1QUTA

The soluble lytic transglycosylase slt35 from escherichia coli in complex with n-acetylglucosamine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Escherichia coli lytic transglycosylase Slt35 reveals a lysozyme-like catalytic domain with an EF-hand.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
total genus 108
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qutA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qutA02
2BQAA 4R0FA 1FN5A 1LMOA 3ATNA 1IWWA 2MEAA 1JKBA 1AT5A 3A91A 3A6CY 5LVHA 4H9IA 2X0AA 4GCFA 1FLYA 1BQLY 1YAOA 4C3WA 2NWDX 3CT0A 3OJPA 4NSGA 3D9AC 4PJ2C 3ZEKA 4X3BA 1YKYX 4ZEEA 4HJVA 2DQFC 4L41A 3WL2A 2Z37A 1GBOA 5I5QA 5I4XA 1XGRC 1WQMA 2A7FA 2YBMA 3EBAB 4WM5A 4XJIA 1LSCA 4B4EA 3AZ4A 1LZ1A 2BQHA 2MEFA 3WULA 2Z18A 1BB6A 1QSAA 1HEWA 3TXGA 1D6PA 4I8SA 4DDBA 1RCMA 4Z98A 1F6SA 1IORA 1EQ5A 1JSFA 1C45A 4H9FA 3TMWA 1GHLA 4WLXA 1OUCA 1YKZX 1NKHA 5KXLA 4ANRA 2CDSA 1GF4A 1LZBA 1QTKA 3E3DA 1IIZA 1UIEA 1XEIA 1KIPC 3LYOA 4W94A 5KXMA 1XSFA 5APFA 3AW6A 3WXTA 1UIFA 1G7JC 4M4OA 4ETAA 1HF4A 1FDLY 1GWDA 2D4IA 4LYMA 1YL0X 5KKIA 5KXYA 1HFYA 2ZYCA 1IX0A 4G4BA 6LYZA 1OUIA 1GB0A 1UIBA 4NEBA 1LTMA 1FKVA 1IWVA 4G4CA 4PRUA 3WPKA 4B4JA 1IP6A 2HEAA 8LYZA 4B49A 4DWXA 4IJ4A 1HMKA 1IP2A 2W1YA 4NHPA 1IWXA 1RI8B 4J1AA 4MSTA 1JTPL 2LYZA 1B2KA 3BKHA 3FI7A 4A7DA 2C8PA 1W08A 3WPJA 4XJFA 4WG1A 3TMXA 1JSEA 5M1YA 2DQJY 1UIAA 2H5ZA 5KXNA 4XJGA 5LA5A 1ZMYL 3B72A 2DQDY 2YDGA 2HEDA 5C6LA 4H1PA 1HELA 1ZV5L 5LINA 2EPEA 4HTKA 4OWAA 132LA 4QEQA 2DKVA 1VFBC 3W6AA 1LSAA 4H8YA 4N1CC 4XJHA 1B5ZA 1LJHA 1YILA 3AB6A 1GFGA 4WL6A 1BHZA 4WM6A 1DI3A 1IP7A 1UACY 1ZVYB 2RSCA 3P65A 1IR9A 5HNLA 4ETEA 1GE2A 4RLMA 3WUMA 4TSBA 1EQEA 4GCDA 4CFPA 2BPUA 5HMVA 3LN2A 3TXEA 1LYSA 3W6FA 5KY1A 2Q0MX 1GB5A 1GPQC 3AZ7A 1IEEA 2MECA 4NGZA 1LZRA 2BQDA 5DN4A 4WOAA 4GCBA 3IJUA 1LSGA 1HEQA 1XGQC 4LYBA 1LSDA 2HEFA 4R6CA 4BADA 4EOFA 4J0LA 2I26L 4G4HA 1C7PA 1B7SA 1JKDA 1YAMA 2ZNWY 1GBXA 1LZYA 2LYOA 4KPMA 1IC7Y 1GXXA 1NBZC 1YIKA 2D4KA 3HBHA 4XENA 1B7QA 1GAZA 3WW5A 2BQJA 1NDGC 4PHIA 5LVIA 5IHGA 135LA 3B0KA 2MEDA 5HLLA 2CJLA 1HENA 2I6ZA 4HSFA 1XGUC 4ET9A 3WW6A 1LZTA 1LJIA 1BGIA 1IOSA 3LYZA 4HTQA 4NG8A 3TXKA 5KJ9A 2BQIA 1XGTC 1HERA 4H8XA 1B0DA 1MLCE 5LYZA 3WU7A 1OUJA 3CT5A 4ETBA 1FBIX 2BQCA 1JTTL 4KL7A 1JISA 4DYGA 4TX7A 1VEDA 207LA 3AW7A 4DC4A 2G4NA 4RDSA 4CJ2A 1LZ5A 5IELA 3K3TA 1DI4A 4O34A 1B5WA 1LJEA 3A94A 1REZA 1GBZA 1GF0A 4NGLA 3TXBA 4H9AA 2BQLA 4LYCA 1GB2A 1CNSA 1UIHA 4LZTA 2AUBA 5ILFA 1VDSA 4N9RA 4NHSA 5FELA 3AGHA 1LSZA 3WVYA 2ZILA 5LAGA 1WQPA 4ET8A 2G4QA 3AZ5A 1QTEA 1NDMC 2F2NA 1JJ0A 1FLQA 4NHIA 1YROA 2XBRA 4LFXA 2H9JA 3M3UA 4XJBA 2F4AA 1YQVY 5B06A 9LYZA 2IHLA 4NIJA 1NQIA 5HMJA 1GB8A 1HSWA 1LMTA 4LT3A 3TMUA 1LMCA 4NGWA 1B7MA 4XJDA 1T6VL 3QNGA 1REXA 2WARA 2DQIY 1KXXA 5DM9A 2HECA 2MEBA 1LJ4A 3WYHA 4J7VA 1LSFA 1GF3A 5C6IA 4UWVA 1WQOA 1C43A 1IWTA 4QY9A 3AZ6A 4H9HA 1OUDA 1KXWA 2HEEA 3TMVA 1IWYA 4DD7A 1C46A 193LA 4LT2A 1OP9B 3RNXA 4U3XB 1LSBA 2XBSA 1DPXA 1LOZA 3WUNA 1QDRA 1B7NA 2ZQ3A 1D9UA 5KXWA 1LZEA 3OK0A 1BVKC 4H94A 4CGEA 1FLUA 4G49A 2LHMA 5I54A 1WTMA 3CB7A 4YENA 1B7LA 1H87A 5D5FA 4GN3A 1XFPL 2HTXA 1V7SA 3AJNA 5AMYA 1SLYA 1GBSA 4WMGA 1JJ3A 1LJFA 1LYZA 2D91A 4LFPA 1J1OY 1BVXA 2W1LA 3LZTA 4NFVA 1CJ9A 2IFFY 3W6CA 4DD3A 2BQFA 2YBIA 5EBHA 1LZSA 1G7LC 1UCOA 1TEWA 3ULRA 3HBEX 1IR7A 1LHKA 3CSQA 1LHMA 3WU9A 4OW1A 1UIGA 4LYTA 5B07A 4HJZA 4GN4A 4E3UA 5FEKA 2DQGY 1EQ4A 5LYMA 1CJ8A 1AKIA 1UIDA 5F9XA 5APCA 4TSCA 4QGZA 4ZFPA 2GV0A 2YBLA 2EKSC 3GXKA 1GFTA 1HEMA 1LYYA 1LZCA 2ZYPA 4HP0A 1LCNA 5K7OA 2EIZC 2HUBA 4Z3MA 3RW8A 4OWEA 3W6BA 5IDDA 4LYZA 1HC0A 2BQMA 4H9CA 1LHHA 3ZVQA 1C08C 1UUZC 1YAQA 2F30A 2YBJA 1BB7A 3HFMY 4H90A 4WG7A 1REYA 4AXTA 1LHLA 1LSYA 2EQLA 1LJ3A 1JJ1A 2Z39A 1J1PY 1OUFA 1ZVHL 3P64A 1DKJA 4RW1A 5APEA 5L9JA 3MGWA 1IOCA 5LAFA 5F81A 2BQEA 3CT1A 3J4GA 4CFOA 1GFHA 1B7OA 3T6UA 3A8ZA 3CSRA 1GDWA 5JENB 1QQYA 2B5ZA 3B6LA 1LAAA 4NGIA 4NGYA 4WM2A 1DZBX 153LA 4CHXA 5APDA 1ALCA 2YSSC 5I4WA 2YVBA 1HFZA 3QY4A 3B0OA 1LJKA 1UC0A 2D6BA 4TWSA 194LA 1MELL 3CSZA 1TAYA 3WMKA 1E8LA 3CQLA 1IP1A 4OWBA 1XEKA 2BQOA 1GF8A 1JWRA 1GE3A 4H9EA 3W6DA 3W3EA 1WVVA 3A3RX 1IR8A 1NBYC 1PZYA 4HPIA 1BB4A 1F10A 1OUGA 1LZGA 1BWHA 3VWOA 1JIYA 1GBYA 1GFVA 4OOOA 3TXIA 1D0LA 1LYOA 4C5FA 5I53A 133LA 1DI5A 4J1BA 5DL9A 1GE1A 4WM1A 2DBTA 5KXZA 3P66A 1LZ9A 1GB6A 1O23A 2BQGA 5HNCA 5KXTA 2LZTA 1LZ4A 4HPEA 1IC4Y 1IY4A 1BB5A 4NY5A 5KXOA 3QE8A 1QDTA 2D4JA 5L3HA 4D9ZA 3A92A 5KKJA 3RZ4A 1GF7A 1IOQA 4LGKA 3A67Y 3AYQA 4DD0A 1QUTA 1VDPA 4DD9A 4LT0A 1VDQA 3A93A 4WLYA 3M18B 3TXDA 4B1AA 2Z12A 1LZ8A 7LYZA 1WQQA 2A7DA 3WU8A 4LYOA 4BAFA 1OUEA 2F4GA 4RW2A 4DDCA 4YOPA 2PC2A 4HV1A 5LVJA 3TXJA 3BKVA 3N9EA 1JPOA 4ETDA 5FDJA 2VB1A 1GFUA 5DLAA 3HBDA 1FKQA 5L3IA 6LYTA 1JITA 4WO9A 1B7RA 4NGVA 5KXPA 1INUA 3RU5A 4DDAA 3A34A 1DPWA 3WH1A 4YEOA 4BS7A 4WL7A 5LIOA 3LYTA 4Z46A 2YBNA 5C6JA 1REMA 2CWIA 1T3PA 4PGJB 2LYMA 4ETCA 4G9SA 4HV2A 1JTOL 1HSXA 1G7IC 3B0IA 4H8ZA 2DQEY 4MCKA 3TXHA 4BAPA 5KXSA 1UA6Y 1LSEA 2XJWA 4NSHA 4NWHA 1LJNA 2Y8PA 1LMNA 1LZDA 4OWCA 3IWRA 1GBWA 1A2YC 5B1GA 2H9KA 2Z2EA 1EL1A 1TCYA 1NF5A 3TXFA 1LSMA 1YANA 1QUSA 1WQRA 4YF2A 1JKCA 1RJCB 4NGJA 5B1FA 1HHLA 1GFAA 1TDYA 4MR1A 5ILCA 5F14A 5HQ1A 1CKHA 1HNLA 3N9CA 4XYYA 4FJRA 5F16A 3LYMA 4IATA 4B4IA 5A3ZA 5LXWA 2HU3A 1J1XY 4WM3A 1LJGA 4DD1A 4GLAA 2DQAA 3F6ZA 2FYCA 1UICA 1F0WA 1OUAA 1GXV2 4HTNA 4PRQA 4DD2A 1BB3A 1GAYA 3LHMA 1Z55A 1WTNA 4YM8A 1JHLA 4FDYA 4NSJA 4HJYA 4NGOA 1DXJA 2ZNXY 3G3AB 1C10A 2ZIJA 2FBBA 1GE0A 4H91A 4NHQA 4RLNA 3RT5X 4GCEA 2I25L 4LT1A 4NWEA 4Z41A 3IJVA 3P68A 2MEGA 3SP3A 1D0MA 2BQNA 1GB9A 1DQJC 4GN5C 4I0CA 1CKFA 5B59A 1VDTA 1IVMA 1CKDA 4OWHA 3GXRA 208LA 1CJ6A 4H92A 1LSPA 4WLTA 2C8OA 1VAUA 4M6DA 4IASA 5II3A 3W6EA 1FLWA 3EMSA 1GDXA 5LVGA 1GD6A 1KXYA 5T3FA 3T36A 1RFPA 1B5UA 1GFKA 3A3QA 2YBHA 1AT6A 1LZAA 5A3EA 1N4FA 5LYTA 1IOTA 1AZFA 5KXKA 3WUAA 5DN5A 1P2CC 1KIQC 4UWNA 1HFXA 4WM4A 1DKKA 1LMPA 1YKXX 1LZNA 4PPOA 2HEBA 5E9RA 1XEJA 1IC5Y 2LZ2A 4NGKA 1YAPA 1WVUA 3FE0A 4NHTA 4TTDA 2MEIA 3P4ZA 1H6MA 4N8ZA 1JUGA 1LJJA 1A4VA 1WQNA 4H9BA 4KXIA 2BLYA 1YL1X 1HEPA 1I56A 2DQCY 3G3BB 5LVKA 3D3DA 4ZIXA 1GB3A 4N5RA 1G7MC 5FHWA 4YEMA 2Z38A 5F9UA 1IWZA 1LHJA 5I4YA 1XGPC 3A95A 5KXRA 2HU1A 1B7PA 1LKRA 2BQBA 5LA8A 1B5VA 1BWJA 1LPIA 2W1MA 3KAMA 5FCPA 3EXDA 1IO5A 1CJ7A 1GF5A 1SQ2L 3N9AA 4NSIA 4B0DA 2Z2FA 1NWGA 4GLVA 1I20A 1IP5A 3WXUA 1JKAA 2G4PA 4N0JA 2MEHA 1GB7A 2ZWBA 4P2EA 1VATA 2ZQ4A 5D5CA 1GEZA 1GF9A 4OOTA 2BLXA 2Z19A 1D0KA 4H93A 4TUNA 3EO5A 1B9OA 3LZ2A 1LMAA 4UWUA 1OUBA 4WO6A 3WVXA 154LA 1JEFA 1HMLA 5FSTA 1TBYA 2DQHY 1IP4A 4II8A 1I1ZA 1GFJA 2MEEA 2BQKA 1LMQA 2CGIA 1UBZA 1GFRA 1B5YA 1LHIA 1OQMA 4NG1A 4KT3A 2FYDA 5E4PA 3A6BY 1HEOA 2W1XA 3AGIA 2XTHA 1G7HC 4GCCA 1CKCA 2BAAA 4XN6A 5J7CA 1IWUA 1GFEA 3ATOA 4XADA 1NMMA 1B5XA 4AGAA 4QDNA 4DT3A 3A96A 4WLDA 1NHEA 1RE2A 1GE4A 1LKSA 1KIRC 1LSNA 2N5ZA 1IY3A 1QSWA 2FBDA 4EMNA 3J6KA 4W96A 4N1EI 1D6QA 1W6ZA 3AGGG 1CKGA 1BWIA 1LZ6A 1PS5A 1V7TA 4ML7A 3WPLA 3ZVQB 5KXXA 1OUHA 134LA 5B05A 2ZIKA 1QIOA 1GEVA 1IP3A 1AM7A 1F6RA 1GF6A 3A90A
chains in the Genus database with same CATH superfamily
1CU2A 1ZMUA 2R0IA 1LMOA 3F9LA 1T8AA 1G1WA 1IWWA 1JKBA 2OU8A 3A6CY 4H9IA 1L2BA 4YXAC 4GCFA 1FLYA 1AIPC 1BQLY 3Q8GA 3GUOA 3D9AC 4NSGA 4PJ2C 4X3BA 169LA 1Q3CA 1XGRC 4AKHA 4WM5A 3HJ8A 1C65A 2MR9A 3I04M 1L83A 1ZQ9A 1LZ1A 212LA 118LA 2Z18A 1QSAA 1HEWA 3DN4A 1L69A 1RCMA 3F92A 4Z98A 3NWLA 1EQ5A 1C45A 4H9FA 2H5XA 1L35A 4IIWA 1CV4A 1OUCA 3KSJA 5KXLA 1L92A 1P2LA 1LZBA 3GLIE 1L19A 1KIPC 5APFA 2XZFA 3U60A 3WXTA 4M4OA 4ETAA 1KW7A 4LYMA 1QS9A 1GB0A 4PRUA 1FKVA 1IWVA 4G4CA 4EXMA 3KFUG 2MJ5B 2RRUA 5FTLA 1EPYA 4M0DA 2W1YA 4MSTA 2RH1A 2Z3XA 4LZMA 3GLIA 210LA 4FCTA 1QS5A 3AJIB 4D82A 2YDGA 3ODUA 1OVHA 4H1PA 4I7TA 1VEGA 2OO9A 4QEQA 165LA 2B75A 167LA 3U61A 4B08A 109LA 1N75A 4WM6A 1UACY 1IR9A 1D2YA 1GE2A 4RLMA 186LA 4R7GA 1EQEA 4GCDA 2ZAMA 2L6OA 1LWGA 1JTMA 5KY1A 1XXHE 3SMPA 1GPQC 5BPVA 195LA 3AZ7A 1IEEA 1LZRA 1TGUA 1TDHA 4GCBA 205LA 1EIJA 1DV0A 1XGQC 4R6CA 3GRVA 4J0LA 2I26L 4G4HA 1JKDA 1IC7Y 139LA 1PQJA 2D4KA 2KRUA 1G71A 5LVIA 1LI2A 5IHGA 1L54A 5ITXE 3E21A 1GL6A 2ANVA 1T43A 4AG6A 1BGIA 1LJIA 1P7SA 5KJ9A 1HERA 4YY3M 1MLCE 1LYIA 1L50A 3CT5A 2BQCA 1WIVA 1MN3A 3VDPA 2G4NA 4IJFA 221LA 1OWZA 5IELA 226LA 2BWBA 2UUBM 170LA 4DV5M 1LJEA 4O34A 1GBZA 5ITYA 2BQLA 2KW0A 1GB2A 1L98A 1VDSA 1TF0B 3WVYA 2XH9A 1R6BX 3SMSA 2LCBA 4ET8A 3U60B 2DAGA 1QTEA 2F2NA 2JZ0A 1Q3BA 2F2QA 1OAIA 2IHLA 4I7RA 1D3JA 1L34A 1LMTA 4LT3A 4NGWA 1L39A 1B7MA 2QP9X 103LA 3D4SA 3QNGA 5DM9A 1T97A 4J7VA 4LJ7A 3FD9A 1GF3A 3I01M 5C6IA 4UWVA 3TWKA 2R62A 3DN8A 4H9HA 1KXWA 4DD7A 1IWYA 2WSFF 2Y21A 1OP9B 2LTUA 2QBYA 3DN0A 1GABA 1OV5A 3WUNA 2ZQ3A 1L48A 2F32A 5KXWA 4ARPA 2HUMA 3OK0A 4H94A 3SBAA 3DZDA 1FLUA 2LHMA 1KY0A 4YENA 3HDFA 3HUAA 3BXWA 4WMGA 1D3FA 2D91A 4LFPA 3K2RA 1J1OY 1HNZM 1CX7A 2W1LA 4NFVA 3HX3A 2IFFY 4DD3A 3SASA 2HHHM 2BQFA 5E6JA 2JY8A 2JXNA 1G7LC 3HBEX 3HH4A 1L2DA 4MGKE 220LA 1UIGA 158LA 4MH0E 3G3VA 2Y0QA 4HJZA 3HHYA 3J7BA 2R45A 1CJ8A 5F9XA 5APCA 2DZLA 4JI5M 4ZFPA 148LE 2DVWB 2YBLA 1L01A 1C61A 2EKSC 3GXKA 1GFTA 1HEMA 1LZCA 4DBGB 4LDEA 4Z3MA 3SHFA 1OKSA 131LA 1L06A 2OE4X 4H90A 3ZVQB 1LGXA 3HFMY 257LA 3SB8A 1DGFA 5E26A 1P36A 3U6QA 1L16A 1WGLA 3J4GA 4CFOA 2JA2A 2KXEA 1HNXM 5JENB 1VQ1A 2B5ZA 4CHXA 5APDA 4GRIA 1W5TA 4FW9A 3QY4A 1DGBA 188LA 7LZMA 1UC0A 3UGJA 4TWSA 1TH2A 3GPXA 2X8AA 5DYGA 3CSZA 3GRRA 3WMKA 2Z8YM 2LWXA 3E4RA 4H9EA 2QZ4A 1GF8A 1GE3A 127LA 3W3EA 1F10A 1LYJA 2DHYA 4LFCM 1K82A 3GQ5A 2CV1A 4LJAA 3CGWA 5EXPA 1C6HA 4OOOA 3TXIA 1LYOA 4C5FA 4ZPUA 1DI5A 1L95A 3SB9A 3RUNA 1RU3A 2HWJA 5KXZA 1LZ9A 3LMMA 1DYFA 2BQGA 1Z5BA 5KQDA 3AL0C 4R3DA 2P5TA 1LZ4A 4NY5A 1IY4A 5KXOA 4IBEA 5L3HA 4NRVA 3CDVA 4Z6YA 1L86A 2C9CA 3SAVA 1NHBA 1VDPA 2DXIA 4FCVA 1VDQA 4WLYA 3M18B 3TXDA 236LA 2VDBB 4I7SA 3AOEC 1XJUA 1L72A 3TXJA 128LA 5FDJA 2VB1A 123LA 2DWLA 3W0FA 1FKQA 1QT8A 3D8BA 218LA 4DDAA 4WO9A 1OWYA 3A34A 1F4IA 3TPZA 5ITQA 1HR0M 252LA 1QAQA 1CVKA 4YEOA 3PVSA 4WL7A 4QHTA 1TTEA 2Z6BA 1REMA 5EP1A 1JTNA 4PDGA 1OFIA 4L78A 1K3WA 1G1VA 4CISA 1HSXA 4JI6M 3TXHA 4BAPA 234LA 4NWHA 2ANXA 2CP8A 4OWCA 1GBWA 2FFJA 4KT0F 1NF5A 147LA 2RGHA 1WQRA 4YF2A 5H37D 1HHLA 3U6EA 1GFAA 1TDYA 241LA 3NBXX 3DN2A 247LA 230LA 3HU8A 112LA 2QHOB 4XK8F 1N34M 1T8FA 1PQKA 4B3SM 4I7PA 4WM3A 3HHZA 5KPZA 1J5EM 2DAMA 3KOXE 1GJTA 1GXV2 214LA 5DFLA 4PRQA 1BB3A 1GAYA 2AHMA 4YM8A 1JHLA 4FDYA 4HJYA 1L47A 144LA 3G3AB 2ZIJA 4RLNA 2O4WA 4H91A 4NWEA 3IJVA 3P68A 4AZFA 2BQNA 3AOEA 3FUWA 4M9SA 1XNRM 1L04A 1VDTA 1PJSA 1CJ6A 1P2RA 4JV5M 1E94E 5II3A 5FLXS 4W58A 5LVGA 2B6YA 4DR6M 3B7NA 4BBAA 4DAJA 2HCBA 3A3QA 1IM2A 1DYEA 1NHGC 2B3TA 5A3EA 3FTFA 1L65A 4I7OA 2FH0A 2GQFA 5KXKA 4X62M 4GMQA 4X65M 4WM4A 1DKKA 2Z4SA 4PPOA 2HEBA 2DZOB 1YAPA 1QZMA 2N35A 138LA 3FRHA 2J5YA 1QQWA 3C7YA 2BLYA 1HEPA 1IN8A 3D3DA 4ZIXA 4YEMA 1ZV1A 5I4YA 1IWZA 1L40A 1AUAA 3A95A 1D3MA 2BQBA 3HKPA 4TUWA 1J7KA 4W59A 3N9AA 3KOZE 1ORYB 4B0DA 3PFIA 2BWEA 3C80A 156LA 3FE3A 3T38A 4S12A 4N0JA 1GB7A 5D5CA 1L88A 4II7A 1L71A 3RZEA 1B9OA 4UWUA 5ITRA 1OUBA 154LA 262LA 4NXNM 3LQRA 1HT2E 1CU6A 8CATA 4RF1A 197LA 2BQKA 3FTEA 2CGIA 1L12A 5E4PA 1TDZA 1R2YA 2MGWA 1G7HC 2QB0B 2W1XA 2BAAA 1QUHA 5J7CA 2LNHC 3VKGA 2RKOA 1QTCA 4WLDA 2JY6B 3SATA 1LKSA 3GQ3A 1GLNA 4D80A 2UXBM 1IY3A 4I4LA 4W96A 4N1EI 3LCUA 1D6QA 1D9WA 2RB1X 1CKGA 5KXXA 2CV2A 1L53A 3WPLA 199LA 1DGGA 1SXJE 1I94M 2JUJA 2BQAA 5IT9S 2OTYX 1FN5A 3CDRA 4PT5A 3ATNA 1AT5A 1L42A 3A91A 4I8OA 3J80S 2X0AA 4C3WA 3I4YA 5LMUM 3HHXA 4W52A 3OJPA 1XXHA 2F5PA 1YKYX 244LA 4ZEEA 4HJVA 3OE9A 1PM5A 4LZZA 2DAEA 3WL2A 3VKHA 4DR1M 2Z37A 1GBOA 1D3NA 253LA 1WQMA 4XJIA 3EBAB 1LSCA 5IWAM 4GHLA 184LA 2BQHA 2MEFA 3WULA 1QT6A 1BB6A 3TXGA 3GUIA 1LYGA 1GHLA 5LZMA 4WLXA 1YKZX 1NKHA 4I81A 201LA 2CDSA 4W94A 1XEIA 3L2XA 2FE8A 1CUQA 4GEWA 1GKIA 1FDLY 1HF4A 4EPFA 1SXJB 1L67A 4BB9A 5ITXA 1QT4A 2F5OA 172LA 1ZMVA 1CV5A 3FTDA 4B4JA 1IP6A 2HEAA 8LYZA 4DWXA 1IWXA 1RI8B 1EE8A 2LYZA 1B2KA 4A7DA 3MMPA 2C8PA 1W08A 3WPJA 4XJFA 3TMXA 5M1YA 4XJGA 5LA5A 1C64A 1MU5A 1ZMYL 1L58A 2DQDY 4F1IA 5C6LA 5LINA 4OWAA 2DKVA 1NJFA 1L22A 7CATA 3B7QA 5FTJA 1G8PA 3HU1A 3C83A 1NSFA 3GUPA 1SX7A 3J2PB 4TSBA 4CFPA 3HT7A 1LYSA 4OVZA 2Q0MX 3BOSA 1KSFX 2G3QA 1BVSA 1P6YA 2BQDA 4WOAA 3SB7A 237LA 3IJUA 1QTBA 1NV9A 5EQTA 4LF5M 163LA 1HEQA 2HEFA 4IBKA 1PGYA 4AKGA 260LA 5FTKA 2UUCM 3L64A 1YAMA 246LA 2LYOA 4KPMA 3QAKA 1C1KA 1KS3A 1NDGC 171LA 1T6HA 1R5LA 3B0KA 1L29A 2MEDA 5HLLA 3IG5A 104LA 4ET9A 4LY6A 180LA 4NG8A 4HTQA 2BQIA 1XGTC 1B0DA 2KRKA 3GLFE 1JTTL 213LA 1JISA 1VDDA 4TX7A 207LA 1YUBA 3FA0A 4CJ2A 1R2ZA 3L27A 1DO2A 3UMMA 1B5WA 1XMOM 3I4VA 3GLGE 1GF0A 4LYCA 1CNSA 1UIHA 1SX2A 1LYEA 2KA6B 4NHSA 4I7MA 5LAGA 1WQPA 228LA 166LA 3AZ5A 3QWLA 3OTOM 1NDMC 3IECA 3U61B 1T6OA 1YROA 198LA 217LA 219LA 3B89A 3KP0E 9LYZA 5IZ7D 3VK8A 1HSWA 2MROB 1L36A 3TMUA 175LA 1REXA 1D2WA 2WARA 1LJ4A 2O25A 5FTNA 155LA 4JI8M 4YHHM 4QY9A 3U5ZB 4I7KA 3U6LA 3FKEA 1C46A 4LT2A 3ILKA 3GLFB 2HUKA 2XBSA 3UJNA 1L51A 3EMLA 1B7NA 4G4QA 1LZEA 3IG8A 4CGEA 4I7LA 1C66A 1L84A 1C6QA 3CB7A 1B7LA 5D5FA 2UXCM 1XFPL 2HTXA 1LJFA 2V1UA 2KNAA 5EJCA 3LZTA 1L30A 3SB6A 1LZSA 150LA 2L4FA 1L93A 3ULRA 1IR7A 1LHKA 2LC9A 1LHMA 4OW1A 4DV6M 5FEKA 2DQGY 2HL7A 2ZBKB 1T8GA 3SAWA 4I7QA 1UIDA 1LLHA 4TSCA 2D7EA 4QGZA 1LWKA 1C60A 3GRUA 2ZYPA 1LCNA 1L73A 2YNMD 3C8SA 4W54A 4LYZA 4LZJA 4QNMA 5IDDA 4H9CA 3W6BA 1HC0A 3ZVQA 3CDTA 4AXTA 3QYBA 2EO2A 1LHLA 2L7IA 1LI3A 2EQLA 2L2DA 1G0JA 1OUFA 1ZVHL 3P64A 4RW1A 5APEA 3MGWA 1JQJC 2CUUA 2Z7JA 1HQYE 4IBJA 4LF4M 1IOCA 5F81A 5LAFA 4FWDA 2L4EA 5EXTA 4NGYA 3GUMA 1LAAA 4NGIA 2A4TA 153LA 1DZBX 1L79A 1HFZA 3KW6A 1LJKA 4HL4A 143LA 3KOWE 1MELL 1KNIA 3H4MA 2CEAA 3K9PA 4OWBA 3G3WA 2CHQA 1IY0A 1WVVA 3A3RX 1C67A 3TWLA 2LVAA 1OUGA 2DWZB 1LZGA 4K5YA 3C58A 1JIYA 1GBYA 1GFVA 1QZEA 4G4RA 1D0LA 4DV4M 1LYFA 2R46A 1L02A 1GE1A 1P37A 4L4UA 1GB6A 1O23A 3NYAA 4HPEA 3R8FA 4B3MM 3U6CA 4S0WA 3C9PA 1IN5A 4I5SA 1DYCA 1NNUC 4LGYA 3A67Y 1YE9A 4XBOA 1C6TA 4DD9A 1DYGA 3A93A 1L08A 4DV3M 7LYZA 1WQQA 1V92A 1L11A 4LYOA 4BAFA 4DKLA 5F3WA 1OUEA 4DDCA 4IBIA 2HULA 3LCVB 4LF7M 4DR4M 3N9EA 3FYCA 1JPOA 1C68A 1DYAA 4RF0A 3KSXA 4FVMA 5KXPA 4NGVA 1YLAA 1C6MA 2B73A 249LA 3TE6A 4BS7A 4WP2A 4Z46A 1CU3A 225LA 2YBNA 2CWIA 1N77A 4B7FA 2XLJA 2XSZA 115LA 4HV2A 1G7IC 1QT3A 3LVVA 5KXSA 2K0BX 1IN4A 1IXZA 2C98A 4NSHA 2Y8PA 1L70A 1L90A 5B1GA 3J27B 3JR6A 4GC9A 1TCYA 3SAUA 3HT9A 4IBCA 1QUSA 3GO8A 1GL7A 1JKCA 1RJCB 1I4WA 1LGUA 129LA 4NGJA 4A3VB 1GVNA 1CKHA 1HNLA 3V2YA 1SSWA 2BJVA 2OE9X 1IY2A 2IGCA 1L77A 2HU3A 5LXWA 1LJGA 2R65A 4DD1A 189LA 2B6ZA 1JR3E 3L26A 1F0WA 5EP4A 1L74A 4HTNA 4JI4M 1XB2B 1G0GA 3ZQJA 2ZNXY 1HJPA 1GE0A 1SWZA 4GCEA 3GLHB 215LA 2UXDM 1ZAEA 5FTMA 1D0MA 4GN5C 3L2AA 4LRSA 1UFZA 3H4JA 1XJTA 3GXRA 208LA 4H92A 3VDUA 3T6PA 4JN6A 4IASA 3W6EA 3EMSA 4L6V6 1RFPA 2OU0X 1G59A 1S3SA 1GFKA 5DYIA 4LG2A 141LA 3QYEA 4KLNA 1G0MA 1L38A 2OEAX 3WUAA 1OIPA 1KIQC 4UWNA 4OX9M 1HFXA 183LA 5GKNA 3TL4X 174LA 1YKXX 1XXHB 5E9RA 3M7GA 1WVUA 4TTDA 2CUZA 1NY5A 4W56A 1JUGA 1LJJA 4KXIA 3JR4A 3PBLA 1I56A 3SBJA 1G07A 4N5RA 1C6LA 1L75A 5F9UA 2W1MA 3KAMA 1IO5A 1CJ7A 4NSIA 1LYHA 1C6NA 3PNYA 1OQYA 1SSYA 4P2EA 2OPFA 1P64A 2BLXA 3JAMS 3DMXA 1D0KA 209LA 2DWNA 4H93A 4X64M 3THGA 1LMAA 5FSTA 1IFYA 1TBYA 2DQHY 1IP4A 4II8A 1I1ZA 4ARLA 4EKRA 1LMQA 5BR8M 1OFHA 4L16A 4KT3A 255LA 3SB5A 3A6BY 4FWGA 2XTHA 1L55A 3K9OA 4LCBA 1A5TA 2FS1A 4RKUF 1NMMA 2DI0A 2DWMA 4P16A 2I7NA 1C7YA 3LW5F 4GHAA 1QSWA 4EMNA 4MGIE 1IQPA 1CUKA 245LA 1W6ZA 1LZ6A 1V7TA 1PS5A 4LF9M 2ZIKA 1QIOA 1YSYA 1AM7A 4GN4A 3A90A 3GUJA 1Q39A 4DV1M 4W51A 4YX7C 1LGWA 1L1TA 2YR0A 3CT0A 3DMVA 2NTGA 3ZEKA 2Y20A 3FUUA 1UM8A 1TH3A 2RBQA 3NBIA 1OVJA 185LA 5I5QA 2DAKA 4E97A 5I4XA 2A7FA 2D7HA 4B4EA 3HZJA 3AZ4A 4PK0A 1L66A 4DDBA 4LF8M 2LHCA 4DR7M 1IORA 3TMWA 3ZCBB 192LA 1DGHB 4ANRA 1IIZA 1UIEA 2JY7A 5KXMA 1XSFA 3AW6A 149LA 1UIFA 1G7JC 2MH8A 3HH5A 4AI6A 3HHWA 1GWDA 2D4IA 1HFYA 2ZYCA 1IX0A 4DQ7A 1OUIA 1UIBA 1C6BA 3WHLA 3WPKA 3VFDA 4MM3B 4REZA 3VLFB 4B49A 2QBYB 4IJ4A 1IP2A 4PD2A 1L8QA 1L1ZA 2L7HA 4J1AA 4QOZC 3FI7A 2KHHA 3LQQA 146LA 4NL4H 3CF6E 2DQJY 1UIAA 2H5ZA 5KXNA 4CHTB 2YQZA 3HJSA 1ZYTA 2CFOA 3M6AA 3RFWA 1N32M 2HEDA 2EPEA 2H1RA 4HTKA 132LA 1QUDA 4G4NA 4DR5M 3W6AA 3T1YM 1L24A 1LSAA 1B5ZA 1YILA 3T1HM 1DI3A 1IP7A 2RSCA 4DQ5A 3P65A 3SHGB 2DHRA 1OV7A 1SG9A 2CWBA 4NSOB 4IBBA 2BPUA 3HT8A 5HMVA 2RAYX 3W6FA 1L05A 4EPIA 2APLA 2MECA 3NY9A 1FNNA 1IBMM 1L52A 5DN4A 4QHSA 2V6ZM 176LA 1NY6A 4LYBA 1L07A 4G3OA 3W0LB 3GULA 2Y0TA 4ZPXA 4XENA 1B7QA 1GEVA 2CRUA 3ZC7B 3QAUA 135LA 1GJSA 4CGYB 1HENA 2CJLA 3VW7A 4HSFA 1OJLA 168LA 1Z6TA 1LZTA 3LYZA 1JR3A 3BBZA 3TXKA 2BJWA 1L00A 1OIZA 4H8XA 3DN6A 3C8RA 5LYZA 1OUJA 4ETBA 3KOYE 4KL7A 1QTHA 4DYGA 4LJ8A 4DC4A 152LA 2JWSA 4RDSA 1LZ5A 2Q2EB 1CX6A 1K28A 3K3TA 5IREB 4ARJA 4KO8A 3DFZA 2ZANA 5ILFA 4N9RA 3HWLA 5FELA 4WW0A 2C5RA 4NOOB 232LA 2G4QA 4DJHA 1XC8A 251LA 1JJ0A 1QAMA 5A2QS 4LFXA 4XJBA 5B06A 1XMQM 1NQIA 5HMJA 1GB8A 159LA 1P3QQ 4GKKM 1LMCA 3UONA 4XJDA 1L43A 2DQIY 1KXXA 1PQOA 3WYHA 2F5SA 1LSFA 2OTZX 4IBDA 3GLIB 1IWTA 1WJ7A 1KY1A 1NNJA 2QPAA 4LF6M 3AZ6A 1L33A 193LA 3OE8A 1E32A 1VEJA 3RNXA 1LSBA 4EKPA 1QDRA 4X66M 1D9UA 2EJSA 5KPTA 4G49A 1WTMA 2JZ1A 2LVQD 1H87A 2X4AA 4EIWA 211LA 4DV2M 4GN3A 3GQ4A 4DV7M 2VF8A 1JJ3A 1LYZA 1BVXA 1L49A 4JI2M 1L96A 2YBIA 5EBHA 1UCOA 5KO3A 231LA 2XSZD 2RGOA 2L09A 1PRBA 1P56A 4LYTA 4L8RC 4GIPA 1EQ4A 3A98B 2CV0A 1AKIA 1L37A 1P46A 4JI7M 2QARC 1HT1E 2GV0A 4MGYE 2HUBA 2B7XA 216LA 4OWEA 1LPYA 1OYUA 3RW8A 1H6UA 1LHHA 2Q9EA 1YAQA 2F30A 1L87A 1LSYA 1L57A 142LA 1LJ3A 1WHCA 1CU5A 2GNOA 1DKJA 4M9XA 1Z5AA 3CT1A 2EKKA 1B6IA 1GFHA 3A8ZA 3CSRA 1Q02A 1QQYA 3B6LA 2CE7A 1IXSB 2NTHA 3CF2A 2YSSC 3MHVC 2YVBA 4JI3M 3FUTA 194LA 1E8LA 3HWSA 3J81S 1XEKA 2BQOA 1DYDA 1PQMA 1OAOC 177LA 238LA 1IR8A 1NBYC 4JI0M 2DENA 3W68A 3VWOA 1L94A 3FI5A 1DO0A 1L17A 250LA 3U6SA 3HGIA 133LA 1VDLA 4J1BA 4WM1A 102LA 1WXQA 3P66A 4EKQA 5HNCA 5KXTA 2F5NA 2LZTA 1IC4Y 1N33M 3QE8A 1QDTA 3HU2A 4D9ZA 5KKJA 3A92A 161LA 1E9SA 1IOQA 4LGKA 243LA 3AYQA 2JP7A 1QUTA 4B7GA 4LT0A 5KQ8A 4PDIA 2Z12A 1NHWC 2KEBA 3WU8A 4W57A 1DGHA 3OE0A 3UZUA 4YOPA 3GLHA 2PC2A 2R44A 1L03A 4HV1A 5LVJA 2RBPA 2OE7X 3GRYA 1SWYA 5L3IA 1L21A 2G5GX 3HTFA 1INUA 4DUZM 4DV0M 1DPWA 2RB2X 3WH1A 3AKZA 1FJGM 4JI1M 1CV0A 3U5ZA 2RB0X 1L18A 3T15A 4LDLA 1V33A 3FTCA 1C69A 4G9SA 1R4GA 3KDSE 2DQEY 259LA 2F4VM 3SN6R 3J7AS 1UA6Y 2XJWA 3CDOA 157LA 1LMNA 1LZDA 2D7GA 4DQJA 1L26A 1A2YC 5KPRA 2H9KA 2Z2EA 1EL1A 1G0PA 3TXFA 3V76A 1C6KA 2QENA 5B1FA 3GUKA 3B7ZA 1NJGA 1SXJD 1K3XA 2R18A 5F16A 2KNZA 3LYMA 4IATA 4B4IA 4I7NA 5A3ZA 4AQYM 1L25A 1J1XY 4LJ6A 4L15A 4GLAA 3F6ZA 4FD2A 1L64A 2W82A 3VK7A 3C82A 2FNAA 1IBKM 3K2LA 3GUNA 1OTRA 3C3EA 1TH4A 4LFAM 2LXEA 4IBGA 1Z55A 4NSJA 1C6PA 122LA 4NGOA 1C10A 2FBBA 1L27A 3RT5X 4Z41A 3SP3A 3CF0A 254LA 1GB9A 1IVMA 4I0CA 3PXGA 1CKFA 5B59A 4P17A 4NRWA 4DR3M 2C8OA 1VAUA 1L61A 1WR1B 111LA 1GDXA 1GD6A 1EFUB 130LA 1IY1A 3T36A 1B5UA 2QSFX 1L81A 5EP3A 2RAZX 2YBHA 4NC6A 1N4FA 5FSWA 1IOTA 3GPPA 1IXRC 5DNYA 1P2CC 2Z4RA 1TR8A 4ARQB 1PQDA 2J7NA 248LA 4OW0A 3CTWB 2LZ2A 4NGKA 1Z59A 3FE0A 4NHTA 1JB0F 258LA 1L99A 1H6MA 4N8ZA 1A4VA 1LV7A 2LH0A 3HUKA 1GB3A 1JR3D 1G7MC 5FHWA 2Z38A 3DOAA 4W55A 1LHJA 3FADA 2HU1A 1B7PA 5LA8A 1DYBA 1BWJA 3A46A 2BNKA 1NWGA 1I20A 1IP5A 3DN3A 229LA 1N36M 1JKAA 3HH3A 5I14A 3K92A 1VATA 2ZM6M 2VQEM 113LA 3KXEC 1GEZA 3FUXA 3HUQA 1IN7A 2ZTCA 4TUNA 1L89A 3ZH9B 3LZ2A 1JEFA 1PJTA 1L10A 1L41A 1HMLA 1PQIA 2QCUA 3C7ZA 1NVMA 3GLGB 1IN6A 3HT6A 1L56A 2K6BA 1UBZA 3I51A 1GFRA 4NG1A 4LDOA 3SC3A 4XN6A 3L28A 1CKCA 1IWUA 3HU3A 3GLFA 4XADA 4DT3A 4QDNA 2DNAA 3A96A 2F47A 2E5LM 1NHEA 1RE2A 1LSNA 3AGGG 4ML7A 1BWIA 1OUHA 3CDQA 134LA 2UUAM 3K1JA 5B05A 1IP3A 1F6RA 4R0FA 173LA 3TWMA 4NXMM 2B72A 4GITA 2MEAA 5LVHA 3L29A 162LA 2XFSA 1YAOA 3FYDA 4Q7JA 2NWDX 3HTBA 3HTDA 1P5CA 4Z8XA 2DQFC 222LA 4L41A 1QANA 108LA 1QTVA 2YBMA 2RBSA 4KHPM 1KW5A 4LJ9A 4GBRB 1G3IA 1L76A 2C99A 1D6PA 4I8SA 3MK6A 4OU7A 1C6GA 1F6SA 3U6OA 1JSFA 1QUGA 3FUVA 2DKLA 2OOAA 1GF4A 5EXSA 1QTKA 3E3DA 2V1CA 3LYOA 2UU9M 4R71A 4MGZE 2M5ZA 1QVRA 4PJZA 1L63A 5KKIA 1YL0X 2LVPC 5KXYA 6LYZA 4G4BA 4NEBA 1LTMA 2YFQA 4K0KM 4F2LA 1N78A 3C81A 1V34A 1HMKA 4NHPA 1NV8A 1L62A 1JTPL 2LVOC 2WSCF 3BKHA 4LRTA 4WG1A 1JSEA 1HNWM 3B72A 3NY8A 1QTZA 3HU9A 2WZJA 2O79A 1G06A 1HELA 1ZV5L 2B6TA 1VFBC 3M0EA 1LYDA 5JI2E 4H8YA 4N1CC 160LA 4XJHA 1LJHA 3AB6A 1GFGA 4WL6A 1BHZA 1G0QA 1ZVYB 5HNLA 3HJQA 2C96A 4ETEA 3WUMA 3D8LA 1CTWA 3HDEA 4YXCA 164LA 1QYRA 3LN2A 3TXEA 1GB5A 3Q8XA 4NGZA 1L13A 2FOIC 3DNAA 1LSGA 1MX0A 1QAOA 3L25A 4EKSA 1LSDA 4BADA 2K9DA 4EOFA 5EP2A 1C7PA 1B7SA 2ZNWY 1GBXA 1LZYA 1GXXA 1JQUA 1NBZC 1YIKA 3HBHA 3K8ZA 1GAZA 1L80A 3WW5A 2BQJA 3SARA 1C6IA 4PHIA 1XEPA 1MJGM 1C6FA 4M0WA 4CJ6A 2I6ZA 1XGUC 3WW6A 190LA 1IOSA 145LA 4DR2M 4NSRA 3UK6A 2ERCA 3WU7A 1L15A 3SBBC 1FBIX 1W5SA 4W53A 1C6CA 1VEDA 3AW7A 2VQFM 2XGNA 2XEPA 1XWIA 1DI4A 3KS4A 1L0JA 3U6MA 1X37A 3A94A 1REZA 2WSEF 4NGLA 3TXBA 4H9AA 4B3RM 2JY5A 4LZTA 2EKFA 2AUBA 2F5QA 4JYAM 3AGHA 1LSZA 2ZILA 3HTGA 1OVKA 4B7HA 3JR5A 187LA 4NHIA 1FLQA 2XBRA 2H9JA 3M3UA 2F4AA 1YQVY 125LA 4NIJA 1E9RA 5C1BA 1KYIA 1T6VL 1L20A 2HECA 178LA 2MEBA 4G6ZA 181LA 2B70A 2LZMA 1WQOA 1C43A 3C8QA 1CU0A 3C3DA 1OUDA 1L45A 2HEEA 3TMVA 256LA 2KZSA 4U3XB 1DPXA 1LOZA 206LA 4AQNA 1L97A 4JXJA 2HKJA 1BVKC 4W5WA 1I6SA 4CIZA 4AW4A 5I54A 1L85A 261LA 1T3TA 1V7SA 3AJNA 5AMYA 1SLYA 1GBSA 1G0LA 4EJ4A 3GPUA 1PJQA 2L78A 1CJ9A 3W6CA 1L32A 1G41A 2EUCA 3A42A 1TEWA 137LA 3CSQA 1C6JA 3A45A 4LJ5A 3WU9A 5B07A 3EIHA 4E3UA 1QSBA 4QNRA 1SXJC 4KODA 1C63A 5LYMA 4D81A 4AG5A 3DKEX 1LYYA 1L44A 4HP0A 5K7OA 2EIZC 1QT7A 3AV0A 227LA 2BQMA 3W67A 1C08C 1UUZC 2YBJA 4WG7A 1BB7A 1REYA 2Z39A 1JJ1A 1J1PY 1L23A 3G3XA 5L9JA 2BQEA 2G8LA 4ARMB 1R7RA 1B7OA 3T6UA 3OE6A 1GDWA 4WM2A 151LA 2CHGA 2RBNA 5C18A 1ALCA 5I4WA 3B0OA 4MB7A 2D6BA 1LW9A 3FRIA 1TAYA 4XGIA 3WHKA 4HEOA 3CQLA 1IP1A 2NQ8C 2R6FA 1JWRA 4ARMA 3W6DA 2ZAOA 4GC5A 4IAPA 1PZYA 4HPIA 1BB4A 5JI3E 1BWHA 2KZUA 5LMNM 1XHBA 2OQ4A 5I53A 5DL9A 4M9ZA 2DBTA 2X49A 1BB5A 2D4JA 2Q9DA 1L28A 2VIIA 3RZ4A 1GF7A 2VF7A 2XF3A 1L59A 4DD0A 3SFZA 1SXJA 3EIEA 4B1AA 1LZ8A 2A7DA 1HQCA 4ITQA 4MGHA 2DAIA 2OU9A 4DUYM 4RW2A 2JNHA 2F4GA 3LVWA 4IJEA 3RGSA 196LA 3BKVA 1J09A 3KVWA 4ETDA 1LI6A 1GFUA 1Z5CA 3HBDA 5DLAA 6LYTA 1JITA 1B7RA 4ARQA 3RU5A 1C6DA 2K47A 2B6XA 3DN1A 3B9PA 126LA 224LA 239LA 1D2NA 4FCWA 3MJ5A 5LIOA 3LYTA 242LA 5C6JA 3SYLA 5L8RF 1T3PA 1WTHA 4PGJB 2LYMA 4ETCA 3LZMA 3RGPA 3HY5A 3IHPA 4B3TM 1XNQM 1JTOL 3B0IA 4H8ZA 2RBRA 4MCKA 2LHGA 3SYKA 5EXXA 119LA 120LA 1LSEA 2O01F 1LJNA 2A5YB 1IBLM 3IWRA 1ZMWA 1L46A 3GPYA 1LSMA 1YANA 4GH9A 191LA 4MR1A 2LVNC 4PCZA 2RBOA 5ILCA 5F14A 5HQ1A 3N9CA 4XYYA 4FJRA 3GLHE 4BLCA 1L91A 2XFTA 1L14A 2DQAA 1P3NA 223LA 2FYCA 2OOBA 1UICA 1C62A 1QUOA 2KNVA 1OUAA 4OVZB 1L82A 4DD2A 3KP1E 3LHMA 240LA 1WTNA 2CHVA 107LA 4Y28F 4UN2B 1DXJA 3RE8A 4NHQA 3TQSA 5ITUA 2I25L 4LT1A 1QT5A 2MEGA 1PJJA 3E46A 1DQJC 6LZMA 1TLAA 1CKDA 4OWHA 1G0KA 1LSPA 3HH6A 4WLTA 1QSQA 4M6DA 235LA 1FLWA 1KXYA 5T3FA 1QTDA 2B6WA 1IXSA 1GO5A 3U6DA 1AT6A 1LZAA 2XZUA 5LYTA 200LA 1AZFA 3AOGA 5DN5A 3PDSA 3DMZA 2O7AA 5ITTA 1LMPA 1LZNA 3R9XB 1XEJA 4FWHA 1IC5Y 4G4OA 3C7WA 2MEIA 3GP1A 182LA 3F8VA 3P4ZA 1C6AA 3AFHA 1WQNA 3E9SA 4H9BA 3V2WA 3G3BB 1YL1X 2DQCY 4HLQA 5LVKA 1L09A 110LA 4GRVA 1XGPC 5KXRA 114LA 1LKRA 5FCPA 1B5VA 1LPIA 2R4EA 3EXDA 2ZTDA 1SQ2L 1GF5A 3PNVA 2Z2FA 2R4JA 2C9OA 2KDLA 4GLVA 4I7JA 3WXUA 3KS8A 1ZURA 2G4PA 2MEHA 2ZWBA 2ZQ4A 1CV1A 4IBFA 1G4AE 1GF9A 4OOTA 1L68A 4OO9A 2Z19A 1C6EA 1CV3A 1KFVA 3EO5A 3WVXA 1L60A 4WO6A 2QQ8A 3DA1A 2XQOA 233LA 3U6PA 1VG5A 2I7PA 3GLGA 1ZWNA 1GFJA 4RNAA 2MEEA 2M60A 1CUPA 2QNJA 1B5YA 1Y8GA 1LHIA 1OQMA 1L2CA 2FYDA 3AGIA 1HEOA 4GCCA 1L31A 1GFEA 1L0KA 3ATOA 1NO1A 1PJIA 1B5XA 4AGAA 140LA 2HAKA 1GE4A 4AKIA 2LBCA 3B74A 4LGMA 1KIRC 1VEKA 4LFBM 2N5ZA 2J7OA 2DZNB 2FBDA 3J6KA 4QOSA 2O5RA 4LJ4A 2B74A 4WURA 1WGNA 2EA0A 1CV6A 4GKJM 1GF6A
chains in the Genus database with same CATH topology
1CU2A 1LMOA 3F9LA 1T8AA 1G1WA 1IWWA 1JKBA 2OU8A 3A6CY 4H9IA 4YXAC 4GCFA 1FLYA 1BQLY 4NSGA 3GUOA 3D9AC 4PJ2C 4X3BA 169LA 1XGRC 4WM5A 1C65A 1L83A 1LZ1A 212LA 118LA 2Z18A 1QSAA 1HEWA 3DN4A 1L69A 1RCMA 4Z98A 1EQ5A 1C45A 4H9FA 1L35A 1CV4A 1OUCA 5KXLA 1L92A 1P2LA 1LZBA 1L19A 1KIPC 5APFA 3WXTA 4M4OA 4ETAA 1KW7A 4LYMA 1QS9A 1GB0A 4PRUA 1FKVA 1IWVA 4G4CA 4EXMA 1EPYA 2W1YA 4MSTA 2RH1A 4LZMA 210LA 1QS5A 2YDGA 3ODUA 1OVHA 4H1PA 4I7TA 4QEQA 165LA 2B75A 167LA 109LA 4WM6A 1UACY 1IR9A 1D2YA 1GE2A 4RLMA 186LA 1EQEA 4GCDA 1LWGA 1JTMA 5KY1A 1GPQC 195LA 3AZ7A 1IEEA 1LZRA 4GCBA 205LA 1XGQC 4R6CA 4J0LA 2I26L 4G4HA 1JKDA 1IC7Y 139LA 1PQJA 2D4KA 5LVIA 1LI2A 5IHGA 1L54A 2ANVA 1BGIA 1LJIA 1P7SA 5KJ9A 1HERA 1MLCE 1LYIA 1L50A 3CT5A 2BQCA 2G4NA 221LA 1OWZA 5IELA 226LA 170LA 4O34A 1LJEA 1GBZA 2BQLA 1GB2A 1L98A 1VDSA 3WVYA 2LCBA 4ET8A 1QTEA 2F2NA 2F2QA 2IHLA 4I7RA 1D3JA 1L34A 1LMTA 4LT3A 4NGWA 1L39A 1B7MA 103LA 3D4SA 3QNGA 5DM9A 1T97A 4J7VA 1GF3A 5C6IA 4UWVA 3DN8A 4H9HA 1KXWA 4DD7A 1IWYA 1OP9B 3DN0A 1OV5A 3WUNA 2ZQ3A 1L48A 2F32A 5KXWA 4ARPA 2HUMA 3OK0A 4H94A 3SBAA 1FLUA 2LHMA 1KY0A 4YENA 3HDFA 3HUAA 4WMGA 1D3FA 2D91A 4LFPA 3K2RA 1J1OY 1CX7A 2W1LA 4NFVA 2IFFY 4DD3A 2BQFA 1G7LC 3HBEX 3HH4A 220LA 1UIGA 158LA 3G3VA 4HJZA 1CJ8A 5F9XA 5APCA 4ZFPA 148LE 2YBLA 1L01A 1C61A 2EKSC 3GXKA 1GFTA 1HEMA 1LZCA 4LDEA 4Z3MA 131LA 1L06A 2OE4X 4H90A 3ZVQB 1LGXA 3HFMY 257LA 3SB8A 1P36A 1L16A 3J4GA 4CFOA 5JENB 2B5ZA 4CHXA 5APDA 3QY4A 188LA 7LZMA 1UC0A 4TWSA 3CSZA 3WMKA 4H9EA 1GF8A 1GE3A 127LA 3W3EA 1F10A 1LYJA 1C6HA 4OOOA 3TXIA 1LYOA 4C5FA 4ZPUA 1DI5A 1L95A 3SB9A 3RUNA 5KXZA 1LZ9A 1DYFA 2BQGA 1LZ4A 4NY5A 1IY4A 5KXOA 5L3HA 3CDVA 1L86A 1NHBA 1VDPA 1VDQA 4WLYA 3M18B 3TXDA 236LA 4I7SA 1XJUA 1L72A 3TXJA 128LA 5FDJA 2VB1A 123LA 1FKQA 1QT8A 218LA 4DDAA 4WO9A 1OWYA 3A34A 252LA 1CVKA 4YEOA 4WL7A 2Z6BA 1REMA 1JTNA 1G1VA 1HSXA 3TXHA 4BAPA 234LA 4NWHA 2ANXA 4OWCA 1GBWA 1NF5A 147LA 1WQRA 4YF2A 1HHLA 1GFAA 1TDYA 241LA 3DN2A 247LA 230LA 3HU8A 112LA 1T8FA 1PQKA 4I7PA 4WM3A 1GXV2 214LA 4PRQA 1BB3A 1GAYA 4YM8A 1JHLA 4FDYA 4HJYA 1L47A 144LA 3G3AB 2ZIJA 4RLNA 2O4WA 4H91A 4NWEA 3IJVA 3P68A 2BQNA 1L04A 1VDTA 1CJ6A 1P2RA 5II3A 4W58A 5LVGA 2B6YA 4DAJA 3A3QA 1DYEA 5A3EA 1L65A 4I7OA 5KXKA 4WM4A 1DKKA 4PPOA 2HEBA 1YAPA 138LA 3C7YA 2BLYA 1HEPA 3D3DA 4ZIXA 4YEMA 5I4YA 1IWZA 1L40A 3A95A 1D3MA 2BQBA 4W59A 3N9AA 4B0DA 3C80A 156LA 4N0JA 1GB7A 5D5CA 1L88A 1L71A 3RZEA 1B9OA 4UWUA 154LA 1OUBA 262LA 1CU6A 197LA 2BQKA 2CGIA 1L12A 5E4PA 2W1XA 2QB0B 1G7HC 5J7CA 2BAAA 1QUHA 4WLDA 1QTCA 1LKSA 1IY3A 4W96A 4N1EI 1D6QA 1D9WA 2RB1X 1CKGA 5KXXA 1L53A 3WPLA 199LA 2BQAA 2OTYX 1FN5A 3CDRA 3ATNA 1AT5A 1L42A 3A91A 2X0AA 4C3WA 4W52A 3OJPA 1YKYX 244LA 4ZEEA 4HJVA 3OE9A 3WL2A 2Z37A 1GBOA 1D3NA 253LA 1WQMA 4XJIA 3EBAB 1LSCA 184LA 2BQHA 2MEFA 3WULA 1QT6A 1BB6A 3TXGA 3GUIA 1LYGA 1GHLA 5LZMA 4WLXA 1YKZX 1NKHA 201LA 2CDSA 4W94A 1XEIA 3L2XA 1CUQA 1HF4A 1FDLY 4EPFA 1L67A 1QT4A 172LA 1CV5A 4B4JA 1IP6A 2HEAA 8LYZA 4DWXA 1IWXA 1RI8B 2LYZA 1B2KA 4A7DA 2C8PA 1W08A 3WPJA 4XJFA 3TMXA 5M1YA 4XJGA 5LA5A 1C64A 1ZMYL 1L58A 2DQDY 5C6LA 5LINA 4OWAA 2DKVA 1L22A 3C83A 3GUPA 1SX7A 4TSBA 4CFPA 3HT7A 1LYSA 2Q0MX 1P6YA 2BQDA 4WOAA 3SB7A 237LA 3IJUA 1QTBA 163LA 1HEQA 2HEFA 260LA 3L64A 1YAMA 246LA 2LYOA 4KPMA 3QAKA 1KS3A 1NDGC 1CV6A 171LA 1T6HA 3B0KA 1L29A 2MEDA 5HLLA 104LA 4ET9A 180LA 4NG8A 4HTQA 2BQIA 1XGTC 1B0DA 1JTTL 213LA 1JISA 4TX7A 207LA 3FA0A 4CJ2A 1B5WA 1GF0A 4LYCA 1CNSA 1UIHA 1SX2A 1LYEA 4NHSA 4I7MA 5LAGA 1WQPA 228LA 166LA 3AZ5A 1NDMC 1YROA 198LA 217LA 219LA 9LYZA 1HSWA 1L36A 3TMUA 175LA 1REXA 1D2WA 2WARA 1LJ4A 155LA 4QY9A 4I7KA 1C46A 4LT2A 2HUKA 2XBSA 1L51A 3EMLA 1B7NA 1LZEA 4CGEA 4I7LA 1C66A 1L84A 1C6QA 3CB7A 1B7LA 5D5FA 1XFPL 2HTXA 1LJFA 3LZTA 1L30A 3SB6A 1LZSA 150LA 1L93A 3ULRA 1IR7A 1LHKA 2LC9A 1LHMA 4OW1A 5FEKA 2DQGY 1T8GA 4I7QA 1UIDA 1LLHA 4TSCA 4QGZA 1LWKA 1C60A 2ZYPA 1LCNA 1L73A 3W6BA 3C8SA 4W54A 4LYZA 5IDDA 1HC0A 4H9CA 3ZVQA 3CDTA 4AXTA 1LHLA 1LI3A 2EQLA 1G0JA 1OUFA 1ZVHL 3P64A 4RW1A 5APEA 3MGWA 2CUUA 1IOCA 5LAFA 5F81A 4NGYA 3GUMA 1LAAA 4NGIA 2A4TA 153LA 1DZBX 1L79A 1HFZA 1LJKA 143LA 1MELL 1KNIA 4OWBA 3G3WA 1WVVA 3A3RX 1C67A 1OUGA 1LZGA 4K5YA 1JIYA 1GBYA 1GFVA 1D0LA 1LYFA 1L02A 1GE1A 1P37A 1GB6A 1O23A 3NYAA 4HPEA 4S0WA 1DYCA 3A67Y 1C6TA 4DD9A 1DYGA 3A93A 1L08A 7LYZA 1WQQA 1L11A 4LYOA 4BAFA 4DKLA 1OUEA 4DDCA 2HULA 3N9EA 1JPOA 1C68A 1DYAA 5KXPA 4NGVA 1C6MA 2B73A 249LA 4BS7A 4Z46A 1CU3A 225LA 2YBNA 2CWIA 115LA 4HV2A 1G7IC 1QT3A 5KXSA 4NSHA 2Y8PA 1L70A 1L90A 5B1GA 3JR6A 1TCYA 3HT9A 1QUSA 1JKCA 1RJCB 1LGUA 4NGJA 129LA 1CKHA 1HNLA 3V2YA 1SSWA 2OE9X 2IGCA 1L77A 2HU3A 5LXWA 1LJGA 4DD1A 189LA 2B6ZA 1F0WA 1L74A 4HTNA 1G0GA 2ZNXY 1GE0A 1SWZA 4GCEA 215LA 1D0MA 4GN5C 1XJTA 3GXRA 208LA 4H92A 4IASA 3W6EA 3EMSA 1RFPA 2OU0X 1GFKA 141LA 1G0MA 1L38A 2OEAX 3WUAA 1KIQC 4UWNA 1HFXA 183LA 174LA 1YKXX 5E9RA 1WVUA 4TTDA 4W56A 1JUGA 1LJJA 4KXIA 3PBLA 1I56A 1G07A 4N5RA 1C6LA 1L75A 5F9UA 2W1MA 3KAMA 1IO5A 1CJ7A 4NSIA 1LYHA 1C6NA 1SSYA 4P2EA 1P64A 2BLXA 3DMXA 1D0KA 209LA 4H93A 1LMAA 5FSTA 1TBYA 2DQHY 1IP4A 4II8A 1I1ZA 4ARLA 4EKRA 1LMQA 4KT3A 255LA 3SB5A 3A6BY 2XTHA 1L55A 1NMMA 1QSWA 4EMNA 245LA 1W6ZA 1LZ6A 1V7TA 1PS5A 2ZIKA 1QIOA 1AM7A 4GN4A 3A90A 3GUJA 4W51A 4YX7C 1LGWA 3CT0A 3DMVA 2NTGA 3ZEKA 2RBQA 1OVJA 185LA 5I5QA 4E97A 5I4XA 2A7FA 4B4EA 3AZ4A 4PK0A 1L66A 4DDBA 1IORA 3TMWA 192LA 4ANRA 1IIZA 1UIEA 5KXMA 1XSFA 3AW6A 149LA 1UIFA 1G7JC 3HH5A 1GWDA 2D4IA 1HFYA 2ZYCA 1IX0A 4DQ7A 1OUIA 1UIBA 1C6BA 3WPKA 4B49A 4IJ4A 1IP2A 4J1AA 3FI7A 146LA 2DQJY 1UIAA 2H5ZA 5KXNA 1ZYTA 2HEDA 2EPEA 4HTKA 132LA 1QUDA 3W6AA 1L24A 1LSAA 1B5ZA 1YILA 1DI3A 1IP7A 2RSCA 4DQ5A 3P65A 1OV7A 2BPUA 3HT8A 5HMVA 2RAYX 3W6FA 1L05A 4EPIA 2MECA 3NY9A 5DN4A 1L52A 176LA 4LYBA 1L07A 3GULA 4XENA 1B7QA 135LA 2CJLA 1HENA 3VW7A 4HSFA 168LA 1LZTA 3LYZA 3TXKA 1L00A 4H8XA 3DN6A 3C8RA 5LYZA 1OUJA 4ETBA 4KL7A 1QTHA 4DYGA 4DC4A 152LA 4RDSA 1LZ5A 1CX6A 1K28A 3K3TA 4ARJA 5ILFA 4N9RA 3HWLA 5FELA 232LA 2G4QA 4DJHA 251LA 1JJ0A 4LFXA 4XJBA 5B06A 1NQIA 5HMJA 1GB8A 159LA 1LMCA 3UONA 4XJDA 1L43A 2DQIY 1KXXA 1PQOA 3WYHA 1LSFA 2OTZX 1IWTA 1KY1A 3AZ6A 1L33A 193LA 3OE8A 3RNXA 1LSBA 4EKPA 1QDRA 1D9UA 4G49A 1WTMA 1H87A 211LA 4GN3A 1JJ3A 1LYZA 1BVXA 1L49A 1L96A 2YBIA 5EBHA 1UCOA 231LA 1P56A 4LYTA 1EQ4A 1AKIA 1L37A 1P46A 2QARC 2GV0A 2HUBA 2B7XA 216LA 4OWEA 1LPYA 1OYUA 3RW8A 1LHHA 2Q9EA 1YAQA 2F30A 1L87A 1LSYA 1L57A 142LA 1LJ3A 1CU5A 1DKJA 3CT1A 1B6IA 1GFHA 3A8ZA 3CSRA 1QQYA 3B6LA 2NTHA 2YSSC 2YVBA 194LA 1E8LA 1XEKA 2BQOA 1DYDA 1PQMA 177LA 238LA 1IR8A 1NBYC 3VWOA 1L94A 3FI5A 1L17A 250LA 133LA 4J1BA 4WM1A 102LA 3P66A 4EKQA 5HNCA 5KXTA 2LZTA 1IC4Y 3QE8A 1QDTA 4D9ZA 5KKJA 3A92A 161LA 1IOQA 4LGKA 243LA 3AYQA 1QUTA 4LT0A 2Z12A 3WU8A 4W57A 3OE0A 4YOPA 2PC2A 1L03A 4HV1A 5LVJA 2RBPA 2OE7X 1SWYA 5L3IA 1L21A 3HTFA 1INUA 1DPWA 2RB2X 3WH1A 1CV0A 2RB0X 1L18A 4LDLA 1C69A 4G9SA 2DQEY 259LA 3SN6R 1UA6Y 2XJWA 3CDOA 157LA 1LMNA 1LZDA 4DQJA 1L26A 1A2YC 2H9KA 2Z2EA 1EL1A 1G0PA 3TXFA 1C6KA 5B1FA 3GUKA 5F16A 3LYMA 4IATA 4B4IA 4I7NA 5A3ZA 1L25A 1J1XY 4GLAA 3F6ZA 1L64A 3C82A 3GUNA 1Z55A 4NSJA 1C6PA 122LA 4NGOA 1C10A 2FBBA 1L27A 3RT5X 4Z41A 3SP3A 254LA 1GB9A 1IVMA 4I0CA 5B59A 1CKFA 2C8OA 1VAUA 1L61A 111LA 1GDXA 1GD6A 3T36A 130LA 1B5UA 1L81A 2RAZX 2YBHA 1N4FA 1IOTA 1P2CC 4ARQB 1PQDA 248LA 2LZ2A 4NGKA 3FE0A 4NHTA 258LA 1L99A 1H6MA 4N8ZA 1A4VA 3HUKA 1GB3A 1G7MC 5FHWA 2Z38A 4W55A 1LHJA 3FADA 2HU1A 1B7PA 5LA8A 1DYBA 1BWJA 1NWGA 1I20A 1IP5A 3DN3A 229LA 1JKAA 3HH3A 5I14A 1VATA 1GEZA 113LA 3HUQA 4TUNA 1L89A 3LZ2A 1JEFA 1L10A 1L41A 1HMLA 1PQIA 3C7ZA 3HT6A 1L56A 1UBZA 1GFRA 4NG1A 4LDOA 4XN6A 1CKCA 1IWUA 4XADA 4DT3A 4QDNA 3A96A 2F47A 1NHEA 1RE2A 1LSNA 4ML7A 3AGGG 1BWIA 1OUHA 3CDQA 134LA 5B05A 1IP3A 1F6RA 4R0FA 173LA 2B72A 2MEAA 5LVHA 162LA 1YAOA 2NWDX 3HTBA 3HTDA 1P5CA 2DQFC 222LA 4L41A 108LA 1QTVA 2YBMA 2RBSA 1KW5A 4GBRB 1L76A 1D6PA 4I8SA 1F6SA 1C6GA 1JSFA 1QUGA 1GF4A 3LYOA 1QTKA 3E3DA 4PJZA 1L63A 5KKIA 1YL0X 5KXYA 6LYZA 4G4BA 4NEBA 1LTMA 3C81A 1HMKA 4NHPA 1L62A 1JTPL 3BKHA 4WG1A 1JSEA 3B72A 3NY8A 1QTZA 3HU9A 2O79A 1G06A 1HELA 1ZV5L 2B6TA 1VFBC 1LYDA 4H8YA 4N1CC 160LA 4XJHA 1LJHA 3AB6A 1GFGA 4WL6A 1BHZA 1G0QA 1ZVYB 5HNLA 4ETEA 3WUMA 1CTWA 3HDEA 4YXCA 164LA 3LN2A 3TXEA 1GB5A 4NGZA 1L13A 3DNAA 1LSGA 4EKSA 1LSDA 4BADA 4EOFA 1C7PA 1B7SA 2ZNWY 1GBXA 1LZYA 1GXXA 1JQUA 1NBZC 1YIKA 3HBHA 1GAZA 1L80A 3WW5A 2BQJA 1C6IA 4PHIA 1XEPA 1C6FA 2I6ZA 1XGUC 3WW6A 190LA 1IOSA 145LA 3WU7A 1L15A 3SBBC 1FBIX 4W53A 1C6CA 1VEDA 3AW7A 1DI4A 1L0JA 3A94A 1REZA 4NGLA 3TXBA 4H9AA 4LZTA 2AUBA 3AGHA 1LSZA 2ZILA 3HTGA 1OVKA 187LA 4NHIA 1FLQA 2XBRA 2H9JA 3M3UA 2F4AA 1YQVY 125LA 4NIJA 1T6VL 1L20A 2HECA 178LA 2MEBA 181LA 2B70A 2LZMA 1WQOA 1C43A 3C8QA 1CU0A 1OUDA 3TMVA 1L45A 2HEEA 256LA 4U3XB 1DPXA 1LOZA 206LA 4AQNA 1L97A 1BVKC 1I6SA 5I54A 1L85A 261LA 1V7SA 3AJNA 5AMYA 1SLYA 1GBSA 1G0LA 4EJ4A 2L78A 1CJ9A 3W6CA 1L32A 1TEWA 137LA 3CSQA 1C6JA 3WU9A 5B07A 4E3UA 1QSBA 1C63A 5LYMA 3DKEX 1LYYA 1L44A 4HP0A 5K7OA 2EIZC 1QT7A 227LA 2BQMA 1C08C 1UUZC 2YBJA 4WG7A 1BB7A 1REYA 2Z39A 1JJ1A 1J1PY 1L23A 3G3XA 5L9JA 2BQEA 4ARMB 1B7OA 3T6UA 3OE6A 1GDWA 4WM2A 151LA 2RBNA 1ALCA 5I4WA 3B0OA 2D6BA 1LW9A 1TAYA 3CQLA 1IP1A 1JWRA 4ARMA 3W6DA 4IAPA 1PZYA 4HPIA 1BB4A 1BWHA 5I53A 5DL9A 2DBTA 1BB5A 2D4JA 2Q9DA 1L28A 3RZ4A 1GF7A 1L59A 4DD0A 4B1AA 1LZ8A 2A7DA 2OU9A 4RW2A 2F4GA 196LA 3BKVA 4ETDA 1LI6A 1GFUA 5DLAA 3HBDA 6LYTA 1JITA 1B7RA 4ARQA 3RU5A 1C6DA 2B6XA 3DN1A 126LA 224LA 239LA 5LIOA 3LYTA 242LA 5C6JA 1T3PA 1WTHA 4PGJB 2LYMA 4ETCA 3LZMA 1JTOL 3B0IA 4H8ZA 2RBRA 4MCKA 119LA 120LA 1LSEA 1LJNA 3IWRA 1L46A 1LSMA 1YANA 191LA 4MR1A 5ILCA 2RBOA 5F14A 5HQ1A 3N9CA 4XYYA 4FJRA 1L91A 1L14A 2DQAA 1P3NA 223LA 2FYCA 1UICA 1C62A 1QUOA 1OUAA 1L82A 4DD2A 3LHMA 240LA 1WTNA 107LA 1DXJA 4NHQA 2I25L 4LT1A 1QT5A 2MEGA 6LZMA 1DQJC 1TLAA 1CKDA 4OWHA 1G0KA 1LSPA 3HH6A 4WLTA 1QSQA 4M6DA 235LA 1FLWA 1KXYA 5T3FA 1QTDA 2B6WA 1AT6A 1LZAA 5LYTA 200LA 1AZFA 5DN5A 3PDSA 3DMZA 2O7AA 1LMPA 1LZNA 1XEJA 1IC5Y 3C7WA 2MEIA 3F8VA 182LA 3P4ZA 1C6AA 1WQNA 4H9BA 3V2WA 3G3BB 1YL1X 2DQCY 5LVKA 1L09A 110LA 4GRVA 1XGPC 5KXRA 114LA 1LKRA 5FCPA 1B5VA 1LPIA 3EXDA 1SQ2L 1GF5A 2Z2FA 4GLVA 4I7JA 3WXUA 1ZURA 2G4PA 2MEHA 2ZWBA 2ZQ4A 1CV1A 1GF9A 4OOTA 4OO9A 1L68A 2Z19A 1C6EA 1CV3A 3EO5A 3WVXA 1L60A 4WO6A 2XQOA 233LA 1ZWNA 1GFJA 2MEEA 1CUPA 1B5YA 1LHIA 1OQMA 2FYDA 3AGIA 1HEOA 4GCCA 1L31A 1GFEA 1L0KA 3ATOA 1B5XA 4AGAA 140LA 1GE4A 1KIRC 2N5ZA 2FBDA 3J6KA 2B74A 1GEVA 1GF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BQA A;  4R0F A;  1FN5 A;  1LMO A;  3ATN A;  1IWW A;  2MEA A;  1JKB A;  1AT5 A;  3A91 A;  3A6C Y;  5LVH A;  4H9I A;  2X0A A;  4GCF A;  1FLY A;  1BQL Y;  1YAO A;  4C3W A;  2NWD X;  3CT0 A;  3OJP A;  4NSG A;  3D9A C;  4PJ2 C;  3ZEK A;  4X3B A;  1YKY X;  4ZEE A;  4HJV A;  2DQF C;  4L41 A;  3WL2 A;  2Z37 A;  1GBO A;  5I5Q A;  5I4X A;  1XGR C;  1WQM A;  2A7F A;  2YBM A;  3EBA B;  4WM5 A;  4XJI A;  1LSC A;  4B4E A;  3AZ4 A;  1LZ1 A;  2BQH A;  2MEF A;  3WUL A;  2Z18 A;  1BB6 A;  1QSA A;  1HEW A;  3TXG A;  1D6P A;  4I8S A;  4DDB A;  1RCM A;  4Z98 A;  1F6S A;  1IOR A;  1EQ5 A;  1JSF A;  1C45 A;  4H9F A;  3TMW A;  1GHL A;  4WLX A;  1OUC A;  1YKZ X;  1NKH A;  5KXL A;  4ANR A;  2CDS A;  1GF4 A;  1LZB A;  1QTK A;  3E3D A;  1IIZ A;  1UIE A;  1XEI A;  1KIP C;  3LYO A;  4W94 A;  5KXM A;  1XSF A;  5APF A;  3AW6 A;  3WXT A;  1UIF A;  1G7J C;  4M4O A;  4ETA A;  1HF4 A;  1FDL Y;  1GWD A;  2D4I A;  4LYM A;  1YL0 X;  5KKI A;  5KXY A;  1HFY A;  2ZYC A;  1IX0 A;  4G4B A;  6LYZ A;  1OUI A;  1GB0 A;  1UIB A;  4NEB A;  1LTM A;  1FKV A;  1IWV A;  4G4C A;  4PRU A;  3WPK A;  4B4J A;  1IP6 A;  2HEA A;  8LYZ A;  4B49 A;  4DWX A;  4IJ4 A;  1HMK A;  1IP2 A;  2W1Y A;  4NHP A;  1IWX A;  1RI8 B;  4J1A A;  4MST A;  1JTP L;  2LYZ A;  1B2K A;  3BKH A;  3FI7 A;  4A7D A;  2C8P A;  1W08 A;  3WPJ A;  4XJF A;  4WG1 A;  3TMX A;  1JSE A;  5M1Y A;  2DQJ Y;  1UIA A;  2H5Z A;  5KXN A;  4XJG A;  5LA5 A;  1ZMY L;  3B72 A;  2DQD Y;  2YDG A;  2HED A;  5C6L A;  4H1P A;  1HEL A;  1ZV5 L;  5LIN A;  2EPE A;  4HTK A;  4OWA A;  132L A;  4QEQ A;  2DKV A;  1VFB C;  3W6A A;  1LSA A;  4H8Y A;  4N1C C;  4XJH A;  1B5Z A;  1LJH A;  1YIL A;  3AB6 A;  1GFG A;  4WL6 A;  1BHZ A;  4WM6 A;  1DI3 A;  1IP7 A;  1UAC Y;  1ZVY B;  2RSC A;  3P65 A;  1IR9 A;  5HNL A;  4ETE A;  1GE2 A;  4RLM A;  3WUM A;  4TSB A;  1EQE A;  4GCD A;  4CFP A;  2BPU A;  5HMV A;  3LN2 A;  3TXE A;  1LYS A;  3W6F A;  5KY1 A;  2Q0M X;  1GB5 A;  1GPQ C;  3AZ7 A;  1IEE A;  2MEC A;  4NGZ A;  1LZR A;  2BQD A;  5DN4 A;  4WOA A;  4GCB A;  3IJU A;  1LSG A;  1HEQ A;  1XGQ C;  4LYB A;  1LSD A;  2HEF A;  4R6C A;  4BAD A;  4EOF A;  4J0L A;  2I26 L;  4G4H A;  1C7P A;  1B7S A;  1JKD A;  1YAM A;  2ZNW Y;  1GBX A;  1LZY A;  2LYO A;  4KPM A;  1IC7 Y;  1GXX A;  1NBZ C;  1YIK A;  2D4K A;  3HBH A;  4XEN A;  1B7Q A;  1GAZ A;  3WW5 A;  2BQJ A;  1NDG C;  4PHI A;  5LVI A;  5IHG A;  135L A;  3B0K A;  2MED A;  5HLL A;  2CJL A;  1HEN A;  2I6Z A;  4HSF A;  1XGU C;  4ET9 A;  3WW6 A;  1LZT A;  1LJI A;  1BGI A;  1IOS A;  3LYZ A;  4HTQ A;  4NG8 A;  3TXK A;  5KJ9 A;  2BQI A;  1XGT C;  1HER A;  4H8X A;  1B0D A;  1MLC E;  5LYZ A;  3WU7 A;  1OUJ A;  3CT5 A;  4ETB A;  1FBI X;  2BQC A;  1JTT L;  4KL7 A;  1JIS A;  4DYG A;  4TX7 A;  1VED A;  207L A;  3AW7 A;  4DC4 A;  2G4N A;  4RDS A;  4CJ2 A;  1LZ5 A;  5IEL A;  3K3T A;  1DI4 A;  4O34 A;  1B5W A;  1LJE A;  3A94 A;  1REZ A;  1GBZ A;  1GF0 A;  4NGL A;  3TXB A;  4H9A A;  2BQL A;  4LYC A;  1GB2 A;  1CNS A;  1UIH A;  4LZT A;  2AUB A;  5ILF A;  1VDS A;  4N9R A;  4NHS A;  5FEL A;  3AGH A;  1LSZ A;  3WVY A;  2ZIL A;  5LAG A;  1WQP A;  4ET8 A;  2G4Q A;  3AZ5 A;  1QTE A;  1NDM C;  2F2N A;  1JJ0 A;  1FLQ A;  4NHI A;  1YRO A;  2XBR A;  4LFX A;  2H9J A;  3M3U A;  4XJB A;  2F4A A;  1YQV Y;  5B06 A;  9LYZ A;  2IHL A;  4NIJ A;  1NQI A;  5HMJ A;  1GB8 A;  1HSW A;  1LMT A;  4LT3 A;  3TMU A;  1LMC A;  4NGW A;  1B7M A;  4XJD A;  1T6V L;  3QNG A;  1REX A;  2WAR A;  2DQI Y;  1KXX A;  5DM9 A;  2HEC A;  2MEB A;  1LJ4 A;  3WYH A;  4J7V A;  1LSF A;  1GF3 A;  5C6I A;  4UWV A;  1WQO A;  1C43 A;  1IWT A;  4QY9 A;  3AZ6 A;  4H9H A;  1OUD A;  1KXW A;  2HEE A;  3TMV A;  1IWY A;  4DD7 A;  1C46 A;  193L A;  4LT2 A;  1OP9 B;  3RNX A;  4U3X B;  1LSB A;  2XBS A;  1DPX A;  1LOZ A;  3WUN A;  1QDR A;  1B7N A;  2ZQ3 A;  1D9U A;  5KXW A;  1LZE A;  3OK0 A;  1BVK C;  4H94 A;  4CGE A;  1FLU A;  4G49 A;  2LHM A;  5I54 A;  1WTM A;  3CB7 A;  4YEN A;  1B7L A;  1H87 A;  5D5F A;  4GN3 A;  1XFP L;  2HTX A;  1V7S A;  3AJN A;  5AMY A;  1SLY A;  1GBS A;  4WMG A;  1JJ3 A;  1LJF A;  1LYZ A;  2D91 A;  4LFP A;  1J1O Y;  1BVX A;  2W1L A;  3LZT A;  4NFV A;  1CJ9 A;  2IFF Y;  3W6C A;  4DD3 A;  2BQF A;  2YBI A;  5EBH A;  1LZS A;  1G7L C;  1UCO A;  1TEW A;  3ULR A;  3HBE X;  1IR7 A;  1LHK A;  3CSQ A;  1LHM A;  3WU9 A;  4OW1 A;  1UIG A;  4LYT A;  5B07 A;  4HJZ A;  4GN4 A;  4E3U A;  5FEK A;  2DQG Y;  1EQ4 A;  5LYM A;  1CJ8 A;  1AKI A;  1UID A;  5F9X A;  5APC A;  4TSC A;  4QGZ A;  4ZFP A;  2GV0 A;  2YBL A;  2EKS C;  3GXK A;  1GFT A;  1HEM A;  1LYY A;  1LZC A;  2ZYP A;  4HP0 A;  1LCN A;  5K7O A;  2EIZ C;  2HUB A;  4Z3M A;  3RW8 A;  4OWE A;  3W6B A;  5IDD A;  4LYZ A;  1HC0 A;  2BQM A;  4H9C A;  1LHH A;  3ZVQ A;  1C08 C;  1UUZ C;  1YAQ A;  2F30 A;  2YBJ A;  1BB7 A;  3HFM Y;  4H90 A;  4WG7 A;  1REY A;  4AXT A;  1LHL A;  1LSY A;  2EQL A;  1LJ3 A;  1JJ1 A;  2Z39 A;  1J1P Y;  1OUF A;  1ZVH L;  3P64 A;  1DKJ A;  4RW1 A;  5APE A;  5L9J A;  3MGW A;  1IOC A;  5LAF A;  5F81 A;  2BQE A;  3CT1 A;  3J4G A;  4CFO A;  1GFH A;  1B7O A;  3T6U A;  3A8Z A;  3CSR A;  1GDW A;  5JEN B;  1QQY A;  2B5Z A;  3B6L A;  1LAA A;  4NGI A;  4NGY A;  4WM2 A;  1DZB X;  153L A;  4CHX A;  5APD A;  1ALC A;  2YSS C;  5I4W A;  2YVB A;  1HFZ A;  3QY4 A;  3B0O A;  1LJK A;  1UC0 A;  2D6B A;  4TWS A;  194L A;  1MEL L;  3CSZ A;  1TAY A;  3WMK A;  1E8L A;  3CQL A;  1IP1 A;  4OWB A;  1XEK A;  2BQO A;  1GF8 A;  1JWR A;  1GE3 A;  4H9E A;  3W6D A;  3W3E A;  1WVV A;  3A3R X;  1IR8 A;  1NBY C;  1PZY A;  4HPI A;  1BB4 A;  1F10 A;  1OUG A;  1LZG A;  1BWH A;  3VWO A;  1JIY A;  1GBY A;  1GFV A;  4OOO A;  3TXI A;  1D0L A;  1LYO A;  4C5F A;  5I53 A;  133L A;  1DI5 A;  4J1B A;  5DL9 A;  1GE1 A;  4WM1 A;  2DBT A;  5KXZ A;  3P66 A;  1LZ9 A;  1GB6 A;  1O23 A;  2BQG A;  5HNC A;  5KXT A;  2LZT A;  1LZ4 A;  4HPE A;  1IC4 Y;  1IY4 A;  1BB5 A;  4NY5 A;  5KXO A;  3QE8 A;  1QDT A;  2D4J A;  5L3H A;  4D9Z A;  3A92 A;  5KKJ A;  3RZ4 A;  1GF7 A;  1IOQ A;  4LGK A;  3A67 Y;  3AYQ A;  4DD0 A;  1QUT A;  1VDP A;  4DD9 A;  4LT0 A;  1VDQ A;  3A93 A;  4WLY A;  3M18 B;  3TXD A;  4B1A A;  2Z12 A;  1LZ8 A;  7LYZ A;  1WQQ A;  2A7D A;  3WU8 A;  4LYO A;  4BAF A;  1OUE A;  2F4G A;  4RW2 A;  4DDC A;  4YOP A;  2PC2 A;  4HV1 A;  5LVJ A;  3TXJ A;  3BKV A;  3N9E A;  1JPO A;  4ETD A;  5FDJ A;  2VB1 A;  1GFU A;  5DLA A;  3HBD A;  1FKQ A;  5L3I A;  6LYT A;  1JIT A;  4WO9 A;  1B7R A;  4NGV A;  5KXP A;  1INU A;  3RU5 A;  4DDA A;  3A34 A;  1DPW A;  3WH1 A;  4YEO A;  4BS7 A;  4WL7 A;  5LIO A;  3LYT A;  4Z46 A;  2YBN A;  5C6J A;  1REM A;  2CWI A;  1T3P A;  4PGJ B;  2LYM A;  4ETC A;  4G9S A;  4HV2 A;  1JTO L;  1HSX A;  1G7I C;  3B0I A;  4H8Z A;  2DQE Y;  4MCK A;  3TXH A;  4BAP A;  5KXS A;  1UA6 Y;  1LSE A;  2XJW A;  4NSH A;  4NWH A;  1LJN A;  2Y8P A;  1LMN A;  1LZD A;  4OWC A;  3IWR A;  1GBW A;  1A2Y C;  5B1G A;  2H9K A;  2Z2E A;  1EL1 A;  1TCY A;  1NF5 A;  3TXF A;  1LSM A;  1YAN A;  1QUS A;  1WQR A;  4YF2 A;  1JKC A;  1RJC B;  4NGJ A;  5B1F A;  1HHL A;  1GFA A;  1TDY A;  4MR1 A;  5ILC A;  5F14 A;  5HQ1 A;  1CKH A;  1HNL A;  3N9C A;  4XYY A;  4FJR A;  5F16 A;  3LYM A;  4IAT A;  4B4I A;  5A3Z A;  5LXW A;  2HU3 A;  1J1X Y;  4WM3 A;  1LJG A;  4DD1 A;  4GLA A;  2DQA A;  3F6Z A;  2FYC A;  1UIC A;  1F0W A;  1OUA A;  1GXV 2;  4HTN A;  4PRQ A;  4DD2 A;  1BB3 A;  1GAY A;  3LHM A;  1Z55 A;  1WTN A;  4YM8 A;  1JHL A;  4FDY A;  4NSJ A;  4HJY A;  4NGO A;  1DXJ A;  2ZNX Y;  3G3A B;  1C10 A;  2ZIJ A;  2FBB A;  1GE0 A;  4H91 A;  4NHQ A;  4RLN A;  3RT5 X;  4GCE A;  2I25 L;  4LT1 A;  4NWE A;  4Z41 A;  3IJV A;  3P68 A;  2MEG A;  3SP3 A;  1D0M A;  2BQN A;  1GB9 A;  1DQJ C;  4GN5 C;  4I0C A;  1CKF A;  5B59 A;  1VDT A;  1IVM A;  1CKD A;  4OWH A;  3GXR A;  208L A;  1CJ6 A;  4H92 A;  1LSP A;  4WLT A;  2C8O A;  1VAU A;  4M6D A;  4IAS A;  5II3 A;  3W6E A;  1FLW A;  3EMS A;  1GDX A;  5LVG A;  1GD6 A;  1KXY A;  5T3F A;  3T36 A;  1RFP A;  1B5U A;  1GFK A;  3A3Q A;  2YBH A;  1AT6 A;  1LZA A;  5A3E A;  1N4F A;  5LYT A;  1IOT A;  1AZF A;  5KXK A;  3WUA A;  5DN5 A;  1P2C C;  1KIQ C;  4UWN A;  1HFX A;  4WM4 A;  1DKK A;  1LMP A;  1YKX X;  1LZN A;  4PPO A;  2HEB A;  5E9R A;  1XEJ A;  1IC5 Y;  2LZ2 A;  4NGK A;  1YAP A;  1WVU A;  3FE0 A;  4NHT A;  4TTD A;  2MEI A;  3P4Z A;  1H6M A;  4N8Z A;  1JUG A;  1LJJ A;  1A4V A;  1WQN A;  4H9B A;  4KXI A;  2BLY A;  1YL1 X;  1HEP A;  1I56 A;  2DQC Y;  3G3B B;  5LVK A;  3D3D A;  4ZIX A;  1GB3 A;  4N5R A;  1G7M C;  5FHW A;  4YEM A;  2Z38 A;  5F9U A;  1IWZ A;  1LHJ A;  5I4Y A;  1XGP C;  3A95 A;  5KXR A;  2HU1 A;  1B7P A;  1LKR A;  2BQB A;  5LA8 A;  1B5V A;  1BWJ A;  1LPI A;  2W1M A;  3KAM A;  5FCP A;  3EXD A;  1IO5 A;  1CJ7 A;  1GF5 A;  1SQ2 L;  3N9A A;  4NSI A;  4B0D A;  2Z2F A;  1NWG A;  4GLV A;  1I20 A;  1IP5 A;  3WXU A;  1JKA A;  2G4P A;  4N0J A;  2MEH A;  1GB7 A;  2ZWB A;  4P2E A;  1VAT A;  2ZQ4 A;  5D5C A;  1GEZ A;  1GF9 A;  4OOT A;  2BLX A;  2Z19 A;  1D0K A;  4H93 A;  4TUN A;  3EO5 A;  1B9O A;  3LZ2 A;  1LMA A;  4UWU A;  1OUB A;  4WO6 A;  3WVX A;  154L A;  1JEF A;  1HML A;  5FST A;  1TBY A;  2DQH Y;  1IP4 A;  4II8 A;  1I1Z A;  1GFJ A;  2MEE A;  2BQK A;  1LMQ A;  2CGI A;  1UBZ A;  1GFR A;  1B5Y A;  1LHI A;  1OQM A;  4NG1 A;  4KT3 A;  2FYD A;  5E4P A;  3A6B Y;  1HEO A;  2W1X A;  3AGI A;  2XTH A;  1G7H C;  4GCC A;  1CKC A;  2BAA A;  4XN6 A;  5J7C A;  1IWU A;  1GFE A;  3ATO A;  4XAD A;  1NMM A;  1B5X A;  4AGA A;  4QDN A;  4DT3 A;  3A96 A;  4WLD A;  1NHE A;  1RE2 A;  1GE4 A;  1LKS A;  1KIR C;  1LSN A;  2N5Z A;  1IY3 A;  1QSW A;  2FBD A;  4EMN A;  3J6K A;  4W96 A;  4N1E I;  1D6Q A;  1W6Z A;  3AGG G;  1CKG A;  1BWI A;  1LZ6 A;  1PS5 A;  1V7T A;  4ML7 A;  3WPL A;  3ZVQ B;  5KXX A;  1OUH A;  134L A;  5B05 A;  2ZIK A;  1QIO A;  1GEV A;  1IP3 A;  1AM7 A;  1F6R A;  1GF6 A;  3A90 A; 
#chains in the Genus database with same CATH topology
 1CU2 A;  1ZMU A;  2R0I A;  1LMO A;  3F9L A;  1T8A A;  1G1W A;  1IWW A;  1JKB A;  2OU8 A;  3A6C Y;  4H9I A;  1L2B A;  4YXA C;  4GCF A;  1FLY A;  1AIP C;  1BQL Y;  3Q8G A;  3GUO A;  3D9A C;  4NSG A;  4PJ2 C;  4X3B A;  169L A;  1Q3C A;  1XGR C;  4AKH A;  4WM5 A;  3HJ8 A;  1C65 A;  2MR9 A;  3I04 M;  1L83 A;  1ZQ9 A;  1LZ1 A;  212L A;  118L A;  2Z18 A;  1QSA A;  1HEW A;  3DN4 A;  1L69 A;  1RCM A;  3F92 A;  4Z98 A;  3NWL A;  1EQ5 A;  1C45 A;  4H9F A;  2H5X A;  1L35 A;  4IIW A;  1CV4 A;  1OUC A;  3KSJ A;  5KXL A;  1L92 A;  1P2L A;  1LZB A;  3GLI E;  1L19 A;  1KIP C;  5APF A;  2XZF A;  3U60 A;  3WXT A;  4M4O A;  4ETA A;  1KW7 A;  4LYM A;  1QS9 A;  1GB0 A;  4PRU A;  1FKV A;  1IWV A;  4G4C A;  4EXM A;  3KFU G;  2MJ5 B;  2RRU A;  5FTL A;  1EPY A;  4M0D A;  2W1Y A;  4MST A;  2RH1 A;  2Z3X A;  4LZM A;  3GLI A;  210L A;  4FCT A;  1QS5 A;  3AJI B;  4D82 A;  2YDG A;  3ODU A;  1OVH A;  4H1P A;  4I7T A;  1VEG A;  2OO9 A;  4QEQ A;  165L A;  2B75 A;  167L A;  3U61 A;  4B08 A;  109L A;  1N75 A;  4WM6 A;  1UAC Y;  1IR9 A;  1D2Y A;  1GE2 A;  4RLM A;  186L A;  4R7G A;  1EQE A;  4GCD A;  2ZAM A;  2L6O A;  1LWG A;  1JTM A;  5KY1 A;  1XXH E;  3SMP A;  1GPQ C;  5BPV A;  195L A;  3AZ7 A;  1IEE A;  1LZR A;  1TGU A;  1TDH A;  4GCB A;  205L A;  1EIJ A;  1DV0 A;  1XGQ C;  4R6C A;  3GRV A;  4J0L A;  2I26 L;  4G4H A;  1JKD A;  1IC7 Y;  139L A;  1PQJ A;  2D4K A;  2KRU A;  1G71 A;  5LVI A;  1LI2 A;  5IHG A;  1L54 A;  5ITX E;  3E21 A;  1GL6 A;  2ANV A;  1T43 A;  4AG6 A;  1BGI A;  1LJI A;  1P7S A;  5KJ9 A;  1HER A;  4YY3 M;  1MLC E;  1LYI A;  1L50 A;  3CT5 A;  2BQC A;  1WIV A;  1MN3 A;  3VDP A;  2G4N A;  4IJF A;  221L A;  1OWZ A;  5IEL A;  226L A;  2BWB A;  2UUB M;  170L A;  4DV5 M;  1LJE A;  4O34 A;  1GBZ A;  5ITY A;  2BQL A;  2KW0 A;  1GB2 A;  1L98 A;  1VDS A;  1TF0 B;  3WVY A;  2XH9 A;  1R6B X;  3SMS A;  2LCB A;  4ET8 A;  3U60 B;  2DAG A;  1QTE A;  2F2N A;  2JZ0 A;  1Q3B A;  2F2Q A;  1OAI A;  2IHL A;  4I7R A;  1D3J A;  1L34 A;  1LMT A;  4LT3 A;  4NGW A;  1L39 A;  1B7M A;  2QP9 X;  103L A;  3D4S A;  3QNG A;  5DM9 A;  1T97 A;  4J7V A;  4LJ7 A;  3FD9 A;  1GF3 A;  3I01 M;  5C6I A;  4UWV A;  3TWK A;  2R62 A;  3DN8 A;  4H9H A;  1KXW A;  4DD7 A;  1IWY A;  2WSF F;  2Y21 A;  1OP9 B;  2LTU A;  2QBY A;  3DN0 A;  1GAB A;  1OV5 A;  3WUN A;  2ZQ3 A;  1L48 A;  2F32 A;  5KXW A;  4ARP A;  2HUM A;  3OK0 A;  4H94 A;  3SBA A;  3DZD A;  1FLU A;  2LHM A;  1KY0 A;  4YEN A;  3HDF A;  3HUA A;  3BXW A;  4WMG A;  1D3F A;  2D91 A;  4LFP A;  3K2R A;  1J1O Y;  1HNZ M;  1CX7 A;  2W1L A;  4NFV A;  3HX3 A;  2IFF Y;  4DD3 A;  3SAS A;  2HHH M;  2BQF A;  5E6J A;  2JY8 A;  2JXN A;  1G7L C;  3HBE X;  3HH4 A;  1L2D A;  4MGK E;  220L A;  1UIG A;  158L A;  4MH0 E;  3G3V A;  2Y0Q A;  4HJZ A;  3HHY A;  3J7B A;  2R45 A;  1CJ8 A;  5F9X A;  5APC A;  2DZL A;  4JI5 M;  4ZFP A;  148L E;  2DVW B;  2YBL A;  1L01 A;  1C61 A;  2EKS C;  3GXK A;  1GFT A;  1HEM A;  1LZC A;  4DBG B;  4LDE A;  4Z3M A;  3SHF A;  1OKS A;  131L A;  1L06 A;  2OE4 X;  4H90 A;  3ZVQ B;  1LGX A;  3HFM Y;  257L A;  3SB8 A;  1DGF A;  5E26 A;  1P36 A;  3U6Q A;  1L16 A;  1WGL A;  3J4G A;  4CFO A;  2JA2 A;  2KXE A;  1HNX M;  5JEN B;  1VQ1 A;  2B5Z A;  4CHX A;  5APD A;  4GRI A;  1W5T A;  4FW9 A;  3QY4 A;  1DGB A;  188L A;  7LZM A;  1UC0 A;  3UGJ A;  4TWS A;  1TH2 A;  3GPX A;  2X8A A;  5DYG A;  3CSZ A;  3GRR A;  3WMK A;  2Z8Y M;  2LWX A;  3E4R A;  4H9E A;  2QZ4 A;  1GF8 A;  1GE3 A;  127L A;  3W3E A;  1F10 A;  1LYJ A;  2DHY A;  4LFC M;  1K82 A;  3GQ5 A;  2CV1 A;  4LJA A;  3CGW A;  5EXP A;  1C6H A;  4OOO A;  3TXI A;  1LYO A;  4C5F A;  4ZPU A;  1DI5 A;  1L95 A;  3SB9 A;  3RUN A;  1RU3 A;  2HWJ A;  5KXZ A;  1LZ9 A;  3LMM A;  1DYF A;  2BQG A;  1Z5B A;  5KQD A;  3AL0 C;  4R3D A;  2P5T A;  1LZ4 A;  4NY5 A;  1IY4 A;  5KXO A;  4IBE A;  5L3H A;  4NRV A;  3CDV A;  4Z6Y A;  1L86 A;  2C9C A;  3SAV A;  1NHB A;  1VDP A;  2DXI A;  4FCV A;  1VDQ A;  4WLY A;  3M18 B;  3TXD A;  236L A;  2VDB B;  4I7S A;  3AOE C;  1XJU A;  1L72 A;  3TXJ A;  128L A;  5FDJ A;  2VB1 A;  123L A;  2DWL A;  3W0F A;  1FKQ A;  1QT8 A;  3D8B A;  218L A;  4DDA A;  4WO9 A;  1OWY A;  3A34 A;  1F4I A;  3TPZ A;  5ITQ A;  1HR0 M;  252L A;  1QAQ A;  1CVK A;  4YEO A;  3PVS A;  4WL7 A;  4QHT A;  1TTE A;  2Z6B A;  1REM A;  5EP1 A;  1JTN A;  4PDG A;  1OFI A;  4L78 A;  1K3W A;  1G1V A;  4CIS A;  1HSX A;  4JI6 M;  3TXH A;  4BAP A;  234L A;  4NWH A;  2ANX A;  2CP8 A;  4OWC A;  1GBW A;  2FFJ A;  4KT0 F;  1NF5 A;  147L A;  2RGH A;  1WQR A;  4YF2 A;  5H37 D;  1HHL A;  3U6E A;  1GFA A;  1TDY A;  241L A;  3NBX X;  3DN2 A;  247L A;  230L A;  3HU8 A;  112L A;  2QHO B;  4XK8 F;  1N34 M;  1T8F A;  1PQK A;  4B3S M;  4I7P A;  4WM3 A;  3HHZ A;  5KPZ A;  1J5E M;  2DAM A;  3KOX E;  1GJT A;  1GXV 2;  214L A;  5DFL A;  4PRQ A;  1BB3 A;  1GAY A;  2AHM A;  4YM8 A;  1JHL A;  4FDY A;  4HJY A;  1L47 A;  144L A;  3G3A B;  2ZIJ A;  4RLN A;  2O4W A;  4H91 A;  4NWE A;  3IJV A;  3P68 A;  4AZF A;  2BQN A;  3AOE A;  3FUW A;  4M9S A;  1XNR M;  1L04 A;  1VDT A;  1PJS A;  1CJ6 A;  1P2R A;  4JV5 M;  1E94 E;  5II3 A;  5FLX S;  4W58 A;  5LVG A;  2B6Y A;  4DR6 M;  3B7N A;  4BBA A;  4DAJ A;  2HCB A;  3A3Q A;  1IM2 A;  1DYE A;  1NHG C;  2B3T A;  5A3E A;  3FTF A;  1L65 A;  4I7O A;  2FH0 A;  2GQF A;  5KXK A;  4X62 M;  4GMQ A;  4X65 M;  4WM4 A;  1DKK A;  2Z4S A;  4PPO A;  2HEB A;  2DZO B;  1YAP A;  1QZM A;  2N35 A;  138L A;  3FRH A;  2J5Y A;  1QQW A;  3C7Y A;  2BLY A;  1HEP A;  1IN8 A;  3D3D A;  4ZIX A;  4YEM A;  1ZV1 A;  5I4Y A;  1IWZ A;  1L40 A;  1AUA A;  3A95 A;  1D3M A;  2BQB A;  3HKP A;  4TUW A;  1J7K A;  4W59 A;  3N9A A;  3KOZ E;  1ORY B;  4B0D A;  3PFI A;  2BWE A;  3C80 A;  156L A;  3FE3 A;  3T38 A;  4S12 A;  4N0J A;  1GB7 A;  5D5C A;  1L88 A;  4II7 A;  1L71 A;  3RZE A;  1B9O A;  4UWU A;  5ITR A;  1OUB A;  154L A;  262L A;  4NXN M;  3LQR A;  1HT2 E;  1CU6 A;  8CAT A;  4RF1 A;  197L A;  2BQK A;  3FTE A;  2CGI A;  1L12 A;  5E4P A;  1TDZ A;  1R2Y A;  2MGW A;  1G7H C;  2QB0 B;  2W1X A;  2BAA A;  1QUH A;  5J7C A;  2LNH C;  3VKG A;  2RKO A;  1QTC A;  4WLD A;  2JY6 B;  3SAT A;  1LKS A;  3GQ3 A;  1GLN A;  4D80 A;  2UXB M;  1IY3 A;  4I4L A;  4W96 A;  4N1E I;  3LCU A;  1D6Q A;  1D9W A;  2RB1 X;  1CKG A;  5KXX A;  2CV2 A;  1L53 A;  3WPL A;  199L A;  1DGG A;  1SXJ E;  1I94 M;  2JUJ A;  2BQA A;  5IT9 S;  2OTY X;  1FN5 A;  3CDR A;  4PT5 A;  3ATN A;  1AT5 A;  1L42 A;  3A91 A;  4I8O A;  3J80 S;  2X0A A;  4C3W A;  3I4Y A;  5LMU M;  3HHX A;  4W52 A;  3OJP A;  1XXH A;  2F5P A;  1YKY X;  244L A;  4ZEE A;  4HJV A;  3OE9 A;  1PM5 A;  4LZZ A;  2DAE A;  3WL2 A;  3VKH A;  4DR1 M;  2Z37 A;  1GBO A;  1D3N A;  253L A;  1WQM A;  4XJI A;  3EBA B;  1LSC A;  5IWA M;  4GHL A;  184L A;  2BQH A;  2MEF A;  3WUL A;  1QT6 A;  1BB6 A;  3TXG A;  3GUI A;  1LYG A;  1GHL A;  5LZM A;  4WLX A;  1YKZ X;  1NKH A;  4I81 A;  201L A;  2CDS A;  4W94 A;  1XEI A;  3L2X A;  2FE8 A;  1CUQ A;  4GEW A;  1GKI A;  1FDL Y;  1HF4 A;  4EPF A;  1SXJ B;  1L67 A;  4BB9 A;  5ITX A;  1QT4 A;  2F5O A;  172L A;  1ZMV A;  1CV5 A;  3FTD A;  4B4J A;  1IP6 A;  2HEA A;  8LYZ A;  4DWX A;  1IWX A;  1RI8 B;  1EE8 A;  2LYZ A;  1B2K A;  4A7D A;  3MMP A;  2C8P A;  1W08 A;  3WPJ A;  4XJF A;  3TMX A;  5M1Y A;  4XJG A;  5LA5 A;  1C64 A;  1MU5 A;  1ZMY L;  1L58 A;  2DQD Y;  4F1I A;  5C6L A;  5LIN A;  4OWA A;  2DKV A;  1NJF A;  1L22 A;  7CAT A;  3B7Q A;  5FTJ A;  1G8P A;  3HU1 A;  3C83 A;  1NSF A;  3GUP A;  1SX7 A;  3J2P B;  4TSB A;  4CFP A;  3HT7 A;  1LYS A;  4OVZ A;  2Q0M X;  3BOS A;  1KSF X;  2G3Q A;  1BVS A;  1P6Y A;  2BQD A;  4WOA A;  3SB7 A;  237L A;  3IJU A;  1QTB A;  1NV9 A;  5EQT A;  4LF5 M;  163L A;  1HEQ A;  2HEF A;  4IBK A;  1PGY A;  4AKG A;  260L A;  5FTK A;  2UUC M;  3L64 A;  1YAM A;  246L A;  2LYO A;  4KPM A;  3QAK A;  1C1K A;  1KS3 A;  1NDG C;  171L A;  1T6H A;  1R5L A;  3B0K A;  1L29 A;  2MED A;  5HLL A;  3IG5 A;  104L A;  4ET9 A;  4LY6 A;  180L A;  4NG8 A;  4HTQ A;  2BQI A;  1XGT C;  1B0D A;  2KRK A;  3GLF E;  1JTT L;  213L A;  1JIS A;  1VDD A;  4TX7 A;  207L A;  1YUB A;  3FA0 A;  4CJ2 A;  1R2Z A;  3L27 A;  1DO2 A;  3UMM A;  1B5W A;  1XMO M;  3I4V A;  3GLG E;  1GF0 A;  4LYC A;  1CNS A;  1UIH A;  1SX2 A;  1LYE A;  2KA6 B;  4NHS A;  4I7M A;  5LAG A;  1WQP A;  228L A;  166L A;  3AZ5 A;  3QWL A;  3OTO M;  1NDM C;  3IEC A;  3U61 B;  1T6O A;  1YRO A;  198L A;  217L A;  219L A;  3B89 A;  3KP0 E;  9LYZ A;  5IZ7 D;  3VK8 A;  1HSW A;  2MRO B;  1L36 A;  3TMU A;  175L A;  1REX A;  1D2W A;  2WAR A;  1LJ4 A;  2O25 A;  5FTN A;  155L A;  4JI8 M;  4YHH M;  4QY9 A;  3U5Z B;  4I7K A;  3U6L A;  3FKE A;  1C46 A;  4LT2 A;  3ILK A;  3GLF B;  2HUK A;  2XBS A;  3UJN A;  1L51 A;  3EML A;  1B7N A;  4G4Q A;  1LZE A;  3IG8 A;  4CGE A;  4I7L A;  1C66 A;  1L84 A;  1C6Q A;  3CB7 A;  1B7L A;  5D5F A;  2UXC M;  1XFP L;  2HTX A;  1LJF A;  2V1U A;  2KNA A;  5EJC A;  3LZT A;  1L30 A;  3SB6 A;  1LZS A;  150L A;  2L4F A;  1L93 A;  3ULR A;  1IR7 A;  1LHK A;  2LC9 A;  1LHM A;  4OW1 A;  4DV6 M;  5FEK A;  2DQG Y;  2HL7 A;  2ZBK B;  1T8G A;  3SAW A;  4I7Q A;  1UID A;  1LLH A;  4TSC A;  2D7E A;  4QGZ A;  1LWK A;  1C60 A;  3GRU A;  2ZYP A;  1LCN A;  1L73 A;  2YNM D;  3C8S A;  4W54 A;  4LYZ A;  4LZJ A;  4QNM A;  5IDD A;  4H9C A;  3W6B A;  1HC0 A;  3ZVQ A;  3CDT A;  4AXT A;  3QYB A;  2EO2 A;  1LHL A;  2L7I A;  1LI3 A;  2EQL A;  2L2D A;  1G0J A;  1OUF A;  1ZVH L;  3P64 A;  4RW1 A;  5APE A;  3MGW A;  1JQJ C;  2CUU A;  2Z7J A;  1HQY E;  4IBJ A;  4LF4 M;  1IOC A;  5F81 A;  5LAF A;  4FWD A;  2L4E A;  5EXT A;  4NGY A;  3GUM A;  1LAA A;  4NGI A;  2A4T A;  153L A;  1DZB X;  1L79 A;  1HFZ A;  3KW6 A;  1LJK A;  4HL4 A;  143L A;  3KOW E;  1MEL L;  1KNI A;  3H4M A;  2CEA A;  3K9P A;  4OWB A;  3G3W A;  2CHQ A;  1IY0 A;  1WVV A;  3A3R X;  1C67 A;  3TWL A;  2LVA A;  1OUG A;  2DWZ B;  1LZG A;  4K5Y A;  3C58 A;  1JIY A;  1GBY A;  1GFV A;  1QZE A;  4G4R A;  1D0L A;  4DV4 M;  1LYF A;  2R46 A;  1L02 A;  1GE1 A;  1P37 A;  4L4U A;  1GB6 A;  1O23 A;  3NYA A;  4HPE A;  3R8F A;  4B3M M;  3U6C A;  4S0W A;  3C9P A;  1IN5 A;  4I5S A;  1DYC A;  1NNU C;  4LGY A;  3A67 Y;  1YE9 A;  4XBO A;  1C6T A;  4DD9 A;  1DYG A;  3A93 A;  1L08 A;  4DV3 M;  7LYZ A;  1WQQ A;  1V92 A;  1L11 A;  4LYO A;  4BAF A;  4DKL A;  5F3W A;  1OUE A;  4DDC A;  4IBI A;  2HUL A;  3LCV B;  4LF7 M;  4DR4 M;  3N9E A;  3FYC A;  1JPO A;  1C68 A;  1DYA A;  4RF0 A;  3KSX A;  4FVM A;  5KXP A;  4NGV A;  1YLA A;  1C6M A;  2B73 A;  249L A;  3TE6 A;  4BS7 A;  4WP2 A;  4Z46 A;  1CU3 A;  225L A;  2YBN A;  2CWI A;  1N77 A;  4B7F A;  2XLJ A;  2XSZ A;  115L A;  4HV2 A;  1G7I C;  1QT3 A;  3LVV A;  5KXS A;  2K0B X;  1IN4 A;  1IXZ A;  2C98 A;  4NSH A;  2Y8P A;  1L70 A;  1L90 A;  5B1G A;  3J27 B;  3JR6 A;  4GC9 A;  1TCY A;  3SAU A;  3HT9 A;  4IBC A;  1QUS A;  3GO8 A;  1GL7 A;  1JKC A;  1RJC B;  1I4W A;  1LGU A;  129L A;  4NGJ A;  4A3V B;  1GVN A;  1CKH A;  1HNL A;  3V2Y A;  1SSW A;  2BJV A;  2OE9 X;  1IY2 A;  2IGC A;  1L77 A;  2HU3 A;  5LXW A;  1LJG A;  2R65 A;  4DD1 A;  189L A;  2B6Z A;  1JR3 E;  3L26 A;  1F0W A;  5EP4 A;  1L74 A;  4HTN A;  4JI4 M;  1XB2 B;  1G0G A;  3ZQJ A;  2ZNX Y;  1HJP A;  1GE0 A;  1SWZ A;  4GCE A;  3GLH B;  215L A;  2UXD M;  1ZAE A;  5FTM A;  1D0M A;  4GN5 C;  3L2A A;  4LRS A;  1UFZ A;  3H4J A;  1XJT A;  3GXR A;  208L A;  4H92 A;  3VDU A;  3T6P A;  4JN6 A;  4IAS A;  3W6E A;  3EMS A;  4L6V 6;  1RFP A;  2OU0 X;  1G59 A;  1S3S A;  1GFK A;  5DYI A;  4LG2 A;  141L A;  3QYE A;  4KLN A;  1G0M A;  1L38 A;  2OEA X;  3WUA A;  1OIP A;  1KIQ C;  4UWN A;  4OX9 M;  1HFX A;  183L A;  5GKN A;  3TL4 X;  174L A;  1YKX X;  1XXH B;  5E9R A;  3M7G A;  1WVU A;  4TTD A;  2CUZ A;  1NY5 A;  4W56 A;  1JUG A;  1LJJ A;  4KXI A;  3JR4 A;  3PBL A;  1I56 A;  3SBJ A;  1G07 A;  4N5R A;  1C6L A;  1L75 A;  5F9U A;  2W1M A;  3KAM A;  1IO5 A;  1CJ7 A;  4NSI A;  1LYH A;  1C6N A;  3PNY A;  1OQY A;  1SSY A;  4P2E A;  2OPF A;  1P64 A;  2BLX A;  3JAM S;  3DMX A;  1D0K A;  209L A;  2DWN A;  4H93 A;  4X64 M;  3THG A;  1LMA A;  5FST A;  1IFY A;  1TBY A;  2DQH Y;  1IP4 A;  4II8 A;  1I1Z A;  4ARL A;  4EKR A;  1LMQ A;  5BR8 M;  1OFH A;  4L16 A;  4KT3 A;  255L A;  3SB5 A;  3A6B Y;  4FWG A;  2XTH A;  1L55 A;  3K9O A;  4LCB A;  1A5T A;  2FS1 A;  4RKU F;  1NMM A;  2DI0 A;  2DWM A;  4P16 A;  2I7N A;  1C7Y A;  3LW5 F;  4GHA A;  1QSW A;  4EMN A;  4MGI E;  1IQP A;  1CUK A;  245L A;  1W6Z A;  1LZ6 A;  1V7T A;  1PS5 A;  4LF9 M;  2ZIK A;  1QIO A;  1YSY A;  1AM7 A;  4GN4 A;  3A90 A;  3GUJ A;  1Q39 A;  4DV1 M;  4W51 A;  4YX7 C;  1LGW A;  1L1T A;  2YR0 A;  3CT0 A;  3DMV A;  2NTG A;  3ZEK A;  2Y20 A;  3FUU A;  1UM8 A;  1TH3 A;  2RBQ A;  3NBI A;  1OVJ A;  185L A;  5I5Q A;  2DAK A;  4E97 A;  5I4X A;  2A7F A;  2D7H A;  4B4E A;  3HZJ A;  3AZ4 A;  4PK0 A;  1L66 A;  4DDB A;  4LF8 M;  2LHC A;  4DR7 M;  1IOR A;  3TMW A;  3ZCB B;  192L A;  1DGH B;  4ANR A;  1IIZ A;  1UIE A;  2JY7 A;  5KXM A;  1XSF A;  3AW6 A;  149L A;  1UIF A;  1G7J C;  2MH8 A;  3HH5 A;  4AI6 A;  3HHW A;  1GWD A;  2D4I A;  1HFY A;  2ZYC A;  1IX0 A;  4DQ7 A;  1OUI A;  1UIB A;  1C6B A;  3WHL A;  3WPK A;  3VFD A;  4MM3 B;  4REZ A;  3VLF B;  4B49 A;  2QBY B;  4IJ4 A;  1IP2 A;  4PD2 A;  1L8Q A;  1L1Z A;  2L7H A;  4J1A A;  4QOZ C;  3FI7 A;  2KHH A;  3LQQ A;  146L A;  4NL4 H;  3CF6 E;  2DQJ Y;  1UIA A;  2H5Z A;  5KXN A;  4CHT B;  2YQZ A;  3HJS A;  1ZYT A;  2CFO A;  3M6A A;  3RFW A;  1N32 M;  2HED A;  2EPE A;  2H1R A;  4HTK A;  132L A;  1QUD A;  4G4N A;  4DR5 M;  3W6A A;  3T1Y M;  1L24 A;  1LSA A;  1B5Z A;  1YIL A;  3T1H M;  1DI3 A;  1IP7 A;  2RSC A;  4DQ5 A;  3P65 A;  3SHG B;  2DHR A;  1OV7 A;  1SG9 A;  2CWB A;  4NSO B;  4IBB A;  2BPU A;  3HT8 A;  5HMV A;  2RAY X;  3W6F A;  1L05 A;  4EPI A;  2APL A;  2MEC A;  3NY9 A;  1FNN A;  1IBM M;  1L52 A;  5DN4 A;  4QHS A;  2V6Z M;  176L A;  1NY6 A;  4LYB A;  1L07 A;  4G3O A;  3W0L B;  3GUL A;  2Y0T A;  4ZPX A;  4XEN A;  1B7Q A;  1GEV A;  2CRU A;  3ZC7 B;  3QAU A;  135L A;  1GJS A;  4CGY B;  1HEN A;  2CJL A;  3VW7 A;  4HSF A;  1OJL A;  168L A;  1Z6T A;  1LZT A;  3LYZ A;  1JR3 A;  3BBZ A;  3TXK A;  2BJW A;  1L00 A;  1OIZ A;  4H8X A;  3DN6 A;  3C8R A;  5LYZ A;  1OUJ A;  4ETB A;  3KOY E;  4KL7 A;  1QTH A;  4DYG A;  4LJ8 A;  4DC4 A;  152L A;  2JWS A;  4RDS A;  1LZ5 A;  2Q2E B;  1CX6 A;  1K28 A;  3K3T A;  5IRE B;  4ARJ A;  4KO8 A;  3DFZ A;  2ZAN A;  5ILF A;  4N9R A;  3HWL A;  5FEL A;  4WW0 A;  2C5R A;  4NOO B;  232L A;  2G4Q A;  4DJH A;  1XC8 A;  251L A;  1JJ0 A;  1QAM A;  5A2Q S;  4LFX A;  4XJB A;  5B06 A;  1XMQ M;  1NQI A;  5HMJ A;  1GB8 A;  159L A;  1P3Q Q;  4GKK M;  1LMC A;  3UON A;  4XJD A;  1L43 A;  2DQI Y;  1KXX A;  1PQO A;  3WYH A;  2F5S A;  1LSF A;  2OTZ X;  4IBD A;  3GLI B;  1IWT A;  1WJ7 A;  1KY1 A;  1NNJ A;  2QPA A;  4LF6 M;  3AZ6 A;  1L33 A;  193L A;  3OE8 A;  1E32 A;  1VEJ A;  3RNX A;  1LSB A;  4EKP A;  1QDR A;  4X66 M;  1D9U A;  2EJS A;  5KPT A;  4G49 A;  1WTM A;  2JZ1 A;  2LVQ D;  1H87 A;  2X4A A;  4EIW A;  211L A;  4DV2 M;  4GN3 A;  3GQ4 A;  4DV7 M;  2VF8 A;  1JJ3 A;  1LYZ A;  1BVX A;  1L49 A;  4JI2 M;  1L96 A;  2YBI A;  5EBH A;  1UCO A;  5KO3 A;  231L A;  2XSZ D;  2RGO A;  2L09 A;  1PRB A;  1P56 A;  4LYT A;  4L8R C;  4GIP A;  1EQ4 A;  3A98 B;  2CV0 A;  1AKI A;  1L37 A;  1P46 A;  4JI7 M;  2QAR C;  1HT1 E;  2GV0 A;  4MGY E;  2HUB A;  2B7X A;  216L A;  4OWE A;  1LPY A;  1OYU A;  3RW8 A;  1H6U A;  1LHH A;  2Q9E A;  1YAQ A;  2F30 A;  1L87 A;  1LSY A;  1L57 A;  142L A;  1LJ3 A;  1WHC A;  1CU5 A;  2GNO A;  1DKJ A;  4M9X A;  1Z5A A;  3CT1 A;  2EKK A;  1B6I A;  1GFH A;  3A8Z A;  3CSR A;  1Q02 A;  1QQY A;  3B6L A;  2CE7 A;  1IXS B;  2NTH A;  3CF2 A;  2YSS C;  3MHV C;  2YVB A;  4JI3 M;  3FUT A;  194L A;  1E8L A;  3HWS A;  3J81 S;  1XEK A;  2BQO A;  1DYD A;  1PQM A;  1OAO C;  177L A;  238L A;  1IR8 A;  1NBY C;  4JI0 M;  2DEN A;  3W68 A;  3VWO A;  1L94 A;  3FI5 A;  1DO0 A;  1L17 A;  250L A;  3U6S A;  3HGI A;  133L A;  1VDL A;  4J1B A;  4WM1 A;  102L A;  1WXQ A;  3P66 A;  4EKQ A;  5HNC A;  5KXT A;  2F5N A;  2LZT A;  1IC4 Y;  1N33 M;  3QE8 A;  1QDT A;  3HU2 A;  4D9Z A;  5KKJ A;  3A92 A;  161L A;  1E9S A;  1IOQ A;  4LGK A;  243L A;  3AYQ A;  2JP7 A;  1QUT A;  4B7G A;  4LT0 A;  5KQ8 A;  4PDI A;  2Z12 A;  1NHW C;  2KEB A;  3WU8 A;  4W57 A;  1DGH A;  3OE0 A;  3UZU A;  4YOP A;  3GLH A;  2PC2 A;  2R44 A;  1L03 A;  4HV1 A;  5LVJ A;  2RBP A;  2OE7 X;  3GRY A;  1SWY A;  5L3I A;  1L21 A;  2G5G X;  3HTF A;  1INU A;  4DUZ M;  4DV0 M;  1DPW A;  2RB2 X;  3WH1 A;  3AKZ A;  1FJG M;  4JI1 M;  1CV0 A;  3U5Z A;  2RB0 X;  1L18 A;  3T15 A;  4LDL A;  1V33 A;  3FTC A;  1C69 A;  4G9S A;  1R4G A;  3KDS E;  2DQE Y;  259L A;  2F4V M;  3SN6 R;  3J7A S;  1UA6 Y;  2XJW A;  3CDO A;  157L A;  1LMN A;  1LZD A;  2D7G A;  4DQJ A;  1L26 A;  1A2Y C;  5KPR A;  2H9K A;  2Z2E A;  1EL1 A;  1G0P A;  3TXF A;  3V76 A;  1C6K A;  2QEN A;  5B1F A;  3GUK A;  3B7Z A;  1NJG A;  1SXJ D;  1K3X A;  2R18 A;  5F16 A;  2KNZ A;  3LYM A;  4IAT A;  4B4I A;  4I7N A;  5A3Z A;  4AQY M;  1L25 A;  1J1X Y;  4LJ6 A;  4L15 A;  4GLA A;  3F6Z A;  4FD2 A;  1L64 A;  2W82 A;  3VK7 A;  3C82 A;  2FNA A;  1IBK M;  3K2L A;  3GUN A;  1OTR A;  3C3E A;  1TH4 A;  4LFA M;  2LXE A;  4IBG A;  1Z55 A;  4NSJ A;  1C6P A;  122L A;  4NGO A;  1C10 A;  2FBB A;  1L27 A;  3RT5 X;  4Z41 A;  3SP3 A;  3CF0 A;  254L A;  1GB9 A;  1IVM A;  4I0C A;  3PXG A;  1CKF A;  5B59 A;  4P17 A;  4NRW A;  4DR3 M;  2C8O A;  1VAU A;  1L61 A;  1WR1 B;  111L A;  1GDX A;  1GD6 A;  1EFU B;  130L A;  1IY1 A;  3T36 A;  1B5U A;  2QSF X;  1L81 A;  5EP3 A;  2RAZ X;  2YBH A;  4NC6 A;  1N4F A;  5FSW A;  1IOT A;  3GPP A;  1IXR C;  5DNY A;  1P2C C;  2Z4R A;  1TR8 A;  4ARQ B;  1PQD A;  2J7N A;  248L A;  4OW0 A;  3CTW B;  2LZ2 A;  4NGK A;  1Z59 A;  3FE0 A;  4NHT A;  1JB0 F;  258L A;  1L99 A;  1H6M A;  4N8Z A;  1A4V A;  1LV7 A;  2LH0 A;  3HUK A;  1GB3 A;  1JR3 D;  1G7M C;  5FHW A;  2Z38 A;  3DOA A;  4W55 A;  1LHJ A;  3FAD A;  2HU1 A;  1B7P A;  5LA8 A;  1DYB A;  1BWJ A;  3A46 A;  2BNK A;  1NWG A;  1I20 A;  1IP5 A;  3DN3 A;  229L A;  1N36 M;  1JKA A;  3HH3 A;  5I14 A;  3K92 A;  1VAT A;  2ZM6 M;  2VQE M;  113L A;  3KXE C;  1GEZ A;  3FUX A;  3HUQ A;  1IN7 A;  2ZTC A;  4TUN A;  1L89 A;  3ZH9 B;  3LZ2 A;  1JEF A;  1PJT A;  1L10 A;  1L41 A;  1HML A;  1PQI A;  2QCU A;  3C7Z A;  1NVM A;  3GLG B;  1IN6 A;  3HT6 A;  1L56 A;  2K6B A;  1UBZ A;  3I51 A;  1GFR A;  4NG1 A;  4LDO A;  3SC3 A;  4XN6 A;  3L28 A;  1CKC A;  1IWU A;  3HU3 A;  3GLF A;  4XAD A;  4DT3 A;  4QDN A;  2DNA A;  3A96 A;  2F47 A;  2E5L M;  1NHE A;  1RE2 A;  1LSN A;  3AGG G;  4ML7 A;  1BWI A;  1OUH A;  3CDQ A;  134L A;  2UUA M;  3K1J A;  5B05 A;  1IP3 A;  1F6R A;  4R0F A;  173L A;  3TWM A;  4NXM M;  2B72 A;  4GIT A;  2MEA A;  5LVH A;  3L29 A;  162L A;  2XFS A;  1YAO A;  3FYD A;  4Q7J A;  2NWD X;  3HTB A;  3HTD A;  1P5C A;  4Z8X A;  2DQF C;  222L A;  4L41 A;  1QAN A;  108L A;  1QTV A;  2YBM A;  2RBS A;  4KHP M;  1KW5 A;  4LJ9 A;  4GBR B;  1G3I A;  1L76 A;  2C99 A;  1D6P A;  4I8S A;  3MK6 A;  4OU7 A;  1C6G A;  1F6S A;  3U6O A;  1JSF A;  1QUG A;  3FUV A;  2DKL A;  2OOA A;  1GF4 A;  5EXS A;  1QTK A;  3E3D A;  2V1C A;  3LYO A;  2UU9 M;  4R71 A;  4MGZ E;  2M5Z A;  1QVR A;  4PJZ A;  1L63 A;  5KKI A;  1YL0 X;  2LVP C;  5KXY A;  6LYZ A;  4G4B A;  4NEB A;  1LTM A;  2YFQ A;  4K0K M;  4F2L A;  1N78 A;  3C81 A;  1V34 A;  1HMK A;  4NHP A;  1NV8 A;  1L62 A;  1JTP L;  2LVO C;  2WSC F;  3BKH A;  4LRT A;  4WG1 A;  1JSE A;  1HNW M;  3B72 A;  3NY8 A;  1QTZ A;  3HU9 A;  2WZJ A;  2O79 A;  1G06 A;  1HEL A;  1ZV5 L;  2B6T A;  1VFB C;  3M0E A;  1LYD A;  5JI2 E;  4H8Y A;  4N1C C;  160L A;  4XJH A;  1LJH A;  3AB6 A;  1GFG A;  4WL6 A;  1BHZ A;  1G0Q A;  1ZVY B;  5HNL A;  3HJQ A;  2C96 A;  4ETE A;  3WUM A;  3D8L A;  1CTW A;  3HDE A;  4YXC A;  164L A;  1QYR A;  3LN2 A;  3TXE A;  1GB5 A;  3Q8X A;  4NGZ A;  1L13 A;  2FOI C;  3DNA A;  1LSG A;  1MX0 A;  1QAO A;  3L25 A;  4EKS A;  1LSD A;  4BAD A;  2K9D A;  4EOF A;  5EP2 A;  1C7P A;  1B7S A;  2ZNW Y;  1GBX A;  1LZY A;  1GXX A;  1JQU A;  1NBZ C;  1YIK A;  3HBH A;  3K8Z A;  1GAZ A;  1L80 A;  3WW5 A;  2BQJ A;  3SAR A;  1C6I A;  4PHI A;  1XEP A;  1MJG M;  1C6F A;  4M0W A;  4CJ6 A;  2I6Z A;  1XGU C;  3WW6 A;  190L A;  1IOS A;  145L A;  4DR2 M;  4NSR A;  3UK6 A;  2ERC A;  3WU7 A;  1L15 A;  3SBB C;  1FBI X;  1W5S A;  4W53 A;  1C6C A;  1VED A;  3AW7 A;  2VQF M;  2XGN A;  2XEP A;  1XWI A;  1DI4 A;  3KS4 A;  1L0J A;  3U6M A;  1X37 A;  3A94 A;  1REZ A;  2WSE F;  4NGL A;  3TXB A;  4H9A A;  4B3R M;  2JY5 A;  4LZT A;  2EKF A;  2AUB A;  2F5Q A;  4JYA M;  3AGH A;  1LSZ A;  2ZIL A;  3HTG A;  1OVK A;  4B7H A;  3JR5 A;  187L A;  4NHI A;  1FLQ A;  2XBR A;  2H9J A;  3M3U A;  2F4A A;  1YQV Y;  125L A;  4NIJ A;  1E9R A;  5C1B A;  1KYI A;  1T6V L;  1L20 A;  2HEC A;  178L A;  2MEB A;  4G6Z A;  181L A;  2B70 A;  2LZM A;  1WQO A;  1C43 A;  3C8Q A;  1CU0 A;  3C3D A;  1OUD A;  1L45 A;  2HEE A;  3TMV A;  256L A;  2KZS A;  4U3X B;  1DPX A;  1LOZ A;  206L A;  4AQN A;  1L97 A;  4JXJ A;  2HKJ A;  1BVK C;  4W5W A;  1I6S A;  4CIZ A;  4AW4 A;  5I54 A;  1L85 A;  261L A;  1T3T A;  1V7S A;  3AJN A;  5AMY A;  1SLY A;  1GBS A;  1G0L A;  4EJ4 A;  3GPU A;  1PJQ A;  2L78 A;  1CJ9 A;  3W6C A;  1L32 A;  1G41 A;  2EUC A;  3A42 A;  1TEW A;  137L A;  3CSQ A;  1C6J A;  3A45 A;  4LJ5 A;  3WU9 A;  5B07 A;  3EIH A;  4E3U A;  1QSB A;  4QNR A;  1SXJ C;  4KOD A;  1C63 A;  5LYM A;  4D81 A;  4AG5 A;  3DKE X;  1LYY A;  1L44 A;  4HP0 A;  5K7O A;  2EIZ C;  1QT7 A;  3AV0 A;  227L A;  2BQM A;  3W67 A;  1C08 C;  1UUZ C;  2YBJ A;  4WG7 A;  1BB7 A;  1REY A;  2Z39 A;  1JJ1 A;  1J1P Y;  1L23 A;  3G3X A;  5L9J A;  2BQE A;  2G8L A;  4ARM B;  1R7R A;  1B7O A;  3T6U A;  3OE6 A;  1GDW A;  4WM2 A;  151L A;  2CHG A;  2RBN A;  5C18 A;  1ALC A;  5I4W A;  3B0O A;  4MB7 A;  2D6B A;  1LW9 A;  3FRI A;  1TAY A;  4XGI A;  3WHK A;  4HEO A;  3CQL A;  1IP1 A;  2NQ8 C;  2R6F A;  1JWR A;  4ARM A;  3W6D A;  2ZAO A;  4GC5 A;  4IAP A;  1PZY A;  4HPI A;  1BB4 A;  5JI3 E;  1BWH A;  2KZU A;  5LMN M;  1XHB A;  2OQ4 A;  5I53 A;  5DL9 A;  4M9Z A;  2DBT A;  2X49 A;  1BB5 A;  2D4J A;  2Q9D A;  1L28 A;  2VII A;  3RZ4 A;  1GF7 A;  2VF7 A;  2XF3 A;  1L59 A;  4DD0 A;  3SFZ A;  1SXJ A;  3EIE A;  4B1A A;  1LZ8 A;  2A7D A;  1HQC A;  4ITQ A;  4MGH A;  2DAI A;  2OU9 A;  4DUY M;  4RW2 A;  2JNH A;  2F4G A;  3LVW A;  4IJE A;  3RGS A;  196L A;  3BKV A;  1J09 A;  3KVW A;  4ETD A;  1LI6 A;  1GFU A;  1Z5C A;  3HBD A;  5DLA A;  6LYT A;  1JIT A;  1B7R A;  4ARQ A;  3RU5 A;  1C6D A;  2K47 A;  2B6X A;  3DN1 A;  3B9P A;  126L A;  224L A;  239L A;  1D2N A;  4FCW A;  3MJ5 A;  5LIO A;  3LYT A;  242L A;  5C6J A;  3SYL A;  5L8R F;  1T3P A;  1WTH A;  4PGJ B;  2LYM A;  4ETC A;  3LZM A;  3RGP A;  3HY5 A;  3IHP A;  4B3T M;  1XNQ M;  1JTO L;  3B0I A;  4H8Z A;  2RBR A;  4MCK A;  2LHG A;  3SYK A;  5EXX A;  119L A;  120L A;  1LSE A;  2O01 F;  1LJN A;  2A5Y B;  1IBL M;  3IWR A;  1ZMW A;  1L46 A;  3GPY A;  1LSM A;  1YAN A;  4GH9 A;  191L A;  4MR1 A;  2LVN C;  4PCZ A;  2RBO A;  5ILC A;  5F14 A;  5HQ1 A;  3N9C A;  4XYY A;  4FJR A;  3GLH E;  4BLC A;  1L91 A;  2XFT A;  1L14 A;  2DQA A;  1P3N A;  223L A;  2FYC A;  2OOB A;  1UIC A;  1C62 A;  1QUO A;  2KNV A;  1OUA A;  4OVZ B;  1L82 A;  4DD2 A;  3KP1 E;  3LHM A;  240L A;  1WTN A;  2CHV A;  107L A;  4Y28 F;  4UN2 B;  1DXJ A;  3RE8 A;  4NHQ A;  3TQS A;  5ITU A;  2I25 L;  4LT1 A;  1QT5 A;  2MEG A;  1PJJ A;  3E46 A;  1DQJ C;  6LZM A;  1TLA A;  1CKD A;  4OWH A;  1G0K A;  1LSP A;  3HH6 A;  4WLT A;  1QSQ A;  4M6D A;  235L A;  1FLW A;  1KXY A;  5T3F A;  1QTD A;  2B6W A;  1IXS A;  1GO5 A;  3U6D A;  1AT6 A;  1LZA A;  2XZU A;  5LYT A;  200L A;  1AZF A;  3AOG A;  5DN5 A;  3PDS A;  3DMZ A;  2O7A A;  5ITT A;  1LMP A;  1LZN A;  3R9X B;  1XEJ A;  4FWH A;  1IC5 Y;  4G4O A;  3C7W A;  2MEI A;  3GP1 A;  182L A;  3F8V A;  3P4Z A;  1C6A A;  3AFH A;  1WQN A;  3E9S A;  4H9B A;  3V2W A;  3G3B B;  1YL1 X;  2DQC Y;  4HLQ A;  5LVK A;  1L09 A;  110L A;  4GRV A;  1XGP C;  5KXR A;  114L A;  1LKR A;  5FCP A;  1B5V A;  1LPI A;  2R4E A;  3EXD A;  2ZTD A;  1SQ2 L;  1GF5 A;  3PNV A;  2Z2F A;  2R4J A;  2C9O A;  2KDL A;  4GLV A;  4I7J A;  3WXU A;  3KS8 A;  1ZUR A;  2G4P A;  2MEH A;  2ZWB A;  2ZQ4 A;  1CV1 A;  4IBF A;  1G4A E;  1GF9 A;  4OOT A;  1L68 A;  4OO9 A;  2Z19 A;  1C6E A;  1CV3 A;  1KFV A;  3EO5 A;  3WVX A;  1L60 A;  4WO6 A;  2QQ8 A;  3DA1 A;  2XQO A;  233L A;  3U6P A;  1VG5 A;  2I7P A;  3GLG A;  1ZWN A;  1GFJ A;  4RNA A;  2MEE A;  2M60 A;  1CUP A;  2QNJ A;  1B5Y A;  1Y8G A;  1LHI A;  1OQM A;  1L2C A;  2FYD A;  3AGI A;  1HEO A;  4GCC A;  1L31 A;  1GFE A;  1L0K A;  3ATO A;  1NO1 A;  1PJI A;  1B5X A;  4AGA A;  140L A;  2HAK A;  1GE4 A;  4AKI A;  2LBC A;  3B74 A;  4LGM A;  1KIR C;  1VEK A;  4LFB M;  2N5Z A;  2J7O A;  2DZN B;  2FBD A;  3J6K A;  4QOS A;  2O5R A;  4LJ4 A;  2B74 A;  4WUR A;  1WGN A;  2EA0 A;  1CV6 A;  4GKJ M;  1GF6 A; 
#chains in the Genus database with same CATH homology
 1CU2 A;  1LMO A;  3F9L A;  1T8A A;  1G1W A;  1IWW A;  1JKB A;  2OU8 A;  3A6C Y;  4H9I A;  4YXA C;  4GCF A;  1FLY A;  1BQL Y;  4NSG A;  3GUO A;  3D9A C;  4PJ2 C;  4X3B A;  169L A;  1XGR C;  4WM5 A;  1C65 A;  1L83 A;  1LZ1 A;  212L A;  118L A;  2Z18 A;  1QSA A;  1HEW A;  3DN4 A;  1L69 A;  1RCM A;  4Z98 A;  1EQ5 A;  1C45 A;  4H9F A;  1L35 A;  1CV4 A;  1OUC A;  5KXL A;  1L92 A;  1P2L A;  1LZB A;  1L19 A;  1KIP C;  5APF A;  3WXT A;  4M4O A;  4ETA A;  1KW7 A;  4LYM A;  1QS9 A;  1GB0 A;  4PRU A;  1FKV A;  1IWV A;  4G4C A;  4EXM A;  1EPY A;  2W1Y A;  4MST A;  2RH1 A;  4LZM A;  210L A;  1QS5 A;  2YDG A;  3ODU A;  1OVH A;  4H1P A;  4I7T A;  4QEQ A;  165L A;  2B75 A;  167L A;  109L A;  4WM6 A;  1UAC Y;  1IR9 A;  1D2Y A;  1GE2 A;  4RLM A;  186L A;  1EQE A;  4GCD A;  1LWG A;  1JTM A;  5KY1 A;  1GPQ C;  195L A;  3AZ7 A;  1IEE A;  1LZR A;  4GCB A;  205L A;  1XGQ C;  4R6C A;  4J0L A;  2I26 L;  4G4H A;  1JKD A;  1IC7 Y;  139L A;  1PQJ A;  2D4K A;  5LVI A;  1LI2 A;  5IHG A;  1L54 A;  2ANV A;  1BGI A;  1LJI A;  1P7S A;  5KJ9 A;  1HER A;  1MLC E;  1LYI A;  1L50 A;  3CT5 A;  2BQC A;  2G4N A;  221L A;  1OWZ A;  5IEL A;  226L A;  170L A;  4O34 A;  1LJE A;  1GBZ A;  2BQL A;  1GB2 A;  1L98 A;  1VDS A;  3WVY A;  2LCB A;  4ET8 A;  1QTE A;  2F2N A;  2F2Q A;  2IHL A;  4I7R A;  1D3J A;  1L34 A;  1LMT A;  4LT3 A;  4NGW A;  1L39 A;  1B7M A;  103L A;  3D4S A;  3QNG A;  5DM9 A;  1T97 A;  4J7V A;  1GF3 A;  5C6I A;  4UWV A;  3DN8 A;  4H9H A;  1KXW A;  4DD7 A;  1IWY A;  1OP9 B;  3DN0 A;  1OV5 A;  3WUN A;  2ZQ3 A;  1L48 A;  2F32 A;  5KXW A;  4ARP A;  2HUM A;  3OK0 A;  4H94 A;  3SBA A;  1FLU A;  2LHM A;  1KY0 A;  4YEN A;  3HDF A;  3HUA A;  4WMG A;  1D3F A;  2D91 A;  4LFP A;  3K2R A;  1J1O Y;  1CX7 A;  2W1L A;  4NFV A;  2IFF Y;  4DD3 A;  2BQF A;  1G7L C;  3HBE X;  3HH4 A;  220L A;  1UIG A;  158L A;  3G3V A;  4HJZ A;  1CJ8 A;  5F9X A;  5APC A;  4ZFP A;  148L E;  2YBL A;  1L01 A;  1C61 A;  2EKS C;  3GXK A;  1GFT A;  1HEM A;  1LZC A;  4LDE A;  4Z3M A;  131L A;  1L06 A;  2OE4 X;  4H90 A;  3ZVQ B;  1LGX A;  3HFM Y;  257L A;  3SB8 A;  1P36 A;  1L16 A;  3J4G A;  4CFO A;  5JEN B;  2B5Z A;  4CHX A;  5APD A;  3QY4 A;  188L A;  7LZM A;  1UC0 A;  4TWS A;  3CSZ A;  3WMK A;  4H9E A;  1GF8 A;  1GE3 A;  127L A;  3W3E A;  1F10 A;  1LYJ A;  1C6H A;  4OOO A;  3TXI A;  1LYO A;  4C5F A;  4ZPU A;  1DI5 A;  1L95 A;  3SB9 A;  3RUN A;  5KXZ A;  1LZ9 A;  1DYF A;  2BQG A;  1LZ4 A;  4NY5 A;  1IY4 A;  5KXO A;  5L3H A;  3CDV A;  1L86 A;  1NHB A;  1VDP A;  1VDQ A;  4WLY A;  3M18 B;  3TXD A;  236L A;  4I7S A;  1XJU A;  1L72 A;  3TXJ A;  128L A;  5FDJ A;  2VB1 A;  123L A;  1FKQ A;  1QT8 A;  218L A;  4DDA A;  4WO9 A;  1OWY A;  3A34 A;  252L A;  1CVK A;  4YEO A;  4WL7 A;  2Z6B A;  1REM A;  1JTN A;  1G1V A;  1HSX A;  3TXH A;  4BAP A;  234L A;  4NWH A;  2ANX A;  4OWC A;  1GBW A;  1NF5 A;  147L A;  1WQR A;  4YF2 A;  1HHL A;  1GFA A;  1TDY A;  241L A;  3DN2 A;  247L A;  230L A;  3HU8 A;  112L A;  1T8F A;  1PQK A;  4I7P A;  4WM3 A;  1GXV 2;  214L A;  4PRQ A;  1BB3 A;  1GAY A;  4YM8 A;  1JHL A;  4FDY A;  4HJY A;  1L47 A;  144L A;  3G3A B;  2ZIJ A;  4RLN A;  2O4W A;  4H91 A;  4NWE A;  3IJV A;  3P68 A;  2BQN A;  1L04 A;  1VDT A;  1CJ6 A;  1P2R A;  5II3 A;  4W58 A;  5LVG A;  2B6Y A;  4DAJ A;  3A3Q A;  1DYE A;  5A3E A;  1L65 A;  4I7O A;  5KXK A;  4WM4 A;  1DKK A;  4PPO A;  2HEB A;  1YAP A;  138L A;  3C7Y A;  2BLY A;  1HEP A;  3D3D A;  4ZIX A;  4YEM A;  5I4Y A;  1IWZ A;  1L40 A;  3A95 A;  1D3M A;  2BQB A;  4W59 A;  3N9A A;  4B0D A;  3C80 A;  156L A;  4N0J A;  1GB7 A;  5D5C A;  1L88 A;  1L71 A;  3RZE A;  1B9O A;  4UWU A;  154L A;  1OUB A;  262L A;  1CU6 A;  197L A;  2BQK A;  2CGI A;  1L12 A;  5E4P A;  2W1X A;  2QB0 B;  1G7H C;  5J7C A;  2BAA A;  1QUH A;  4WLD A;  1QTC A;  1LKS A;  1IY3 A;  4W96 A;  4N1E I;  1D6Q A;  1D9W A;  2RB1 X;  1CKG A;  5KXX A;  1L53 A;  3WPL A;  199L A;  2BQA A;  2OTY X;  1FN5 A;  3CDR A;  3ATN A;  1AT5 A;  1L42 A;  3A91 A;  2X0A A;  4C3W A;  4W52 A;  3OJP A;  1YKY X;  244L A;  4ZEE A;  4HJV A;  3OE9 A;  3WL2 A;  2Z37 A;  1GBO A;  1D3N A;  253L A;  1WQM A;  4XJI A;  3EBA B;  1LSC A;  184L A;  2BQH A;  2MEF A;  3WUL A;  1QT6 A;  1BB6 A;  3TXG A;  3GUI A;  1LYG A;  1GHL A;  5LZM A;  4WLX A;  1YKZ X;  1NKH A;  201L A;  2CDS A;  4W94 A;  1XEI A;  3L2X A;  1CUQ A;  1HF4 A;  1FDL Y;  4EPF A;  1L67 A;  1QT4 A;  172L A;  1CV5 A;  4B4J A;  1IP6 A;  2HEA A;  8LYZ A;  4DWX A;  1IWX A;  1RI8 B;  2LYZ A;  1B2K A;  4A7D A;  2C8P A;  1W08 A;  3WPJ A;  4XJF A;  3TMX A;  5M1Y A;  4XJG A;  5LA5 A;  1C64 A;  1ZMY L;  1L58 A;  2DQD Y;  5C6L A;  5LIN A;  4OWA A;  2DKV A;  1L22 A;  3C83 A;  3GUP A;  1SX7 A;  4TSB A;  4CFP A;  3HT7 A;  1LYS A;  2Q0M X;  1P6Y A;  2BQD A;  4WOA A;  3SB7 A;  237L A;  3IJU A;  1QTB A;  163L A;  1HEQ A;  2HEF A;  260L A;  3L64 A;  1YAM A;  246L A;  2LYO A;  4KPM A;  3QAK A;  1KS3 A;  1NDG C;  1CV6 A;  171L A;  1T6H A;  3B0K A;  1L29 A;  2MED A;  5HLL A;  104L A;  4ET9 A;  180L A;  4NG8 A;  4HTQ A;  2BQI A;  1XGT C;  1B0D A;  1JTT L;  213L A;  1JIS A;  4TX7 A;  207L A;  3FA0 A;  4CJ2 A;  1B5W A;  1GF0 A;  4LYC A;  1CNS A;  1UIH A;  1SX2 A;  1LYE A;  4NHS A;  4I7M A;  5LAG A;  1WQP A;  228L A;  166L A;  3AZ5 A;  1NDM C;  1YRO A;  198L A;  217L A;  219L A;  9LYZ A;  1HSW A;  1L36 A;  3TMU A;  175L A;  1REX A;  1D2W A;  2WAR A;  1LJ4 A;  155L A;  4QY9 A;  4I7K A;  1C46 A;  4LT2 A;  2HUK A;  2XBS A;  1L51 A;  3EML A;  1B7N A;  1LZE A;  4CGE A;  4I7L A;  1C66 A;  1L84 A;  1C6Q A;  3CB7 A;  1B7L A;  5D5F A;  1XFP L;  2HTX A;  1LJF A;  3LZT A;  1L30 A;  3SB6 A;  1LZS A;  150L A;  1L93 A;  3ULR A;  1IR7 A;  1LHK A;  2LC9 A;  1LHM A;  4OW1 A;  5FEK A;  2DQG Y;  1T8G A;  4I7Q A;  1UID A;  1LLH A;  4TSC A;  4QGZ A;  1LWK A;  1C60 A;  2ZYP A;  1LCN A;  1L73 A;  3W6B A;  3C8S A;  4W54 A;  4LYZ A;  5IDD A;  1HC0 A;  4H9C A;  3ZVQ A;  3CDT A;  4AXT A;  1LHL A;  1LI3 A;  2EQL A;  1G0J A;  1OUF A;  1ZVH L;  3P64 A;  4RW1 A;  5APE A;  3MGW A;  2CUU A;  1IOC A;  5LAF A;  5F81 A;  4NGY A;  3GUM A;  1LAA A;  4NGI A;  2A4T A;  153L A;  1DZB X;  1L79 A;  1HFZ A;  1LJK A;  143L A;  1MEL L;  1KNI A;  4OWB A;  3G3W A;  1WVV A;  3A3R X;  1C67 A;  1OUG A;  1LZG A;  4K5Y A;  1JIY A;  1GBY A;  1GFV A;  1D0L A;  1LYF A;  1L02 A;  1GE1 A;  1P37 A;  1GB6 A;  1O23 A;  3NYA A;  4HPE A;  4S0W A;  1DYC A;  3A67 Y;  1C6T A;  4DD9 A;  1DYG A;  3A93 A;  1L08 A;  7LYZ A;  1WQQ A;  1L11 A;  4LYO A;  4BAF A;  4DKL A;  1OUE A;  4DDC A;  2HUL A;  3N9E A;  1JPO A;  1C68 A;  1DYA A;  5KXP A;  4NGV A;  1C6M A;  2B73 A;  249L A;  4BS7 A;  4Z46 A;  1CU3 A;  225L A;  2YBN A;  2CWI A;  115L A;  4HV2 A;  1G7I C;  1QT3 A;  5KXS A;  4NSH A;  2Y8P A;  1L70 A;  1L90 A;  5B1G A;  3JR6 A;  1TCY A;  3HT9 A;  1QUS A;  1JKC A;  1RJC B;  1LGU A;  4NGJ A;  129L A;  1CKH A;  1HNL A;  3V2Y A;  1SSW A;  2OE9 X;  2IGC A;  1L77 A;  2HU3 A;  5LXW A;  1LJG A;  4DD1 A;  189L A;  2B6Z A;  1F0W A;  1L74 A;  4HTN A;  1G0G A;  2ZNX Y;  1GE0 A;  1SWZ A;  4GCE A;  215L A;  1D0M A;  4GN5 C;  1XJT A;  3GXR A;  208L A;  4H92 A;  4IAS A;  3W6E A;  3EMS A;  1RFP A;  2OU0 X;  1GFK A;  141L A;  1G0M A;  1L38 A;  2OEA X;  3WUA A;  1KIQ C;  4UWN A;  1HFX A;  183L A;  174L A;  1YKX X;  5E9R A;  1WVU A;  4TTD A;  4W56 A;  1JUG A;  1LJJ A;  4KXI A;  3PBL A;  1I56 A;  1G07 A;  4N5R A;  1C6L A;  1L75 A;  5F9U A;  2W1M A;  3KAM A;  1IO5 A;  1CJ7 A;  4NSI A;  1LYH A;  1C6N A;  1SSY A;  4P2E A;  1P64 A;  2BLX A;  3DMX A;  1D0K A;  209L A;  4H93 A;  1LMA A;  5FST A;  1TBY A;  2DQH Y;  1IP4 A;  4II8 A;  1I1Z A;  4ARL A;  4EKR A;  1LMQ A;  4KT3 A;  255L A;  3SB5 A;  3A6B Y;  2XTH A;  1L55 A;  1NMM A;  1QSW A;  4EMN A;  245L A;  1W6Z A;  1LZ6 A;  1V7T A;  1PS5 A;  2ZIK A;  1QIO A;  1AM7 A;  4GN4 A;  3A90 A;  3GUJ A;  4W51 A;  4YX7 C;  1LGW A;  3CT0 A;  3DMV A;  2NTG A;  3ZEK A;  2RBQ A;  1OVJ A;  185L A;  5I5Q A;  4E97 A;  5I4X A;  2A7F A;  4B4E A;  3AZ4 A;  4PK0 A;  1L66 A;  4DDB A;  1IOR A;  3TMW A;  192L A;  4ANR A;  1IIZ A;  1UIE A;  5KXM A;  1XSF A;  3AW6 A;  149L A;  1UIF A;  1G7J C;  3HH5 A;  1GWD A;  2D4I A;  1HFY A;  2ZYC A;  1IX0 A;  4DQ7 A;  1OUI A;  1UIB A;  1C6B A;  3WPK A;  4B49 A;  4IJ4 A;  1IP2 A;  4J1A A;  3FI7 A;  146L A;  2DQJ Y;  1UIA A;  2H5Z A;  5KXN A;  1ZYT A;  2HED A;  2EPE A;  4HTK A;  132L A;  1QUD A;  3W6A A;  1L24 A;  1LSA A;  1B5Z A;  1YIL A;  1DI3 A;  1IP7 A;  2RSC A;  4DQ5 A;  3P65 A;  1OV7 A;  2BPU A;  3HT8 A;  5HMV A;  2RAY X;  3W6F A;  1L05 A;  4EPI A;  2MEC A;  3NY9 A;  5DN4 A;  1L52 A;  176L A;  4LYB A;  1L07 A;  3GUL A;  4XEN A;  1B7Q A;  135L A;  2CJL A;  1HEN A;  3VW7 A;  4HSF A;  168L A;  1LZT A;  3LYZ A;  3TXK A;  1L00 A;  4H8X A;  3DN6 A;  3C8R A;  5LYZ A;  1OUJ A;  4ETB A;  4KL7 A;  1QTH A;  4DYG A;  4DC4 A;  152L A;  4RDS A;  1LZ5 A;  1CX6 A;  1K28 A;  3K3T A;  4ARJ A;  5ILF A;  4N9R A;  3HWL A;  5FEL A;  232L A;  2G4Q A;  4DJH A;  251L A;  1JJ0 A;  4LFX A;  4XJB A;  5B06 A;  1NQI A;  5HMJ A;  1GB8 A;  159L A;  1LMC A;  3UON A;  4XJD A;  1L43 A;  2DQI Y;  1KXX A;  1PQO A;  3WYH A;  1LSF A;  2OTZ X;  1IWT A;  1KY1 A;  3AZ6 A;  1L33 A;  193L A;  3OE8 A;  3RNX A;  1LSB A;  4EKP A;  1QDR A;  1D9U A;  4G49 A;  1WTM A;  1H87 A;  211L A;  4GN3 A;  1JJ3 A;  1LYZ A;  1BVX A;  1L49 A;  1L96 A;  2YBI A;  5EBH A;  1UCO A;  231L A;  1P56 A;  4LYT A;  1EQ4 A;  1AKI A;  1L37 A;  1P46 A;  2QAR C;  2GV0 A;  2HUB A;  2B7X A;  216L A;  4OWE A;  1LPY A;  1OYU A;  3RW8 A;  1LHH A;  2Q9E A;  1YAQ A;  2F30 A;  1L87 A;  1LSY A;  1L57 A;  142L A;  1LJ3 A;  1CU5 A;  1DKJ A;  3CT1 A;  1B6I A;  1GFH A;  3A8Z A;  3CSR A;  1QQY A;  3B6L A;  2NTH A;  2YSS C;  2YVB A;  194L A;  1E8L A;  1XEK A;  2BQO A;  1DYD A;  1PQM A;  177L A;  238L A;  1IR8 A;  1NBY C;  3VWO A;  1L94 A;  3FI5 A;  1L17 A;  250L A;  133L A;  4J1B A;  4WM1 A;  102L A;  3P66 A;  4EKQ A;  5HNC A;  5KXT A;  2LZT A;  1IC4 Y;  3QE8 A;  1QDT A;  4D9Z A;  5KKJ A;  3A92 A;  161L A;  1IOQ A;  4LGK A;  243L A;  3AYQ A;  1QUT A;  4LT0 A;  2Z12 A;  3WU8 A;  4W57 A;  3OE0 A;  4YOP A;  2PC2 A;  1L03 A;  4HV1 A;  5LVJ A;  2RBP A;  2OE7 X;  1SWY A;  5L3I A;  1L21 A;  3HTF A;  1INU A;  1DPW A;  2RB2 X;  3WH1 A;  1CV0 A;  2RB0 X;  1L18 A;  4LDL A;  1C69 A;  4G9S A;  2DQE Y;  259L A;  3SN6 R;  1UA6 Y;  2XJW A;  3CDO A;  157L A;  1LMN A;  1LZD A;  4DQJ A;  1L26 A;  1A2Y C;  2H9K A;  2Z2E A;  1EL1 A;  1G0P A;  3TXF A;  1C6K A;  5B1F A;  3GUK A;  5F16 A;  3LYM A;  4IAT A;  4B4I A;  4I7N A;  5A3Z A;  1L25 A;  1J1X Y;  4GLA A;  3F6Z A;  1L64 A;  3C82 A;  3GUN A;  1Z55 A;  4NSJ A;  1C6P A;  122L A;  4NGO A;  1C10 A;  2FBB A;  1L27 A;  3RT5 X;  4Z41 A;  3SP3 A;  254L A;  1GB9 A;  1IVM A;  4I0C A;  5B59 A;  1CKF A;  2C8O A;  1VAU A;  1L61 A;  111L A;  1GDX A;  1GD6 A;  3T36 A;  130L A;  1B5U A;  1L81 A;  2RAZ X;  2YBH A;  1N4F A;  1IOT A;  1P2C C;  4ARQ B;  1PQD A;  248L A;  2LZ2 A;  4NGK A;  3FE0 A;  4NHT A;  258L A;  1L99 A;  1H6M A;  4N8Z A;  1A4V A;  3HUK A;  1GB3 A;  1G7M C;  5FHW A;  2Z38 A;  4W55 A;  1LHJ A;  3FAD A;  2HU1 A;  1B7P A;  5LA8 A;  1DYB A;  1BWJ A;  1NWG A;  1I20 A;  1IP5 A;  3DN3 A;  229L A;  1JKA A;  3HH3 A;  5I14 A;  1VAT A;  1GEZ A;  113L A;  3HUQ A;  4TUN A;  1L89 A;  3LZ2 A;  1JEF A;  1L10 A;  1L41 A;  1HML A;  1PQI A;  3C7Z A;  3HT6 A;  1L56 A;  1UBZ A;  1GFR A;  4NG1 A;  4LDO A;  4XN6 A;  1CKC A;  1IWU A;  4XAD A;  4DT3 A;  4QDN A;  3A96 A;  2F47 A;  1NHE A;  1RE2 A;  1LSN A;  4ML7 A;  3AGG G;  1BWI A;  1OUH A;  3CDQ A;  134L A;  5B05 A;  1IP3 A;  1F6R A;  4R0F A;  173L A;  2B72 A;  2MEA A;  5LVH A;  162L A;  1YAO A;  2NWD X;  3HTB A;  3HTD A;  1P5C A;  2DQF C;  222L A;  4L41 A;  108L A;  1QTV A;  2YBM A;  2RBS A;  1KW5 A;  4GBR B;  1L76 A;  1D6P A;  4I8S A;  1F6S A;  1C6G A;  1JSF A;  1QUG A;  1GF4 A;  3LYO A;  1QTK A;  3E3D A;  4PJZ A;  1L63 A;  5KKI A;  1YL0 X;  5KXY A;  6LYZ A;  4G4B A;  4NEB A;  1LTM A;  3C81 A;  1HMK A;  4NHP A;  1L62 A;  1JTP L;  3BKH A;  4WG1 A;  1JSE A;  3B72 A;  3NY8 A;  1QTZ A;  3HU9 A;  2O79 A;  1G06 A;  1HEL A;  1ZV5 L;  2B6T A;  1VFB C;  1LYD A;  4H8Y A;  4N1C C;  160L A;  4XJH A;  1LJH A;  3AB6 A;  1GFG A;  4WL6 A;  1BHZ A;  1G0Q A;  1ZVY B;  5HNL A;  4ETE A;  3WUM A;  1CTW A;  3HDE A;  4YXC A;  164L A;  3LN2 A;  3TXE A;  1GB5 A;  4NGZ A;  1L13 A;  3DNA A;  1LSG A;  4EKS A;  1LSD A;  4BAD A;  4EOF A;  1C7P A;  1B7S A;  2ZNW Y;  1GBX A;  1LZY A;  1GXX A;  1JQU A;  1NBZ C;  1YIK A;  3HBH A;  1GAZ A;  1L80 A;  3WW5 A;  2BQJ A;  1C6I A;  4PHI A;  1XEP A;  1C6F A;  2I6Z A;  1XGU C;  3WW6 A;  190L A;  1IOS A;  145L A;  3WU7 A;  1L15 A;  3SBB C;  1FBI X;  4W53 A;  1C6C A;  1VED A;  3AW7 A;  1DI4 A;  1L0J A;  3A94 A;  1REZ A;  4NGL A;  3TXB A;  4H9A A;  4LZT A;  2AUB A;  3AGH A;  1LSZ A;  2ZIL A;  3HTG A;  1OVK A;  187L A;  4NHI A;  1FLQ A;  2XBR A;  2H9J A;  3M3U A;  2F4A A;  1YQV Y;  125L A;  4NIJ A;  1T6V L;  1L20 A;  2HEC A;  178L A;  2MEB A;  181L A;  2B70 A;  2LZM A;  1WQO A;  1C43 A;  3C8Q A;  1CU0 A;  1OUD A;  3TMV A;  1L45 A;  2HEE A;  256L A;  4U3X B;  1DPX A;  1LOZ A;  206L A;  4AQN A;  1L97 A;  1BVK C;  1I6S A;  5I54 A;  1L85 A;  261L A;  1V7S A;  3AJN A;  5AMY A;  1SLY A;  1GBS A;  1G0L A;  4EJ4 A;  2L78 A;  1CJ9 A;  3W6C A;  1L32 A;  1TEW A;  137L A;  3CSQ A;  1C6J A;  3WU9 A;  5B07 A;  4E3U A;  1QSB A;  1C63 A;  5LYM A;  3DKE X;  1LYY A;  1L44 A;  4HP0 A;  5K7O A;  2EIZ C;  1QT7 A;  227L A;  2BQM A;  1C08 C;  1UUZ C;  2YBJ A;  4WG7 A;  1BB7 A;  1REY A;  2Z39 A;  1JJ1 A;  1J1P Y;  1L23 A;  3G3X A;  5L9J A;  2BQE A;  4ARM B;  1B7O A;  3T6U A;  3OE6 A;  1GDW A;  4WM2 A;  151L A;  2RBN A;  1ALC A;  5I4W A;  3B0O A;  2D6B A;  1LW9 A;  1TAY A;  3CQL A;  1IP1 A;  1JWR A;  4ARM A;  3W6D A;  4IAP A;  1PZY A;  4HPI A;  1BB4 A;  1BWH A;  5I53 A;  5DL9 A;  2DBT A;  1BB5 A;  2D4J A;  2Q9D A;  1L28 A;  3RZ4 A;  1GF7 A;  1L59 A;  4DD0 A;  4B1A A;  1LZ8 A;  2A7D A;  2OU9 A;  4RW2 A;  2F4G A;  196L A;  3BKV A;  4ETD A;  1LI6 A;  1GFU A;  5DLA A;  3HBD A;  6LYT A;  1JIT A;  1B7R A;  4ARQ A;  3RU5 A;  1C6D A;  2B6X A;  3DN1 A;  126L A;  224L A;  239L A;  5LIO A;  3LYT A;  242L A;  5C6J A;  1T3P A;  1WTH A;  4PGJ B;  2LYM A;  4ETC A;  3LZM A;  1JTO L;  3B0I A;  4H8Z A;  2RBR A;  4MCK A;  119L A;  120L A;  1LSE A;  1LJN A;  3IWR A;  1L46 A;  1LSM A;  1YAN A;  191L A;  4MR1 A;  5ILC A;  2RBO A;  5F14 A;  5HQ1 A;  3N9C A;  4XYY A;  4FJR A;  1L91 A;  1L14 A;  2DQA A;  1P3N A;  223L A;  2FYC A;  1UIC A;  1C62 A;  1QUO A;  1OUA A;  1L82 A;  4DD2 A;  3LHM A;  240L A;  1WTN A;  107L A;  1DXJ A;  4NHQ A;  2I25 L;  4LT1 A;  1QT5 A;  2MEG A;  6LZM A;  1DQJ C;  1TLA A;  1CKD A;  4OWH A;  1G0K A;  1LSP A;  3HH6 A;  4WLT A;  1QSQ A;  4M6D A;  235L A;  1FLW A;  1KXY A;  5T3F A;  1QTD A;  2B6W A;  1AT6 A;  1LZA A;  5LYT A;  200L A;  1AZF A;  5DN5 A;  3PDS A;  3DMZ A;  2O7A A;  1LMP A;  1LZN A;  1XEJ A;  1IC5 Y;  3C7W A;  2MEI A;  3F8V A;  182L A;  3P4Z A;  1C6A A;  1WQN A;  4H9B A;  3V2W A;  3G3B B;  1YL1 X;  2DQC Y;  5LVK A;  1L09 A;  110L A;  4GRV A;  1XGP C;  5KXR A;  114L A;  1LKR A;  5FCP A;  1B5V A;  1LPI A;  3EXD A;  1SQ2 L;  1GF5 A;  2Z2F A;  4GLV A;  4I7J A;  3WXU A;  1ZUR A;  2G4P A;  2MEH A;  2ZWB A;  2ZQ4 A;  1CV1 A;  1GF9 A;  4OOT A;  4OO9 A;  1L68 A;  2Z19 A;  1C6E A;  1CV3 A;  3EO5 A;  3WVX A;  1L60 A;  4WO6 A;  2XQO A;  233L A;  1ZWN A;  1GFJ A;  2MEE A;  1CUP A;  1B5Y A;  1LHI A;  1OQM A;  2FYD A;  3AGI A;  1HEO A;  4GCC A;  1L31 A;  1GFE A;  1L0K A;  3ATO A;  1B5X A;  4AGA A;  140L A;  1GE4 A;  1KIR C;  2N5Z A;  2FBD A;  3J6K A;  2B74 A;  1GEV A;  1GF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...