MED A;  3AZ6 A;  4GCF A;  4DDA A;  1LMC A;  1QSA A;  1YAO A;  1ZV5 L;  1HHL A;  1NHE A;  3TMV A;  1G7L C;  1F6R A;  5FEK A;  4NSI A;  3WXT A;  1GAZ A;  1KIQ C;  4TUN A;  1IEE A;  1UIH A;  4R6C A;  1LMO A;  4DWX A;  4G49 A;  1C08 C;  2FBD A;  4ETD A;  5HMJ A;  1B7O A;  1LSC A;  3P65 A;  3WXU A;  3FE0 A;  1LSD A;  4XJF A;  1QTE A;  1IC7 Y;  5APD A;  1LYY A;  2BQK A;  1WQQ A;  4NGZ A;  1INU A;  2DKV A;  4BAP A;  1H87 A;  1VDP A;  1GF8 A;  2D4J A;  2EIZ C;  2YBH A;  2ZNX Y;  4GCC A;  1JKC A;  3EBA B;  4M6D A;  4YEO A;  1OUC A;  3AZ7 A;  5ILF A;  1RE2 A;  3AW7 A;  1KXY A;  3A90 A;  2Y8P A;  3ZVQ B;  3QE8 A;  3W6F A;  4RLM A;  1DZB X;  4GCD A;  2F30 A;  4ETC A;  133L A;  2BAA A;  3F6Z A;  3CSR A;  1TBY A;  3TMX A;  1DI4 A;  4BAF A;  3RZ4 A;  1YIK A;  1CJ8 A;  1GFK A;  1IIZ A;  2CWI A;  2D4I A;  4OWA A;  1NQI A;  4M4O A;  4WM3 A;  3AYQ A;  5KXT A;  1D6P A;  1VDQ A;  4TSC A;  1DKJ A;  1GD6 A;  1XEI A;  1B2K A;  4C5F A;  4FJR A;  3EO5 A;  1CKG A;  135L A;  2BQH A;  3AJN A;  4B0D A;  2C8P A;  4NY5 A;  4G4H A;  4HTQ A;  4W94 A;  2BPU A;  5L3H A;  1GFT A;  2G4Q A;  4A7D A;  3A92 A;  4H9C A;  4WM2 A;  3CB7 A;  1JPO A;  5KXM A;  2Z39 A;  4IAT A;  4B4J A;  4ZEE A;  1AM7 A;  3WL2 A;  1IWZ A;  2W1Y A;  4ETE A;  3E3D A;  5T3F A;  5DN4 A;  1LJK A;  3B6L A;  1LZ6 A;  1YKZ X;  2HU1 A;  4H8Y A;  1GE2 A;  2ZIK A;  1JKD A;  1T6V L;  5KXZ A;  3LYT A;  1BB7 A;  1JWR A;  1AT6 A;  1P2C C;  1UA6 Y;  4G4C A;  4OWE A;  4PPO A;  1NBZ C;  1FN5 A;  4XYY A;  1E8L A;  1G7M C;  1B7L A;  2BQJ A;  3IJV A;  1OUB A;  1GBW A;  3ZEK A;  5J7C A;  1IP5 A;  1N4F A;  1HFX A;  3D9A C;  1XGR C;  5FEL A;  1HEO A;  2H5Z A;  1VDS A;  1JSE A;  2BQD A;  1VFB C;  2Z2F A;  5DM9 A;  1XGP C;  1B0D A;  3HFM Y;  4HSF A;  1D0K A;  2YBN A;  3LN2 A;  5LVJ A;  2YVB A;  1QDT A;  5FCP A;  1LJI A;  3W6A A;  4QDN A;  4LYM A;  4DYG A;  1C45 A;  2CJL A;  1LHI A;  4ZIX A;  1DPW A;  2LYM A;  1JKB A;  1XSF A;  1IWT A;  1WQN A;  2G4N A;  1GEZ A;  4XJH A;  1GFE A;  1LOZ A;  3A95 A;  5KXK A;  2X0A A;  1EL1 A;  4HJY A;  1JKA A;  1GE0 A;  4N5R A;  4HTK A;  1WQP A;  1QTK A;  1BB3 A;  4LT2 A;  2NWD X;  1D9U A;  1CJ6 A;  1UIF A;  1G7J C;  1UIA A;  4TWS A;  1LJN A;  1ZVH L;  4LFP A;  1GB9 A;  1REY A;  4J1B A;  3AW6 A;  4H9E A;  4DD7 A;  3A91 A;  2HEE A;  4NGJ A;  2WAR A;  4LT1 A;  4RW2 A;  5C6L A;  3EMS A;  4H9B A;  1LMQ A;  1LZC A; 
#chains in the Genus database with same CATH topology
 3HY5 A;  248L A;  115L A;  1LW9 A;  252L A;  3RE8 A;  4WG1 A;  231L A;  4LZZ A;  3FUT A;  1CX7 A;  1GDW A;  5JI2 E;  3IWR A;  3DMX A;  2LYO A;  3LZ2 A;  1L71 A;  1R4G A;  2XBS A;  2XBR A;  3TE6 A;  2DQH Y;  5FTJ A;  3GUN A;  4LFX A;  2MGW A;  2CUZ A;  3W6E A;  161L A;  1L39 A;  4S12 A;  2JP7 A;  2C98 A;  2G5G X;  5F9X A;  2JY6 B;  1DPX A;  1UBZ A;  4DBG B;  1FDL Y;  172L A;  3M6A A;  1PM5 A;  1D2Y A;  1L01 A;  2QZ4 A;  4I7M A;  2V6Z M;  4J0L A;  3P4Z A;  4PHI A;  1NHG C;  4CJ2 A;  1RU3 A;  1WR1 B;  1LJE A;  4IBG A;  3ZQJ A;  1QUS A;  3HKP A;  4QEQ A;  3FRH A;  1I1Z A;  4I7Q A;  4FD2 A;  2Z12 A;  2XJW A;  1SX7 A;  1NO1 A;  122L A;  4YHH M;  3AGI A;  4GH9 A;  4MCK A;  3U6C A;  1NY5 A;  3ATN A;  1GJT A;  1NV9 A;  186L A;  3D8L A;  4ARJ A;  1LHM A;  1DYG A;  1OIP A;  1UIB A;  1JQU A;  2BQG A;  1GB5 A;  4B0D A;  4QHS A;  158L A;  2DZN B;  1B7R A;  3JAM S;  1GBS A;  4B4I A;  1HJP A;  3WMK A;  3M0E A;  1G1W A;  1JJ1 A;  3SB7 A;  3G3X A;  4I81 A;  5KXN A;  1NDG C;  140L A;  1L69 A;  3KSJ A;  5B1G A;  1K3X A;  249L A;  2ZWB A;  1I20 A;  1D0M A;  3TXK A;  1OKS A;  2L78 A;  1REM A;  1OWY A;  3ULR A;  3FRI A;  1L20 A;  1LPI A;  1P46 A;  189L A;  3A3Q A;  3HBH A;  5HNL A;  110L A;  1KXX A;  4LDO A;  2CV2 A;  3L64 A;  4GMQ A;  4M9Z A;  170L A;  1B7P A;  1BWJ A;  4CHX A;  5FDJ A;  1PQD A;  201L A;  1PZY A;  5I4W A;  1AZF A;  2YBI A;  4MGI E;  4WLY A;  1SWY A;  4GRI A;  1L53 A;  1QQW A;  1WGN A;  3A46 A;  3J7A S;  1OQM A;  4IBC A;  2XZF A;  1C7P A;  3NYA A;  4PDI A;  5E9R A;  2CWB A;  1SQ2 L;  2O4W A;  3CDT A;  1W5T A;  4XN6 A;  1LZ8 A;  1X37 A;  2DAI A;  3SAV A;  147L A;  2D4K A;  4RLN A;  3GQ5 A;  3FD9 A;  5LYZ A;  225L A;  4FWG A;  3GUO A;  1AT5 A;  3DFZ A;  3SN6 R;  2APL A;  3QWL A;  1IN8 A;  3C8Q A;  3THG A;  3RGS A;  1QTH A;  1T3P A;  1JIT A;  1L82 A;  1R6B X;  103L A;  242L A;  2I25 L;  3GUM A;  256L A;  2DNA A;  1KXW A;  1OV7 A;  3C7Z A;  1EFU B;  2K47 A;  4Z3M A;  1PJQ A;  4IBK A;  1GDX A;  1XWI A;  2CUU A;  4DJH A;  1D3J A;  3KS8 A;  232L A;  3TMW A;  5HLL A;  4OVZ B;  1B5Z A;  1IY3 A;  2A7F A;  1XFP L;  1WVV A;  1G41 A;  4DV5 M;  5HMV A;  2IFF Y;  3A67 Y;  4L8R C;  1L72 A;  4LJ9 A;  3OE8 A;  2RGO A;  1ZMW A;  4LJ4 A;  1VAT A;  2JNH A;  3GLH E;  1IOQ A;  2BQM A;  1LI2 A;  4II7 A;  4GCE A;  2R44 A;  1IP2 A;  1CJ7 A;  1HQY E;  128L A;  2OEA X;  1CU5 A;  1JIY A;  1GE3 A;  1L31 A;  3LW5 F;  4CFP A;  1GL7 A;  1XXH B;  2BLY A;  1G06 A;  3GRV A;  1FKV A;  5LMN M;  2H1R A;  1DKK A;  4ETB A;  5B1F A;  1L67 A;  4G4R A;  4GBR B;  3I04 M;  3WPK A;  153L A;  2B6W A;  163L A;  1EQ5 A;  5APE A;  2YBJ A;  3RZE A;  4ANR A;  2R4J A;  2QEN A;  2ZQ3 A;  2Z8Y M;  4KLN A;  2FH0 A;  1L18 A;  1LZY A;  5A3E A;  2QP9 X;  5KXL A;  3TWM A;  4XJB A;  1S3S A;  3KFU G;  1LYZ A;  1IY2 A;  260L A;  1SXJ D;  2JY8 A;  3SB5 A;  4QY9 A;  251L A;  1L38 A;  3GPX A;  4JI2 M;  1OYU A;  2UUA M;  1SX2 A;  259L A;  1VDT A;  1C6Q A;  2G8L A;  4H9I A;  4J7V A;  2ZTD A;  1GF4 A;  4OW1 A;  1QSB A;  3HJS A;  3GLH A;  1IOR A;  4BBA A;  3WPL A;  3AFH A;  2ERC A;  1LYJ A;  1QS9 A;  3SBA A;  2LC9 A;  3HBD A;  1YAQ A;  1YUB A;  3UK6 A;  1CKD A;  4W96 A;  1C6N A;  3J6K A;  3HZJ A;  3IG8 A;  2CHQ A;  1LZ4 A;  3F92 A;  5E26 A;  1HQC A;  1PGY A;  3LQR A;  3HUA A;  3FKE A;  2VF7 A;  166L A;  4DD9 A;  3G3W A;  2DWZ B;  1PJS A;  2FFJ A;  4LF9 M;  1DI5 A;  2B74 A;  2VII A;  2ANV A;  1CNS A;  4FCW A;  211L A;  4ITQ A;  4PJ2 C;  3FYD A;  3W67 A;  2DBT A;  3HTF A;  2OOB A;  1Q3B A;  2F4V M;  4I7R A;  1LKR A;  2MH8 A;  1QVR A;  3CT0 A;  1NV8 A;  1L77 A;  3GXR A;  3BOS A;  1LZ5 A;  1L33 A;  3CSQ A;  152L A;  4NEB A;  2Z2E A;  4AKH A;  2BLX A;  4RF1 A;  1BGI A;  1R2Y A;  2UXD M;  2BQC A;  1YKY X;  3G3V A;  1XEJ A;  4KT3 A;  3AOG A;  3PXG A;  3WU7 A;  3RNX A;  1D3F A;  212L A;  4NHI A;  4FWD A;  2BJV A;  4DD2 A;  4WW0 A;  5KKJ A;  4RW1 A;  1JUG A;  2KNV A;  2EA0 A;  1J5E M;  4P17 A;  2W1L A;  4NHP A;  1IN5 A;  1L84 A;  4XJG A;  5M1Y A;  1XGQ C;  3G3B B;  175L A;  3ATO A;  1QQY A;  132L A;  3TXJ A;  1HT1 E;  4DV7 M;  2OQ4 A;  4EKR A;  2Y21 A;  4NC6 A;  4JXJ A;  2MEF A;  1QT5 A;  4GHA A;  5C6J A;  2R45 A;  4DR2 M;  2Q0M X;  3WUL A;  4HTN A;  3DN0 A;  3DN3 A;  3GLG B;  4Z6Y A;  1GF3 A;  1DYE A;  1CU3 A;  1QSQ A;  4N9R A;  4NGK A;  1XNQ M;  4II8 A;  1LI6 A;  4F1I A;  125L A;  1QTB A;  2HUM A;  2RBR A;  148L E;  4NG8 A;  4H9A A;  4Z46 A;  4L6V 6;  2YBM A;  2ZTC A;  1JTN A;  1NVM A;  2RSC A;  3NBI A;  190L A;  4G4N A;  1L28 A;  2W1X A;  4ARQ A;  1CUP A;  4GLA A;  1L59 A;  2O79 A;  1G59 A;  1JJ0 A;  5BPV A;  1PS5 A;  2J7N A;  4H8Z A;  1LSE A;  4S0W A;  208L A;  5KQD A;  3W6B A;  3U61 A;  4Z98 A;  1A5T A;  4G6Z A;  143L A;  1HEW A;  4DR4 M;  4ETC A;  3AZ6 A;  4DDA A;  150L A;  1VDD A;  1QUD A;  3TMV A;  169L A;  1NHE A;  2R46 A;  3WXT A;  1GAZ A;  4TUN A;  2HAK A;  1UIH A;  1IN4 A;  4DWX A;  1C08 C;  3I01 M;  2FBD A;  5FTL A;  1LSC A;  2AHM A;  3WXU A;  3FE0 A;  1D2N A;  1LPY A;  245L A;  1DGH B;  4NL4 H;  2ZNX Y;  2FOI C;  3J80 S;  4YEO A;  1OUC A;  2DHY A;  2QNJ A;  3GLG A;  3GLF E;  1C6P A;  1C61 A;  2F5Q A;  4RLM A;  2BAA A;  1C67 A;  3CSR A;  2K6B A;  1MU5 A;  3TMX A;  145L A;  4AQN A;  3DN6 A;  1YIK A;  2WSE F;  1IIZ A;  1ZQ9 A;  2CWI A;  2D4I A;  4WM3 A;  1D6P A;  1VDQ A;  4OVZ A;  4LGY A;  1TDH A;  123L A;  1CKG A;  3AJN A;  3NY9 A;  2L09 A;  2D7E A;  3L2X A;  4I7K A;  1T6O A;  2KZS A;  1L75 A;  2G4Q A;  4A7D A;  1JPO A;  1L93 A;  4ZEE A;  1P2R A;  1SSY A;  3WL2 A;  1QTZ A;  4DV3 M;  1ZUR A;  4ETE A;  1G0P A;  1L86 A;  5KXZ A;  5ITX E;  1T6V L;  4PPO A;  4R71 A;  142L A;  1L00 A;  1E8L A;  1NBZ C;  4XYY A;  2BQJ A;  1GL6 A;  3KSX A;  3SFZ A;  2CV1 A;  5J7C A;  3KP0 E;  4LY6 A;  4MGK E;  3HU8 A;  1YLA A;  1HEO A;  1VDS A;  2BQD A;  165L A;  3L25 A;  1VFB C;  218L A;  2Z2F A;  1XGP C;  1KSF X;  4HSF A;  1D0K A;  5LVJ A;  164L A;  1QDT A;  1JKB A;  4Z8X A;  4QNR A;  4DQJ A;  5EQT A;  2KW0 A;  1LOZ A;  2ZBK B;  5KXK A;  1EL1 A;  1JKA A;  1LYG A;  4HTK A;  2VDB B;  3W68 A;  1BB3 A;  2QPA A;  5EJC A;  2B6Z A;  4LT2 A;  4NSR A;  2UXB M;  162L A;  1GB9 A;  3AW6 A;  258L A;  2BNK A;  2OOA A;  2JY5 A;  3A91 A;  2WAR A;  4RW2 A;  2WSF F;  4IBI A;  2J7O A;  1XHB A;  237L A;  3EMS A;  4H9B A;  1TDZ A;  1LMQ A;  4LFC M;  2R62 A;  1LSA A;  2Z37 A;  4NGV A;  2MEH A;  7LYZ A;  1DYC A;  5FST A;  1FJG M;  1IBK M;  1L73 A;  2KNZ A;  4LDL A;  3Q8G A;  1D0L A;  1B7S A;  4I0C A;  1HFY A;  3P64 A;  4KHP M;  4E3U A;  2XLJ A;  3A96 A;  4I7J A;  1T97 A;  1LZB A;  1OUA A;  2V1C A;  2Y20 A;  4QHT A;  4ARQ B;  1LJ4 A;  2R65 A;  1LSG A;  1IY1 A;  5LAG A;  1B7N A;  4DV1 M;  4F2L A;  1JHL A;  1IP3 A;  1L34 A;  222L A;  4B3S M;  4REZ A;  5H37 D;  1LHL A;  1JB0 F;  4XGI A;  4OU7 A;  3DZD A;  4HV1 A;  1R2Z A;  4OO9 A;  6LYZ A;  2YBL A;  2EKS C;  1L94 A;  5APF A;  2RKO A;  4LF8 M;  3T6U A;  1QTC A;  1CX6 A;  1IR7 A;  2HCB A;  1G7H C;  3A94 A;  4P2E A;  2I7N A;  1P6Y A;  1LJG A;  226L A;  1L79 A;  1CUK A;  4LT3 A;  1VG5 A;  3AGH A;  3U5Z B;  1OWZ A;  4W59 A;  1SXJ E;  1CVK A;  1L21 A;  4DD1 A;  3IEC A;  3W6D A;  1LGX A;  1E94 E;  3WPJ A;  4LZT A;  5LVI A;  1KW7 A;  2C9C A;  3FTF A;  4BLC A;  167L A;  4WO6 A;  3E21 A;  4NRW A;  3LVV A;  4W5W A;  3A93 A;  2B70 A;  234L A;  3FTD A;  1P56 A;  3HT7 A;  5A2Q S;  1L56 A;  1O23 A;  4N1E I;  5C6I A;  4MB7 A;  1IWU A;  4L15 A;  1IWX A;  4PGJ B;  1GF7 A;  1L63 A;  3DKE X;  1C60 A;  4DC4 A;  1FKQ A;  1IFY A;  4W51 A;  3PNY A;  3HHW A;  1UID A;  3C58 A;  4L16 A;  4AQY M;  215L A;  2ANX A;  1DYA A;  1XJT A;  2H9J A;  3QAU A;  4I8S A;  1QT3 A;  2EO2 A;  1BWI A;  1QTD A;  3KS4 A;  3WVX A;  3HH6 A;  5ITX A;  1AIP C;  1V7T A;  1OUE A;  5EP2 A;  2HL7 A;  2XH9 A;  1L1T A;  3TXH A;  3KOY E;  2OTZ X;  1LZG A;  3LHM A;  1DI3 A;  2DQG Y;  2RBS A;  1KIP C;  1WTM A;  1B5Y A;  4MGH A;  5KXO A;  2OU9 A;  1HEM A;  3A6C Y;  4KO8 A;  5LXW A;  1GJS A;  1L07 A;  2LVO C;  2RB2 X;  254L A;  2CP8 A;  3RU5 A;  3L29 A;  1L96 A;  1L99 A;  5D5F A;  4HEO A;  4JYA M;  154L A;  4N1C C;  193L A;  3ZC7 B;  1I4W A;  2LH0 A;  4JI0 M;  2FYC A;  2JXN A;  4GHL A;  5DLA A;  4X66 M;  5IT9 S;  1JTP L;  4H9H A;  3W0L B;  149L A;  1IWW A;  2LZT A;  2MEC A;  4WLX A;  5EP3 A;  1IOT A;  1HEP A;  1G0Q A;  4NSJ A;  2BQN A;  2MEI A;  1EIJ A;  2D6B A;  3HX3 A;  4WG7 A;  2DZO B;  3T38 A;  3DA1 A;  2B6T A;  112L A;  2XF3 A;  1GBY A;  1L0K A;  1LJ3 A;  1B7Q A;  3T6P A;  1NBY C;  1C6E A;  1Y8G A;  1HFZ A;  1BVS A;  1OQY A;  102L A;  3DN4 A;  3MGW A;  1W08 A;  1B6I A;  3R8F A;  1Z55 A;  5DL9 A;  1LSP A;  3DOA A;  2QHO B;  1IP7 A;  3A98 B;  3HUK A;  1HER A;  1NHB A;  1QS5 A;  2DAG A;  2F5P A;  3TPZ A;  5F16 A;  261L A;  137L A;  1JEF A;  1C6H A;  1HEQ A;  2BWB A;  1L66 A;  3M7G A;  1IC4 Y;  1HMK A;  1QUH A;  1QIO A;  1L06 A;  4DR7 M;  4PDG A;  1LZS A;  3LYZ A;  1GF6 A;  2B6Y A;  1IWY A;  4WUR A;  3SB6 A;  3MHV C;  1G3I A;  1ZVY B;  3TWL A;  2YSS C;  1B5U A;  1BQL Y;  3B0K A;  4LZM A;  1OUI A;  113L A;  1FLQ A;  2LHM A;  1L11 A;  2ZAO A;  3WVY A;  3N9A A;  1L49 A;  3FUX A;  1LZE A;  210L A;  2A4T A;  3C7Y A;  5DN5 A;  1LZT A;  2K9D A;  1N75 A;  3GLI B;  191L A;  1REZ A;  1YL0 X;  1L8Q A;  207L A;  2OO9 A;  3WHL A;  5KXP A;  2HHH M;  4EXM A;  4AXT A;  1L37 A;  4YY3 M;  4WL7 A;  5EXX A;  253L A;  2ZIJ A;  2VF8 A;  2FNA A;  3AZ5 A;  3HU3 A;  2QQ8 A;  1H6U A;  1L02 A;  3C80 A;  1L13 A;  2HWJ A;  2F5O A;  2OE4 X;  4EPF A;  2RBO A;  1TH4 A;  2X4A A;  1OUG A;  1MLC E;  1L14 A;  4NGY A;  1IXR C;  3CF0 A;  2NQ8 C;  1HNZ M;  3A3R X;  2XFS A;  4PCZ A;  1LSM A;  3GRR A;  5APC A;  3SAW A;  1L44 A;  4MGY E;  4B49 A;  1VDL A;  4EKP A;  4JI8 M;  4AKG A;  1R5L A;  1L08 A;  3FI7 A;  5AMY A;  1AUA A;  1QT7 A;  2R4E A;  3ILK A;  1GB2 A;  1IBL M;  1OAI A;  4IBJ A;  3OE9 A;  4NIJ A;  1DV0 A;  1L36 A;  4W58 A;  4I7P A;  4NFV A;  1K28 A;  1C63 A;  1VEJ A;  1HR0 M;  1B9O A;  3W6C A;  2HUB A;  4QNM A;  4A3V B;  2L2D A;  1OAO C;  3HWS A;  3K1J A;  1GF5 A;  1LSB A;  1XNR M;  3WUA A;  1L47 A;  3Q8X A;  4GKJ M;  4KPM A;  5KPZ A;  1TH3 A;  3VDP A;  1JR3 A;  1NKH A;  1C6D A;  2Y0T A;  4LJ6 A;  3IHP A;  1TEW A;  2MEB A;  1OUF A;  1GFG A;  2UUC M;  235L A;  1E32 A;  2XFT A;  3LVW A;  1L60 A;  1UFZ A;  3CTW B;  1V7S A;  1G7I C;  2HED A;  156L A;  5F9U A;  4XBO A;  1GBO A;  4RKU F;  4RF0 A;  1NJF A;  1L58 A;  1IP1 A;  1LMT A;  3K92 A;  5I4X A;  4ET8 A;  2A5Y B;  5EP1 A;  141L A;  2DKL A;  1XEP A;  3U60 A;  2RAY X;  184L A;  1LYO A;  1LV7 A;  1QT4 A;  196L A;  2NTG A;  178L A;  4NGI A;  1KY1 A;  1L74 A;  1YRO A;  3VK8 A;  1JTM A;  1QDR A;  2C9O A;  5L3I A;  1L40 A;  2WSC F;  1L45 A;  1OUD A;  3TMU A;  2L4E A;  2EUC A;  5DFL A;  5KPT A;  3U6P A;  2GV0 A;  4AW4 A;  1RJC B;  3WUN A;  3CF6 E;  1IOC A;  4B3R M;  1DYD A;  129L A;  1LZ1 A;  4FW9 A;  1L57 A;  5LIO A;  3DMV A;  120L A;  4G9S A;  3M3U A;  1L50 A;  2PC2 A;  3CQL A;  5IHG A;  3K3T A;  209L A;  1D2W A;  1N77 A;  5FSW A;  4YOP A;  2ZYP A;  5HNC A;  4WOA A;  1LJF A;  4W54 A;  173L A;  5ITU A;  195L A;  2JZ1 A;  4LRS A;  111L A;  1GEV A;  2F4G A;  4GN4 A;  3I51 A;  4MGZ E;  1CV0 A;  240L A;  2RBP A;  4LYC A;  4M9S A;  1ORY B;  4LZJ A;  1C62 A;  5KJ9 A;  3SB8 A;  5EXT A;  3SAT A;  4K5Y A;  2KNA A;  3SHF A;  2EQL A;  1HHL A;  4Q7J A;  1G7L C;  1F6R A;  3HJQ A;  1TTE A;  1NNU C;  1L35 A;  1LMO A;  4WP2 A;  2HUK A;  3FUW A;  3HDE A;  1CV5 A;  2LHC A;  1XJU A;  2RGH A;  4IJE A;  4BAP A;  5ITQ A;  1H87 A;  1VDP A;  4GCC A;  3FE3 A;  2DWM A;  5ILF A;  3AW7 A;  3SYK A;  3SC3 A;  3A90 A;  2Y8P A;  3QE8 A;  2Y0Q A;  4B08 A;  4GCD A;  1CU2 A;  133L A;  4D81 A;  3F6Z A;  1TBY A;  1DI4 A;  4BAF A;  185L A;  2LVP C;  3AOE A;  4M4O A;  1L91 A;  1TGU A;  3CDQ A;  1XMO M;  1DKJ A;  1CU6 A;  1B2K A;  144L A;  138L A;  1ZWN A;  3A45 A;  4NY5 A;  1LYI A;  1G0K A;  1OVH A;  1GFT A;  5L3H A;  4W52 A;  2HUL A;  1G0M A;  5KXM A;  4M0W A;  4B4J A;  5DYG A;  1IWZ A;  2W1Y A;  104L A;  2XSZ D;  2HU1 A;  4G4C A;  1UA6 Y;  1AT6 A;  3B74 A;  1FN5 A;  198L A;  4W55 A;  1KYI A;  3IJV A;  1XXH E;  1L61 A;  1CV1 A;  1EPY A;  1L0J A;  1XGR C;  3UZU A;  2H5Z A;  1XXH A;  5DM9 A;  3AJI B;  3J7B A;  3GLF A;  1E9R A;  3LN2 A;  3A42 A;  3U61 B;  1L62 A;  3W6A A;  1WIV A;  2OPF A;  1IWT A;  2B72 A;  1GFE A;  118L A;  1Q3C A;  4N5R A;  4HJY A;  2UUB M;  1WQP A;  1DO0 A;  1QTK A;  1IXZ A;  4G4O A;  3HJ8 A;  1LJN A;  3GO8 A;  1P37 A;  1P36 A;  1G71 A;  244L A;  2KDL A;  2I7P A;  2HEE A;  4NGJ A;  1N33 M;  206L A;  3UJN A;  2DAE A;  4LFB M;  4AI6 A;  5B05 A;  1VQ1 A;  1XEK A;  1XB2 B;  1QAO A;  1D6Q A;  2I6Z A;  1HC0 A;  2DZL A;  1Z6T A;  1K82 A;  3GXK A;  3EIE A;  4B7F A;  2X8A A;  4O34 A;  3GLI E;  3LQQ A;  8LYZ A;  3D3D A;  2O5R A;  3FA0 A;  5F3W A;  4H92 A;  5IEL A;  2B7X A;  1MJG M;  1UCO A;  1IY4 A;  4BB9 A;  1LJJ A;  4I7O A;  4LYB A;  4W56 A;  4N0J A;  4R7G A;  2XQO A;  5F81 A;  3FUV A;  2XEP A;  1BB6 A;  3WH1 A;  3BKV A;  3VWO A;  1GFU A;  4DQ5 A;  4HLQ A;  1G0G A;  4LDE A;  4WM4 A;  5IRE B;  3HH3 A;  5LAF A;  1LSF A;  1L85 A;  2F4A A;  1GB7 A;  2QB0 B;  3L28 A;  1L10 A;  155L A;  2NTH A;  3VDU A;  1L09 A;  1PQO A;  1WTN A;  1C6C A;  3AV0 A;  1UAC Y;  4DR6 M;  1QT6 A;  2A7D A;  4IJ4 A;  3UMM A;  3VLF B;  1FBI X;  1IN6 A;  1OP9 B;  3GPP A;  1D3N A;  255L A;  9LYZ A;  5JEN B;  4QGZ A;  4GN3 A;  5EBH A;  3BXW A;  3T1H M;  1L83 A;  5LYM A;  2F2N A;  3K9O A;  4DV2 M;  5I53 A;  3WU9 A;  1GFJ A;  4FWH A;  223L A;  2Q2E B;  3A8Z A;  5LA8 A;  3N9C A;  5LVK A;  1QAQ A;  1L95 A;  3MJ5 A;  4XJD A;  1IP4 A;  4WM1 A;  194L A;  2DQD Y;  1HNL A;  3LYO A;  1XGU C;  3BBZ A;  3GRU A;  1ZV1 A;  2L7H A;  1KNI A;  1LJH A;  4H8X A;  1TH2 A;  188L A;  2OTY X;  4IJF A;  1L64 A;  1QUT A;  1YE9 A;  2FYD A;  4GIT A;  2YQZ A;  3AZ4 A;  3SP3 A;  3QYB A;  1IX0 A;  3AL0 C;  4MM3 B;  4LYT A;  1IWV A;  1TDY A;  4IIW A;  1ZMV A;  1B5X A;  2GQF A;  2F5N A;  4K0K M;  1CKF A;  219L A;  1MN3 A;  262L A;  2EPE A;  1YAM A;  2Z18 A;  3AB6 A;  3SHG B;  5KXS A;  2Z3X A;  4IAS A;  2W82 A;  1QAM A;  5I4Y A;  1BVX A;  4RNA A;  5F14 A;  3HT8 A;  1GKI A;  187L A;  1HEN A;  4C3W A;  4NWE A;  2VB1 A;  1V34 A;  4DUZ M;  1KS3 A;  2OU0 X;  2O7A A;  2F47 A;  3TXB A;  213L A;  3HH5 A;  1ALC A;  3WU8 A;  4CHT B;  4FDY A;  4GIP A;  4NHS A;  1L88 A;  2DQF C;  3KOZ E;  1C6A A;  1GFR A;  4G3O A;  3HTB A;  3RT5 X;  1LWK A;  1FLW A;  4BS7 A;  5KXR A;  1GE1 A;  1YAP A;  1C10 A;  2G4P A;  3N9E A;  3B89 A;  3TWK A;  3B7Q A;  4PRU A;  4YEN A;  2DAK A;  1CU0 A;  1L05 A;  1L2C A;  2KRU A;  1GLN A;  1LZD A;  4ZPX A;  1JJ3 A;  220L A;  2QSF X;  1AKI A;  2JWS A;  1OUH A;  2DAM A;  1N34 M;  1LAA A;  1I6S A;  1C65 A;  114L A;  1L32 A;  3PDS A;  1YSY A;  1LYF A;  1GWD A;  1LSN A;  127L A;  5L9J A;  1N36 M;  1SSW A;  4LG2 A;  1GAB A;  146L A;  1FNN A;  1JIS A;  1L89 A;  168L A;  2MEE A;  1F10 A;  1NWG A;  4B7H A;  151L A;  4HL4 A;  4EMN A;  4DKL A;  1PQI A;  2C8O A;  4WO9 A;  2YDG A;  3GLG E;  2HEB A;  2KEB A;  4DD0 A;  3OK0 A;  3GLI A;  3WW5 A;  4R0F A;  4UWN A;  4YEM A;  1F4I A;  4GEW A;  2B6X A;  217L A;  3W3E A;  5IWA M;  2DI0 A;  2BQI A;  1LSZ A;  3WHK A;  3U5Z A;  3TXI A;  3HHZ A;  3RUN A;  4N8Z A;  4DDB A;  3TXG A;  3TXF A;  4H9F A;  1NSF A;  4HPI A;  1L29 A;  2MR9 A;  4HP0 A;  4EKQ A;  1J7K A;  1UM8 A;  4KOD A;  1L19 A;  3J27 B;  3GPY A;  1QAN A;  3VKG A;  3QY4 A;  5II3 A;  2OU8 A;  1CKC A;  3K9P A;  1LCN A;  4GC9 A;  1K3W A;  1C6G A;  2KXE A;  3GP1 A;  1L81 A;  1QSW A;  1XGT C;  4L41 A;  3EXD A;  1PQJ A;  3H4J A;  1RFP A;  5DYI A;  4HJZ A;  134L A;  5D5C A;  4CGE A;  3FTC A;  3CDV A;  1D9W A;  1L76 A;  1HT2 E;  3AOE C;  4TTD A;  4JI5 M;  1C1K A;  221L A;  2BQE A;  4EOF A;  4CJ6 A;  4ARM A;  1LTM A;  3G3A B;  2XSZ A;  3GLH B;  3W0F A;  5C18 A;  3HTD A;  5KKI A;  1L15 A;  3B72 A;  4XEN A;  1DYB A;  1LWG A;  5ITT A;  2DQC Y;  2FS1 A;  5C1B A;  2DQE Y;  171L A;  2LNH C;  1GO5 A;  1CJ9 A;  1LMP A;  3B0I A;  4WM6 A;  1GB6 A;  2OE9 X;  3HTG A;  4LF7 M;  5LVH A;  1IR9 A;  4I8O A;  1IVM A;  1L51 A;  4FCV A;  1LSY A;  3KP1 E;  229L A;  246L A;  1T6H A;  1QUO A;  4E97 A;  4LGM A;  176L A;  1LZ9 A;  1GE4 A;  2D7H A;  1JTO L;  1LMN A;  2YFQ A;  5E4P A;  3I4V A;  4TX7 A;  2CV0 A;  1YL1 X;  3HT6 A;  4OOT A;  1VEG A;  1GVN A;  5KXY A;  3OE6 A;  3WUM A;  2LZM A;  2VQF M;  1J1X Y;  1L52 A;  109L A;  3U6L A;  1NF5 A;  3JR4 A;  1RI8 B;  3DMZ A;  3B7Z A;  5E6J A;  1QYR A;  4LF4 M;  2O01 F;  4QOS A;  1C66 A;  4NSO B;  1B7M A;  3C8S A;  3P68 A;  3CF2 A;  4DD3 A;  1C7Y A;  2H9K A;  2LVN C;  1A4V A;  1LGU A;  4D9Z A;  2KRK A;  1L12 A;  2ZAN A;  3VK7 A;  4UWU A;  2WZJ A;  5IZ7 D;  1L22 A;  1LYS A;  1HSW A;  3KOX E;  4YXC A;  6LYT A;  3LZT A;  4IAP A;  5I14 A;  3KAM A;  1HNX M;  2YR0 A;  228L A;  1J09 A;  4BAD A;  3B9P A;  3LYM A;  1T43 A;  1BWH A;  1GBZ A;  126L A;  4HJV A;  1IBM M;  4PD2 A;  3V76 A;  4JI4 M;  3HHX A;  3IJU A;  1FLU A;  1QT8 A;  2LHG A;  4DDC A;  1GFV A;  1G0J A;  1PQM A;  5KXX A;  1BB4 A;  3C3E A;  3GUI A;  5LA5 A;  1BHZ A;  3RW8 A;  1L54 A;  5FTM A;  200L A;  5HQ1 A;  1BB5 A;  1G4A E;  3ZH9 B;  1GAY A;  3QYE A;  1IC5 Y;  3JR5 A;  4XJI A;  4IBD A;  4ML7 A;  1H6M A;  1KY0 A;  2CE7 A;  2N5Z A;  1C69 A;  4DQ7 A;  1DYF A;  7LZM A;  1YKX X;  1D3M A;  1LHH A;  4LF5 M;  4GCF A;  1QSA A;  1YAO A;  2V1U A;  3R9X B;  5FEK A;  4NSI A;  1NY6 A;  1KIQ C;  1IEE A;  4R6C A;  4CIZ A;  1Q39 A;  1G1V A;  2X49 A;  3B7N A;  1B7O A;  241L A;  1LSD A;  1Z5C A;  1IC7 Y;  1LYY A;  1CTW A;  1WQQ A;  2BQK A;  4NGZ A;  4MH0 E;  2YBH A;  3PBL A;  1JKC A;  3EBA B;  2CEA A;  1CV4 A;  2DHR A;  2H5X A;  4M9X A;  3AZ7 A;  4ARL A;  3L27 A;  4PT5 A;  4ZPU A;  1DZB X;  2F30 A;  3HU1 A;  1IXS B;  1Z59 A;  1CJ8 A;  2ZM6 M;  1G0L A;  4I7S A;  2N35 A;  5FTN A;  2F5S A;  2LCB A;  4LJ5 A;  3GUL A;  5KXT A;  2LXE A;  4TSC A;  4IBF A;  1GD6 A;  3SAR A;  250L A;  159L A;  1NNJ A;  2C8P A;  2LVQ D;  4HTQ A;  1OV5 A;  3LCU A;  4H9C A;  4DAJ A;  4R3D A;  3KW6 A;  4DUY M;  3CDO A;  1C6F A;  3GQ3 A;  2CFO A;  157L A;  2RH1 A;  3FUU A;  5ITR A;  238L A;  3E3D A;  5T3F A;  5DN4 A;  1LJK A;  2R0I A;  1LZ6 A;  1YKZ X;  4H8Y A;  1GE2 A;  2DVW B;  1JKD A;  2ZIK A;  2JZ0 A;  1JWR A;  1L1Z A;  3LYT A;  3J81 S;  1B7L A;  1TR8 A;  1OUB A;  3ZEK A;  3U6E A;  1HFX A;  5FEL A;  4YXA C;  1KW5 A;  1JSE A;  3NY8 A;  3E9S A;  2Z7J A;  1B0D A;  5FCP A;  4QDN A;  4LYM A;  3HWL A;  247L A;  2GNO A;  1XSF A;  1PJI A;  239L A;  1OJL A;  1WQN A;  1IQP A;  3NWL A;  177L A;  2X0A A;  3HHY A;  1PQK A;  192L A;  1D9U A;  4JI1 M;  1CJ6 A;  3OTO M;  1L03 A;  224L A;  1G7J C;  1UIA A;  1L17 A;  4TWS A;  4LFP A;  1REY A;  4J1B A;  4H9E A;  1C6L A;  1IN7 A;  4DD7 A;  3F8V A;  1L04 A;  4LT1 A;  5C6L A;  4LF6 M;  1BVK C;  3AKZ A;  2C5R A;  1LZC A;  4H94 A;  3VKH A;  4AKI A;  2D91 A;  4OWB A;  4X3B A;  2F2Q A;  3V2W A;  4HPE A;  4FCT A;  3D4S A;  1IR8 A;  1J1P Y;  4CFO A;  3M18 B;  1C68 A;  3T15 A;  1L25 A;  1LZR A;  1L42 A;  1OVJ A;  2FE8 A;  3FAD A;  2CDS A;  1UIG A;  5FLX S;  216L A;  3WW6 A;  1GPQ C;  3U6Q A;  1L43 A;  4CIS A;  1UC0 A;  2VQE M;  1HSX A;  174L A;  2R18 A;  4I4L A;  4WL6 A;  4GLV A;  1WJ7 A;  3P66 A;  4DR1 M;  1GB0 A;  4JI3 M;  2AUB A;  3SBB C;  2DQI Y;  3C9P A;  3E46 A;  1GB3 A;  4G4B A;  2DXI A;  1G8P A;  3TQS A;  1MX0 A;  2HU3 A;  3WYH A;  2D7G A;  1XMQ M;  2B73 A;  4B7G A;  4OW0 A;  1IOS A;  2CHG A;  3MMP A;  1JQJ C;  2B75 A;  4U3X B;  1DGH A;  257L A;  1L23 A;  3FYC A;  1Z5A A;  3D8B A;  3OJP A;  4H1P A;  1OTR A;  1DGB A;  2HEF A;  3SYL A;  2K0B X;  3TL4 X;  4LGK A;  4DT3 A;  4AGA A;  1DQJ C;  1Q02 A;  4IBB A;  5FTK A;  4OX9 M;  1YQV Y;  1UIE A;  1B5V A;  8CAT A;  1C46 A;  4L78 A;  199L A;  2MRO B;  3OE0 A;  1LHK A;  5BR8 M;  1C6B A;  2BQB A;  3NBX X;  5LIN A;  2CRU A;  4LRT A;  230L A;  2YNM D;  1LYD A;  2M60 A;  4DR3 M;  2QCU A;  4AZF A;  2ZQ4 A;  2EJS A;  3PVS A;  2Z4R A;  3HH4 A;  1WGL A;  4ARM B;  3C83 A;  1WHC A;  3CT1 A;  2BQF A;  5JI3 E;  1L26 A;  4NSG A;  1F6S A;  2UXC M;  4JI6 M;  2L4F A;  1WQR A;  3QNG A;  1SG9 A;  3UGJ A;  4LJ7 A;  1WVU A;  236L A;  5B59 A;  2LTU A;  1WQM A;  197L A;  2MJ5 B;  1GBX A;  1GB8 A;  1CKH A;  1HNW M;  1L2B A;  4IBE A;  4G4Q A;  2QAR C;  1YIL A;  4B4E A;  1LI3 A;  2RBN A;  4WM5 A;  1IP6 A;  2Z38 A;  2DWN A;  1GXV 2;  1CV3 A;  4KL7 A;  4HV2 A;  2LZ2 A;  1KFV A;  3LMM A;  1WQO A;  2W1M A;  6LZM A;  1LKS A;  2O25 A;  4DV4 M;  227L A;  3U6M A;  4ET9 A;  4P16 A;  1W5S A;  3C81 A;  1SLY A;  2BQO A;  2I26 L;  1J1O Y;  3B0O A;  1T8A A;  4DR5 M;  4NGW A;  1SXJ A;  3GUK A;  3TXE A;  4I7N A;  1L70 A;  2HTX A;  4EIW A;  3L2A A;  2HEA A;  4NGL A;  4DV6 M;  2BJW A;  4FVM A;  1C43 A;  2OE7 X;  2Z6B A;  130L A;  2Q9D A;  1RCM A;  4NHT A;  3HU9 A;  5B06 A;  1Z5B A;  4MR1 A;  4CGY B;  4XAD A;  4KXI A;  1UUZ C;  4JI7 M;  2JUJ A;  5KY1 A;  183L A;  2C96 A;  4KT0 F;  4NRV A;  1HEL A;  1P3N A;  1QZE A;  4I5S A;  1L55 A;  1SXJ B;  1L65 A;  1L46 A;  4NXN M;  1TCY A;  3CDR A;  3U6O A;  1ZMU A;  139L A;  4WMG A;  1EQ4 A;  2FBB A;  4OOO A;  1TAY A;  5EXS A;  4H93 A;  1NMM A;  1LZN A;  5EXP A;  1GXX A;  1CV6 A;  3KDS E;  3QAK A;  3T36 A;  2IHL A;  5IDD A;  2DQJ Y;  1L87 A;  1IM2 A;  1MEL L;  1C6K A;  5B07 A;  2BQA A;  2G3Q A;  2RB1 X;  1HML A;  4UWV A;  4LT0 A;  4PJZ A;  1DXJ A;  5LVG A;  3U60 B;  2ZIL A;  3GQ4 A;  3V2Y A;  2ZAM A;  2Q9E A;  5LYT A;  3SMS A;  3H4M A;  3LZM A;  1XC8 A;  1C6M A;  2BWE A;  5FHW A;  1FLY A;  1T8G A;  3J4G A;  3RGP A;  2CGI A;  5KXW A;  4GN5 C;  1ZAE A;  1YAN A;  2DQA A;  1GFH A;  1I56 A;  4YF2 A;  5I54 A;  1W6Z A;  3JR6 A;  2DWL A;  3VW7 A;  4WLD A;  4TSB A;  1P5C A;  3HT9 A;  2HEC A;  1B5W A;  1VEK A;  4B3T M;  3HDF A;  108L A;  4LFA M;  4NSH A;  4LCB A;  3GLF B;  3FTE A;  4NGO A;  4JN6 A;  2MEA A;  7CAT A;  4PRQ A;  1EQE A;  3T1Y M;  4B1A A;  1R7R A;  5EP4 A;  2E5L M;  1L92 A;  4JV5 M;  2EKF A;  4MST A;  3K2L A;  4M0D A;  1C6T A;  180L A;  181L A;  4NHQ A;  2J5Y A;  1KIR C;  2MEG A;  3SMP A;  4WLT A;  4Z41 A;  2DEN A;  3K8Z A;  4YM8 A;  4D82 A;  3UON A;  2UU9 M;  1L98 A;  1L48 A;  3AGG G;  2ZNW Y;  3GUP A;  4ZFP A;  2BQL A;  1ZMY L;  2XTH A;  1REX A;  1QTV A;  1IO5 A;  2Z19 A;  2M5Z A;  3HBE X;  4H90 A;  3HU2 A;  1JSF A;  3A6B Y;  2LVA A;  3GRY A;  1ZYT A;  2KA6 B;  5K7O A;  3U6S A;  1P7S A;  1C6I A;  1HF4 A;  5DNY A;  1IY0 A;  1LHJ A;  1A2Y C;  4Y28 F;  5LMU M;  3TXD A;  1L27 A;  4LJ8 A;  2JA2 A;  4RDS A;  5KQ8 A;  1VED A;  4GC5 A;  4LYO A;  1OFH A;  1GFA A;  2RB0 X;  4NOO B;  160L A;  3A34 A;  4H91 A;  1P3Q Q;  1GF9 A;  4NG1 A;  1L97 A;  1NDM C;  2HKJ A;  2B5Z A;  131L A;  1PJT A;  1JTT L;  3ODU A;  1OIZ A;  4TUW A;  1OFI A;  2L7I A;  1QZM A;  3LCV B;  4X62 M;  4ETA A;  4NWH A;  1LMA A;  3CSZ A;  1L24 A;  1L16 A;  2LYZ A;  1VAU A;  4GCB A;  4OWC A;  4AG6 A;  1TLA A;  3PNV A;  5ITY A;  3C3D A;  1T3T A;  1LZA A;  1V92 A;  2RBQ A;  2IGC A;  3CT5 A;  3L26 A;  3HGI A;  233L A;  3DN2 A;  5ILC A;  2ZYC A;  4LYZ A;  1PRB A;  2KZU A;  4J1A A;  3HUQ A;  3CGW A;  3IG5 A;  1UIC A;  2Z4S A;  243L A;  3SAU A;  1OUJ A;  1L68 A;  1TF0 B;  4I7T A;  5I5Q A;  2RRU A;  1LGW A;  2L6O A;  1E9S A;  5A3Z A;  3DN1 A;  3C82 A;  4EJ4 A;  1GHL A;  1GF0 A;  4OWH A;  3ZVQ A;  1F0W A;  3GPU A;  3BKH A;  2R6F A;  2MED A;  4LJA A;  1WXQ A;  1LMC A;  1ZV5 L;  3GUJ A;  1L30 A;  4GKK M;  4AG5 A;  4UN2 B;  4G49 A;  4ETD A;  5HMJ A;  2JY7 A;  3P65 A;  4XJF A;  1EE8 A;  1QTE A;  5APD A;  3VFD A;  1INU A;  2DKV A;  3KVW A;  2D4J A;  3K2R A;  1GF8 A;  2EIZ C;  4NXM M;  1LYH A;  1DGF A;  5KO3 A;  4M6D A;  2CHV A;  1RE2 A;  3SB9 A;  1P2L A;  1T8F A;  1KXY A;  3ZVQ B;  3PFI A;  3W6F A;  3EIH A;  1L41 A;  107L A;  1IXS A;  3RZ4 A;  4D80 A;  1GFK A;  4X65 M;  2XGN A;  4OWA A;  1NQI A;  214L A;  3AYQ A;  1XEI A;  4C5F A;  4FJR A;  3EO5 A;  4ARP A;  3DNA A;  1QUG A;  5KPR A;  135L A;  1P64 A;  2BQH A;  3FI5 A;  1PJJ A;  4G4H A;  4W94 A;  3RFW A;  2BPU A;  2B3T A;  3A92 A;  5LZM A;  4WM2 A;  3CB7 A;  2Z39 A;  4QOZ C;  4IAT A;  5L8R F;  1AM7 A;  3U6D A;  4I7L A;  2C99 A;  1N32 M;  3B6L A;  1L2D A;  1JR3 E;  3DN8 A;  4DV0 M;  4W57 A;  3J2P B;  4OWE A;  1BB7 A;  1P2C C;  1L90 A;  4XK8 F;  4PK0 A;  3SAS A;  3MK6 A;  1G7M C;  1OVK A;  119L A;  1GBW A;  4W53 A;  1IP5 A;  1N4F A;  1LLH A;  5GKN A;  2LBC A;  2LWX A;  3D9A C;  1NHW C;  1V33 A;  2XZU A;  2QBY B;  3C7W A;  1I94 M;  205L A;  1JR3 D;  1N78 A;  1WTH A;  3HFM Y;  2P5T A;  2YBN A;  4EKS A;  2YVB A;  3F9L A;  1LYE A;  3C8R A;  1LJI A;  3EML A;  4GRV A;  4DYG A;  1C45 A;  2CJL A;  2EKK A;  1LHI A;  4B3M M;  4ZIX A;  1DGG A;  4L4U A;  3KXE C;  1C6J A;  1SXJ C;  1DPW A;  2LYM A;  3KOW E;  2G4N A;  1GEZ A;  4XJH A;  2F32 A;  1DO2 A;  3A95 A;  1GE0 A;  4EPI A;  2RAZ X;  2NWD X;  4YX7 C;  2QBY A;  1CUQ A;  1UIF A;  3SBJ A;  182L A;  1ZVH L;  4X64 M;  3I4Y A;  1SWZ A;  3ZCB B;  3E4R A;  2KHH A;  1L80 A;  1C64 A;  1NJG A;  1G07 A; 
#chains in the Genus database with same CATH homology
 248L A;  115L A;  1LW9 A;  252L A;  4WG1 A;  231L A;  1CX7 A;  1GDW A;  3IWR A;  3DMX A;  2LYO A;  3LZ2 A;  1L71 A;  2XBS A;  2XBR A;  2DQH Y;  3GUN A;  4LFX A;  3W6E A;  161L A;  1L39 A;  5F9X A;  1DPX A;  1UBZ A;  1FDL Y;  172L A;  1D2Y A;  1L01 A;  4I7M A;  4J0L A;  3P4Z A;  4PHI A;  4CJ2 A;  1LJE A;  1QUS A;  4QEQ A;  1I1Z A;  4I7Q A;  2Z12 A;  2XJW A;  1SX7 A;  122L A;  3AGI A;  4MCK A;  3ATN A;  186L A;  4ARJ A;  1LHM A;  1DYG A;  1UIB A;  1JQU A;  2BQG A;  1GB5 A;  4B0D A;  158L A;  1B7R A;  1GBS A;  4B4I A;  3WMK A;  1G1W A;  1JJ1 A;  3SB7 A;  3G3X A;  5KXN A;  1NDG C;  140L A;  1L69 A;  5B1G A;  249L A;  2ZWB A;  1I20 A;  1D0M A;  3TXK A;  2L78 A;  1REM A;  1OWY A;  3ULR A;  1LPI A;  1L20 A;  1P46 A;  189L A;  3A3Q A;  3HBH A;  5HNL A;  110L A;  1KXX A;  4LDO A;  3L64 A;  170L A;  1B7P A;  1BWJ A;  4CHX A;  5FDJ A;  1PQD A;  201L A;  1PZY A;  5I4W A;  1AZF A;  2YBI A;  4WLY A;  1SWY A;  1L53 A;  1OQM A;  1C7P A;  3NYA A;  5E9R A;  1SQ2 L;  2O4W A;  3CDT A;  4XN6 A;  1LZ8 A;  147L A;  2D4K A;  4RLN A;  5LYZ A;  225L A;  3GUO A;  1AT5 A;  3SN6 R;  3C8Q A;  1QTH A;  1T3P A;  1JIT A;  1L82 A;  103L A;  242L A;  2I25 L;  3GUM A;  256L A;  1KXW A;  1OV7 A;  3C7Z A;  4Z3M A;  1GDX A;  4DJH A;  2CUU A;  1D3J A;  3TMW A;  232L A;  5HLL A;  1B5Z A;  1IY3 A;  2A7F A;  1XFP L;  1WVV A;  5HMV A;  2IFF Y;  3A67 Y;  1L72 A;  3OE8 A;  1VAT A;  1IOQ A;  2BQM A;  1LI2 A;  4GCE A;  1IP2 A;  1CJ7 A;  128L A;  2OEA X;  1CU5 A;  1JIY A;  1GE3 A;  1L31 A;  4CFP A;  2BLY A;  1G06 A;  1FKV A;  1DKK A;  4ETB A;  5B1F A;  1L67 A;  4GBR B;  3WPK A;  153L A;  2B6W A;  163L A;  1EQ5 A;  5APE A;  2YBJ A;  3RZE A;  4ANR A;  2ZQ3 A;  1LZY A;  1L18 A;  5A3E A;  5KXL A;  4XJB A;  1LYZ A;  260L A;  3SB5 A;  4QY9 A;  251L A;  1L38 A;  1OYU A;  259L A;  1SX2 A;  1VDT A;  1C6Q A;  4H9I A;  4J7V A;  1GF4 A;  4OW1 A;  1QSB A;  1IOR A;  3WPL A;  1LYJ A;  1QS9 A;  3SBA A;  2LC9 A;  3HBD A;  1YAQ A;  1CKD A;  4W96 A;  1C6N A;  3J6K A;  1LZ4 A;  3HUA A;  166L A;  4DD9 A;  3G3W A;  1DI5 A;  2B74 A;  2ANV A;  1CNS A;  211L A;  4PJ2 C;  2DBT A;  3HTF A;  4I7R A;  1LKR A;  3CT0 A;  1L77 A;  3GXR A;  1LZ5 A;  1L33 A;  3CSQ A;  152L A;  4NEB A;  2Z2E A;  2BLX A;  1BGI A;  2BQC A;  1YKY X;  3G3V A;  1XEJ A;  4KT3 A;  3WU7 A;  3RNX A;  1D3F A;  212L A;  4NHI A;  4DD2 A;  5KKJ A;  4RW1 A;  1JUG A;  2W1L A;  4NHP A;  1L84 A;  4XJG A;  5M1Y A;  1XGQ C;  3G3B B;  175L A;  3ATO A;  1QQY A;  132L A;  3TXJ A;  4EKR A;  2MEF A;  1QT5 A;  5C6J A;  2Q0M X;  3WUL A;  4HTN A;  3DN0 A;  3DN3 A;  1GF3 A;  1DYE A;  1CU3 A;  4NGK A;  4N9R A;  1QSQ A;  4II8 A;  1LI6 A;  125L A;  1QTB A;  2HUM A;  2RBR A;  148L E;  4NG8 A;  4H9A A;  4Z46 A;  2YBM A;  1JTN A;  2RSC A;  190L A;  1L28 A;  2W1X A;  4ARQ A;  1CUP A;  4GLA A;  1L59 A;  2O79 A;  1JJ0 A;  1PS5 A;  4H8Z A;  1LSE A;  4S0W A;  208L A;  3W6B A;  4Z98 A;  143L A;  1HEW A;  4ETC A;  3AZ6 A;  4DDA A;  150L A;  1QUD A;  3TMV A;  169L A;  1NHE A;  3WXT A;  1GAZ A;  4TUN A;  1UIH A;  4DWX A;  1C08 C;  2FBD A;  1LSC A;  3WXU A;  3FE0 A;  1LPY A;  245L A;  2ZNX Y;  4YEO A;  1OUC A;  1C6P A;  1C61 A;  4RLM A;  2BAA A;  1C67 A;  3CSR A;  3TMX A;  145L A;  4AQN A;  3DN6 A;  1YIK A;  1IIZ A;  2CWI A;  2D4I A;  4WM3 A;  1D6P A;  1VDQ A;  123L A;  1CKG A;  3AJN A;  3NY9 A;  3L2X A;  4I7K A;  1L75 A;  2G4Q A;  4A7D A;  1JPO A;  1L93 A;  4ZEE A;  1P2R A;  1SSY A;  3WL2 A;  1QTZ A;  1ZUR A;  4ETE A;  1G0P A;  1L86 A;  5KXZ A;  1T6V L;  4PPO A;  142L A;  1L00 A;  1E8L A;  1NBZ C;  4XYY A;  2BQJ A;  5J7C A;  3HU8 A;  1HEO A;  1VDS A;  2BQD A;  165L A;  1VFB C;  218L A;  2Z2F A;  1XGP C;  4HSF A;  1D0K A;  5LVJ A;  164L A;  1QDT A;  1JKB A;  4DQJ A;  1LOZ A;  5KXK A;  1EL1 A;  1JKA A;  1LYG A;  4HTK A;  1BB3 A;  2B6Z A;  4LT2 A;  162L A;  1GB9 A;  3AW6 A;  258L A;  3A91 A;  2WAR A;  4RW2 A;  237L A;  3EMS A;  4H9B A;  1LMQ A;  1LSA A;  2Z37 A;  4NGV A;  2MEH A;  7LYZ A;  1DYC A;  5FST A;  1L73 A;  4LDL A;  1D0L A;  1B7S A;  4I0C A;  1HFY A;  3P64 A;  4E3U A;  3A96 A;  4I7J A;  1T97 A;  1LZB A;  1OUA A;  4ARQ B;  1LJ4 A;  1LSG A;  5LAG A;  1B7N A;  1JHL A;  1IP3 A;  1L34 A;  222L A;  1LHL A;  4HV1 A;  4OO9 A;  6LYZ A;  2YBL A;  2EKS C;  1L94 A;  5APF A;  3T6U A;  1QTC A;  1CX6 A;  1IR7 A;  1G7H C;  3A94 A;  4P2E A;  1P6Y A;  1LJG A;  226L A;  1L79 A;  4LT3 A;  3AGH A;  1OWZ A;  4W59 A;  1CVK A;  1L21 A;  4DD1 A;  3W6D A;  1LGX A;  3WPJ A;  4LZT A;  5LVI A;  1KW7 A;  167L A;  4WO6 A;  3A93 A;  2B70 A;  234L A;  1P56 A;  3HT7 A;  1L56 A;  1O23 A;  4N1E I;  5C6I A;  1IWU A;  1IWX A;  4PGJ B;  1GF7 A;  1L63 A;  3DKE X;  1C60 A;  4DC4 A;  1FKQ A;  4W51 A;  1UID A;  2ANX A;  215L A;  1DYA A;  1XJT A;  2H9J A;  4I8S A;  1QT3 A;  1BWI A;  1QTD A;  3WVX A;  3HH6 A;  1V7T A;  1OUE A;  3TXH A;  2OTZ X;  1LZG A;  3LHM A;  1DI3 A;  2DQG Y;  2RBS A;  1KIP C;  1WTM A;  1B5Y A;  5KXO A;  2OU9 A;  1HEM A;  3A6C Y;  5LXW A;  1L07 A;  2RB2 X;  254L A;  3RU5 A;  1L96 A;  1L99 A;  5D5F A;  154L A;  4N1C C;  193L A;  2FYC A;  5DLA A;  1JTP L;  4H9H A;  149L A;  1IWW A;  2LZT A;  2MEC A;  4WLX A;  1IOT A;  1HEP A;  1G0Q A;  4NSJ A;  2BQN A;  2MEI A;  2D6B A;  4WG7 A;  2B6T A;  112L A;  1GBY A;  1L0K A;  1LJ3 A;  1B7Q A;  1NBY C;  1C6E A;  1HFZ A;  102L A;  3DN4 A;  3MGW A;  1W08 A;  1B6I A;  5DL9 A;  1Z55 A;  1LSP A;  1IP7 A;  3HUK A;  1HER A;  1NHB A;  1QS5 A;  5F16 A;  261L A;  137L A;  1JEF A;  1C6H A;  1HEQ A;  1L66 A;  1IC4 Y;  1HMK A;  1QUH A;  1QIO A;  1L06 A;  1LZS A;  3LYZ A;  1GF6 A;  2B6Y A;  1IWY A;  3SB6 A;  1ZVY B;  2YSS C;  1B5U A;  1BQL Y;  3B0K A;  4LZM A;  1OUI A;  113L A;  1FLQ A;  2LHM A;  1L11 A;  3WVY A;  3N9A A;  1L49 A;  1LZE A;  210L A;  2A4T A;  3C7Y A;  5DN5 A;  1LZT A;  191L A;  1REZ A;  1YL0 X;  207L A;  5KXP A;  4EXM A;  4AXT A;  1L37 A;  4WL7 A;  253L A;  2ZIJ A;  3AZ5 A;  1L02 A;  3C80 A;  1L13 A;  2OE4 X;  4EPF A;  2RBO A;  1OUG A;  1MLC E;  1L14 A;  4NGY A;  3A3R X;  1LSM A;  5APC A;  1L44 A;  4B49 A;  4EKP A;  1L08 A;  3FI7 A;  5AMY A;  1QT7 A;  1GB2 A;  3OE9 A;  4NIJ A;  1L36 A;  4W58 A;  4I7P A;  4NFV A;  1K28 A;  1C63 A;  1B9O A;  3W6C A;  2HUB A;  1GF5 A;  1LSB A;  3WUA A;  1L47 A;  4KPM A;  1NKH A;  1C6D A;  1TEW A;  2MEB A;  1OUF A;  1GFG A;  235L A;  1L60 A;  2HED A;  1V7S A;  1G7I C;  156L A;  5F9U A;  1GBO A;  1L58 A;  1IP1 A;  1LMT A;  5I4X A;  4ET8 A;  141L A;  1XEP A;  2RAY X;  184L A;  1LYO A;  1QT4 A;  2NTG A;  196L A;  178L A;  4NGI A;  1KY1 A;  1L74 A;  1YRO A;  1JTM A;  1QDR A;  5L3I A;  1L40 A;  1OUD A;  1L45 A;  3TMU A;  2GV0 A;  1RJC B;  3WUN A;  1IOC A;  1DYD A;  129L A;  1LZ1 A;  1L57 A;  5LIO A;  4G9S A;  120L A;  3DMV A;  3M3U A;  1L50 A;  2PC2 A;  3CQL A;  5IHG A;  3K3T A;  209L A;  1D2W A;  4YOP A;  2ZYP A;  5HNC A;  4WOA A;  1LJF A;  4W54 A;  173L A;  195L A;  1GEV A;  111L A;  4GN4 A;  2F4G A;  1CV0 A;  240L A;  2RBP A;  4LYC A;  5KJ9 A;  1C62 A;  3SB8 A;  4K5Y A;  2EQL A;  1HHL A;  1G7L C;  1F6R A;  1L35 A;  1LMO A;  2HUK A;  3HDE A;  1CV5 A;  1XJU A;  4BAP A;  1H87 A;  1VDP A;  4GCC A;  5ILF A;  3AW7 A;  3A90 A;  2Y8P A;  3QE8 A;  4GCD A;  1CU2 A;  133L A;  3F6Z A;  1TBY A;  1DI4 A;  4BAF A;  185L A;  4M4O A;  1L91 A;  3CDQ A;  1DKJ A;  1CU6 A;  1B2K A;  144L A;  138L A;  1ZWN A;  4NY5 A;  1LYI A;  1G0K A;  1OVH A;  1GFT A;  5L3H A;  4W52 A;  2HUL A;  1G0M A;  5KXM A;  4B4J A;  1IWZ A;  2W1Y A;  104L A;  2HU1 A;  4G4C A;  1UA6 Y;  1AT6 A;  1FN5 A;  198L A;  4W55 A;  3IJV A;  1L61 A;  1CV1 A;  1EPY A;  1L0J A;  1XGR C;  2H5Z A;  5DM9 A;  3LN2 A;  1L62 A;  3W6A A;  1IWT A;  2B72 A;  1GFE A;  118L A;  4N5R A;  4HJY A;  1WQP A;  1QTK A;  1LJN A;  1P37 A;  1P36 A;  244L A;  2HEE A;  4NGJ A;  206L A;  5B05 A;  1XEK A;  2I6Z A;  1D6Q A;  1HC0 A;  3GXK A;  4O34 A;  8LYZ A;  3D3D A;  3FA0 A;  4H92 A;  5IEL A;  2B7X A;  1UCO A;  1IY4 A;  1LJJ A;  4I7O A;  4LYB A;  4W56 A;  4N0J A;  2XQO A;  5F81 A;  1BB6 A;  3WH1 A;  3BKV A;  3VWO A;  1GFU A;  4DQ5 A;  1G0G A;  4LDE A;  4WM4 A;  3HH3 A;  5LAF A;  1LSF A;  1L85 A;  2F4A A;  1GB7 A;  2QB0 B;  1L10 A;  155L A;  2NTH A;  1L09 A;  1PQO A;  1WTN A;  1C6C A;  1UAC Y;  1QT6 A;  2A7D A;  4IJ4 A;  1FBI X;  1OP9 B;  1D3N A;  255L A;  9LYZ A;  5JEN B;  4QGZ A;  4GN3 A;  5EBH A;  5LYM A;  1L83 A;  2F2N A;  5I53 A;  3WU9 A;  1GFJ A;  5LA8 A;  223L A;  3A8Z A;  5LVK A;  3N9C A;  1L95 A;  4XJD A;  1IP4 A;  4WM1 A;  194L A;  2DQD Y;  1HNL A;  3LYO A;  1XGU C;  1KNI A;  1LJH A;  4H8X A;  188L A;  2OTY X;  1L64 A;  1QUT A;  2FYD A;  3AZ4 A;  3SP3 A;  1IX0 A;  4LYT A;  1IWV A;  1TDY A;  1B5X A;  1CKF A;  219L A;  262L A;  2EPE A;  1YAM A;  2Z18 A;  3AB6 A;  5KXS A;  4IAS A;  5I4Y A;  1BVX A;  5F14 A;  3HT8 A;  187L A;  1HEN A;  4C3W A;  4NWE A;  2VB1 A;  1KS3 A;  2OU0 X;  2O7A A;  2F47 A;  3TXB A;  213L A;  3HH5 A;  1ALC A;  3WU8 A;  4FDY A;  4NHS A;  1L88 A;  2DQF C;  1C6A A;  1GFR A;  3HTB A;  3RT5 X;  1LWK A;  1FLW A;  4BS7 A;  5KXR A;  1GE1 A;  1YAP A;  1C10 A;  2G4P A;  3N9E A;  4PRU A;  4YEN A;  1CU0 A;  1L05 A;  1LZD A;  1JJ3 A;  220L A;  1AKI A;  1OUH A;  1LAA A;  1I6S A;  1C65 A;  114L A;  1L32 A;  3PDS A;  1LYF A;  1GWD A;  1LSN A;  127L A;  5L9J A;  1SSW A;  146L A;  1JIS A;  1L89 A;  168L A;  2MEE A;  1F10 A;  1NWG A;  151L A;  4EMN A;  4DKL A;  1PQI A;  2C8O A;  4WO9 A;  2YDG A;  2HEB A;  4DD0 A;  3OK0 A;  3WW5 A;  4R0F A;  4UWN A;  4YEM A;  2B6X A;  217L A;  3W3E A;  2BQI A;  1LSZ A;  3TXI A;  3RUN A;  4N8Z A;  4DDB A;  3TXG A;  3TXF A;  4H9F A;  4HPI A;  1L29 A;  4HP0 A;  4EKQ A;  1L19 A;  5II3 A;  3QY4 A;  2OU8 A;  1CKC A;  1LCN A;  1C6G A;  1L81 A;  1QSW A;  1XGT C;  4L41 A;  3EXD A;  1PQJ A;  1RFP A;  4HJZ A;  134L A;  5D5C A;  4CGE A;  3CDV A;  1D9W A;  1L76 A;  4TTD A;  221L A;  2BQE A;  4EOF A;  4ARM A;  1LTM A;  3G3A B;  3HTD A;  5KKI A;  1L15 A;  3B72 A;  4XEN A;  1DYB A;  1LWG A;  2DQC Y;  2DQE Y;  171L A;  1CJ9 A;  1LMP A;  3B0I A;  4WM6 A;  1GB6 A;  2OE9 X;  3HTG A;  5LVH A;  1IR9 A;  1IVM A;  1L51 A;  1LSY A;  229L A;  246L A;  1T6H A;  1QUO A;  4E97 A;  176L A;  1LZ9 A;  1GE4 A;  1JTO L;  1LMN A;  5E4P A;  4TX7 A;  1YL1 X;  3HT6 A;  4OOT A;  5KXY A;  3OE6 A;  3WUM A;  2LZM A;  1J1X Y;  1L52 A;  109L A;  1NF5 A;  1RI8 B;  3DMZ A;  1C66 A;  1B7M A;  3P68 A;  3C8S A;  4DD3 A;  2H9K A;  1A4V A;  1LGU A;  4D9Z A;  1L12 A;  4UWU A;  1L22 A;  1LYS A;  1HSW A;  4YXC A;  6LYT A;  3LZT A;  4IAP A;  5I14 A;  3KAM A;  228L A;  4BAD A;  3LYM A;  1BWH A;  1GBZ A;  126L A;  4HJV A;  3IJU A;  1FLU A;  1QT8 A;  4DDC A;  1GFV A;  1G0J A;  1PQM A;  5KXX A;  1BB4 A;  3GUI A;  5LA5 A;  1BHZ A;  3RW8 A;  1L54 A;  200L A;  5HQ1 A;  1BB5 A;  1GAY A;  1IC5 Y;  4XJI A;  4ML7 A;  1H6M A;  1KY0 A;  2N5Z A;  1C69 A;  4DQ7 A;  1DYF A;  7LZM A;  1YKX X;  4GCF A;  1D3M A;  1LHH A;  1QSA A;  1YAO A;  5FEK A;  4NSI A;  1KIQ C;  1IEE A;  4R6C A;  1G1V A;  1B7O A;  241L A;  1LSD A;  1IC7 Y;  1LYY A;  1CTW A;  1WQQ A;  2BQK A;  4NGZ A;  2YBH A;  3PBL A;  1JKC A;  3EBA B;  1CV4 A;  4ARL A;  3AZ7 A;  4ZPU A;  1DZB X;  2F30 A;  1CJ8 A;  1G0L A;  4I7S A;  2LCB A;  3GUL A;  5KXT A;  4TSC A;  1GD6 A;  250L A;  159L A;  2C8P A;  4HTQ A;  1OV5 A;  4H9C A;  4DAJ A;  3CDO A;  1C6F A;  157L A;  2RH1 A;  3E3D A;  238L A;  5T3F A;  5DN4 A;  1LJK A;  1LZ6 A;  1YKZ X;  4H8Y A;  1GE2 A;  2ZIK A;  1JKD A;  3LYT A;  1JWR A;  1B7L A;  1OUB A;  3ZEK A;  1HFX A;  5FEL A;  4YXA C;  1KW5 A;  1JSE A;  3NY8 A;  1B0D A;  5FCP A;  4QDN A;  4LYM A;  3HWL A;  247L A;  1XSF A;  239L A;  1WQN A;  177L A;  2X0A A;  1PQK A;  192L A;  1D9U A;  1CJ6 A;  1L03 A;  224L A;  1G7J C;  1UIA A;  1L17 A;  4TWS A;  4LFP A;  1REY A;  4J1B A;  4H9E A;  1C6L A;  4DD7 A;  3F8V A;  1L04 A;  4LT1 A;  5C6L A;  1BVK C;  1LZC A;  4H94 A;  2D91 A;  4OWB A;  4X3B A;  2F2Q A;  3V2W A;  4HPE A;  3D4S A;  1IR8 A;  1J1P Y;  4CFO A;  3M18 B;  1C68 A;  1L25 A;  1LZR A;  1L42 A;  1OVJ A;  3FAD A;  2CDS A;  1UIG A;  216L A;  3WW6 A;  1GPQ C;  1L43 A;  1UC0 A;  1HSX A;  174L A;  4WL6 A;  4GLV A;  3P66 A;  1GB0 A;  2AUB A;  3SBB C;  2DQI Y;  1GB3 A;  4G4B A;  2HU3 A;  3WYH A;  2B73 A;  1IOS A;  2B75 A;  4U3X B;  257L A;  1L23 A;  3OJP A;  4H1P A;  2HEF A;  4LGK A;  4DT3 A;  4AGA A;  1DQJ C;  1YQV Y;  1UIE A;  1B5V A;  1C46 A;  199L A;  3OE0 A;  1LHK A;  1C6B A;  2BQB A;  5LIN A;  230L A;  1LYD A;  2ZQ4 A;  3HH4 A;  4ARM B;  3C83 A;  3CT1 A;  2BQF A;  1L26 A;  4NSG A;  1F6S A;  1WQR A;  3QNG A;  1WVU A;  236L A;  5B59 A;  1WQM A;  197L A;  1GBX A;  1GB8 A;  1CKH A;  2QAR C;  1YIL A;  4B4E A;  1LI3 A;  2RBN A;  4WM5 A;  1IP6 A;  2Z38 A;  1GXV 2;  1CV3 A;  4KL7 A;  4HV2 A;  2LZ2 A;  2W1M A;  1WQO A;  6LZM A;  1LKS A;  227L A;  4ET9 A;  3C81 A;  1SLY A;  2BQO A;  2I26 L;  1J1O Y;  3B0O A;  1T8A A;  4NGW A;  3GUK A;  3TXE A;  4I7N A;  1L70 A;  2HTX A;  2HEA A;  4NGL A;  1C43 A;  2OE7 X;  2Z6B A;  130L A;  2Q9D A;  1RCM A;  4NHT A;  3HU9 A;  5B06 A;  4MR1 A;  4XAD A;  4KXI A;  1UUZ C;  5KY1 A;  183L A;  1HEL A;  1P3N A;  1L55 A;  1L65 A;  1L46 A;  1TCY A;  3CDR A;  4WMG A;  139L A;  1EQ4 A;  2FBB A;  4OOO A;  1TAY A;  4H93 A;  1NMM A;  1LZN A;  1GXX A;  1CV6 A;  3QAK A;  3T36 A;  2IHL A;  5IDD A;  2DQJ Y;  1L87 A;  1MEL L;  1C6K A;  5B07 A;  2BQA A;  2RB1 X;  1HML A;  4UWV A;  4LT0 A;  4PJZ A;  1DXJ A;  5LVG A;  2ZIL A;  3V2Y A;  2Q9E A;  5LYT A;  3LZM A;  1C6M A;  5FHW A;  1FLY A;  1T8G A;  3J4G A;  2CGI A;  5KXW A;  4GN5 C;  1YAN A;  2DQA A;  1GFH A;  1I56 A;  4YF2 A;  5I54 A;  1W6Z A;  3JR6 A;  3VW7 A;  4WLD A;  4TSB A;  1P5C A;  3HT9 A;  2HEC A;  1B5W A;  3HDF A;  108L A;  4NSH A;  4NGO A;  2MEA A;  4PRQ A;  4B1A A;  1EQE A;  1L92 A;  4MST A;  1C6T A;  180L A;  181L A;  4NHQ A;  1KIR C;  2MEG A;  4WLT A;  4Z41 A;  4YM8 A;  3UON A;  1L98 A;  1L48 A;  3AGG G;  2ZNW Y;  3GUP A;  4ZFP A;  2BQL A;  1ZMY L;  2XTH A;  1REX A;  1QTV A;  1IO5 A;  2Z19 A;  3HBE X;  4H90 A;  1JSF A;  3A6B Y;  1ZYT A;  5K7O A;  1P7S A;  1C6I A;  1HF4 A;  1LHJ A;  1A2Y C;  3TXD A;  1L27 A;  4RDS A;  1VED A;  4LYO A;  1GFA A;  2RB0 X;  160L A;  3A34 A;  4H91 A;  4NG1 A;  1GF9 A;  1L97 A;  1NDM C;  2B5Z A;  131L A;  1JTT L;  3ODU A;  4ETA A;  4NWH A;  1LMA A;  3CSZ A;  1L24 A;  1L16 A;  2LYZ A;  1VAU A;  4GCB A;  4OWC A;  1TLA A;  1LZA A;  2RBQ A;  2IGC A;  3CT5 A;  233L A;  3DN2 A;  5ILC A;  2ZYC A;  4LYZ A;  4J1A A;  3HUQ A;  1UIC A;  243L A;  1OUJ A;  4I7T A;  1L68 A;  5I5Q A;  1LGW A;  5A3Z A;  3DN1 A;  3C82 A;  4EJ4 A;  1GHL A;  1GF0 A;  4OWH A;  3ZVQ A;  1F0W A;  3BKH A;  2MED A;  1LMC A;  1ZV5 L;  3GUJ A;  1L30 A;  4G49 A;  4ETD A;  5HMJ A;  3P65 A;  4XJF A;  1QTE A;  5APD A;  1INU A;  2DKV A;  2D4J A;  3K2R A;  1GF8 A;  2EIZ C;  1LYH A;  4M6D A;  1RE2 A;  3SB9 A;  1P2L A;  1T8F A;  1KXY A;  3ZVQ B;  3W6F A;  1L41 A;  107L A;  3RZ4 A;  1GFK A;  4OWA A;  1NQI A;  214L A;  3AYQ A;  1XEI A;  4C5F A;  4FJR A;  3EO5 A;  4ARP A;  3DNA A;  1QUG A;  135L A;  1P64 A;  2BQH A;  3FI5 A;  4G4H A;  4W94 A;  2BPU A;  3A92 A;  5LZM A;  4WM2 A;  3CB7 A;  2Z39 A;  4IAT A;  1AM7 A;  4I7L A;  3B6L A;  3DN8 A;  4W57 A;  4OWE A;  1BB7 A;  1P2C C;  1L90 A;  4PK0 A;  1G7M C;  1OVK A;  119L A;  1GBW A;  4W53 A;  1IP5 A;  1N4F A;  1LLH A;  3D9A C;  3C7W A;  205L A;  1WTH A;  3HFM Y;  2YBN A;  4EKS A;  2YVB A;  3F9L A;  1LYE A;  3C8R A;  1LJI A;  3EML A;  4GRV A;  4DYG A;  1C45 A;  2CJL A;  1LHI A;  4ZIX A;  1C6J A;  1DPW A;  2LYM A;  2G4N A;  1GEZ A;  4XJH A;  2F32 A;  3A95 A;  1GE0 A;  4EPI A;  2RAZ X;  2NWD X;  4YX7 C;  1CUQ A;  1UIF A;  182L A;  1ZVH L;  1SWZ A;  1L80 A;  1C64 A;  1G07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...