1QUTA

The soluble lytic transglycosylase slt35 from escherichia coli in complex with n-acetylglucosamine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
312
Chain Sequence
b'MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
publication title Crystal structure of Escherichia coli lytic transglycosylase Slt35 reveals a lysozyme-like catalytic domain with an EF-hand.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 108
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qutA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qutA02
1LZ1A 1GB2A 1GDXA 5B07A 3AYQA 4LYMA 4LT0A 2MEHA 4TUNA 5B1FA 4H9HA 1VDQA 1LZCA 1TDYA 3CSQA 4DT3A 4D9ZA 4WO9A 4CHXA 5E9RA 1LJ3A 3D3DA 4GN3A 4ETBA 1W6ZA 3P65A 4H8XA 4OOOA 1LMQA 8LYZA 5ILCA 3J4GA 4NGKA 4ZEEA 4B1AA 3F6ZA 1FKQA 4I0CA 4GCBA 1YAMA 1ZMYL 1NWGA 1B7MA 4CGEA 1GB9A 4XYYA 1LHKA 1IX0A 1IP2A 1IC4Y 1JHLA 5HNLA 5DN4A 1LZTA 1XGUC 2F30A 2HUBA 1XFPL 4O34A 1LZBA 3TXFA 1FLYA 2YBHA 3HBEX 3QY4A 4HPIA 2YVBA 2YBNA 1HF4A 3CSZA 1LHHA 1JISA 1YKZX 3CB7A 2W1MA 1LSMA 1WVUA 1LJIA 5LAGA 3BKHA 3AB6A 1IR9A 2BQBA 1UC0A 3A67Y 4BAPA 1TEWA 3WMKA 1EQ5A 1LZEA 4WG1A 1LJGA 7LYZA 1LHIA 1IEEA 1LZ5A 4WM2A 4LYOA 3WL2A 2D4KA 1ZVYB 3ATOA 1GB8A 2H5ZA 2MEEA 1OUFA 1LJNA 1NDGC 3RZ4A 2MEIA 1KXYA 2BQDA 3J6KA 1RJCB 5IDDA 2AUBA 2HECA 1LAAA 4OW1A 1F6RA 4AXTA 1PS5A 4N1EI 4H8ZA 1QUTA 1VDPA 2LHMA 4TWSA 3G3AB 5APCA 5KJ9A 1J1XY 3WH1A 4H90A 3CT5A 1LPIA 4R0FA 4HJZA 1IP4A 4RLMA 1BWIA 3A96A 1C10A 1N4FA 1OP9B 4GCFA 5FEKA 4WLTA 4J7VA 1BB6A 2BPUA 1FLWA 4DD9A 1LYOA 2A7DA 2F4AA 3D9AC 3QNGA 3W6BA 3WPJA 1LZ4A 5LVIA 1G7LC 1XGQC 1IR7A 4UWVA 2Q0MX 4PRQA 1IP1A 1HEQA 1LSBA 1XSFA 1HHLA 1WTMA 3W6DA 1DKKA 1QSAA 1GB7A 1IP7A 3N9CA 4LT3A 3GXRA 5LA8A 5B59A 1JJ3A 1B5VA 2I26L 1FN5A 2CDSA 4NGWA 1AZFA 2ZYCA 4HJVA 4NY5A 4LYTA 4TTDA 3WW6A 1CKFA 3EXDA 1LJHA 1LJEA 1LMNA 1YL1X 2Z19A 2Z2FA 3CQLA 1GFUA 1NQIA 1GFJA 1OUIA 3P66A 3TXHA 1A4VA 1YIKA 1IP6A 2DQAA 2HEDA 3RT5X 4OOTA 2MEGA 1G7JC 4CFOA 1IVMA 1IY3A 2F4GA 2RSCA 3EO5A 3AZ7A 4C3WA 6LYZA 5DLAA 2DQHY 1RFPA 4NEBA 3CT1A 3P64A 3T36A 2BQHA 5T3FA 1B7QA 1GF0A 4E3UA 1MLCE 1TCYA 1KXXA 4Z46A 3HBDA 4GCCA 1DZBX 1FLUA 3K3TA 2GV0A 3OK0A 2XJWA 4NFVA 1GXXA 4LYBA 1BB7A 1UIGA 3KAMA 4A7DA 2W1YA 4H9BA 3TXJA 1CKHA 3WPKA 1LKSA 5KY1A 2YBLA 4ET8A 1YROA 3HBHA 5KKIA 4GCDA 4KL7A 1HEWA 5LA5A 2YBJA 2LYMA 1LZNA 4NGIA 2FYCA 1AT5A 2ZQ4A 1B7NA 1BHZA 3AW6A 5KXMA 5FSTA 3EBAB 1QTEA 5L9JA 1IC7Y 1I20A 4DD0A 2YBMA 2BQMA 1NDMC 1INUA 1C43A 1F10A 1QTKA 4NG1A 4LFXA 1IWWA 2X0AA 1FKVA 5KXOA 5LIOA 1DKJA 1UACY 1LKRA 1KIRC 1JTPL 2WARA 1H6MA 3A3QA 4B0DA 4H9AA 1WVVA 3SP3A 1B7RA 3HFMY 1AM7A 1JITA 1IWYA 4PPOA 5APDA 4DD7A 4YF2A 4XJFA 135LA 1CNSA 1IOCA 4WO6A 4GN4A 2N5ZA 5EBHA 5C6LA 3M3UA 3TXGA 4QEQA 9LYZA 1LSYA 1HSWA 5KXYA 3AJNA 3LYZA 3E3DA 1LZYA 3LYMA 3WVYA 1JSFA 5KXZA 1IOSA 1F6SA 1UIEA 132LA 4W96A 4B49A 5HQ1A 1GF6A 1GFHA 1WQRA 5FHWA 4NWEA 2DQIY 1J1PY 1ZV5L 5KXLA 1GPQC 4NGYA 4WM5A 5B1GA 3N9EA 1LJFA 1O23A 3EMSA 4DDCA 4H94A 4R6CA 2W1XA 1D0KA 1LTMA 1BB4A 1UIAA 2YSSC 4KPMA 1LMPA 5D5FA 4Z98A 2BQLA 1QSWA 153LA 1GB5A 1GBYA 5HLLA 3GXKA 1YILA 1QIOA 4N8ZA 4WOAA 4QDNA 4G49A 1XEJA 3WYHA 4DD1A 3BKVA 1B7LA 1XEKA 4B4EA 3B72A 2Y8PA 5DM9A 4MCKA 3IJVA 1UBZA 1LSZA 3A94A 2EPEA 1OUAA 4J1BA 3A92A 1JIYA 4NHSA 1WQNA 2BAAA 3LZTA 3RW8A 1UIFA 3W6CA 1F0WA 1IWVA 4WG7A 4TSBA 1SLYA 4ZIXA 5AMYA 2MEFA 1UIHA 1JUGA 3AGIA 1LYYA 3B0OA 5I4WA 1GFEA 4OWEA 2FYDA 3WVXA 1LMCA 1J1OY 1NKHA 1VAUA 1GE0A 4WLXA 4DDBA 1YAOA 1OQMA 1XGRC 1HFZA 1WQMA 1LZRA 2ZILA 1GF3A 1LYZA 1HC0A 4H92A 2DQDY 1LMOA 2LYOA 4EMNA 2HU3A 4H9CA 1GB6A 1WQOA 1JTOL 2ZYPA 5B05A 3TXDA 1NF5A 1LSFA 5A3EA 1UIDA 4IATA 4GN5C 1TAYA 3TXKA 3B0IA 5LVKA 2ZNWY 1JKBA 1UUZC 2BQAA 4NG8A 1BWHA 1NMMA 5KKJA 2BQJA 4LYCA 4AGAA 4WM1A 1OUEA 5LYZA 4H9FA 1D6PA 4Z3MA 1IOQA 3N9AA 4NGLA 193LA 5DL9A 3WXUA 1C45A 5LYMA 1C7PA 1LJJA 5K7OA 5KXKA 4OWBA 2YBIA 3WU7A 2PC2A 1VDTA 4G4CA 1PZYA 1BVKC 3CSRA 4U3XB 1LOZA 3A34A 1B5XA 4XADA 1BWJA 3ZEKA 5F81A 1MELL 5E4PA 1GFTA 3A95A 4NSIA 5HNCA 5I4YA 1Z55A 5L3HA 1H87A 4YOPA 2Z18A 3A91A 4M6DA 1I56A 2D4IA 1REYA 4KXIA 1CKCA 4LYZA 5LVHA 5LAFA 5DN5A 2C8PA 1GFGA 4DDAA 4X3BA 3AGHA 2EIZC 2Z37A 1IIZA 1EQ4A 4PGJB 4ETCA 1HERA 1D9UA 2Z38A 2BLYA 4G4BA 1B5WA 1GF9A 3FE0A 4NSJA 1LHJA 4ZFPA 4N5RA 3A3RX 2ZIKA 4PJ2C 1LSGA 3AZ4A 1GBZA 1IWXA 3TMXA 1C08C 1YAQA 2C8OA 194LA 1LZDA 4LT1A 1REXA 2DQJY 2VB1A 4WL6A 3TMVA 1IR8A 2LYZA 4HJYA 1B9OA 4L41A 2D91A 4ETAA 1LZ8A 1OUHA 4Z41A 1HMLA 4H1PA 1XGTC 1FBIX 3LYOA 1V7SA 1DPWA 1GFKA 3TMUA 1HEMA 4DC4A 5LVJA 4QY9A 4XN6A 5I53A 1QDTA 1C46A 5C6JA 4ET9A 1IP5A 3RU5A 4ANRA 1T3PA 4OWAA 5F16A 3TMWA 3WU8A 3WUNA 2EKSC 1B5UA 2D4JA 3A8ZA 4XJHA 1RCMA 2DQCY 2G4PA 5D5CA 4RLNA 1B2KA 1IY4A 1GFRA 1B7PA 4G4HA 1WTNA 2EQLA 4FJRA 3WUMA 1DI3A 4H9IA 3A6BY 3AW7A 4HPEA 1G7MC 1LHMA 2BQGA 3P68A 6LYTA 2D6BA 4IJ4A 4FDYA 154LA 2F2NA 2BQIA 2FBDA 2BQKA 4WLYA 5M1YA 1VDSA 4CFPA 2HU1A 3ZVQA 4GLAA 1GF8A 1QDRA 5I5QA 1AT6A 1IORA 1IWZA 4ML7A 1LHLA 4ETDA 1OUCA 4QGZA 1JKDA 4HTQA 4NIJA 1KIQC 3TXBA 1JKAA 4H93A 4RDSA 4MR1A 207LA 1LSDA 2BQNA 4XJIA 2ZIJA 2DBTA 3QE8A 4P2EA 4WM4A 1HEPA 4XJBA 3P4ZA 3MGWA 1LSNA 2Z39A 1LSCA 3LZ2A 1LZ6A 133LA 4LZTA 1CJ6A 1QUSA 4H91A 5C6IA 1JJ1A 1GBSA 2I25L 2DQFC 3LN2A 4II8A 4NWHA 5I54A 1REZA 3W3EA 3WXTA 1JPOA 1BB3A 4J0LA 2CWIA 2ZNXY 5B06A 1YAPA 5F9XA 4HTNA 2ZWBA 4NHQA 1GE3A 1GF4A 1HENA 1WQQA 2DQEY 4XJDA 3WW5A 4WM6A 2BQOA 5JENB 3ATNA 1GEVA 1FLQA 5LVGA 4H8YA 4EOFA 4MSTA 3W6FA 1LJKA 2CJLA 1GB3A 1DQJC 1GEZA 1HFYA 1QQYA 1LZ9A 2G4QA 5APFA 4C5FA 2B5ZA 2MEBA 2A7FA 1V7TA 2DQGY 1HEOA 1JWRA 2G4NA 4LGKA 4RW2A 1XEIA 3B0KA 2NWDX 1GF7A 4HV1A 2BQCA 2H9JA 3A90A 4CJ2A 2I6ZA 3WUAA 1GAYA 3A6CY 1LMTA 2H9KA 4OWHA 4WMGA 3TXEA 1UIBA 1VFBC 2MEDA 2CGIA 4G9SA 4LT2A 5F9UA 4WL7A 5L3IA 1BB5A 1VEDA 2Z2EA 1UCOA 4NGZA 4YEOA 1LSEA 1HELA 4NSGA 1RI8B 1JEFA 2BLXA 4GLVA 1LYSA 1OUJA 1HNLA 3RNXA 5ILFA 1KXWA 4GCEA 3FI7A 1HFXA 1LZGA 1B5ZA 1OUDA 1UICA 1VATA 1B5YA 2DKVA 3W6EA 5II3A 5A3ZA 4NSHA 1YL0X 2MEAA 2BQFA 2Z12A 1REMA 5KXNA 3WU9A 1ALCA 5I4XA 1P2CC 1AKIA 1G7IC 1GBXA 5IHGA 1LSAA 2HEAA 1D0MA 5J7CA 4DYGA 5FDJA 1IOTA 1EL1A 4I8SA 5F14A 5HMVA 1ZVHL 3ULRA 1GBWA 4YENA 3LYTA 1CJ7A 1JKCA 1LSPA 2XBRA 3AZ5A 5LINA 4XENA 2IFFY 1YANA 1HSXA 4BAFA 1DI4A 1JJ0A 4W94A 3TXIA 1GXV2 1W08A 2XBSA 3IWRA 4KT3A 3IJUA 4N1CC 4PHIA 1DI5A 4YM8A 4YEMA 1GFAA 1IO5A 1NBYC 5LYTA 4DD2A 3CT0A 4HTKA 4LFPA 2HEBA 4NHTA 4WLDA 1DXJA 1T6VL 3LHMA 1IP3A 1UA6Y 2HEFA 4J1AA 1B7OA 1GE4A 1SQ2L 4XJGA 1E8LA 1LCNA 2FBBA 1GF5A 3WPLA 1FDLY 2MECA 4NHPA 3OJPA 5FCPA 4RW1A 1B7SA 2IHLA 3A93A 1LJ4A 2W1LA 4NGVA 1DPXA 3ZVQB 5APEA 3W6AA 1I1ZA 4NGOA 5IELA 2LZTA 1KIPC 2LZ2A 4B4IA 1G7HC 5KXXA 1IWUA 2HTXA 4N9RA 4UWUA 1IWTA 1YKYX 4BS7A 1EQEA 1GHLA 5FELA 1LMAA 1GE2A 1OUGA 4ETEA 4M4OA 1IC5Y 208LA 1D0LA 4IASA 3M18B 1CJ8A 5KXSA 1B0DA 2XTHA 1WQPA 1BQLY 5KXTA 1BVXA 4WM3A 1BGIA 3WULA 4H9EA 1NBZC 3VWOA 1NHEA 2HEEA 1D6QA 5KXRA 1OUBA 4B4JA 1GB0A 1CKDA 4HV2A 3AGGG 134LA 1LZAA 4HSFA 1XGPC 4NHIA 1CJ9A 5KXWA 4TX7A 1HMKA 4OWCA 2ZQ3A 1GWDA 3G3BB 1TBYA 4TSCA 1GE1A 5KXPA 1JTTL 1YKXX 1LZSA 3AZ6A 4NGJA 3T6UA 1YQVY 4DD3A 2BQEA 1GAZA 1GD6A 4UWNA 4N0JA 4HP0A 2YDGA 1GDWA 1GFVA 1JSEA 1RE2A 3B6LA 5LXWA 4PRUA 4BADA 1A2YC 4DWXA 1GBOA 1CKGA 5HMJA
chains in the Genus database with same CATH superfamily
2H1RA 168LA 1GDXA 4LYMA 2DHYA 1L41A 4LT0A 2MEHA 198LA 4TUNA 3J80S 2CHQA 1TDYA 1CU6A 3CSQA 5E9RA 1B6IA 3P65A 1K3XA 2C5RA 3J4GA 2B6TA 2KZSA 1IY2A 1N78A 1YAMA 4MH0E 4NXMM 1IP2A 5DN4A 4E97A 1C68A 1LZTA 4L78A 2F30A 1QSQA 3TXFA 1FLYA 3HBEX 2VQFM 2LH0A 2Z6BA 2B3TA 2Q9EA 2QPAA 1LGXA 3KOXE 1UC0A 3VK8A 4BAPA 3GPUA 1TEWA 1LZEA 4WG1A 1IEEA 155LA 2MEEA 1OUFA 3RZ4A 2LVPC 2BQDA 1RJCB 4DR3M 2AUBA 177LA 3D8BA 1W5TA 1LAAA 1DGBA 255LA 4AXTA 1PS5A 1R7RA 5KJ9A 3WH1A 4OO9A 3CT5A 3DN8A 4R0FA 3FUUA 4HJZA 4RLMA 3HU8A 1BWIA 3A96A 2CP8A 236LA 1NY5A 2CHVA 1BB6A 2QBYB 2BPUA 4OVZB 1RU3A 3DFZA 1XGQC 248LA 200LA 3DKEX 1L01A 1XSFA 1L90A 4I7SA 4LT3A 2HL7A 3N9CA 3E46A 2JY5A 5IREB 3CGWA 3G3WA 2DAGA 163LA 1NV9A 4LCBA 3KS4A 1LMNA 1YL1X 2DWMA 2Z19A 4QHSA 3AKZA 1GFJA 1WJ7A 3T1HM 3TXHA 2R0IA 2UUAM 1QT7A 4IBCA 4AQNA 2DQAA 3EIHA 3CF6E 2R6FA 4CFOA 2JZ1A 2Y0TA 4R3DA 2Z8YM 3W0FA 3AZ7A 4QNMA 4LF4M 2DQHY 4NEBA 4DV4M 1EPYA 3NY8A 3P64A 1W5SA 4LY6A 2BQHA 1L57A 2VIIA 3CDRA 2XF3A 1GF0A 3GLFA 4E3UA 4Z46A 4GCCA 3I4VA 3U5ZB 2Z3XA 1G0LA 2GV0A 4I5SA 1L31A 218LA 4R7GA 5ITRA 1CV4A 1GXXA 4LYBA 1PJJA 3H4JA 1UIGA 3E4RA 4H9BA 3TXJA 4Q7JA 1CKHA 3WPKA 2KZUA 3HBHA 5KKIA 4GCDA 4GMQA 3TWMA 1Q39A 1PQKA 1TR8A 1L21A 1BHZA 3DN0A 1D2WA 3KXEC 1SX7A 1A5TA 4GC5A 1QTEA 5L9JA 253LA 3UMMA 4PDIA 1ZYTA 1NDMC 2BQMA 1L13A 2Z4RA 5KXOA 1DKJA 1UACY 2WARA 4B0DA 3A3QA 1H6MA 4H9AA 2RBOA 5DYIA 5APDA 3SMSA 4XJFA 4WO6A 4W51A 4GN4A 9LYZA 1CUPA 2Z7JA 1HSWA 5KXYA 1L92A 1TH4A 3AJNA 256LA 3PBLA 2DZLA 3WVYA 4B49A 1VEJA 5KXZA 1F6SA 2F5QA 1GFHA 1WQRA 1OV5A 4XK8F 1NNJA 4MGZE 1ZMVA 4NGYA 4WM5A 3EIEA 1LJFA 1O23A 3FADA 2CUZA 2W1XA 3QYBA 4GITA 2KRUA 1QSWA 4HLQA 4LGMA 4WOAA 4N8ZA 2R4EA 4G49A 1XEJA 1OFHA 1XMQM 4IBGA 1T6OA 3DN4A 1IFYA 2CUUA 2VF8A 1N34M 1Z5CA 4LZZA 1OUAA 2OU9A 1SXJA 4J1BA 1DYEA 2KNAA 1JIYA 2KA6B 188LA 1OYUA 3RW8A 3W6CA 2JUJA 3G3VA 1SLYA 5AMYA 4Y28F 4JI4M 2FFJA 1GFEA 234LA 2FYDA 1VAUA 3FUTA 1D2NA 1YAOA 1XGRC 1TTEA 1WQMA 4L15A 3J7AS 149LA 4H92A 3CDQA 4DQ5A 2DQDY 3KP1E 1LMOA 4EMNA 4DV0M 4H9CA 5B05A 1LSFA 3G3XA 5A3EA 1CTWA 3UJNA 3GLFB 195LA 226LA 3RUNA 3B0IA 4I4LA 2J7NA 4NG8A 156LA 1QVRA 4II7A 2BQJA 4F2LA 127LA 3HUAA 1D6PA 5DFLA 1C45A 1LJJA 2B6ZA 2YBIA 3W67A 1VDTA 4G4CA 4F1IA 1XWIA 4LFCM 1GFTA 4DR5M 210LA 2RKOA 2L7HA 1UFZA 4QHTA 2QSFX 2FNAA 2Z18A 1XJTA 1I56A 5LVHA 1ORYB 261LA 1LW9A 5DN5A 196LA 1GFGA 3WHLA 1G0QA 1IM2A 3B89A 1SXJD 1HERA 1D9UA 1TDZA 3A46A 3A45A 1B5WA 1GF9A 4JI5M 1L60A 1JTMA 2ZTCA 4FVMA 2EKFA 5EP3A 2H5XA 2DQJY 3NYAA 1B9OA 4L41A 4Z41A 1LZ8A 3BOSA 4H1PA 1CU3A 1V7SA 3VKHA 1DPWA 3TMUA 1HEMA 1IXZA 3L29A 1QDTA 4JN6A 1PM5A 1LLHA 3F92A 4ET9A 1IP5A 2HULA 1L19A 4P16A 3WUNA 2DZOB 1T3TA 3GUPA 2C9CA 2G4PA 5D5CA 1IY4A 1GFRA 3BXWA 4G4HA 2EQLA 3WUMA 2D7GA 2XZFA 4HPEA 6LYTA 1L39A 2KNZA 3A42A 2C99A 2FBDA 2BWEA 4CFPA 1QT3A 3ZVQA 5I5QA 4ETDA 4ML7A 1OUCA 4AW4A 2G3QA 3VDUA 1SXJB 4X66M 1KIQC 4HTQA 4NIJA 3FTCA 4QOSA 1L99A 219LA 4H93A 4RDSA 3Q8GA 1LSDA 2BQNA 3F9LA 2DBTA 5JI3E 3QE8A 2DENA 3UGJA 3KVWA 2EUCA 1LYEA 184LA 140LA 3KOZE 1K28A 176LA 3L25A 3HT6A 4II8A 1XB2B 5I54A 1ZMUA 3U6PA 1KY0A 4M0DA 1L93A 5B06A 224LA 3KW6A 1YAPA 1GF4A 3TQSA 5LVGA 3DNAA 1L2BA 4B08A 1P46A 4EOFA 239LA 2CJLA 2L7IA 2OOAA 1GEZA 1L07A 5APFA 2B5ZA 2MEBA 2MJ5B 1OWZA 1HEOA 1D2YA 3GLHE 4GEWA 4WW0A 1JR3A 4AKHA 3U6EA 5KXKA 1LMTA 1L18A 2VQEM 1UIBA 1L34A 2CGIA 4G9SA 1LYDA 4FWGA 1L44A 2Z2EA 4YEOA 1L27A 1NHGC 1JEFA 2UUCM 1LYSA 1KXWA 1P56A 3WHKA 1P6YA 1OUDA 3DN6A 242LA 1C1KA 2Z12A 5KXNA 5I4XA 5IHGA 3R8FA 1DYGA 2OE9X 5J7CA 4I8SA 3AL0C 1L06A 3ULRA 4PCZA 4W59A 2XBRA 4XENA 3C82A 4QOZC 1I4WA 2FE8A 4PHIA 2XBSA 1F4IA 5LYTA 1IO5A 1GVNA 4XBOA 3TL4X 1VDDA 3CT0A 3OE8A 3QAKA 4DD2A 1C6QA 1TGUA 3CF2A 1T97A 2C98A 229LA 1UA6Y 1PQDA 2N35A 4DJHA 5EXPA 4AQYM 2QP9X 2ZANA 1XXHA 1GE4A 4XJGA 3SC3A 4MGYE 1P3QQ 3E9SA 2UUBM 3K2LA 3WPLA 1L89A 1FDLY 2MECA 3NWLA 3UONA 3GLGA 1N75A 3AOEA 5FCPA 4LDEA 2IHLA 3L27A 1L70A 3A93A 4NGVA 1DPXA 4EPIA 3ZVQB 3FRIA 1JR3D 5IELA 2LBCA 2LZTA 1KIPC 1GL7A 4UN2B 2HTXA 2OU8A 1T43A 5FELA 3B7QA 2AHMA 4AI6A 114LA 1L68A 1IC5Y 4ARPA 1D0LA 1P37A 1L35A 237LA 3M18B 5KXSA 7LZMA 1WQPA 191LA 1NHEA 262LA 3BBZA 5KXRA 4DV6M 4B4JA 4YXCA 2NQ8C 2ZAMA 4Z6YA 122LA 3AGGG 4ARQA 3HU2A 4NHIA 3I51A 1C6BA 4OWCA 2ZQ3A 4EKRA 3G3BB 3ZH9B 1L83A 4TSCA 244LA 1TLAA 4X65M 1YKXX 3AZ6A 1L2DA 1QTZA 2RB1X 1AIPC 1GAZA 245LA 2YNMD 1MN3A 2A5YB 4JI7M 4HP0A 1GDWA 4BADA 3HH4A 3OE6A 3SB5A 3SBAA 2UXCM 120LA 1L55A 3SAUA 1GB2A 2V1CA 1KS3A 3DZDA 4IBJA 4IIWA 4DUZM 2F5OA 1L0KA 1VDQA 233LA 2QNJA 1Z5AA 1LZCA 5BPVA 1HNWM 1V33A 5GKNA 4W58A 2CRUA 2R18A 2EO2A 1LMQA 4ZEEA 4I0CA 1B7MA 1L69A 4CGEA 1LHKA 1IX0A 5HNLA 2KEBA 4RKUF 1I6SA 2HUBA 1XFPL 4O34A 171LA 1DV0A 1E94E 3QY4A 1ZWNA 4IBKA 3DN2A 2YBNA 1HF4A 139LA 1LHHA 2RB0X 4LF8M 1C69A 2W1MA 3U60A 1VQ1A 1LSMA 1WVUA 2DAKA 1IR9A 1L95A 3A98B 3A67Y 1L56A 7LYZA 4OU7A 2XLJA 4LYOA 3WL2A 169LA 4LF9M 201LA 1LJNA 1NDGC 3J6KA 3FA0A 4G4RA 4JI8M 1QUTA 1L81A 3G3AB 2MR9A 3GPXA 4H90A 142LA 3PNYA 1IP4A 3FTFA 4DR7M 1OP9B 5FEKA 3GO8A 1XXHB 4S12A 1FLWA 2XZUA 2F4AA 1NO1A 3U6LA 4I81A 5LVIA 1IR7A 4PRQA 3HWSA 2DWZB 4BB9A 1LSBA 1P5CA 2ERCA 1IN8A 3SMPA 3AV0A 3SYLA 1CU5A 1PJIA 1B5VA 1AZFA 4TTDA 4HJVA 3WW6A 3L2XA 4LYTA 3EMLA 3RZEA 1LJHA 2KDLA 3P66A 1L48A 1C6HA 1T8AA 1CX7A 1IY3A 3EO5A 3AFHA 5DLAA 1L22A 4ARQB 2JY7A 3CT1A 3HTFA 3T36A 4LF7M 4RNAA 1MLCE 2LNHC 3I4YA 166LA 3SB6A 1FLUA 3K3TA 3OK0A 1MJGM 137LA 3HU1A 128LA 4AG6A 5KO3A 1QUHA 1L75A 3FYCA 3T6PA 257LA 4A3VB 2LYMA 2ZQ4A 2RH1A 3EBAB 1I20A 1CVKA 160LA 1INUA 1F10A 1QTKA 1X37A 4LFXA 2RBRA 112LA 1FKVA 4B3TM 1LGWA 1R6BX 2L4FA 1XC8A 1LKRA 1JTPL 1WVVA 1JITA 216LA 2V6ZM 4PPOA 5FTKA 4YF2A 1IOCA 1Z6TA 2DXIA 2B6YA 1ZAEA 3TXGA 5C6LA 1LSYA 1YLAA 3GULA 1L11A 1LYFA 1L36A 3LYMA 3U60B 5EXXA 1JSFA 4W96A 221LA 1GF6A 3LQRA 1J1PY 3GPPA 4LDOA 4DDCA 4H94A 3ZQJA 4R6CA 2DKLA 3AOGA 1UIAA 2RBNA 5IZ7D 4KPMA 1LMPA 1QSBA 1E9RA 4Z98A 1C6CA 1C6TA 1YILA 1G06A 4JYAM 1QIOA 4G3OA 3WYHA 3F8VA 3BKVA 2OE4X 1QTCA 4B4EA 5KPTA 2DNAA 3IJVA 2CV1A 4PK0A 143LA 213LA 3A92A 3L2AA 8CATA 4DR1M 4NHSA 1OKSA 2V1UA 1UIFA 4KODA 1F0WA 4WG7A 2MROB 4TSBA 1FJGM 1JUGA 1LYYA 3GRVA 4OWEA 4G4OA 1LMCA 1P2LA 1HNZM 1C6PA 4WLXA 4DDBA 1SWYA 1HFZA 1LZRA 3GUIA 3LVWA 5KQDA 3LMMA 2LYOA 2KXEA 1L51A 2EJSA 2HU3A 2XSZD 2ZYPA 1D3JA 1L33A 4IATA 4GN5C 5A2QS 1TAYA 3V2WA 1JKBA 2BQAA 1TDHA 1BWHA 3SHFA 1C66A 2RRUA 4LYCA 1L30A 4AGAA 5L8RF 5EXSA 1IOQA 3N9AA 5DL9A 193LA 107LA 3GRUA 228LA 1C7PA 1SX2A 3D8LA 3WU7A 3CSRA 3A34A 1B5XA 4XADA 5E4PA 3A95A 2X8AA 1QAMA 3A91A 4HEOA 2VDBB 2L6OA 2D4IA 5LAFA 2XGNA 2CWBA 4X3BA 2EIZC 1EQ4A 4ETCA 4NXNM 1TH2A 3TWLA 4G4BA 1L50A 3VFDA 3C80A 4ZFPA 1L65A 259LA 1LSGA 1C08C 1G0GA 2VB1A 4WL6A 230LA 1IR8A 2LYZA 2D91A 1XGTC 1QYRA 1FBIX 3LYOA 1GFKA 5LVJA 4YY3M 4QY9A 178LA 1IBKM 3GUNA 5C6JA 222LA 5ITXE 4GHLA 3IECA 110LA 3RU5A 2BJWA 2R65A 2OO9A 3FUXA 3C8RA 3WU8A 2EKSC 1TF0B 1C60A 2D4JA 1AUAA 4XJHA 1RCMA 4RLNA 2DI0A 1B7PA 1LWKA 1J7KA 1DI3A 1L09A 3A6BY 3AW7A 1LHMA 3P68A 125LA 1EE8A 2LC9A 2F2NA 4FCWA 3U6MA 4WLYA 3HJSA 3CTWB 4L8RC 1VDSA 3SB8A 2HCBA 3HGIA 4GLAA 1AT6A 2OQ4A 1HQCA 1L37A 4L6V6 4MR1A 5KPZA 4XJIA 2L09A 2KNVA 2ZIJA 4P2EA 4WM4A 104LA 4YXAC 3VW7A 4MB7A 3LZ2A 4DQ7A 133LA 3OE0A 1QUSA 5C6IA 2K9DA 3ILKA 250LA 2DQFC 3W3EA 3L28A 4X62M 1JPOA 1PQMA 1BB3A 1IQPA 2CWIA 3M0EA 1L76A 1XEPA 5F9XA 2ZWBA 4NHQA 1GE3A 4XJDA 3KP0E 2BQOA 1FLQA 3J2PB 145LA 4H8YA 1N36M 1GB3A 1HFYA 225LA 1LZ9A 2G4QA 1V7TA 2JP7A 2UXBM 2RB2X 4FWHA 4RW2A 3B0KA 3UK6A 1GF7A 4HV1A 4DV7M 2H9JA 3U6SA 2I6ZA 5LZMA 3A6CY 4OWHA 2H9KA 1L45A 4WL7A 4DAJA 1E32A 1UCOA 2K0BX 1GABA 1OUJA 1HNLA 2B7XA 3C3DA 3FI7A 3NBXX 1VATA 3SASA 1LI2A 1IN4A 1YL0X 5JENB 1GBXA 1LSAA 2HEAA 1D0MA 1TH3A 1CUQA 4LRSA 2DAEA 4DKLA 1ZVHL 3T1YM 6LZMA 1CJ7A 1LSPA 1IN6A 126LA 1V92A 2Q9DA 1GXV2 4KT3A 2JXNA 1K82A 3R9XB 3C9PA 4DV5M 4YEMA 1GFAA 1NBYC 3KDSE 5C18A 1XHBA 4CHTB 115LA 1C6MA 1S3SA 4LFPA 4NHTA 1T6VL 4W56A 5EQTA 2HEFA 3GLIE 5DNYA 1D3NA 1B7OA 4DQJA 1G1VA 3SB7A 1E8LA 1LCNA 4I7NA 4DV3M 3HH5A 1YUBA 1GF5A 1L23A 2B73A 4NHPA 3HU3A 1C6JA 4W53A 2KRKA 3HT9A 4DV2M 2QENA 3JR5A 1CV3A 1QT6A 5APEA 4NGOA 4B4IA 5ITQA 1IWTA 1EQEA 1GE2A 1OUGA 4ETEA 3C7WA 1QUDA 1CJ8A 1NJFA 1B0DA 2XTHA 1QAOA 3J7BA 3K92A 103LA 4WM3A 1L03A 4H9EA 2B6WA 4I7PA 2ZTDA 1L04A 1CKDA 4I7KA 4HSFA 1XGPC 1T8GA 174LA 1CJ9A 4ZPXA 5KXWA 1HMKA 4EKQA 1GWDA 1DO2A 1LZSA 3M6AA 2M60A 3T6UA 2BQEA 4UWNA 3SAWA 2F2QA 4N0JA 4NSRA 4NRVA 3B6LA 5LXWA 3D4SA 2YQZA 1GBOA 1NHBA 1NY6A 2L4EA 5B07A 3AYQA 4GKKM 2DVWB 1C6KA 5B1FA 2C9OA 2ZAOA 4H9HA 3U61A 1JTNA 4D9ZA 1V34A 2DAIA 4WO9A 1L49A 4CHXA 3KOYE 214LA 3HX3A 1G0KA 4ETBA 3VDPA 4H8XA 8LYZA 1YE9A 260LA 4NGKA 5ILCA 4RF0A 2O79A 1WGLA 4MM3B 3F6ZA 4DUYM 5IT9S 4GCBA 1ZMYL 1NWGA 2JNHA 3L64A 1IC4Y 1IN5A 1C6DA 2Y0QA 183LA 1DGHA 1XGUC 4B3SM 2HKJA 1GLNA 1LZBA 3KFUG 2CHGA 1L77A 1L80A 4HPIA 4LJ6A 3CSZA 1JISA 1L64A 3CB7A 2OPFA 1L10A 4EKSA 5LAGA 180LA 3AB6A 1E9SA 1P2RA 2BQBA 1LJGA 2LVNC 4LRTA 1LZ5A 4WM2A 3PNVA 2D4KA 3B74A 1ZVYB 3ATOA 3TPZA 3SB9A 2H5ZA 162LA 3VKGA 2MEIA 1DYDA 220LA 5IDDA 1L14A 119LA 1F6RA 4N1EI 1VDPA 4TWSA 5APCA 1L25A 1XJUA 2ZM6M 1L74A 1LPIA 3T15A 3JR4A 1C10A 2QHOB 2GNOA 4J7VA 1L16A 4DD9A 1OJLA 1LYOA 2A7DA 3WPJA 3QNGA 1L02A 1LZ4A 1WHCA 3IG8A 1G7LC 2Q0MX 1IP1A 2B70A 3B7NA 3LW5F 1HHLA 3GLHA 1WTMA 3KSXA 1QSAA 181LA 1IP7A 1GB7A 5LA8A 3GXRA 3W6DA 5B59A 1JJ3A 1G3IA 1CV0A 2CDSA 1QZMA 4NGWA 2JZ0A 1QT8A 3C83A 3EXDA 1LJEA 240LA 4GH9A 2Z2FA 2QCUA 3CQLA 3HDEA 1GFUA 3PFIA 1CU2A 4GC9A 3HDFA 4RF1A 1IP6A 3DMVA 3RT5X 4OOTA 5EJCA 2MH8A 1IVMA 2F4GA 4C3WA 6LYZA 2QB0B 4ARLA 1RFPA 4AKIA 4I8OA 2LVAA 1J09A 3B7ZA 5JI2E 5E6JA 2CV2A 1KXXA 2RGHA 1GO5A 2K6BA 1QTVA 3SFZA 2IGCA 1BB7A 1WR1B 3ODUA 3K8ZA 3LVVA 5KY1A 1P3NA 2YBLA 2LHCA 4MGIE 2F5NA 4KL7A 1OAOC 1HEWA 5LA5A 1OWYA 2YBJA 1C63A 2R45A 2FYCA 1L8QA 3SARA 2G8LA 1IC7Y 3GUJA 4IJEA 2YBMA 1DYFA 3HJQA 3HH3A 5LIOA 3QYEA 3AOEC 2F4VM 4AKGA 1C6EA 3SP3A 4JI6M 1AM7A 2APLA 1Z59A 1NNUC 1IWYA 1QQWA 3M7GA 1DGHB 1CNSA 2N5ZA 1OQYA 1L71A 4FD2A 3E3DA 5EP1A 1IOSA 5FLXS 5HQ1A 4G4QA 5FHWA 4NWEA 1ZV5L 5KXLA 1GPQC 1QS9A 2KW0A 165LA 3HUQA 1L20A 130LA 4LJ8A 2UU9M 2YSSC 3SBBC 4MGKE 1BVSA 5D5FA 1JQUA 2BQLA 5LMUM 3FUWA 1GBYA 3DOAA 3GXKA 5HLLA 1PRBA 2O7AA 2O25A 2J5YA 4QDNA 235LA 2WSFF 1B7LA 1XEKA 209LA 1OVJA 3B72A 2UXDM 1L67A 2Y8PA 5DM9A 4MCKA 4YX7C 1NVMA 2L2DA 1UBZA 1LSZA 1KNIA 2HAKA 3J81S 1WQNA 3GLHB 2BAAA 4CGYB 1IN7A 4ZIXA 1L66A 150LA 1LWGA 2RAYX 2MEFA 1UIHA 3B0OA 4W52A 3K9OA 1LGUA 4ARJA 1NKHA 1L15A 2F47A 1GE0A 4B3RM 1L85A 4L16A 3W0LB 2P5TA 1ZURA 1LYZA 1HC0A 2Z4SA 3B9PA 3GLGB 1L96A 1JTOL 3TXDA 5FSWA 1NF5A 3MHVC 1UIDA 5FTNA 3NY9A 1Z5BA 3TXKA 5LVKA 1PQIA 1L62A 3JR6A 4LJ7A 190LA 2F32A 3GRRA 5EP4A 4WM1A 1OUEA 5LYZA 3HWLA 4Z3MA 4L4UA 199LA 4JV5M 187LA 4NGLA 5K7OA 1OV7A 1QTHA 217LA 4U3XB 1C61A 1G71A 4I7QA 1BWJA 1UM8A 2CE7A 1MELL 5HNCA 4EXMA 1Z55A 5L3HA 2DHRA 1H87A 151LA 4YOPA 4M6DA 1D3MA 4NC6A 4LYZA 4OX9M 1GKIA 3AGHA 3HT8A 3SHGB 3FE0A 1LHJA 4FCVA 1CX6A 2XQOA 3A3RX 4PJ2C 3AZ4A 1GBZA 189LA 3SYKA 1L84A 4LT1A 1Y8GA 3TMVA 2XFTA 173LA 4HJYA 1OUHA 1HMLA 1KW7A 4DC4A 3GUKA 3K9PA 4NOOB 2X4AA 4XN6A 5I53A 2Q2EB 1OVHA 2D7HA 2X49A 3TMWA 1T3PA 4OWAA 2F5SA 5F16A 175LA 1B5UA 7CATA 1QANA 3A8ZA 2DQCY 2F5PA 1B2KA 5H37D 2G5GX 2XSZA 4PDGA 1DYCA 4GRIA 2D6BA 4FDYA 154LA 4JI1M 5M1YA 4XGIA 3HY5A 4KHPM 2HU1A 1G41A 1GF8A 1LHLA 4QGZA 1JKDA 1P7SA 3C8QA 3TXBA 1VEKA 167LA 2OEAX 2LHGA 1IXSA 3VK7A 3P4ZA 3MGWA 1LSNA 5EXTA 2Z39A 1L29A 1LZ6A 1C64A 4LZMA 1IBLM 1QZEA 4H91A 5E26A 4DR2M 3W68A 2XFSA 1EIJA 1CV5A 2NTGA 4NWHA 1REZA 1T8FA 2RGOA 4J0LA 4CISA 1HR0M 146LA 1SWZA 2ZNXY 4B3MM 1HT2E 3CDOA 1NSFA 1WQQA 2DQEY 2O01F 4WM6A 197LA 3ATNA 1GEVA 3GQ4A 4B7GA 1HT1E 2E5LM 1SSWA 4IAPA 1DQJC 1QQYA 2RBPA 4LJ5A 2QQ8A 2A7FA 2DQGY 2CV0A 3RGSA 1PGYA 3ZC7B 1JWRA 4LGKA 2K47A 2NWDX 2BQCA 1L47A 1G0JA 3HTBA 3A90A 1G4AE 3WUAA 1KY1A 1VFBC 2MEDA 4LT2A 4JXJA 3RFWA 1KSFX 5L3IA 1BB5A 4NGZA 1LSEA 1HELA 4NSGA 1RI8B 2BLXA 4GLVA 4ZPUA 2NTHA 4GCEA 1HFXA 1B5ZA 249LA 3W6EA 5II3A 3FRHA 2B74A 5A3ZA 144LA 2MEAA 2BQFA 2B6XA 1REMA 2OE7X 3WU9A 1G7IC 1T6HA 4DYGA 1C6AA 2WSEF 3GLFE 4I7TA 4IJFA 1L28A 5HMVA 1XNQM 1L58A 1GBWA 4YENA 2KHHA 3LYTA 1JB0F 1C6GA 3AZ5A 1YANA 1HSXA 1L42A 2BJVA 3H4MA 4W94A 4R71A 3IWRA 3IJUA 3TWKA 1DI5A 4YM8A 1IY1A 1CUKA 4FWDA 1C6FA 4HTKA 4WLDA 2BNKA 4BBAA 5KPRA 111LA 1DXJA 1IP3A 3LHMA 2RBSA 1C67A 3HU9A 192LA 4J1AA 2ANXA 3LQQA 4G4NA 158LA 182LA 1SQ2L 3CDVA 1CV6A 3LZMA 2FBBA 2OTZX 3C81A 4B7FA 1VEGA 1L63A 1B7SA 1LJ4A 2YR0A 3U6OA 4GHAA 2DAMA 231LA 3W6AA 1I1ZA 2XH9A 1LYGA 2LZ2A 5KXXA 4UWUA 4N9RA 1YKYX 1GHLA 4IBFA 1LMAA 212LA 1IXSB 4IASA 208LA 1BVXA 5DYGA 4S0WA 1NBZC 3VWOA 1LI6A 2HEEA 148LE 4OW0A 3C7YA 2DZNB 3HUKA 1QT5A 1L1ZA 3CDTA 4TX7A 5KXPA 1I94M 3K2RA 2B72A 147LA 2YDGA 1LYJA 1JSEA 3JAMS 1A2YC 4DWXA 3FTEA 129LA 3TMXA 1LZ1A 3I01M 1JQJC 1SXJE 1PJSA 3IG5A 1CV1A 3FD9A 161LA 5ITXA 157LA 3FKEA 1G0PA 4DT3A 3NBIA 1C7YA 1LJ3A 3D3DA 4GN3A 1W6ZA 1L2CA 4OOOA 1D3FA 3HHZA 4B1AA 1FKQA 1L91A 170LA 1D9WA 1EFUB 1GB9A 4XYYA 1L61A 1JHLA 1GJTA 1OFIA 3DMXA 2W82A 3RGPA 159LA 2YBHA 3E21A 4I7RA 2YVBA 2MGWA 4JI0M 5FTJA 1P64A 3Q8XA 1YKZX 1ZQ9A 2LVOC 2OOBA 1LJIA 3RE8A 4P17A 3BKHA 4K0KM 4PJZA 1PQJA 3WMKA 1EQ5A 1SG9A 5ITYA 1OIPA 1LHIA 2A4TA 232LA 5FTMA 2ZBKB 3C8SA 1GB8A 4W54A 1G07A 1L73A 2I7NA 1KXYA 4LJ9A 2ANVA 2HECA 4OW1A 1R2ZA 3GPYA 4LDLA 1SXJC 4H8ZA 2LHMA 1J1XY 1HQYE 3HT7A 1C62A 4AZFA 5ITTA 4GCFA 1N4FA 2HHHM 4WLTA 4X64M 4EJ4A 3D9AC 1L43A 3W6BA 3GQ3A 4EPFA 4UWVA 4BLCA 4PD2A 4NRWA 1L52A 1QTDA 1K3WA 1HEQA 1QT4A 1DKKA 4CIZA 1LYIA 2I26L 123LA 1FN5A 2ZYCA 4NY5A 3FE3A 2EKKA 1CKFA 3HKPA 1L12A 3HHWA 1NQIA 1OUIA 4CJ6A 2R46A 4QNRA 1A4VA 4LF6M 4M9ZA 3TE6A 1YIKA 2HEDA 2MEGA 131LA 1G7JC 2RSCA 3IHPA 243LA 2LCBA 2M5ZA 3UZUA 1KFVA 2JWSA 5EP2A 5T3FA 1B7QA 1TCYA 4GIPA 3HBDA 1DZBX 2XJWA 3DN3A 5BR8M 2BWBA 4NFVA 1L87A 1MU5A 2LVQD 3KAMA 4A7DA 4ARMA 4DR4M 2W1YA 1LKSA 4ET8A 1YROA 5KQ8A 1L94A 223LA 3U6QA 3CF0A 3THGA 1LZNA 4NGIA 1AT5A 2HUKA 1B7NA 5KXMA 3AW6A 5FSTA 238LA 4DD0A 1KW5A 211LA 3DN1A 3GLIA 2FS1A 1C43A 1WGNA 251LA 4NG1A 1IWWA 2X0AA 3OTOM 3HTGA 4HL4A 3LCUA 3ZCBB 1KIRC 1B7RA 3HFMY 3SBJA 3FUVA 4DD7A 1GJSA 135LA 4IBDA 5EBHA 4DBGB 2WSCF 3M3UA 4QEQA 4TUWA 1OVKA 3LYZA 3MJ5A 4Z8XA 1LZYA 3HTDA 1UIEA 132LA 4LZJA 2DQIY 252LA 1L00A 5B1GA 3N9EA 1DYAA 3QAUA 215LA 3EMSA 1D0KA 1LTMA 1BB4A 2OTYX 1JR3E 1WXQA 1IY0A 153LA 3HZJA 1L26A 1GB5A 205LA 258LA 4DD1A 2LWXA 1G0MA 185LA 2YFQA 3HJ8A 2LZMA 1C6IA 3V2YA 227LA 4LFAM 1NHWC 2JY8A 4M9SA 1L0JA 3L26A 3A94A 3C58A 4IBBA 2EPEA 4K5YA 1L79A 1WIVA 3LZTA 1VDLA 4KT0F 1IWVA 3AGIA 5I4WA 3KS8A 1Q02A 1NV8A 3WVXA 1J1OY 4NSOB 1L17A 1OQMA 2RBQA 2L78A 2ZILA 1GF3A 1L72A 3C7ZA 4D80A 1GB6A 1WQOA 1XXHE 247LA 2QARC 2ZNWY 1PJQA 1R2YA 138LA 5LMNM 1UUZC 1L54A 1YSYA 2JY6B 4LJAA 1NMMA 3GLGE 5KKJA 4ARMB 1CU0A 4H9FA 4LGYA 1L38A 2GQFA 3WXUA 1G59A 2O4WA 241LA 5LYMA 2D7EA 4LF5M 4OWBA 3I04M 2PC2A 1PZYA 1BVKC 4KLNA 1LOZA 4I7LA 3SAVA 3ZEKA 5F81A 3K1JA 1N32M 3GLIB 4M9XA 4NSIA 5I4YA 1OIZA 102LA 5IWAM 1REYA 4KXIA 1CKCA 1DYBA 4IBIA 2DWNA 2C8PA 4DDAA 2DWLA 4G6ZA 3GUOA 2Z37A 2CEAA 1IIZA 4PGJB 1ZMWA 2Z38A 1PJTA 2BLYA 4NSJA 4N5RA 246LA 2ZIKA 2CFOA 3OE9A 2LTUA 172LA 1IWXA 1LPYA 3MMPA 1YAQA 2C8OA 194LA 1LZDA 1L98A 1REXA 3U61B 3GQ5A 1L24A 1N33M 2I7PA 4ETAA 1IXRC 1MX0A 3SN6R 1DO0A 2B75A 113LA 1C46A 1L05A 5F3WA 4EKPA 4ANRA 4I7OA 1C6NA 1DGGA 3U6CA 2HWJA 5C1BA 1WTNA 4FJRA 4H9IA 1QUOA 1G7MC 1L32A 2BQGA 3KOWE 4IJ4A 2BQIA 2BQKA 3FI5A 4W55A 4FW9A 2FH0A 3FTDA 4I7MA 1QDRA 4WURA 1IORA 1IWZA 1HJPA 4LFBM 2RAZX 3SATA 4EIWA 1JKAA 1P36A 207LA 1L59A 1L40A 4WP2A 1PQOA 1HEPA 4XJBA 1LSCA 1QUGA 3LCVB 4LZTA 3KSJA 1CJ6A 2O5RA 1JJ1A 4KO8A 3HHXA 1G1WA 1GBSA 2I25L 3LN2A 4D82A 3GP1A 3V76A 1DGFA 4MGHA 1Q3BA 1L82A 3WXTA 4I7JA 2VF7A 1QAQA 4FCTA 164LA 5LINA 4W5WA 4HTNA 1HENA 2Y21A 3WW5A 3VLFB 4GBRB 4MSTA 2FOIC 3W6FA 2LXEA 108LA 1LJKA 1VG5A 1QTBA 1WTHA 4C5FA 141LA 2XEPA 1HNXM 186LA 2EA0A 2G4NA 4JI3M 2R4JA 1XEIA 3DA1A 5ITUA 4CJ2A 3HHYA 1GAYA 4WMGA 3TXEA 5F9UA 1FNNA 3J27B 1VEDA 1XNRM 1QS5A 5ILFA 3RNXA 1L53A 4AG5A 4IBEA 4ITQA 1C65A 1LZGA 1UICA 2DKVA 1B5YA 4M0WA 1SSYA 3AJIB 4NSHA 1IBMM 4LJ4A 1ALCA 3GRYA 1AKIA 1P2CC 1N77A 4REZA 5FDJA 3QWLA 1IOTA 1EL1A 5F14A 3GUMA 3PXGA 1R4GA 1JKCA 2R62A 4LG2A 1OAIA 2OU0X 4JI2M 2IFFY 1LI3A 4BAFA 1DI4A 1JJ0A 1H6UA 1KYIA 3TXIA 1XMOM 4N1CC 1W08A 4GKJM 2WZJA 2JA2A 2HEBA 4DR6M 118LA 2C96A 254LA 1L86A 2QBYA 3U6DA 2Y20A 1L08A 2R44A 4OVZA 3OJPA 4RW1A 2J7OA 2W1LA 3PVSA 4D81A 4YHHM 1NJGA 1ZV1A 1G7HC 1IWUA 109LA 4W57A 4BS7A 2QZ4A 1L97A 1LV7A 4PT5A 1LYHA 4M4OA 3T38A 1R5LA 1BQLY 5KXTA 206LA 3FYDA 4B7HA 4DV1M 1BGIA 3WULA 5FTLA 1D6QA 1OUBA 1GB0A 4HV2A 152LA 134LA 1LZAA 3MK6A 1G8PA 1C6LA 1GL6A 1L88A 3C3EA 1OTRA 1L1TA 3PDSA 5I14A 1Q3CA 1TBYA 3U5ZA 1GE1A 1JTTL 2HUMA 4GRVA 1J5EM 1YQVY 4DD3A 1GD6A 3DMZA 4NL4H 1GFVA 1L46A 1RE2A 4PRUA 4NGJA 1CKGA 5HMJA 3HH6A
chains in the Genus database with same CATH topology
168LA 1GDXA 4LYMA 4LT0A 1L41A 2MEHA 198LA 4TUNA 1TDYA 1CU6A 3CSQA 5E9RA 1B6IA 3P65A 3J4GA 2B6TA 1YAMA 1IP2A 5DN4A 4E97A 1C68A 1LZTA 2F30A 1QSQA 3TXFA 1FLYA 3HBEX 2Z6BA 2Q9EA 1LGXA 1UC0A 4BAPA 1TEWA 1LZEA 4WG1A 1IEEA 155LA 2MEEA 1OUFA 3RZ4A 2BQDA 1RJCB 2AUBA 177LA 1LAAA 255LA 4AXTA 1PS5A 5KJ9A 3WH1A 4OO9A 3CT5A 3DN8A 4R0FA 4HJZA 4RLMA 3HU8A 1BWIA 3A96A 236LA 1BB6A 2BPUA 1XGQC 248LA 200LA 3DKEX 1L01A 1XSFA 1L90A 4I7SA 4LT3A 3N9CA 3G3WA 163LA 1LMNA 1YL1X 2Z19A 1GFJA 3TXHA 1QT7A 4AQNA 2DQAA 4CFOA 3AZ7A 2DQHY 4NEBA 1EPYA 3NY8A 3P64A 2BQHA 1L57A 3CDRA 1GF0A 4E3UA 4Z46A 4GCCA 1G0LA 2GV0A 1L31A 218LA 1CV4A 1GXXA 4LYBA 1UIGA 4H9BA 3TXJA 1CKHA 3WPKA 3HBHA 5KKIA 4GCDA 1PQKA 1L21A 1BHZA 3DN0A 1D2WA 1SX7A 1QTEA 5L9JA 253LA 1ZYTA 1NDMC 2BQMA 1L13A 5KXOA 1DKJA 1UACY 2WARA 4B0DA 3A3QA 1H6MA 4H9AA 2RBOA 5APDA 4XJFA 4WO6A 4W51A 4GN4A 9LYZA 1CUPA 1HSWA 5KXYA 1L92A 3AJNA 256LA 3PBLA 3WVYA 4B49A 5KXZA 1F6SA 1GFHA 1WQRA 1OV5A 4NGYA 4WM5A 1LJFA 1O23A 3FADA 2W1XA 1QSWA 4WOAA 4N8ZA 4G49A 1XEJA 3DN4A 2CUUA 1OUAA 2OU9A 4J1BA 1DYEA 1JIYA 188LA 1OYUA 3RW8A 3W6CA 3G3VA 1SLYA 5AMYA 1GFEA 234LA 2FYDA 1VAUA 1YAOA 1XGRC 1WQMA 149LA 4H92A 3CDQA 4DQ5A 2DQDY 1LMOA 4EMNA 4H9CA 5B05A 1LSFA 3G3XA 5A3EA 1CTWA 195LA 3RUNA 226LA 3B0IA 4NG8A 156LA 2BQJA 127LA 3HUAA 1D6PA 1C45A 1LJJA 2B6ZA 2YBIA 1VDTA 4G4CA 1GFTA 210LA 2Z18A 1XJTA 1I56A 5LVHA 261LA 1LW9A 5DN5A 196LA 1GFGA 1G0QA 1HERA 1D9UA 1B5WA 1GF9A 1L60A 1JTMA 2DQJY 3NYAA 1B9OA 4L41A 4Z41A 1LZ8A 4H1PA 1CU3A 1V7SA 1DPWA 3TMUA 1HEMA 1QDTA 1LLHA 4ET9A 1IP5A 2HULA 1L19A 3WUNA 3GUPA 2G4PA 5D5CA 1IY4A 1GFRA 4G4HA 2EQLA 3WUMA 4HPEA 6LYTA 1L39A 2FBDA 4CFPA 1QT3A 3ZVQA 5I5QA 4ETDA 4ML7A 1OUCA 4HTQA 4NIJA 1KIQC 1L99A 219LA 4H93A 4RDSA 1LSDA 2BQNA 3F9LA 2DBTA 3QE8A 1LYEA 184LA 140LA 1K28A 176LA 3HT6A 4II8A 5I54A 1KY0A 1L93A 5B06A 224LA 1YAPA 1GF4A 5LVGA 3DNAA 4EOFA 1P46A 239LA 2CJLA 1GEZA 1L07A 5APFA 2B5ZA 2MEBA 1OWZA 1HEOA 1D2YA 5KXKA 1LMTA 1L18A 1UIBA 1L34A 2CGIA 4G9SA 1LYDA 1L44A 2Z2EA 4YEOA 1L27A 1JEFA 1LYSA 1KXWA 1P56A 1P6YA 3DN6A 1OUDA 242LA 2Z12A 5KXNA 5I4XA 5IHGA 1DYGA 2OE9X 5J7CA 4I8SA 1L06A 3ULRA 4W59A 2XBRA 4XENA 3C82A 4PHIA 2XBSA 5LYTA 1IO5A 3QAKA 3OE8A 3CT0A 4DD2A 1C6QA 1T97A 229LA 1UA6Y 1PQDA 4DJHA 1GE4A 4XJGA 3WPLA 1L89A 1FDLY 2MECA 3UONA 5FCPA 4LDEA 2IHLA 1L70A 3A93A 4NGVA 1DPXA 4EPIA 3ZVQB 5IELA 2LZTA 1KIPC 2HTXA 2OU8A 5FELA 114LA 1L68A 1IC5Y 4ARPA 1D0LA 1P37A 1L35A 237LA 3M18B 5KXSA 7LZMA 1WQPA 191LA 1NHEA 262LA 5KXRA 4B4JA 4YXCA 122LA 4ARQA 3AGGG 4NHIA 1C6BA 4OWCA 2ZQ3A 4EKRA 3G3BB 1L83A 4TSCA 244LA 1TLAA 1YKXX 3AZ6A 1QTZA 2RB1X 1GAZA 245LA 4HP0A 1GDWA 4BADA 3HH4A 3OE6A 3SB5A 3SBAA 120LA 1L55A 1GB2A 1KS3A 233LA 1L0KA 1VDQA 1LZCA 4W58A 1LMQA 4ZEEA 4I0CA 1B7MA 1L69A 4CGEA 1LHKA 1IX0A 5HNLA 1I6SA 2HUBA 1XFPL 4O34A 171LA 3QY4A 1ZWNA 3DN2A 2YBNA 1HF4A 139LA 1LHHA 2RB0X 1C69A 2W1MA 1LSMA 1WVUA 1IR9A 1L95A 3A67Y 1L56A 7LYZA 4LYOA 3WL2A 169LA 201LA 1LJNA 1NDGC 3J6KA 3FA0A 1QUTA 1L81A 3G3AB 4H90A 142LA 1IP4A 1OP9B 5FEKA 1FLWA 2F4AA 5LVIA 1IR7A 4PRQA 1LSBA 1P5CA 1CU5A 1B5VA 1AZFA 4TTDA 4HJVA 3WW6A 3L2XA 4LYTA 3EMLA 3RZEA 1LJHA 3P66A 1L48A 1C6HA 1T8AA 1CX7A 1IY3A 3EO5A 5DLAA 1L22A 4ARQB 3CT1A 3HTFA 3T36A 1MLCE 166LA 3SB6A 1FLUA 3K3TA 3OK0A 137LA 128LA 1QUHA 1L75A 257LA 2LYMA 2ZQ4A 2RH1A 3EBAB 1I20A 1CVKA 160LA 1INUA 1F10A 1QTKA 4LFXA 2RBRA 112LA 1FKVA 1LGWA 1LKRA 1JTPL 1WVVA 1JITA 216LA 4PPOA 4YF2A 1IOCA 2B6YA 3TXGA 5C6LA 1LSYA 3GULA 1L11A 1LYFA 1L36A 3LYMA 1JSFA 4W96A 221LA 1GF6A 1J1PY 4LDOA 4DDCA 4H94A 4R6CA 1UIAA 2RBNA 4KPMA 1LMPA 1QSBA 4Z98A 1C6CA 1C6TA 1YILA 1G06A 1QIOA 3WYHA 3F8VA 3BKVA 2OE4X 1QTCA 4B4EA 3IJVA 4PK0A 143LA 213LA 3A92A 4NHSA 1UIFA 1F0WA 4WG7A 4TSBA 1JUGA 1LYYA 4OWEA 1LMCA 1P2LA 1C6PA 4WLXA 4DDBA 1SWYA 1HFZA 1LZRA 3GUIA 2LYOA 1L51A 2HU3A 2ZYPA 1D3JA 1L33A 4IATA 4GN5C 1TAYA 3V2WA 1JKBA 2BQAA 1BWHA 1C66A 4LYCA 4AGAA 1L30A 1IOQA 3N9AA 5DL9A 193LA 107LA 228LA 1C7PA 1SX2A 3WU7A 3CSRA 3A34A 1B5XA 4XADA 5E4PA 3A95A 3A91A 2D4IA 5LAFA 4X3BA 2EIZC 1EQ4A 4ETCA 4G4BA 1L50A 3C80A 4ZFPA 1L65A 259LA 1LSGA 1C08C 1G0GA 2VB1A 4WL6A 230LA 1IR8A 2LYZA 2D91A 1XGTC 1FBIX 3LYOA 1GFKA 5LVJA 4QY9A 178LA 3GUNA 5C6JA 222LA 110LA 3RU5A 3WU8A 3C8RA 2EKSC 2D4JA 1C60A 4XJHA 1RCMA 4RLNA 1B7PA 1LWKA 1DI3A 1L09A 3A6BY 3AW7A 1LHMA 3P68A 125LA 2LC9A 2F2NA 4WLYA 1VDSA 3SB8A 4GLAA 1AT6A 1L37A 4MR1A 4XJIA 2ZIJA 4P2EA 4WM4A 104LA 4YXAC 3VW7A 3LZ2A 4DQ7A 133LA 3OE0A 1QUSA 5C6IA 250LA 2DQFC 3W3EA 1JPOA 1PQMA 1BB3A 2CWIA 1L76A 1XEPA 5F9XA 2ZWBA 4NHQA 1GE3A 4XJDA 2BQOA 1FLQA 145LA 4H8YA 1GB3A 1HFYA 225LA 1LZ9A 2G4QA 1V7TA 2RB2X 4RW2A 3B0KA 1GF7A 4HV1A 2H9JA 2I6ZA 5LZMA 3A6CY 4OWHA 2H9KA 1L45A 4WL7A 4DAJA 1UCOA 1OUJA 1HNLA 2B7XA 3FI7A 1VATA 1LI2A 1YL0X 5JENB 1GBXA 1LSAA 2HEAA 1D0MA 1CUQA 4DKLA 1ZVHL 6LZMA 1CJ7A 1LSPA 126LA 2Q9DA 1GXV2 4KT3A 4YEMA 1GFAA 1NBYC 115LA 1C6MA 4LFPA 4NHTA 1T6VL 4W56A 2HEFA 1D3NA 1B7OA 4DQJA 1G1VA 3SB7A 1E8LA 1LCNA 4I7NA 3HH5A 1GF5A 1L23A 2B73A 4NHPA 1C6JA 4W53A 3HT9A 1CV3A 1QT6A 5APEA 4NGOA 4B4IA 1IWTA 1EQEA 1GE2A 1OUGA 4ETEA 3C7WA 1QUDA 1CJ8A 1B0DA 2XTHA 103LA 4WM3A 1L03A 4H9EA 2B6WA 4I7PA 1L04A 1CKDA 4I7KA 4HSFA 1XGPC 1T8GA 174LA 1CJ9A 5KXWA 1HMKA 4EKQA 1GWDA 1LZSA 3T6UA 2BQEA 4UWNA 2F2QA 4N0JA 3B6LA 5LXWA 3D4SA 1GBOA 1NHBA 5B07A 3AYQA 1C6KA 5B1FA 4H9HA 1JTNA 4D9ZA 4WO9A 1L49A 4CHXA 214LA 1G0KA 4ETBA 4H8XA 8LYZA 260LA 5ILCA 4NGKA 2O79A 3F6ZA 4GCBA 1ZMYL 1NWGA 3L64A 1IC4Y 1C6DA 183LA 1XGUC 1LZBA 1L80A 1L77A 4HPIA 3CSZA 1JISA 1L64A 3CB7A 1L10A 4EKSA 5LAGA 180LA 3AB6A 1P2RA 2BQBA 1LJGA 1LZ5A 4WM2A 2D4KA 1ZVYB 3ATOA 3SB9A 2H5ZA 162LA 2MEIA 1DYDA 220LA 5IDDA 1L14A 119LA 1F6RA 4N1EI 1VDPA 4TWSA 5APCA 1L25A 1XJUA 1LPIA 1L74A 1C10A 4J7VA 1L16A 4DD9A 1LYOA 2A7DA 3WPJA 3QNGA 1L02A 1LZ4A 1G7LC 2Q0MX 1IP1A 2B70A 1HHLA 1WTMA 3W6DA 1QSAA 5LA8A 181LA 1IP7A 1GB7A 5B59A 3GXRA 1JJ3A 1CV0A 2CDSA 4NGWA 3EXDA 1QT8A 3C83A 1LJEA 240LA 2Z2FA 3CQLA 3HDEA 1GFUA 1CU2A 3HDFA 1IP6A 3DMVA 3RT5X 4OOTA 1IVMA 2F4GA 4C3WA 6LYZA 2QB0B 4ARLA 1RFPA 1KXXA 1QTVA 1BB7A 3ODUA 5KY1A 1P3NA 2YBLA 4KL7A 1HEWA 5LA5A 1OWYA 2YBJA 1C63A 2FYCA 1IC7Y 3GUJA 2YBMA 1DYFA 3HH3A 5LIOA 1C6EA 3SP3A 1AM7A 1IWYA 1CNSA 2N5ZA 1L71A 3E3DA 1IOSA 5HQ1A 5FHWA 4NWEA 1ZV5L 5KXLA 1GPQC 1QS9A 165LA 3HUQA 1L20A 130LA 2YSSC 3SBBC 5D5FA 1JQUA 2BQLA 1GBYA 5HLLA 3GXKA 2O7AA 4QDNA 235LA 1B7LA 1XEKA 209LA 1OVJA 3B72A 2Y8PA 1L67A 5DM9A 4MCKA 4YX7C 1UBZA 1LSZA 1KNIA 1WQNA 2BAAA 4ZIXA 1L66A 150LA 1LWGA 2RAYX 2MEFA 1UIHA 3B0OA 4W52A 1LGUA 4ARJA 1NKHA 1L15A 2F47A 1GE0A 1L85A 1ZURA 1LYZA 1HC0A 1L96A 1JTOL 3TXDA 1NF5A 1UIDA 3NY9A 3TXKA 5LVKA 1PQIA 1L62A 3JR6A 2F32A 190LA 4WM1A 1OUEA 5LYZA 3HWLA 4Z3MA 199LA 187LA 4NGLA 5K7OA 1OV7A 1QTHA 217LA 4U3XB 1C61A 4I7QA 1BWJA 1MELL 5HNCA 4EXMA 1Z55A 5L3HA 1H87A 4YOPA 151LA 4M6DA 1D3MA 4LYZA 3AGHA 3HT8A 3FE0A 1LHJA 1CX6A 2XQOA 3A3RX 4PJ2C 3AZ4A 1GBZA 189LA 1L84A 4LT1A 3TMVA 173LA 4HJYA 1OUHA 1HMLA 1KW7A 4DC4A 3GUKA 4XN6A 5I53A 1OVHA 3TMWA 1T3PA 4OWAA 5F16A 175LA 1B5UA 3A8ZA 2DQCY 1B2KA 1DYCA 2D6BA 4FDYA 154LA 5M1YA 2HU1A 1GF8A 1LHLA 4QGZA 1JKDA 1P7SA 3C8QA 3TXBA 167LA 2OEAX 3P4ZA 3MGWA 1LSNA 2Z39A 1L29A 1LZ6A 1C64A 4LZMA 4H91A 1CV5A 2NTGA 4NWHA 1REZA 1T8FA 4J0LA 146LA 1SWZA 2ZNXY 3CDOA 1WQQA 2DQEY 4WM6A 197LA 3ATNA 1GEVA 1SSWA 4IAPA 1DQJC 2RBPA 1QQYA 2A7FA 2DQGY 1JWRA 4LGKA 2NWDX 2BQCA 1L47A 1G0JA 3HTBA 3A90A 3WUAA 1KY1A 1VFBC 2MEDA 4LT2A 5L3IA 1BB5A 4NGZA 1LSEA 1HELA 4NSGA 1RI8B 2BLXA 4GLVA 4ZPUA 2NTHA 4GCEA 1HFXA 1B5ZA 249LA 3W6EA 5II3A 2B74A 5A3ZA 144LA 2MEAA 2BQFA 2B6XA 1REMA 2OE7X 3WU9A 1G7IC 1T6HA 4DYGA 1C6AA 4I7TA 1L28A 5HMVA 1L58A 1GBWA 4YENA 3LYTA 1C6GA 3AZ5A 1YANA 1HSXA 1L42A 4W94A 3IWRA 3IJUA 1DI5A 4YM8A 1C6FA 4HTKA 4WLDA 111LA 1DXJA 3LHMA 1IP3A 2RBSA 1C67A 3HU9A 192LA 4J1AA 2ANXA 158LA 182LA 1SQ2L 3CDVA 1CV6A 3LZMA 2FBBA 2OTZX 3C81A 1L63A 1B7SA 1LJ4A 231LA 3W6AA 1I1ZA 1LYGA 2LZ2A 5KXXA 4UWUA 4N9RA 1YKYX 1GHLA 1LMAA 212LA 4IASA 208LA 1BVXA 4S0WA 1NBZC 3VWOA 1LI6A 2HEEA 148LE 3C7YA 3HUKA 1QT5A 3CDTA 4TX7A 5KXPA 1CKGA 3K2RA 2B72A 147LA 2YDGA 1LYJA 1JSEA 1A2YC 4DWXA 129LA 3TMXA 1LZ1A 161LA 1CV1A 157LA 1G0PA 4DT3A 1LJ3A 3D3DA 4GN3A 1W6ZA 4OOOA 1D3FA 4B1AA 1FKQA 1L91A 170LA 1D9WA 1GB9A 4XYYA 1L61A 1JHLA 3DMXA 159LA 2YBHA 4I7RA 2YVBA 1P64A 1YKZX 1LJIA 3BKHA 4PJZA 1PQJA 3WMKA 1EQ5A 1LHIA 2A4TA 232LA 3C8SA 1GB8A 4W54A 1G07A 1L73A 1KXYA 2ANVA 2HECA 4OW1A 4LDLA 4H8ZA 2LHMA 1J1XY 3HT7A 1C62A 4GCFA 1N4FA 4WLTA 4EJ4A 3D9AC 1L43A 3W6BA 4EPFA 4UWVA 1QTDA 1L52A 1HEQA 1QT4A 1DKKA 1LYIA 2I26L 123LA 1FN5A 2ZYCA 4NY5A 1CKFA 1L12A 1NQIA 1OUIA 1A4VA 1YIKA 2HEDA 2MEGA 131LA 1G7JC 2RSCA 243LA 2LCBA 5T3FA 1B7QA 1TCYA 3HBDA 1DZBX 2XJWA 3DN3A 4NFVA 1L87A 3KAMA 4A7DA 4ARMA 2W1YA 1LKSA 4ET8A 1YROA 1L94A 223LA 1LZNA 4NGIA 1AT5A 2HUKA 1B7NA 5KXMA 3AW6A 5FSTA 238LA 4DD0A 1KW5A 211LA 3DN1A 251LA 4NG1A 1C43A 1IWWA 2X0AA 3HTGA 1KIRC 1B7RA 3HFMY 4DD7A 135LA 5EBHA 3M3UA 4QEQA 1OVKA 3LYZA 1LZYA 3HTDA 1UIEA 132LA 2DQIY 252LA 1L00A 5B1GA 3N9EA 1DYAA 215LA 3EMSA 1D0KA 1LTMA 1BB4A 2OTYX 153LA 1L26A 1GB5A 205LA 258LA 4DD1A 1G0MA 185LA 2LZMA 1C6IA 3V2YA 227LA 1L0JA 3A94A 2EPEA 4K5YA 1L79A 3LZTA 1IWVA 3AGIA 5I4WA 3WVXA 1J1OY 1L17A 1OQMA 2RBQA 2L78A 2ZILA 1GF3A 1L72A 3C7ZA 1GB6A 1WQOA 247LA 2QARC 2ZNWY 138LA 1UUZC 1L54A 1NMMA 5KKJA 4ARMB 1CU0A 4H9FA 1L38A 3WXUA 2O4WA 241LA 5LYMA 4OWBA 2PC2A 1PZYA 1BVKC 4I7LA 1LOZA 3ZEKA 5F81A 4NSIA 5I4YA 102LA 1REYA 4KXIA 1CKCA 1DYBA 2C8PA 4DDAA 3GUOA 2Z37A 1IIZA 4PGJB 2Z38A 2BLYA 4NSJA 4N5RA 246LA 2ZIKA 3OE9A 172LA 1IWXA 1LPYA 1YAQA 2C8OA 194LA 1LZDA 1L98A 1REXA 1L24A 4ETAA 3SN6R 2B75A 113LA 1C46A 1L05A 4EKPA 4ANRA 4I7OA 1C6NA 1WTNA 4FJRA 4H9IA 1QUOA 1G7MC 1L32A 2BQGA 4IJ4A 2BQIA 2BQKA 3FI5A 4W55A 4I7MA 1QDRA 1IORA 1IWZA 2RAZX 1JKAA 1P36A 207LA 1L59A 1L40A 1PQOA 1HEPA 4XJBA 1LSCA 1QUGA 4LZTA 1CJ6A 1JJ1A 1G1WA 1GBSA 2I25L 3LN2A 3WXTA 1L82A 4I7JA 164LA 5LINA 4HTNA 1HENA 3WW5A 4GBRB 4MSTA 3W6FA 108LA 1LJKA 1QTBA 1WTHA 4C5FA 141LA 186LA 2G4NA 1XEIA 4CJ2A 1GAYA 4WMGA 3TXEA 5F9UA 1VEDA 1QS5A 5ILFA 3RNXA 1L53A 1C65A 1LZGA 1UICA 2DKVA 1B5YA 1SSYA 4NSHA 1ALCA 1P2CC 1AKIA 5FDJA 1IOTA 1EL1A 5F14A 3GUMA 1JKCA 2OU0X 2IFFY 1LI3A 4BAFA 1DI4A 1JJ0A 3TXIA 4N1CC 1W08A 2HEBA 118LA 254LA 1L86A 1L08A 3OJPA 4RW1A 2W1LA 1G7HC 1IWUA 109LA 4W57A 4BS7A 1L97A 1LYHA 4M4OA 1BQLY 5KXTA 206LA 1BGIA 3WULA 1D6QA 1OUBA 1GB0A 4HV2A 152LA 134LA 1LZAA 1C6LA 1L88A 3PDSA 5I14A 1TBYA 1GE1A 1JTTL 2HUMA 4GRVA 1YQVY 4DD3A 1GD6A 3DMZA 1GFVA 1L46A 1RE2A 4PRUA 4NGJA 2IGCA 5HMJA 3HH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LZ1 A;  1GB2 A;  1GDX A;  5B07 A;  3AYQ A;  4LYM A;  4LT0 A;  2MEH A;  4TUN A;  5B1F A;  4H9H A;  1VDQ A;  1LZC A;  1TDY A;  3CSQ A;  4DT3 A;  4D9Z A;  4WO9 A;  4CHX A;  5E9R A;  1LJ3 A;  3D3D A;  4GN3 A;  4ETB A;  1W6Z A;  3P65 A;  4H8X A;  4OOO A;  1LMQ A;  8LYZ A;  5ILC A;  3J4G A;  4NGK A;  4ZEE A;  4B1A A;  3F6Z A;  1FKQ A;  4I0C A;  4GCB A;  1YAM A;  1ZMY L;  1NWG A;  1B7M A;  4CGE A;  1GB9 A;  4XYY A;  1LHK A;  1IX0 A;  1IP2 A;  1IC4 Y;  1JHL A;  5HNL A;  5DN4 A;  1LZT A;  1XGU C;  2F30 A;  2HUB A;  1XFP L;  4O34 A;  1LZB A;  3TXF A;  1FLY A;  2YBH A;  3HBE X;  3QY4 A;  4HPI A;  2YVB A;  2YBN A;  1HF4 A;  3CSZ A;  1LHH A;  1JIS A;  1YKZ X;  3CB7 A;  2W1M A;  1LSM A;  1WVU A;  1LJI A;  5LAG A;  3BKH A;  3AB6 A;  1IR9 A;  2BQB A;  1UC0 A;  3A67 Y;  4BAP A;  1TEW A;  3WMK A;  1EQ5 A;  1LZE A;  4WG1 A;  1LJG A;  7LYZ A;  1LHI A;  1IEE A;  1LZ5 A;  4WM2 A;  4LYO A;  3WL2 A;  2D4K A;  1ZVY B;  3ATO A;  1GB8 A;  2H5Z A;  2MEE A;  1OUF A;  1LJN A;  1NDG C;  3RZ4 A;  2MEI A;  1KXY A;  2BQD A;  3J6K A;  1RJC B;  5IDD A;  2AUB A;  2HEC A;  1LAA A;  4OW1 A;  1F6R A;  4AXT A;  1PS5 A;  4N1E I;  4H8Z A;  1QUT A;  1VDP A;  2LHM A;  4TWS A;  3G3A B;  5APC A;  5KJ9 A;  1J1X Y;  3WH1 A;  4H90 A;  3CT5 A;  1LPI A;  4R0F A;  4HJZ A;  1IP4 A;  4RLM A;  1BWI A;  3A96 A;  1C10 A;  1N4F A;  1OP9 B;  4GCF A;  5FEK A;  4WLT A;  4J7V A;  1BB6 A;  2BPU A;  1FLW A;  4DD9 A;  1LYO A;  2A7D A;  2F4A A;  3D9A C;  3QNG A;  3W6B A;  3WPJ A;  1LZ4 A;  5LVI A;  1G7L C;  1XGQ C;  1IR7 A;  4UWV A;  2Q0M X;  4PRQ A;  1IP1 A;  1HEQ A;  1LSB A;  1XSF A;  1HHL A;  1WTM A;  3W6D A;  1DKK A;  1QSA A;  1GB7 A;  1IP7 A;  3N9C A;  4LT3 A;  3GXR A;  5LA8 A;  5B59 A;  1JJ3 A;  1B5V A;  2I26 L;  1FN5 A;  2CDS A;  4NGW A;  1AZF A;  2ZYC A;  4HJV A;  4NY5 A;  4LYT A;  4TTD A;  3WW6 A;  1CKF A;  3EXD A;  1LJH A;  1LJE A;  1LMN A;  1YL1 X;  2Z19 A;  2Z2F A;  3CQL A;  1GFU A;  1NQI A;  1GFJ A;  1OUI A;  3P66 A;  3TXH A;  1A4V A;  1YIK A;  1IP6 A;  2DQA A;  2HED A;  3RT5 X;  4OOT A;  2MEG A;  1G7J C;  4CFO A;  1IVM A;  1IY3 A;  2F4G A;  2RSC A;  3EO5 A;  3AZ7 A;  4C3W A;  6LYZ A;  5DLA A;  2DQH Y;  1RFP A;  4NEB A;  3CT1 A;  3P64 A;  3T36 A;  2BQH A;  5T3F A;  1B7Q A;  1GF0 A;  4E3U A;  1MLC E;  1TCY A;  1KXX A;  4Z46 A;  3HBD A;  4GCC A;  1DZB X;  1FLU A;  3K3T A;  2GV0 A;  3OK0 A;  2XJW A;  4NFV A;  1GXX A;  4LYB A;  1BB7 A;  1UIG A;  3KAM A;  4A7D A;  2W1Y A;  4H9B A;  3TXJ A;  1CKH A;  3WPK A;  1LKS A;  5KY1 A;  2YBL A;  4ET8 A;  1YRO A;  3HBH A;  5KKI A;  4GCD A;  4KL7 A;  1HEW A;  5LA5 A;  2YBJ A;  2LYM A;  1LZN A;  4NGI A;  2FYC A;  1AT5 A;  2ZQ4 A;  1B7N A;  1BHZ A;  3AW6 A;  5KXM A;  5FST A;  3EBA B;  1QTE A;  5L9J A;  1IC7 Y;  1I20 A;  4DD0 A;  2YBM A;  2BQM A;  1NDM C;  1INU A;  1C43 A;  1F10 A;  1QTK A;  4NG1 A;  4LFX A;  1IWW A;  2X0A A;  1FKV A;  5KXO A;  5LIO A;  1DKJ A;  1UAC Y;  1LKR A;  1KIR C;  1JTP L;  2WAR A;  1H6M A;  3A3Q A;  4B0D A;  4H9A A;  1WVV A;  3SP3 A;  1B7R A;  3HFM Y;  1AM7 A;  1JIT A;  1IWY A;  4PPO A;  5APD A;  4DD7 A;  4YF2 A;  4XJF A;  135L A;  1CNS A;  1IOC A;  4WO6 A;  4GN4 A;  2N5Z A;  5EBH A;  5C6L A;  3M3U A;  3TXG A;  4QEQ A;  9LYZ A;  1LSY A;  1HSW A;  5KXY A;  3AJN A;  3LYZ A;  3E3D A;  1LZY A;  3LYM A;  3WVY A;  1JSF A;  5KXZ A;  1IOS A;  1F6S A;  1UIE A;  132L A;  4W96 A;  4B49 A;  5HQ1 A;  1GF6 A;  1GFH A;  1WQR A;  5FHW A;  4NWE A;  2DQI Y;  1J1P Y;  1ZV5 L;  5KXL A;  1GPQ C;  4NGY A;  4WM5 A;  5B1G A;  3N9E A;  1LJF A;  1O23 A;  3EMS A;  4DDC A;  4H94 A;  4R6C A;  2W1X A;  1D0K A;  1LTM A;  1BB4 A;  1UIA A;  2YSS C;  4KPM A;  1LMP A;  5D5F A;  4Z98 A;  2BQL A;  1QSW A;  153L A;  1GB5 A;  1GBY A;  5HLL A;  3GXK A;  1YIL A;  1QIO A;  4N8Z A;  4WOA A;  4QDN A;  4G49 A;  1XEJ A;  3WYH A;  4DD1 A;  3BKV A;  1B7L A;  1XEK A;  4B4E A;  3B72 A;  2Y8P A;  5DM9 A;  4MCK A;  3IJV A;  1UBZ A;  1LSZ A;  3A94 A;  2EPE A;  1OUA A;  4J1B A;  3A92 A;  1JIY A;  4NHS A;  1WQN A;  2BAA A;  3LZT A;  3RW8 A;  1UIF A;  3W6C A;  1F0W A;  1IWV A;  4WG7 A;  4TSB A;  1SLY A;  4ZIX A;  5AMY A;  2MEF A;  1UIH A;  1JUG A;  3AGI A;  1LYY A;  3B0O A;  5I4W A;  1GFE A;  4OWE A;  2FYD A;  3WVX A;  1LMC A;  1J1O Y;  1NKH A;  1VAU A;  1GE0 A;  4WLX A;  4DDB A;  1YAO A;  1OQM A;  1XGR C;  1HFZ A;  1WQM A;  1LZR A;  2ZIL A;  1GF3 A;  1LYZ A;  1HC0 A;  4H92 A;  2DQD Y;  1LMO A;  2LYO A;  4EMN A;  2HU3 A;  4H9C A;  1GB6 A;  1WQO A;  1JTO L;  2ZYP A;  5B05 A;  3TXD A;  1NF5 A;  1LSF A;  5A3E A;  1UID A;  4IAT A;  4GN5 C;  1TAY A;  3TXK A;  3B0I A;  5LVK A;  2ZNW Y;  1JKB A;  1UUZ C;  2BQA A;  4NG8 A;  1BWH A;  1NMM A;  5KKJ A;  2BQJ A;  4LYC A;  4AGA A;  4WM1 A;  1OUE A;  5LYZ A;  4H9F A;  1D6P A;  4Z3M A;  1IOQ A;  3N9A A;  4NGL A;  193L A;  5DL9 A;  3WXU A;  1C45 A;  5LYM A;  1C7P A;  1LJJ A;  5K7O A;  5KXK A;  4OWB A;  2YBI A;  3WU7 A;  2PC2 A;  1VDT A;  4G4C A;  1PZY A;  1BVK C;  3CSR A;  4U3X B;  1LOZ A;  3A34 A;  1B5X A;  4XAD A;  1BWJ A;  3ZEK A;  5F81 A;  1MEL L;  5E4P A;  1GFT A;  3A95 A;  4NSI A;  5HNC A;  5I4Y A;  1Z55 A;  5L3H A;  1H87 A;  4YOP A;  2Z18 A;  3A91 A;  4M6D A;  1I56 A;  2D4I A;  1REY A;  4KXI A;  1CKC A;  4LYZ A;  5LVH A;  5LAF A;  5DN5 A;  2C8P A;  1GFG A;  4DDA A;  4X3B A;  3AGH A;  2EIZ C;  2Z37 A;  1IIZ A;  1EQ4 A;  4PGJ B;  4ETC A;  1HER A;  1D9U A;  2Z38 A;  2BLY A;  4G4B A;  1B5W A;  1GF9 A;  3FE0 A;  4NSJ A;  1LHJ A;  4ZFP A;  4N5R A;  3A3R X;  2ZIK A;  4PJ2 C;  1LSG A;  3AZ4 A;  1GBZ A;  1IWX A;  3TMX A;  1C08 C;  1YAQ A;  2C8O A;  194L A;  1LZD A;  4LT1 A;  1REX A;  2DQJ Y;  2VB1 A;  4WL6 A;  3TMV A;  1IR8 A;  2LYZ A;  4HJY A;  1B9O A;  4L41 A;  2D91 A;  4ETA A;  1LZ8 A;  1OUH A;  4Z41 A;  1HML A;  4H1P A;  1XGT C;  1FBI X;  3LYO A;  1V7S A;  1DPW A;  1GFK A;  3TMU A;  1HEM A;  4DC4 A;  5LVJ A;  4QY9 A;  4XN6 A;  5I53 A;  1QDT A;  1C46 A;  5C6J A;  4ET9 A;  1IP5 A;  3RU5 A;  4ANR A;  1T3P A;  4OWA A;  5F16 A;  3TMW A;  3WU8 A;  3WUN A;  2EKS C;  1B5U A;  2D4J A;  3A8Z A;  4XJH A;  1RCM A;  2DQC Y;  2G4P A;  5D5C A;  4RLN A;  1B2K A;  1IY4 A;  1GFR A;  1B7P A;  4G4H A;  1WTN A;  2EQL A;  4FJR A;  3WUM A;  1DI3 A;  4H9I A;  3A6B Y;  3AW7 A;  4HPE A;  1G7M C;  1LHM A;  2BQG A;  3P68 A;  6LYT A;  2D6B A;  4IJ4 A;  4FDY A;  154L A;  2F2N A;  2BQI A;  2FBD A;  2BQK A;  4WLY A;  5M1Y A;  1VDS A;  4CFP A;  2HU1 A;  3ZVQ A;  4GLA A;  1GF8 A;  1QDR A;  5I5Q A;  1AT6 A;  1IOR A;  1IWZ A;  4ML7 A;  1LHL A;  4ETD A;  1OUC A;  4QGZ A;  1JKD A;  4HTQ A;  4NIJ A;  1KIQ C;  3TXB A;  1JKA A;  4H93 A;  4RDS A;  4MR1 A;  207L A;  1LSD A;  2BQN A;  4XJI A;  2ZIJ A;  2DBT A;  3QE8 A;  4P2E A;  4WM4 A;  1HEP A;  4XJB A;  3P4Z A;  3MGW A;  1LSN A;  2Z39 A;  1LSC A;  3LZ2 A;  1LZ6 A;  133L A;  4LZT A;  1CJ6 A;  1QUS A;  4H91 A;  5C6I A;  1JJ1 A;  1GBS A;  2I25 L;  2DQF C;  3LN2 A;  4II8 A;  4NWH A;  5I54 A;  1REZ A;  3W3E A;  3WXT A;  1JPO A;  1BB3 A;  4J0L A;  2CWI A;  2ZNX Y;  5B06 A;  1YAP A;  5F9X A;  4HTN A;  2ZWB A;  4NHQ A;  1GE3 A;  1GF4 A;  1HEN A;  1WQQ A;  2DQE Y;  4XJD A;  3WW5 A;  4WM6 A;  2BQO A;  5JEN B;  3ATN A;  1GEV A;  1FLQ A;  5LVG A;  4H8Y A;  4EOF A;  4MST A;  3W6F A;  1LJK A;  2CJL A;  1GB3 A;  1DQJ C;  1GEZ A;  1HFY A;  1QQY A;  1LZ9 A;  2G4Q A;  5APF A;  4C5F A;  2B5Z A;  2MEB A;  2A7F A;  1V7T A;  2DQG Y;  1HEO A;  1JWR A;  2G4N A;  4LGK A;  4RW2 A;  1XEI A;  3B0K A;  2NWD X;  1GF7 A;  4HV1 A;  2BQC A;  2H9J A;  3A90 A;  4CJ2 A;  2I6Z A;  3WUA A;  1GAY A;  3A6C Y;  1LMT A;  2H9K A;  4OWH A;  4WMG A;  3TXE A;  1UIB A;  1VFB C;  2MED A;  2CGI A;  4G9S A;  4LT2 A;  5F9U A;  4WL7 A;  5L3I A;  1BB5 A;  1VED A;  2Z2E A;  1UCO A;  4NGZ A;  4YEO A;  1LSE A;  1HEL A;  4NSG A;  1RI8 B;  1JEF A;  2BLX A;  4GLV A;  1LYS A;  1OUJ A;  1HNL A;  3RNX A;  5ILF A;  1KXW A;  4GCE A;  3FI7 A;  1HFX A;  1LZG A;  1B5Z A;  1OUD A;  1UIC A;  1VAT A;  1B5Y A;  2DKV A;  3W6E A;  5II3 A;  5A3Z A;  4NSH A;  1YL0 X;  2MEA A;  2BQF A;  2Z12 A;  1REM A;  5KXN A;  3WU9 A;  1ALC A;  5I4X A;  1P2C C;  1AKI A;  1G7I C;  1GBX A;  5IHG A;  1LSA A;  2HEA A;  1D0M A;  5J7C A;  4DYG A;  5FDJ A;  1IOT A;  1EL1 A;  4I8S A;  5F14 A;  5HMV A;  1ZVH L;  3ULR A;  1GBW A;  4YEN A;  3LYT A;  1CJ7 A;  1JKC A;  1LSP A;  2XBR A;  3AZ5 A;  5LIN A;  4XEN A;  2IFF Y;  1YAN A;  1HSX A;  4BAF A;  1DI4 A;  1JJ0 A;  4W94 A;  3TXI A;  1GXV 2;  1W08 A;  2XBS A;  3IWR A;  4KT3 A;  3IJU A;  4N1C C;  4PHI A;  1DI5 A;  4YM8 A;  4YEM A;  1GFA A;  1IO5 A;  1NBY C;  5LYT A;  4DD2 A;  3CT0 A;  4HTK A;  4LFP A;  2HEB A;  4NHT A;  4WLD A;  1DXJ A;  1T6V L;  3LHM A;  1IP3 A;  1UA6 Y;  2HEF A;  4J1A A;  1B7O A;  1GE4 A;  1SQ2 L;  4XJG A;  1E8L A;  1LCN A;  2FBB A;  1GF5 A;  3WPL A;  1FDL Y;  2MEC A;  4NHP A;  3OJP A;  5FCP A;  4RW1 A;  1B7S A;  2IHL A;  3A93 A;  1LJ4 A;  2W1L A;  4NGV A;  1DPX A;  3ZVQ B;  5APE A;  3W6A A;  1I1Z A;  4NGO A;  5IEL A;  2LZT A;  1KIP C;  2LZ2 A;  4B4I A;  1G7H C;  5KXX A;  1IWU A;  2HTX A;  4N9R A;  4UWU A;  1IWT A;  1YKY X;  4BS7 A;  1EQE A;  1GHL A;  5FEL A;  1LMA A;  1GE2 A;  1OUG A;  4ETE A;  4M4O A;  1IC5 Y;  208L A;  1D0L A;  4IAS A;  3M18 B;  1CJ8 A;  5KXS A;  1B0D A;  2XTH A;  1WQP A;  1BQL Y;  5KXT A;  1BVX A;  4WM3 A;  1BGI A;  3WUL A;  4H9E A;  1NBZ C;  3VWO A;  1NHE A;  2HEE A;  1D6Q A;  5KXR A;  1OUB A;  4B4J A;  1GB0 A;  1CKD A;  4HV2 A;  3AGG G;  134L A;  1LZA A;  4HSF A;  1XGP C;  4NHI A;  1CJ9 A;  5KXW A;  4TX7 A;  1HMK A;  4OWC A;  2ZQ3 A;  1GWD A;  3G3B B;  1TBY A;  4TSC A;  1GE1 A;  5KXP A;  1JTT L;  1YKX X;  1LZS A;  3AZ6 A;  4NGJ A;  3T6U A;  1YQV Y;  4DD3 A;  2BQE A;  1GAZ A;  1GD6 A;  4UWN A;  4N0J A;  4HP0 A;  2YDG A;  1GDW A;  1GFV A;  1JSE A;  1RE2 A;  3B6L A;  5LXW A;  4PRU A;  4BAD A;  1A2Y C;  4DWX A;  1GBO A;  1CKG A;  5HMJ A; 
#chains in the Genus database with same CATH topology
 2H1R A;  168L A;  1GDX A;  4LYM A;  2DHY A;  1L41 A;  4LT0 A;  2MEH A;  198L A;  4TUN A;  3J80 S;  2CHQ A;  1TDY A;  1CU6 A;  3CSQ A;  5E9R A;  1B6I A;  3P65 A;  1K3X A;  2C5R A;  3J4G A;  2B6T A;  2KZS A;  1IY2 A;  1N78 A;  1YAM A;  4MH0 E;  4NXM M;  1IP2 A;  5DN4 A;  4E97 A;  1C68 A;  1LZT A;  4L78 A;  2F30 A;  1QSQ A;  3TXF A;  1FLY A;  3HBE X;  2VQF M;  2LH0 A;  2Z6B A;  2B3T A;  2Q9E A;  2QPA A;  1LGX A;  3KOX E;  1UC0 A;  3VK8 A;  4BAP A;  3GPU A;  1TEW A;  1LZE A;  4WG1 A;  1IEE A;  155L A;  2MEE A;  1OUF A;  3RZ4 A;  2LVP C;  2BQD A;  1RJC B;  4DR3 M;  2AUB A;  177L A;  3D8B A;  1W5T A;  1LAA A;  1DGB A;  255L A;  4AXT A;  1PS5 A;  1R7R A;  5KJ9 A;  3WH1 A;  4OO9 A;  3CT5 A;  3DN8 A;  4R0F A;  3FUU A;  4HJZ A;  4RLM A;  3HU8 A;  1BWI A;  3A96 A;  2CP8 A;  236L A;  1NY5 A;  2CHV A;  1BB6 A;  2QBY B;  2BPU A;  4OVZ B;  1RU3 A;  3DFZ A;  1XGQ C;  248L A;  200L A;  3DKE X;  1L01 A;  1XSF A;  1L90 A;  4I7S A;  4LT3 A;  2HL7 A;  3N9C A;  3E46 A;  2JY5 A;  5IRE B;  3CGW A;  3G3W A;  2DAG A;  163L A;  1NV9 A;  4LCB A;  3KS4 A;  1LMN A;  1YL1 X;  2DWM A;  2Z19 A;  4QHS A;  3AKZ A;  1GFJ A;  1WJ7 A;  3T1H M;  3TXH A;  2R0I A;  2UUA M;  1QT7 A;  4IBC A;  4AQN A;  2DQA A;  3EIH A;  3CF6 E;  2R6F A;  4CFO A;  2JZ1 A;  2Y0T A;  4R3D A;  2Z8Y M;  3W0F A;  3AZ7 A;  4QNM A;  4LF4 M;  2DQH Y;  4NEB A;  4DV4 M;  1EPY A;  3NY8 A;  3P64 A;  1W5S A;  4LY6 A;  2BQH A;  1L57 A;  2VII A;  3CDR A;  2XF3 A;  1GF0 A;  3GLF A;  4E3U A;  4Z46 A;  4GCC A;  3I4V A;  3U5Z B;  2Z3X A;  1G0L A;  2GV0 A;  4I5S A;  1L31 A;  218L A;  4R7G A;  5ITR A;  1CV4 A;  1GXX A;  4LYB A;  1PJJ A;  3H4J A;  1UIG A;  3E4R A;  4H9B A;  3TXJ A;  4Q7J A;  1CKH A;  3WPK A;  2KZU A;  3HBH A;  5KKI A;  4GCD A;  4GMQ A;  3TWM A;  1Q39 A;  1PQK A;  1TR8 A;  1L21 A;  1BHZ A;  3DN0 A;  1D2W A;  3KXE C;  1SX7 A;  1A5T A;  4GC5 A;  1QTE A;  5L9J A;  253L A;  3UMM A;  4PDI A;  1ZYT A;  1NDM C;  2BQM A;  1L13 A;  2Z4R A;  5KXO A;  1DKJ A;  1UAC Y;  2WAR A;  4B0D A;  3A3Q A;  1H6M A;  4H9A A;  2RBO A;  5DYI A;  5APD A;  3SMS A;  4XJF A;  4WO6 A;  4W51 A;  4GN4 A;  9LYZ A;  1CUP A;  2Z7J A;  1HSW A;  5KXY A;  1L92 A;  1TH4 A;  3AJN A;  256L A;  3PBL A;  2DZL A;  3WVY A;  4B49 A;  1VEJ A;  5KXZ A;  1F6S A;  2F5Q A;  1GFH A;  1WQR A;  1OV5 A;  4XK8 F;  1NNJ A;  4MGZ E;  1ZMV A;  4NGY A;  4WM5 A;  3EIE A;  1LJF A;  1O23 A;  3FAD A;  2CUZ A;  2W1X A;  3QYB A;  4GIT A;  2KRU A;  1QSW A;  4HLQ A;  4LGM A;  4WOA A;  4N8Z A;  2R4E A;  4G49 A;  1XEJ A;  1OFH A;  1XMQ M;  4IBG A;  1T6O A;  3DN4 A;  1IFY A;  2CUU A;  2VF8 A;  1N34 M;  1Z5C A;  4LZZ A;  1OUA A;  2OU9 A;  1SXJ A;  4J1B A;  1DYE A;  2KNA A;  1JIY A;  2KA6 B;  188L A;  1OYU A;  3RW8 A;  3W6C A;  2JUJ A;  3G3V A;  1SLY A;  5AMY A;  4Y28 F;  4JI4 M;  2FFJ A;  1GFE A;  234L A;  2FYD A;  1VAU A;  3FUT A;  1D2N A;  1YAO A;  1XGR C;  1TTE A;  1WQM A;  4L15 A;  3J7A S;  149L A;  4H92 A;  3CDQ A;  4DQ5 A;  2DQD Y;  3KP1 E;  1LMO A;  4EMN A;  4DV0 M;  4H9C A;  5B05 A;  1LSF A;  3G3X A;  5A3E A;  1CTW A;  3UJN A;  3GLF B;  195L A;  226L A;  3RUN A;  3B0I A;  4I4L A;  2J7N A;  4NG8 A;  156L A;  1QVR A;  4II7 A;  2BQJ A;  4F2L A;  127L A;  3HUA A;  1D6P A;  5DFL A;  1C45 A;  1LJJ A;  2B6Z A;  2YBI A;  3W67 A;  1VDT A;  4G4C A;  4F1I A;  1XWI A;  4LFC M;  1GFT A;  4DR5 M;  210L A;  2RKO A;  2L7H A;  1UFZ A;  4QHT A;  2QSF X;  2FNA A;  2Z18 A;  1XJT A;  1I56 A;  5LVH A;  1ORY B;  261L A;  1LW9 A;  5DN5 A;  196L A;  1GFG A;  3WHL A;  1G0Q A;  1IM2 A;  3B89 A;  1SXJ D;  1HER A;  1D9U A;  1TDZ A;  3A46 A;  3A45 A;  1B5W A;  1GF9 A;  4JI5 M;  1L60 A;  1JTM A;  2ZTC A;  4FVM A;  2EKF A;  5EP3 A;  2H5X A;  2DQJ Y;  3NYA A;  1B9O A;  4L41 A;  4Z41 A;  1LZ8 A;  3BOS A;  4H1P A;  1CU3 A;  1V7S A;  3VKH A;  1DPW A;  3TMU A;  1HEM A;  1IXZ A;  3L29 A;  1QDT A;  4JN6 A;  1PM5 A;  1LLH A;  3F92 A;  4ET9 A;  1IP5 A;  2HUL A;  1L19 A;  4P16 A;  3WUN A;  2DZO B;  1T3T A;  3GUP A;  2C9C A;  2G4P A;  5D5C A;  1IY4 A;  1GFR A;  3BXW A;  4G4H A;  2EQL A;  3WUM A;  2D7G A;  2XZF A;  4HPE A;  6LYT A;  1L39 A;  2KNZ A;  3A42 A;  2C99 A;  2FBD A;  2BWE A;  4CFP A;  1QT3 A;  3ZVQ A;  5I5Q A;  4ETD A;  4ML7 A;  1OUC A;  4AW4 A;  2G3Q A;  3VDU A;  1SXJ B;  4X66 M;  1KIQ C;  4HTQ A;  4NIJ A;  3FTC A;  4QOS A;  1L99 A;  219L A;  4H93 A;  4RDS A;  3Q8G A;  1LSD A;  2BQN A;  3F9L A;  2DBT A;  5JI3 E;  3QE8 A;  2DEN A;  3UGJ A;  3KVW A;  2EUC A;  1LYE A;  184L A;  140L A;  3KOZ E;  1K28 A;  176L A;  3L25 A;  3HT6 A;  4II8 A;  1XB2 B;  5I54 A;  1ZMU A;  3U6P A;  1KY0 A;  4M0D A;  1L93 A;  5B06 A;  224L A;  3KW6 A;  1YAP A;  1GF4 A;  3TQS A;  5LVG A;  3DNA A;  1L2B A;  4B08 A;  1P46 A;  4EOF A;  239L A;  2CJL A;  2L7I A;  2OOA A;  1GEZ A;  1L07 A;  5APF A;  2B5Z A;  2MEB A;  2MJ5 B;  1OWZ A;  1HEO A;  1D2Y A;  3GLH E;  4GEW A;  4WW0 A;  1JR3 A;  4AKH A;  3U6E A;  5KXK A;  1LMT A;  1L18 A;  2VQE M;  1UIB A;  1L34 A;  2CGI A;  4G9S A;  1LYD A;  4FWG A;  1L44 A;  2Z2E A;  4YEO A;  1L27 A;  1NHG C;  1JEF A;  2UUC M;  1LYS A;  1KXW A;  1P56 A;  3WHK A;  1P6Y A;  1OUD A;  3DN6 A;  242L A;  1C1K A;  2Z12 A;  5KXN A;  5I4X A;  5IHG A;  3R8F A;  1DYG A;  2OE9 X;  5J7C A;  4I8S A;  3AL0 C;  1L06 A;  3ULR A;  4PCZ A;  4W59 A;  2XBR A;  4XEN A;  3C82 A;  4QOZ C;  1I4W A;  2FE8 A;  4PHI A;  2XBS A;  1F4I A;  5LYT A;  1IO5 A;  1GVN A;  4XBO A;  3TL4 X;  1VDD A;  3CT0 A;  3OE8 A;  3QAK A;  4DD2 A;  1C6Q A;  1TGU A;  3CF2 A;  1T97 A;  2C98 A;  229L A;  1UA6 Y;  1PQD A;  2N35 A;  4DJH A;  5EXP A;  4AQY M;  2QP9 X;  2ZAN A;  1XXH A;  1GE4 A;  4XJG A;  3SC3 A;  4MGY E;  1P3Q Q;  3E9S A;  2UUB M;  3K2L A;  3WPL A;  1L89 A;  1FDL Y;  2MEC A;  3NWL A;  3UON A;  3GLG A;  1N75 A;  3AOE A;  5FCP A;  4LDE A;  2IHL A;  3L27 A;  1L70 A;  3A93 A;  4NGV A;  1DPX A;  4EPI A;  3ZVQ B;  3FRI A;  1JR3 D;  5IEL A;  2LBC A;  2LZT A;  1KIP C;  1GL7 A;  4UN2 B;  2HTX A;  2OU8 A;  1T43 A;  5FEL A;  3B7Q A;  2AHM A;  4AI6 A;  114L A;  1L68 A;  1IC5 Y;  4ARP A;  1D0L A;  1P37 A;  1L35 A;  237L A;  3M18 B;  5KXS A;  7LZM A;  1WQP A;  191L A;  1NHE A;  262L A;  3BBZ A;  5KXR A;  4DV6 M;  4B4J A;  4YXC A;  2NQ8 C;  2ZAM A;  4Z6Y A;  122L A;  3AGG G;  4ARQ A;  3HU2 A;  4NHI A;  3I51 A;  1C6B A;  4OWC A;  2ZQ3 A;  4EKR A;  3G3B B;  3ZH9 B;  1L83 A;  4TSC A;  244L A;  1TLA A;  4X65 M;  1YKX X;  3AZ6 A;  1L2D A;  1QTZ A;  2RB1 X;  1AIP C;  1GAZ A;  245L A;  2YNM D;  1MN3 A;  2A5Y B;  4JI7 M;  4HP0 A;  1GDW A;  4BAD A;  3HH4 A;  3OE6 A;  3SB5 A;  3SBA A;  2UXC M;  120L A;  1L55 A;  3SAU A;  1GB2 A;  2V1C A;  1KS3 A;  3DZD A;  4IBJ A;  4IIW A;  4DUZ M;  2F5O A;  1L0K A;  1VDQ A;  233L A;  2QNJ A;  1Z5A A;  1LZC A;  5BPV A;  1HNW M;  1V33 A;  5GKN A;  4W58 A;  2CRU A;  2R18 A;  2EO2 A;  1LMQ A;  4ZEE A;  4I0C A;  1B7M A;  1L69 A;  4CGE A;  1LHK A;  1IX0 A;  5HNL A;  2KEB A;  4RKU F;  1I6S A;  2HUB A;  1XFP L;  4O34 A;  171L A;  1DV0 A;  1E94 E;  3QY4 A;  1ZWN A;  4IBK A;  3DN2 A;  2YBN A;  1HF4 A;  139L A;  1LHH A;  2RB0 X;  4LF8 M;  1C69 A;  2W1M A;  3U60 A;  1VQ1 A;  1LSM A;  1WVU A;  2DAK A;  1IR9 A;  1L95 A;  3A98 B;  3A67 Y;  1L56 A;  7LYZ A;  4OU7 A;  2XLJ A;  4LYO A;  3WL2 A;  169L A;  4LF9 M;  201L A;  1LJN A;  1NDG C;  3J6K A;  3FA0 A;  4G4R A;  4JI8 M;  1QUT A;  1L81 A;  3G3A B;  2MR9 A;  3GPX A;  4H90 A;  142L A;  3PNY A;  1IP4 A;  3FTF A;  4DR7 M;  1OP9 B;  5FEK A;  3GO8 A;  1XXH B;  4S12 A;  1FLW A;  2XZU A;  2F4A A;  1NO1 A;  3U6L A;  4I81 A;  5LVI A;  1IR7 A;  4PRQ A;  3HWS A;  2DWZ B;  4BB9 A;  1LSB A;  1P5C A;  2ERC A;  1IN8 A;  3SMP A;  3AV0 A;  3SYL A;  1CU5 A;  1PJI A;  1B5V A;  1AZF A;  4TTD A;  4HJV A;  3WW6 A;  3L2X A;  4LYT A;  3EML A;  3RZE A;  1LJH A;  2KDL A;  3P66 A;  1L48 A;  1C6H A;  1T8A A;  1CX7 A;  1IY3 A;  3EO5 A;  3AFH A;  5DLA A;  1L22 A;  4ARQ B;  2JY7 A;  3CT1 A;  3HTF A;  3T36 A;  4LF7 M;  4RNA A;  1MLC E;  2LNH C;  3I4Y A;  166L A;  3SB6 A;  1FLU A;  3K3T A;  3OK0 A;  1MJG M;  137L A;  3HU1 A;  128L A;  4AG6 A;  5KO3 A;  1QUH A;  1L75 A;  3FYC A;  3T6P A;  257L A;  4A3V B;  2LYM A;  2ZQ4 A;  2RH1 A;  3EBA B;  1I20 A;  1CVK A;  160L A;  1INU A;  1F10 A;  1QTK A;  1X37 A;  4LFX A;  2RBR A;  112L A;  1FKV A;  4B3T M;  1LGW A;  1R6B X;  2L4F A;  1XC8 A;  1LKR A;  1JTP L;  1WVV A;  1JIT A;  216L A;  2V6Z M;  4PPO A;  5FTK A;  4YF2 A;  1IOC A;  1Z6T A;  2DXI A;  2B6Y A;  1ZAE A;  3TXG A;  5C6L A;  1LSY A;  1YLA A;  3GUL A;  1L11 A;  1LYF A;  1L36 A;  3LYM A;  3U60 B;  5EXX A;  1JSF A;  4W96 A;  221L A;  1GF6 A;  3LQR A;  1J1P Y;  3GPP A;  4LDO A;  4DDC A;  4H94 A;  3ZQJ A;  4R6C A;  2DKL A;  3AOG A;  1UIA A;  2RBN A;  5IZ7 D;  4KPM A;  1LMP A;  1QSB A;  1E9R A;  4Z98 A;  1C6C A;  1C6T A;  1YIL A;  1G06 A;  4JYA M;  1QIO A;  4G3O A;  3WYH A;  3F8V A;  3BKV A;  2OE4 X;  1QTC A;  4B4E A;  5KPT A;  2DNA A;  3IJV A;  2CV1 A;  4PK0 A;  143L A;  213L A;  3A92 A;  3L2A A;  8CAT A;  4DR1 M;  4NHS A;  1OKS A;  2V1U A;  1UIF A;  4KOD A;  1F0W A;  4WG7 A;  2MRO B;  4TSB A;  1FJG M;  1JUG A;  1LYY A;  3GRV A;  4OWE A;  4G4O A;  1LMC A;  1P2L A;  1HNZ M;  1C6P A;  4WLX A;  4DDB A;  1SWY A;  1HFZ A;  1LZR A;  3GUI A;  3LVW A;  5KQD A;  3LMM A;  2LYO A;  2KXE A;  1L51 A;  2EJS A;  2HU3 A;  2XSZ D;  2ZYP A;  1D3J A;  1L33 A;  4IAT A;  4GN5 C;  5A2Q S;  1TAY A;  3V2W A;  1JKB A;  2BQA A;  1TDH A;  1BWH A;  3SHF A;  1C66 A;  2RRU A;  4LYC A;  1L30 A;  4AGA A;  5L8R F;  5EXS A;  1IOQ A;  3N9A A;  5DL9 A;  193L A;  107L A;  3GRU A;  228L A;  1C7P A;  1SX2 A;  3D8L A;  3WU7 A;  3CSR A;  3A34 A;  1B5X A;  4XAD A;  5E4P A;  3A95 A;  2X8A A;  1QAM A;  3A91 A;  4HEO A;  2VDB B;  2L6O A;  2D4I A;  5LAF A;  2XGN A;  2CWB A;  4X3B A;  2EIZ C;  1EQ4 A;  4ETC A;  4NXN M;  1TH2 A;  3TWL A;  4G4B A;  1L50 A;  3VFD A;  3C80 A;  4ZFP A;  1L65 A;  259L A;  1LSG A;  1C08 C;  1G0G A;  2VB1 A;  4WL6 A;  230L A;  1IR8 A;  2LYZ A;  2D91 A;  1XGT C;  1QYR A;  1FBI X;  3LYO A;  1GFK A;  5LVJ A;  4YY3 M;  4QY9 A;  178L A;  1IBK M;  3GUN A;  5C6J A;  222L A;  5ITX E;  4GHL A;  3IEC A;  110L A;  3RU5 A;  2BJW A;  2R65 A;  2OO9 A;  3FUX A;  3C8R A;  3WU8 A;  2EKS C;  1TF0 B;  1C60 A;  2D4J A;  1AUA A;  4XJH A;  1RCM A;  4RLN A;  2DI0 A;  1B7P A;  1LWK A;  1J7K A;  1DI3 A;  1L09 A;  3A6B Y;  3AW7 A;  1LHM A;  3P68 A;  125L A;  1EE8 A;  2LC9 A;  2F2N A;  4FCW A;  3U6M A;  4WLY A;  3HJS A;  3CTW B;  4L8R C;  1VDS A;  3SB8 A;  2HCB A;  3HGI A;  4GLA A;  1AT6 A;  2OQ4 A;  1HQC A;  1L37 A;  4L6V 6;  4MR1 A;  5KPZ A;  4XJI A;  2L09 A;  2KNV A;  2ZIJ A;  4P2E A;  4WM4 A;  104L A;  4YXA C;  3VW7 A;  4MB7 A;  3LZ2 A;  4DQ7 A;  133L A;  3OE0 A;  1QUS A;  5C6I A;  2K9D A;  3ILK A;  250L A;  2DQF C;  3W3E A;  3L28 A;  4X62 M;  1JPO A;  1PQM A;  1BB3 A;  1IQP A;  2CWI A;  3M0E A;  1L76 A;  1XEP A;  5F9X A;  2ZWB A;  4NHQ A;  1GE3 A;  4XJD A;  3KP0 E;  2BQO A;  1FLQ A;  3J2P B;  145L A;  4H8Y A;  1N36 M;  1GB3 A;  1HFY A;  225L A;  1LZ9 A;  2G4Q A;  1V7T A;  2JP7 A;  2UXB M;  2RB2 X;  4FWH A;  4RW2 A;  3B0K A;  3UK6 A;  1GF7 A;  4HV1 A;  4DV7 M;  2H9J A;  3U6S A;  2I6Z A;  5LZM A;  3A6C Y;  4OWH A;  2H9K A;  1L45 A;  4WL7 A;  4DAJ A;  1E32 A;  1UCO A;  2K0B X;  1GAB A;  1OUJ A;  1HNL A;  2B7X A;  3C3D A;  3FI7 A;  3NBX X;  1VAT A;  3SAS A;  1LI2 A;  1IN4 A;  1YL0 X;  5JEN B;  1GBX A;  1LSA A;  2HEA A;  1D0M A;  1TH3 A;  1CUQ A;  4LRS A;  2DAE A;  4DKL A;  1ZVH L;  3T1Y M;  6LZM A;  1CJ7 A;  1LSP A;  1IN6 A;  126L A;  1V92 A;  2Q9D A;  1GXV 2;  4KT3 A;  2JXN A;  1K82 A;  3R9X B;  3C9P A;  4DV5 M;  4YEM A;  1GFA A;  1NBY C;  3KDS E;  5C18 A;  1XHB A;  4CHT B;  115L A;  1C6M A;  1S3S A;  4LFP A;  4NHT A;  1T6V L;  4W56 A;  5EQT A;  2HEF A;  3GLI E;  5DNY A;  1D3N A;  1B7O A;  4DQJ A;  1G1V A;  3SB7 A;  1E8L A;  1LCN A;  4I7N A;  4DV3 M;  3HH5 A;  1YUB A;  1GF5 A;  1L23 A;  2B73 A;  4NHP A;  3HU3 A;  1C6J A;  4W53 A;  2KRK A;  3HT9 A;  4DV2 M;  2QEN A;  3JR5 A;  1CV3 A;  1QT6 A;  5APE A;  4NGO A;  4B4I A;  5ITQ A;  1IWT A;  1EQE A;  1GE2 A;  1OUG A;  4ETE A;  3C7W A;  1QUD A;  1CJ8 A;  1NJF A;  1B0D A;  2XTH A;  1QAO A;  3J7B A;  3K92 A;  103L A;  4WM3 A;  1L03 A;  4H9E A;  2B6W A;  4I7P A;  2ZTD A;  1L04 A;  1CKD A;  4I7K A;  4HSF A;  1XGP C;  1T8G A;  174L A;  1CJ9 A;  4ZPX A;  5KXW A;  1HMK A;  4EKQ A;  1GWD A;  1DO2 A;  1LZS A;  3M6A A;  2M60 A;  3T6U A;  2BQE A;  4UWN A;  3SAW A;  2F2Q A;  4N0J A;  4NSR A;  4NRV A;  3B6L A;  5LXW A;  3D4S A;  2YQZ A;  1GBO A;  1NHB A;  1NY6 A;  2L4E A;  5B07 A;  3AYQ A;  4GKK M;  2DVW B;  1C6K A;  5B1F A;  2C9O A;  2ZAO A;  4H9H A;  3U61 A;  1JTN A;  4D9Z A;  1V34 A;  2DAI A;  4WO9 A;  1L49 A;  4CHX A;  3KOY E;  214L A;  3HX3 A;  1G0K A;  4ETB A;  3VDP A;  4H8X A;  8LYZ A;  1YE9 A;  260L A;  4NGK A;  5ILC A;  4RF0 A;  2O79 A;  1WGL A;  4MM3 B;  3F6Z A;  4DUY M;  5IT9 S;  4GCB A;  1ZMY L;  1NWG A;  2JNH A;  3L64 A;  1IC4 Y;  1IN5 A;  1C6D A;  2Y0Q A;  183L A;  1DGH A;  1XGU C;  4B3S M;  2HKJ A;  1GLN A;  1LZB A;  3KFU G;  2CHG A;  1L77 A;  1L80 A;  4HPI A;  4LJ6 A;  3CSZ A;  1JIS A;  1L64 A;  3CB7 A;  2OPF A;  1L10 A;  4EKS A;  5LAG A;  180L A;  3AB6 A;  1E9S A;  1P2R A;  2BQB A;  1LJG A;  2LVN C;  4LRT A;  1LZ5 A;  4WM2 A;  3PNV A;  2D4K A;  3B74 A;  1ZVY B;  3ATO A;  3TPZ A;  3SB9 A;  2H5Z A;  162L A;  3VKG A;  2MEI A;  1DYD A;  220L A;  5IDD A;  1L14 A;  119L A;  1F6R A;  4N1E I;  1VDP A;  4TWS A;  5APC A;  1L25 A;  1XJU A;  2ZM6 M;  1L74 A;  1LPI A;  3T15 A;  3JR4 A;  1C10 A;  2QHO B;  2GNO A;  4J7V A;  1L16 A;  4DD9 A;  1OJL A;  1LYO A;  2A7D A;  3WPJ A;  3QNG A;  1L02 A;  1LZ4 A;  1WHC A;  3IG8 A;  1G7L C;  2Q0M X;  1IP1 A;  2B70 A;  3B7N A;  3LW5 F;  1HHL A;  3GLH A;  1WTM A;  3KSX A;  1QSA A;  181L A;  1IP7 A;  1GB7 A;  5LA8 A;  3GXR A;  3W6D A;  5B59 A;  1JJ3 A;  1G3I A;  1CV0 A;  2CDS A;  1QZM A;  4NGW A;  2JZ0 A;  1QT8 A;  3C83 A;  3EXD A;  1LJE A;  240L A;  4GH9 A;  2Z2F A;  2QCU A;  3CQL A;  3HDE A;  1GFU A;  3PFI A;  1CU2 A;  4GC9 A;  3HDF A;  4RF1 A;  1IP6 A;  3DMV A;  3RT5 X;  4OOT A;  5EJC A;  2MH8 A;  1IVM A;  2F4G A;  4C3W A;  6LYZ A;  2QB0 B;  4ARL A;  1RFP A;  4AKI A;  4I8O A;  2LVA A;  1J09 A;  3B7Z A;  5JI2 E;  5E6J A;  2CV2 A;  1KXX A;  2RGH A;  1GO5 A;  2K6B A;  1QTV A;  3SFZ A;  2IGC A;  1BB7 A;  1WR1 B;  3ODU A;  3K8Z A;  3LVV A;  5KY1 A;  1P3N A;  2YBL A;  2LHC A;  4MGI E;  2F5N A;  4KL7 A;  1OAO C;  1HEW A;  5LA5 A;  1OWY A;  2YBJ A;  1C63 A;  2R45 A;  2FYC A;  1L8Q A;  3SAR A;  2G8L A;  1IC7 Y;  3GUJ A;  4IJE A;  2YBM A;  1DYF A;  3HJQ A;  3HH3 A;  5LIO A;  3QYE A;  3AOE C;  2F4V M;  4AKG A;  1C6E A;  3SP3 A;  4JI6 M;  1AM7 A;  2APL A;  1Z59 A;  1NNU C;  1IWY A;  1QQW A;  3M7G A;  1DGH B;  1CNS A;  2N5Z A;  1OQY A;  1L71 A;  4FD2 A;  3E3D A;  5EP1 A;  1IOS A;  5FLX S;  5HQ1 A;  4G4Q A;  5FHW A;  4NWE A;  1ZV5 L;  5KXL A;  1GPQ C;  1QS9 A;  2KW0 A;  165L A;  3HUQ A;  1L20 A;  130L A;  4LJ8 A;  2UU9 M;  2YSS C;  3SBB C;  4MGK E;  1BVS A;  5D5F A;  1JQU A;  2BQL A;  5LMU M;  3FUW A;  1GBY A;  3DOA A;  3GXK A;  5HLL A;  1PRB A;  2O7A A;  2O25 A;  2J5Y A;  4QDN A;  235L A;  2WSF F;  1B7L A;  1XEK A;  209L A;  1OVJ A;  3B72 A;  2UXD M;  1L67 A;  2Y8P A;  5DM9 A;  4MCK A;  4YX7 C;  1NVM A;  2L2D A;  1UBZ A;  1LSZ A;  1KNI A;  2HAK A;  3J81 S;  1WQN A;  3GLH B;  2BAA A;  4CGY B;  1IN7 A;  4ZIX A;  1L66 A;  150L A;  1LWG A;  2RAY X;  2MEF A;  1UIH A;  3B0O A;  4W52 A;  3K9O A;  1LGU A;  4ARJ A;  1NKH A;  1L15 A;  2F47 A;  1GE0 A;  4B3R M;  1L85 A;  4L16 A;  3W0L B;  2P5T A;  1ZUR A;  1LYZ A;  1HC0 A;  2Z4S A;  3B9P A;  3GLG B;  1L96 A;  1JTO L;  3TXD A;  5FSW A;  1NF5 A;  3MHV C;  1UID A;  5FTN A;  3NY9 A;  1Z5B A;  3TXK A;  5LVK A;  1PQI A;  1L62 A;  3JR6 A;  4LJ7 A;  190L A;  2F32 A;  3GRR A;  5EP4 A;  4WM1 A;  1OUE A;  5LYZ A;  3HWL A;  4Z3M A;  4L4U A;  199L A;  4JV5 M;  187L A;  4NGL A;  5K7O A;  1OV7 A;  1QTH A;  217L A;  4U3X B;  1C61 A;  1G71 A;  4I7Q A;  1BWJ A;  1UM8 A;  2CE7 A;  1MEL L;  5HNC A;  4EXM A;  1Z55 A;  5L3H A;  2DHR A;  1H87 A;  151L A;  4YOP A;  4M6D A;  1D3M A;  4NC6 A;  4LYZ A;  4OX9 M;  1GKI A;  3AGH A;  3HT8 A;  3SHG B;  3FE0 A;  1LHJ A;  4FCV A;  1CX6 A;  2XQO A;  3A3R X;  4PJ2 C;  3AZ4 A;  1GBZ A;  189L A;  3SYK A;  1L84 A;  4LT1 A;  1Y8G A;  3TMV A;  2XFT A;  173L A;  4HJY A;  1OUH A;  1HML A;  1KW7 A;  4DC4 A;  3GUK A;  3K9P A;  4NOO B;  2X4A A;  4XN6 A;  5I53 A;  2Q2E B;  1OVH A;  2D7H A;  2X49 A;  3TMW A;  1T3P A;  4OWA A;  2F5S A;  5F16 A;  175L A;  1B5U A;  7CAT A;  1QAN A;  3A8Z A;  2DQC Y;  2F5P A;  1B2K A;  5H37 D;  2G5G X;  2XSZ A;  4PDG A;  1DYC A;  4GRI A;  2D6B A;  4FDY A;  154L A;  4JI1 M;  5M1Y A;  4XGI A;  3HY5 A;  4KHP M;  2HU1 A;  1G41 A;  1GF8 A;  1LHL A;  4QGZ A;  1JKD A;  1P7S A;  3C8Q A;  3TXB A;  1VEK A;  167L A;  2OEA X;  2LHG A;  1IXS A;  3VK7 A;  3P4Z A;  3MGW A;  1LSN A;  5EXT A;  2Z39 A;  1L29 A;  1LZ6 A;  1C64 A;  4LZM A;  1IBL M;  1QZE A;  4H91 A;  5E26 A;  4DR2 M;  3W68 A;  2XFS A;  1EIJ A;  1CV5 A;  2NTG A;  4NWH A;  1REZ A;  1T8F A;  2RGO A;  4J0L A;  4CIS A;  1HR0 M;  146L A;  1SWZ A;  2ZNX Y;  4B3M M;  1HT2 E;  3CDO A;  1NSF A;  1WQQ A;  2DQE Y;  2O01 F;  4WM6 A;  197L A;  3ATN A;  1GEV A;  3GQ4 A;  4B7G A;  1HT1 E;  2E5L M;  1SSW A;  4IAP A;  1DQJ C;  1QQY A;  2RBP A;  4LJ5 A;  2QQ8 A;  2A7F A;  2DQG Y;  2CV0 A;  3RGS A;  1PGY A;  3ZC7 B;  1JWR A;  4LGK A;  2K47 A;  2NWD X;  2BQC A;  1L47 A;  1G0J A;  3HTB A;  3A90 A;  1G4A E;  3WUA A;  1KY1 A;  1VFB C;  2MED A;  4LT2 A;  4JXJ A;  3RFW A;  1KSF X;  5L3I A;  1BB5 A;  4NGZ A;  1LSE A;  1HEL A;  4NSG A;  1RI8 B;  2BLX A;  4GLV A;  4ZPU A;  2NTH A;  4GCE A;  1HFX A;  1B5Z A;  249L A;  3W6E A;  5II3 A;  3FRH A;  2B74 A;  5A3Z A;  144L A;  2MEA A;  2BQF A;  2B6X A;  1REM A;  2OE7 X;  3WU9 A;  1G7I C;  1T6H A;  4DYG A;  1C6A A;  2WSE F;  3GLF E;  4I7T A;  4IJF A;  1L28 A;  5HMV A;  1XNQ M;  1L58 A;  1GBW A;  4YEN A;  2KHH A;  3LYT A;  1JB0 F;  1C6G A;  3AZ5 A;  1YAN A;  1HSX A;  1L42 A;  2BJV A;  3H4M A;  4W94 A;  4R71 A;  3IWR A;  3IJU A;  3TWK A;  1DI5 A;  4YM8 A;  1IY1 A;  1CUK A;  4FWD A;  1C6F A;  4HTK A;  4WLD A;  2BNK A;  4BBA A;  5KPR A;  111L A;  1DXJ A;  1IP3 A;  3LHM A;  2RBS A;  1C67 A;  3HU9 A;  192L A;  4J1A A;  2ANX A;  3LQQ A;  4G4N A;  158L A;  182L A;  1SQ2 L;  3CDV A;  1CV6 A;  3LZM A;  2FBB A;  2OTZ X;  3C81 A;  4B7F A;  1VEG A;  1L63 A;  1B7S A;  1LJ4 A;  2YR0 A;  3U6O A;  4GHA A;  2DAM A;  231L A;  3W6A A;  1I1Z A;  2XH9 A;  1LYG A;  2LZ2 A;  5KXX A;  4UWU A;  4N9R A;  1YKY X;  1GHL A;  4IBF A;  1LMA A;  212L A;  1IXS B;  4IAS A;  208L A;  1BVX A;  5DYG A;  4S0W A;  1NBZ C;  3VWO A;  1LI6 A;  2HEE A;  148L E;  4OW0 A;  3C7Y A;  2DZN B;  3HUK A;  1QT5 A;  1L1Z A;  3CDT A;  4TX7 A;  5KXP A;  1I94 M;  3K2R A;  2B72 A;  147L A;  2YDG A;  1LYJ A;  1JSE A;  3JAM S;  1A2Y C;  4DWX A;  3FTE A;  129L A;  3TMX A;  1LZ1 A;  3I01 M;  1JQJ C;  1SXJ E;  1PJS A;  3IG5 A;  1CV1 A;  3FD9 A;  161L A;  5ITX A;  157L A;  3FKE A;  1G0P A;  4DT3 A;  3NBI A;  1C7Y A;  1LJ3 A;  3D3D A;  4GN3 A;  1W6Z A;  1L2C A;  4OOO A;  1D3F A;  3HHZ A;  4B1A A;  1FKQ A;  1L91 A;  170L A;  1D9W A;  1EFU B;  1GB9 A;  4XYY A;  1L61 A;  1JHL A;  1GJT A;  1OFI A;  3DMX A;  2W82 A;  3RGP A;  159L A;  2YBH A;  3E21 A;  4I7R A;  2YVB A;  2MGW A;  4JI0 M;  5FTJ A;  1P64 A;  3Q8X A;  1YKZ X;  1ZQ9 A;  2LVO C;  2OOB A;  1LJI A;  3RE8 A;  4P17 A;  3BKH A;  4K0K M;  4PJZ A;  1PQJ A;  3WMK A;  1EQ5 A;  1SG9 A;  5ITY A;  1OIP A;  1LHI A;  2A4T A;  232L A;  5FTM A;  2ZBK B;  3C8S A;  1GB8 A;  4W54 A;  1G07 A;  1L73 A;  2I7N A;  1KXY A;  4LJ9 A;  2ANV A;  2HEC A;  4OW1 A;  1R2Z A;  3GPY A;  4LDL A;  1SXJ C;  4H8Z A;  2LHM A;  1J1X Y;  1HQY E;  3HT7 A;  1C62 A;  4AZF A;  5ITT A;  4GCF A;  1N4F A;  2HHH M;  4WLT A;  4X64 M;  4EJ4 A;  3D9A C;  1L43 A;  3W6B A;  3GQ3 A;  4EPF A;  4UWV A;  4BLC A;  4PD2 A;  4NRW A;  1L52 A;  1QTD A;  1K3W A;  1HEQ A;  1QT4 A;  1DKK A;  4CIZ A;  1LYI A;  2I26 L;  123L A;  1FN5 A;  2ZYC A;  4NY5 A;  3FE3 A;  2EKK A;  1CKF A;  3HKP A;  1L12 A;  3HHW A;  1NQI A;  1OUI A;  4CJ6 A;  2R46 A;  4QNR A;  1A4V A;  4LF6 M;  4M9Z A;  3TE6 A;  1YIK A;  2HED A;  2MEG A;  131L A;  1G7J C;  2RSC A;  3IHP A;  243L A;  2LCB A;  2M5Z A;  3UZU A;  1KFV A;  2JWS A;  5EP2 A;  5T3F A;  1B7Q A;  1TCY A;  4GIP A;  3HBD A;  1DZB X;  2XJW A;  3DN3 A;  5BR8 M;  2BWB A;  4NFV A;  1L87 A;  1MU5 A;  2LVQ D;  3KAM A;  4A7D A;  4ARM A;  4DR4 M;  2W1Y A;  1LKS A;  4ET8 A;  1YRO A;  5KQ8 A;  1L94 A;  223L A;  3U6Q A;  3CF0 A;  3THG A;  1LZN A;  4NGI A;  1AT5 A;  2HUK A;  1B7N A;  5KXM A;  3AW6 A;  5FST A;  238L A;  4DD0 A;  1KW5 A;  211L A;  3DN1 A;  3GLI A;  2FS1 A;  1C43 A;  1WGN A;  251L A;  4NG1 A;  1IWW A;  2X0A A;  3OTO M;  3HTG A;  4HL4 A;  3LCU A;  3ZCB B;  1KIR C;  1B7R A;  3HFM Y;  3SBJ A;  3FUV A;  4DD7 A;  1GJS A;  135L A;  4IBD A;  5EBH A;  4DBG B;  2WSC F;  3M3U A;  4QEQ A;  4TUW A;  1OVK A;  3LYZ A;  3MJ5 A;  4Z8X A;  1LZY A;  3HTD A;  1UIE A;  132L A;  4LZJ A;  2DQI Y;  252L A;  1L00 A;  5B1G A;  3N9E A;  1DYA A;  3QAU A;  215L A;  3EMS A;  1D0K A;  1LTM A;  1BB4 A;  2OTY X;  1JR3 E;  1WXQ A;  1IY0 A;  153L A;  3HZJ A;  1L26 A;  1GB5 A;  205L A;  258L A;  4DD1 A;  2LWX A;  1G0M A;  185L A;  2YFQ A;  3HJ8 A;  2LZM A;  1C6I A;  3V2Y A;  227L A;  4LFA M;  1NHW C;  2JY8 A;  4M9S A;  1L0J A;  3L26 A;  3A94 A;  3C58 A;  4IBB A;  2EPE A;  4K5Y A;  1L79 A;  1WIV A;  3LZT A;  1VDL A;  4KT0 F;  1IWV A;  3AGI A;  5I4W A;  3KS8 A;  1Q02 A;  1NV8 A;  3WVX A;  1J1O Y;  4NSO B;  1L17 A;  1OQM A;  2RBQ A;  2L78 A;  2ZIL A;  1GF3 A;  1L72 A;  3C7Z A;  4D80 A;  1GB6 A;  1WQO A;  1XXH E;  247L A;  2QAR C;  2ZNW Y;  1PJQ A;  1R2Y A;  138L A;  5LMN M;  1UUZ C;  1L54 A;  1YSY A;  2JY6 B;  4LJA A;  1NMM A;  3GLG E;  5KKJ A;  4ARM B;  1CU0 A;  4H9F A;  4LGY A;  1L38 A;  2GQF A;  3WXU A;  1G59 A;  2O4W A;  241L A;  5LYM A;  2D7E A;  4LF5 M;  4OWB A;  3I04 M;  2PC2 A;  1PZY A;  1BVK C;  4KLN A;  1LOZ A;  4I7L A;  3SAV A;  3ZEK A;  5F81 A;  3K1J A;  1N32 M;  3GLI B;  4M9X A;  4NSI A;  5I4Y A;  1OIZ A;  102L A;  5IWA M;  1REY A;  4KXI A;  1CKC A;  1DYB A;  4IBI A;  2DWN A;  2C8P A;  4DDA A;  2DWL A;  4G6Z A;  3GUO A;  2Z37 A;  2CEA A;  1IIZ A;  4PGJ B;  1ZMW A;  2Z38 A;  1PJT A;  2BLY A;  4NSJ A;  4N5R A;  246L A;  2ZIK A;  2CFO A;  3OE9 A;  2LTU A;  172L A;  1IWX A;  1LPY A;  3MMP A;  1YAQ A;  2C8O A;  194L A;  1LZD A;  1L98 A;  1REX A;  3U61 B;  3GQ5 A;  1L24 A;  1N33 M;  2I7P A;  4ETA A;  1IXR C;  1MX0 A;  3SN6 R;  1DO0 A;  2B75 A;  113L A;  1C46 A;  1L05 A;  5F3W A;  4EKP A;  4ANR A;  4I7O A;  1C6N A;  1DGG A;  3U6C A;  2HWJ A;  5C1B A;  1WTN A;  4FJR A;  4H9I A;  1QUO A;  1G7M C;  1L32 A;  2BQG A;  3KOW E;  4IJ4 A;  2BQI A;  2BQK A;  3FI5 A;  4W55 A;  4FW9 A;  2FH0 A;  3FTD A;  4I7M A;  1QDR A;  4WUR A;  1IOR A;  1IWZ A;  1HJP A;  4LFB M;  2RAZ X;  3SAT A;  4EIW A;  1JKA A;  1P36 A;  207L A;  1L59 A;  1L40 A;  4WP2 A;  1PQO A;  1HEP A;  4XJB A;  1LSC A;  1QUG A;  3LCV B;  4LZT A;  3KSJ A;  1CJ6 A;  2O5R A;  1JJ1 A;  4KO8 A;  3HHX A;  1G1W A;  1GBS A;  2I25 L;  3LN2 A;  4D82 A;  3GP1 A;  3V76 A;  1DGF A;  4MGH A;  1Q3B A;  1L82 A;  3WXT A;  4I7J A;  2VF7 A;  1QAQ A;  4FCT A;  164L A;  5LIN A;  4W5W A;  4HTN A;  1HEN A;  2Y21 A;  3WW5 A;  3VLF B;  4GBR B;  4MST A;  2FOI C;  3W6F A;  2LXE A;  108L A;  1LJK A;  1VG5 A;  1QTB A;  1WTH A;  4C5F A;  141L A;  2XEP A;  1HNX M;  186L A;  2EA0 A;  2G4N A;  4JI3 M;  2R4J A;  1XEI A;  3DA1 A;  5ITU A;  4CJ2 A;  3HHY A;  1GAY A;  4WMG A;  3TXE A;  5F9U A;  1FNN A;  3J27 B;  1VED A;  1XNR M;  1QS5 A;  5ILF A;  3RNX A;  1L53 A;  4AG5 A;  4IBE A;  4ITQ A;  1C65 A;  1LZG A;  1UIC A;  2DKV A;  1B5Y A;  4M0W A;  1SSY A;  3AJI B;  4NSH A;  1IBM M;  4LJ4 A;  1ALC A;  3GRY A;  1AKI A;  1P2C C;  1N77 A;  4REZ A;  5FDJ A;  3QWL A;  1IOT A;  1EL1 A;  5F14 A;  3GUM A;  3PXG A;  1R4G A;  1JKC A;  2R62 A;  4LG2 A;  1OAI A;  2OU0 X;  4JI2 M;  2IFF Y;  1LI3 A;  4BAF A;  1DI4 A;  1JJ0 A;  1H6U A;  1KYI A;  3TXI A;  1XMO M;  4N1C C;  1W08 A;  4GKJ M;  2WZJ A;  2JA2 A;  2HEB A;  4DR6 M;  118L A;  2C96 A;  254L A;  1L86 A;  2QBY A;  3U6D A;  2Y20 A;  1L08 A;  2R44 A;  4OVZ A;  3OJP A;  4RW1 A;  2J7O A;  2W1L A;  3PVS A;  4D81 A;  4YHH M;  1NJG A;  1ZV1 A;  1G7H C;  1IWU A;  109L A;  4W57 A;  4BS7 A;  2QZ4 A;  1L97 A;  1LV7 A;  4PT5 A;  1LYH A;  4M4O A;  3T38 A;  1R5L A;  1BQL Y;  5KXT A;  206L A;  3FYD A;  4B7H A;  4DV1 M;  1BGI A;  3WUL A;  5FTL A;  1D6Q A;  1OUB A;  1GB0 A;  4HV2 A;  152L A;  134L A;  1LZA A;  3MK6 A;  1G8P A;  1C6L A;  1GL6 A;  1L88 A;  3C3E A;  1OTR A;  1L1T A;  3PDS A;  5I14 A;  1Q3C A;  1TBY A;  3U5Z A;  1GE1 A;  1JTT L;  2HUM A;  4GRV A;  1J5E M;  1YQV Y;  4DD3 A;  1GD6 A;  3DMZ A;  4NL4 H;  1GFV A;  1L46 A;  1RE2 A;  4PRU A;  4NGJ A;  1CKG A;  5HMJ A;  3HH6 A; 
#chains in the Genus database with same CATH homology
 168L A;  1GDX A;  4LYM A;  4LT0 A;  1L41 A;  2MEH A;  198L A;  4TUN A;  1TDY A;  1CU6 A;  3CSQ A;  5E9R A;  1B6I A;  3P65 A;  3J4G A;  2B6T A;  1YAM A;  1IP2 A;  5DN4 A;  4E97 A;  1C68 A;  1LZT A;  2F30 A;  1QSQ A;  3TXF A;  1FLY A;  3HBE X;  2Z6B A;  2Q9E A;  1LGX A;  1UC0 A;  4BAP A;  1TEW A;  1LZE A;  4WG1 A;  1IEE A;  155L A;  2MEE A;  1OUF A;  3RZ4 A;  2BQD A;  1RJC B;  2AUB A;  177L A;  1LAA A;  255L A;  4AXT A;  1PS5 A;  5KJ9 A;  3WH1 A;  4OO9 A;  3CT5 A;  3DN8 A;  4R0F A;  4HJZ A;  4RLM A;  3HU8 A;  1BWI A;  3A96 A;  236L A;  1BB6 A;  2BPU A;  1XGQ C;  248L A;  200L A;  3DKE X;  1L01 A;  1XSF A;  1L90 A;  4I7S A;  4LT3 A;  3N9C A;  3G3W A;  163L A;  1LMN A;  1YL1 X;  2Z19 A;  1GFJ A;  3TXH A;  1QT7 A;  4AQN A;  2DQA A;  4CFO A;  3AZ7 A;  2DQH Y;  4NEB A;  1EPY A;  3NY8 A;  3P64 A;  2BQH A;  1L57 A;  3CDR A;  1GF0 A;  4E3U A;  4Z46 A;  4GCC A;  1G0L A;  2GV0 A;  1L31 A;  218L A;  1CV4 A;  1GXX A;  4LYB A;  1UIG A;  4H9B A;  3TXJ A;  1CKH A;  3WPK A;  3HBH A;  5KKI A;  4GCD A;  1PQK A;  1L21 A;  1BHZ A;  3DN0 A;  1D2W A;  1SX7 A;  1QTE A;  5L9J A;  253L A;  1ZYT A;  1NDM C;  2BQM A;  1L13 A;  5KXO A;  1DKJ A;  1UAC Y;  2WAR A;  4B0D A;  3A3Q A;  1H6M A;  4H9A A;  2RBO A;  5APD A;  4XJF A;  4WO6 A;  4W51 A;  4GN4 A;  9LYZ A;  1CUP A;  1HSW A;  5KXY A;  1L92 A;  3AJN A;  256L A;  3PBL A;  3WVY A;  4B49 A;  5KXZ A;  1F6S A;  1GFH A;  1WQR A;  1OV5 A;  4NGY A;  4WM5 A;  1LJF A;  1O23 A;  3FAD A;  2W1X A;  1QSW A;  4WOA A;  4N8Z A;  4G49 A;  1XEJ A;  3DN4 A;  2CUU A;  1OUA A;  2OU9 A;  4J1B A;  1DYE A;  1JIY A;  188L A;  1OYU A;  3RW8 A;  3W6C A;  3G3V A;  1SLY A;  5AMY A;  1GFE A;  234L A;  2FYD A;  1VAU A;  1YAO A;  1XGR C;  1WQM A;  149L A;  4H92 A;  3CDQ A;  4DQ5 A;  2DQD Y;  1LMO A;  4EMN A;  4H9C A;  5B05 A;  1LSF A;  3G3X A;  5A3E A;  1CTW A;  195L A;  3RUN A;  226L A;  3B0I A;  4NG8 A;  156L A;  2BQJ A;  127L A;  3HUA A;  1D6P A;  1C45 A;  1LJJ A;  2B6Z A;  2YBI A;  1VDT A;  4G4C A;  1GFT A;  210L A;  2Z18 A;  1XJT A;  1I56 A;  5LVH A;  261L A;  1LW9 A;  5DN5 A;  196L A;  1GFG A;  1G0Q A;  1HER A;  1D9U A;  1B5W A;  1GF9 A;  1L60 A;  1JTM A;  2DQJ Y;  3NYA A;  1B9O A;  4L41 A;  4Z41 A;  1LZ8 A;  4H1P A;  1CU3 A;  1V7S A;  1DPW A;  3TMU A;  1HEM A;  1QDT A;  1LLH A;  4ET9 A;  1IP5 A;  2HUL A;  1L19 A;  3WUN A;  3GUP A;  2G4P A;  5D5C A;  1IY4 A;  1GFR A;  4G4H A;  2EQL A;  3WUM A;  4HPE A;  6LYT A;  1L39 A;  2FBD A;  4CFP A;  1QT3 A;  3ZVQ A;  5I5Q A;  4ETD A;  4ML7 A;  1OUC A;  4HTQ A;  4NIJ A;  1KIQ C;  1L99 A;  219L A;  4H93 A;  4RDS A;  1LSD A;  2BQN A;  3F9L A;  2DBT A;  3QE8 A;  1LYE A;  184L A;  140L A;  1K28 A;  176L A;  3HT6 A;  4II8 A;  5I54 A;  1KY0 A;  1L93 A;  5B06 A;  224L A;  1YAP A;  1GF4 A;  5LVG A;  3DNA A;  4EOF A;  1P46 A;  239L A;  2CJL A;  1GEZ A;  1L07 A;  5APF A;  2B5Z A;  2MEB A;  1OWZ A;  1HEO A;  1D2Y A;  5KXK A;  1LMT A;  1L18 A;  1UIB A;  1L34 A;  2CGI A;  4G9S A;  1LYD A;  1L44 A;  2Z2E A;  4YEO A;  1L27 A;  1JEF A;  1LYS A;  1KXW A;  1P56 A;  1P6Y A;  3DN6 A;  1OUD A;  242L A;  2Z12 A;  5KXN A;  5I4X A;  5IHG A;  1DYG A;  2OE9 X;  5J7C A;  4I8S A;  1L06 A;  3ULR A;  4W59 A;  2XBR A;  4XEN A;  3C82 A;  4PHI A;  2XBS A;  5LYT A;  1IO5 A;  3QAK A;  3OE8 A;  3CT0 A;  4DD2 A;  1C6Q A;  1T97 A;  229L A;  1UA6 Y;  1PQD A;  4DJH A;  1GE4 A;  4XJG A;  3WPL A;  1L89 A;  1FDL Y;  2MEC A;  3UON A;  5FCP A;  4LDE A;  2IHL A;  1L70 A;  3A93 A;  4NGV A;  1DPX A;  4EPI A;  3ZVQ B;  5IEL A;  2LZT A;  1KIP C;  2HTX A;  2OU8 A;  5FEL A;  114L A;  1L68 A;  1IC5 Y;  4ARP A;  1D0L A;  1P37 A;  1L35 A;  237L A;  3M18 B;  5KXS A;  7LZM A;  1WQP A;  191L A;  1NHE A;  262L A;  5KXR A;  4B4J A;  4YXC A;  122L A;  4ARQ A;  3AGG G;  4NHI A;  1C6B A;  4OWC A;  2ZQ3 A;  4EKR A;  3G3B B;  1L83 A;  4TSC A;  244L A;  1TLA A;  1YKX X;  3AZ6 A;  1QTZ A;  2RB1 X;  1GAZ A;  245L A;  4HP0 A;  1GDW A;  4BAD A;  3HH4 A;  3OE6 A;  3SB5 A;  3SBA A;  120L A;  1L55 A;  1GB2 A;  1KS3 A;  233L A;  1L0K A;  1VDQ A;  1LZC A;  4W58 A;  1LMQ A;  4ZEE A;  4I0C A;  1B7M A;  1L69 A;  4CGE A;  1LHK A;  1IX0 A;  5HNL A;  1I6S A;  2HUB A;  1XFP L;  4O34 A;  171L A;  3QY4 A;  1ZWN A;  3DN2 A;  2YBN A;  1HF4 A;  139L A;  1LHH A;  2RB0 X;  1C69 A;  2W1M A;  1LSM A;  1WVU A;  1IR9 A;  1L95 A;  3A67 Y;  1L56 A;  7LYZ A;  4LYO A;  3WL2 A;  169L A;  201L A;  1LJN A;  1NDG C;  3J6K A;  3FA0 A;  1QUT A;  1L81 A;  3G3A B;  4H90 A;  142L A;  1IP4 A;  1OP9 B;  5FEK A;  1FLW A;  2F4A A;  5LVI A;  1IR7 A;  4PRQ A;  1LSB A;  1P5C A;  1CU5 A;  1B5V A;  1AZF A;  4TTD A;  4HJV A;  3WW6 A;  3L2X A;  4LYT A;  3EML A;  3RZE A;  1LJH A;  3P66 A;  1L48 A;  1C6H A;  1T8A A;  1CX7 A;  1IY3 A;  3EO5 A;  5DLA A;  1L22 A;  4ARQ B;  3CT1 A;  3HTF A;  3T36 A;  1MLC E;  166L A;  3SB6 A;  1FLU A;  3K3T A;  3OK0 A;  137L A;  128L A;  1QUH A;  1L75 A;  257L A;  2LYM A;  2ZQ4 A;  2RH1 A;  3EBA B;  1I20 A;  1CVK A;  160L A;  1INU A;  1F10 A;  1QTK A;  4LFX A;  2RBR A;  112L A;  1FKV A;  1LGW A;  1LKR A;  1JTP L;  1WVV A;  1JIT A;  216L A;  4PPO A;  4YF2 A;  1IOC A;  2B6Y A;  3TXG A;  5C6L A;  1LSY A;  3GUL A;  1L11 A;  1LYF A;  1L36 A;  3LYM A;  1JSF A;  4W96 A;  221L A;  1GF6 A;  1J1P Y;  4LDO A;  4DDC A;  4H94 A;  4R6C A;  1UIA A;  2RBN A;  4KPM A;  1LMP A;  1QSB A;  4Z98 A;  1C6C A;  1C6T A;  1YIL A;  1G06 A;  1QIO A;  3WYH A;  3F8V A;  3BKV A;  2OE4 X;  1QTC A;  4B4E A;  3IJV A;  4PK0 A;  143L A;  213L A;  3A92 A;  4NHS A;  1UIF A;  1F0W A;  4WG7 A;  4TSB A;  1JUG A;  1LYY A;  4OWE A;  1LMC A;  1P2L A;  1C6P A;  4WLX A;  4DDB A;  1SWY A;  1HFZ A;  1LZR A;  3GUI A;  2LYO A;  1L51 A;  2HU3 A;  2ZYP A;  1D3J A;  1L33 A;  4IAT A;  4GN5 C;  1TAY A;  3V2W A;  1JKB A;  2BQA A;  1BWH A;  1C66 A;  4LYC A;  4AGA A;  1L30 A;  1IOQ A;  3N9A A;  5DL9 A;  193L A;  107L A;  228L A;  1C7P A;  1SX2 A;  3WU7 A;  3CSR A;  3A34 A;  1B5X A;  4XAD A;  5E4P A;  3A95 A;  3A91 A;  2D4I A;  5LAF A;  4X3B A;  2EIZ C;  1EQ4 A;  4ETC A;  4G4B A;  1L50 A;  3C80 A;  4ZFP A;  1L65 A;  259L A;  1LSG A;  1C08 C;  1G0G A;  2VB1 A;  4WL6 A;  230L A;  1IR8 A;  2LYZ A;  2D91 A;  1XGT C;  1FBI X;  3LYO A;  1GFK A;  5LVJ A;  4QY9 A;  178L A;  3GUN A;  5C6J A;  222L A;  110L A;  3RU5 A;  3WU8 A;  3C8R A;  2EKS C;  2D4J A;  1C60 A;  4XJH A;  1RCM A;  4RLN A;  1B7P A;  1LWK A;  1DI3 A;  1L09 A;  3A6B Y;  3AW7 A;  1LHM A;  3P68 A;  125L A;  2LC9 A;  2F2N A;  4WLY A;  1VDS A;  3SB8 A;  4GLA A;  1AT6 A;  1L37 A;  4MR1 A;  4XJI A;  2ZIJ A;  4P2E A;  4WM4 A;  104L A;  4YXA C;  3VW7 A;  3LZ2 A;  4DQ7 A;  133L A;  3OE0 A;  1QUS A;  5C6I A;  250L A;  2DQF C;  3W3E A;  1JPO A;  1PQM A;  1BB3 A;  2CWI A;  1L76 A;  1XEP A;  5F9X A;  2ZWB A;  4NHQ A;  1GE3 A;  4XJD A;  2BQO A;  1FLQ A;  145L A;  4H8Y A;  1GB3 A;  1HFY A;  225L A;  1LZ9 A;  2G4Q A;  1V7T A;  2RB2 X;  4RW2 A;  3B0K A;  1GF7 A;  4HV1 A;  2H9J A;  2I6Z A;  5LZM A;  3A6C Y;  4OWH A;  2H9K A;  1L45 A;  4WL7 A;  4DAJ A;  1UCO A;  1OUJ A;  1HNL A;  2B7X A;  3FI7 A;  1VAT A;  1LI2 A;  1YL0 X;  5JEN B;  1GBX A;  1LSA A;  2HEA A;  1D0M A;  1CUQ A;  4DKL A;  1ZVH L;  6LZM A;  1CJ7 A;  1LSP A;  126L A;  2Q9D A;  1GXV 2;  4KT3 A;  4YEM A;  1GFA A;  1NBY C;  115L A;  1C6M A;  4LFP A;  4NHT A;  1T6V L;  4W56 A;  2HEF A;  1D3N A;  1B7O A;  4DQJ A;  1G1V A;  3SB7 A;  1E8L A;  1LCN A;  4I7N A;  3HH5 A;  1GF5 A;  1L23 A;  2B73 A;  4NHP A;  1C6J A;  4W53 A;  3HT9 A;  1CV3 A;  1QT6 A;  5APE A;  4NGO A;  4B4I A;  1IWT A;  1EQE A;  1GE2 A;  1OUG A;  4ETE A;  3C7W A;  1QUD A;  1CJ8 A;  1B0D A;  2XTH A;  103L A;  4WM3 A;  1L03 A;  4H9E A;  2B6W A;  4I7P A;  1L04 A;  1CKD A;  4I7K A;  4HSF A;  1XGP C;  1T8G A;  174L A;  1CJ9 A;  5KXW A;  1HMK A;  4EKQ A;  1GWD A;  1LZS A;  3T6U A;  2BQE A;  4UWN A;  2F2Q A;  4N0J A;  3B6L A;  5LXW A;  3D4S A;  1GBO A;  1NHB A;  5B07 A;  3AYQ A;  1C6K A;  5B1F A;  4H9H A;  1JTN A;  4D9Z A;  4WO9 A;  1L49 A;  4CHX A;  214L A;  1G0K A;  4ETB A;  4H8X A;  8LYZ A;  260L A;  5ILC A;  4NGK A;  2O79 A;  3F6Z A;  4GCB A;  1ZMY L;  1NWG A;  3L64 A;  1IC4 Y;  1C6D A;  183L A;  1XGU C;  1LZB A;  1L80 A;  1L77 A;  4HPI A;  3CSZ A;  1JIS A;  1L64 A;  3CB7 A;  1L10 A;  4EKS A;  5LAG A;  180L A;  3AB6 A;  1P2R A;  2BQB A;  1LJG A;  1LZ5 A;  4WM2 A;  2D4K A;  1ZVY B;  3ATO A;  3SB9 A;  2H5Z A;  162L A;  2MEI A;  1DYD A;  220L A;  5IDD A;  1L14 A;  119L A;  1F6R A;  4N1E I;  1VDP A;  4TWS A;  5APC A;  1L25 A;  1XJU A;  1LPI A;  1L74 A;  1C10 A;  4J7V A;  1L16 A;  4DD9 A;  1LYO A;  2A7D A;  3WPJ A;  3QNG A;  1L02 A;  1LZ4 A;  1G7L C;  2Q0M X;  1IP1 A;  2B70 A;  1HHL A;  1WTM A;  3W6D A;  1QSA A;  5LA8 A;  181L A;  1IP7 A;  1GB7 A;  5B59 A;  3GXR A;  1JJ3 A;  1CV0 A;  2CDS A;  4NGW A;  3EXD A;  1QT8 A;  3C83 A;  1LJE A;  240L A;  2Z2F A;  3CQL A;  3HDE A;  1GFU A;  1CU2 A;  3HDF A;  1IP6 A;  3DMV A;  3RT5 X;  4OOT A;  1IVM A;  2F4G A;  4C3W A;  6LYZ A;  2QB0 B;  4ARL A;  1RFP A;  1KXX A;  1QTV A;  1BB7 A;  3ODU A;  5KY1 A;  1P3N A;  2YBL A;  4KL7 A;  1HEW A;  5LA5 A;  1OWY A;  2YBJ A;  1C63 A;  2FYC A;  1IC7 Y;  3GUJ A;  2YBM A;  1DYF A;  3HH3 A;  5LIO A;  1C6E A;  3SP3 A;  1AM7 A;  1IWY A;  1CNS A;  2N5Z A;  1L71 A;  3E3D A;  1IOS A;  5HQ1 A;  5FHW A;  4NWE A;  1ZV5 L;  5KXL A;  1GPQ C;  1QS9 A;  165L A;  3HUQ A;  1L20 A;  130L A;  2YSS C;  3SBB C;  5D5F A;  1JQU A;  2BQL A;  1GBY A;  5HLL A;  3GXK A;  2O7A A;  4QDN A;  235L A;  1B7L A;  1XEK A;  209L A;  1OVJ A;  3B72 A;  2Y8P A;  1L67 A;  5DM9 A;  4MCK A;  4YX7 C;  1UBZ A;  1LSZ A;  1KNI A;  1WQN A;  2BAA A;  4ZIX A;  1L66 A;  150L A;  1LWG A;  2RAY X;  2MEF A;  1UIH A;  3B0O A;  4W52 A;  1LGU A;  4ARJ A;  1NKH A;  1L15 A;  2F47 A;  1GE0 A;  1L85 A;  1ZUR A;  1LYZ A;  1HC0 A;  1L96 A;  1JTO L;  3TXD A;  1NF5 A;  1UID A;  3NY9 A;  3TXK A;  5LVK A;  1PQI A;  1L62 A;  3JR6 A;  2F32 A;  190L A;  4WM1 A;  1OUE A;  5LYZ A;  3HWL A;  4Z3M A;  199L A;  187L A;  4NGL A;  5K7O A;  1OV7 A;  1QTH A;  217L A;  4U3X B;  1C61 A;  4I7Q A;  1BWJ A;  1MEL L;  5HNC A;  4EXM A;  1Z55 A;  5L3H A;  1H87 A;  4YOP A;  151L A;  4M6D A;  1D3M A;  4LYZ A;  3AGH A;  3HT8 A;  3FE0 A;  1LHJ A;  1CX6 A;  2XQO A;  3A3R X;  4PJ2 C;  3AZ4 A;  1GBZ A;  189L A;  1L84 A;  4LT1 A;  3TMV A;  173L A;  4HJY A;  1OUH A;  1HML A;  1KW7 A;  4DC4 A;  3GUK A;  4XN6 A;  5I53 A;  1OVH A;  3TMW A;  1T3P A;  4OWA A;  5F16 A;  175L A;  1B5U A;  3A8Z A;  2DQC Y;  1B2K A;  1DYC A;  2D6B A;  4FDY A;  154L A;  5M1Y A;  2HU1 A;  1GF8 A;  1LHL A;  4QGZ A;  1JKD A;  1P7S A;  3C8Q A;  3TXB A;  167L A;  2OEA X;  3P4Z A;  3MGW A;  1LSN A;  2Z39 A;  1L29 A;  1LZ6 A;  1C64 A;  4LZM A;  4H91 A;  1CV5 A;  2NTG A;  4NWH A;  1REZ A;  1T8F A;  4J0L A;  146L A;  1SWZ A;  2ZNX Y;  3CDO A;  1WQQ A;  2DQE Y;  4WM6 A;  197L A;  3ATN A;  1GEV A;  1SSW A;  4IAP A;  1DQJ C;  2RBP A;  1QQY A;  2A7F A;  2DQG Y;  1JWR A;  4LGK A;  2NWD X;  2BQC A;  1L47 A;  1G0J A;  3HTB A;  3A90 A;  3WUA A;  1KY1 A;  1VFB C;  2MED A;  4LT2 A;  5L3I A;  1BB5 A;  4NGZ A;  1LSE A;  1HEL A;  4NSG A;  1RI8 B;  2BLX A;  4GLV A;  4ZPU A;  2NTH A;  4GCE A;  1HFX A;  1B5Z A;  249L A;  3W6E A;  5II3 A;  2B74 A;  5A3Z A;  144L A;  2MEA A;  2BQF A;  2B6X A;  1REM A;  2OE7 X;  3WU9 A;  1G7I C;  1T6H A;  4DYG A;  1C6A A;  4I7T A;  1L28 A;  5HMV A;  1L58 A;  1GBW A;  4YEN A;  3LYT A;  1C6G A;  3AZ5 A;  1YAN A;  1HSX A;  1L42 A;  4W94 A;  3IWR A;  3IJU A;  1DI5 A;  4YM8 A;  1C6F A;  4HTK A;  4WLD A;  111L A;  1DXJ A;  3LHM A;  1IP3 A;  2RBS A;  1C67 A;  3HU9 A;  192L A;  4J1A A;  2ANX A;  158L A;  182L A;  1SQ2 L;  3CDV A;  1CV6 A;  3LZM A;  2FBB A;  2OTZ X;  3C81 A;  1L63 A;  1B7S A;  1LJ4 A;  231L A;  3W6A A;  1I1Z A;  1LYG A;  2LZ2 A;  5KXX A;  4UWU A;  4N9R A;  1YKY X;  1GHL A;  1LMA A;  212L A;  4IAS A;  208L A;  1BVX A;  4S0W A;  1NBZ C;  3VWO A;  1LI6 A;  2HEE A;  148L E;  3C7Y A;  3HUK A;  1QT5 A;  3CDT A;  4TX7 A;  5KXP A;  1CKG A;  3K2R A;  2B72 A;  147L A;  2YDG A;  1LYJ A;  1JSE A;  1A2Y C;  4DWX A;  129L A;  3TMX A;  1LZ1 A;  161L A;  1CV1 A;  157L A;  1G0P A;  4DT3 A;  1LJ3 A;  3D3D A;  4GN3 A;  1W6Z A;  4OOO A;  1D3F A;  4B1A A;  1FKQ A;  1L91 A;  170L A;  1D9W A;  1GB9 A;  4XYY A;  1L61 A;  1JHL A;  3DMX A;  159L A;  2YBH A;  4I7R A;  2YVB A;  1P64 A;  1YKZ X;  1LJI A;  3BKH A;  4PJZ A;  1PQJ A;  3WMK A;  1EQ5 A;  1LHI A;  2A4T A;  232L A;  3C8S A;  1GB8 A;  4W54 A;  1G07 A;  1L73 A;  1KXY A;  2ANV A;  2HEC A;  4OW1 A;  4LDL A;  4H8Z A;  2LHM A;  1J1X Y;  3HT7 A;  1C62 A;  4GCF A;  1N4F A;  4WLT A;  4EJ4 A;  3D9A C;  1L43 A;  3W6B A;  4EPF A;  4UWV A;  1QTD A;  1L52 A;  1HEQ A;  1QT4 A;  1DKK A;  1LYI A;  2I26 L;  123L A;  1FN5 A;  2ZYC A;  4NY5 A;  1CKF A;  1L12 A;  1NQI A;  1OUI A;  1A4V A;  1YIK A;  2HED A;  2MEG A;  131L A;  1G7J C;  2RSC A;  243L A;  2LCB A;  5T3F A;  1B7Q A;  1TCY A;  3HBD A;  1DZB X;  2XJW A;  3DN3 A;  4NFV A;  1L87 A;  3KAM A;  4A7D A;  4ARM A;  2W1Y A;  1LKS A;  4ET8 A;  1YRO A;  1L94 A;  223L A;  1LZN A;  4NGI A;  1AT5 A;  2HUK A;  1B7N A;  5KXM A;  3AW6 A;  5FST A;  238L A;  4DD0 A;  1KW5 A;  211L A;  3DN1 A;  251L A;  4NG1 A;  1C43 A;  1IWW A;  2X0A A;  3HTG A;  1KIR C;  1B7R A;  3HFM Y;  4DD7 A;  135L A;  5EBH A;  3M3U A;  4QEQ A;  1OVK A;  3LYZ A;  1LZY A;  3HTD A;  1UIE A;  132L A;  2DQI Y;  252L A;  1L00 A;  5B1G A;  3N9E A;  1DYA A;  215L A;  3EMS A;  1D0K A;  1LTM A;  1BB4 A;  2OTY X;  153L A;  1L26 A;  1GB5 A;  205L A;  258L A;  4DD1 A;  1G0M A;  185L A;  2LZM A;  1C6I A;  3V2Y A;  227L A;  1L0J A;  3A94 A;  2EPE A;  4K5Y A;  1L79 A;  3LZT A;  1IWV A;  3AGI A;  5I4W A;  3WVX A;  1J1O Y;  1L17 A;  1OQM A;  2RBQ A;  2L78 A;  2ZIL A;  1GF3 A;  1L72 A;  3C7Z A;  1GB6 A;  1WQO A;  247L A;  2QAR C;  2ZNW Y;  138L A;  1UUZ C;  1L54 A;  1NMM A;  5KKJ A;  4ARM B;  1CU0 A;  4H9F A;  1L38 A;  3WXU A;  2O4W A;  241L A;  5LYM A;  4OWB A;  2PC2 A;  1PZY A;  1BVK C;  4I7L A;  1LOZ A;  3ZEK A;  5F81 A;  4NSI A;  5I4Y A;  102L A;  1REY A;  4KXI A;  1CKC A;  1DYB A;  2C8P A;  4DDA A;  3GUO A;  2Z37 A;  1IIZ A;  4PGJ B;  2Z38 A;  2BLY A;  4NSJ A;  4N5R A;  246L A;  2ZIK A;  3OE9 A;  172L A;  1IWX A;  1LPY A;  1YAQ A;  2C8O A;  194L A;  1LZD A;  1L98 A;  1REX A;  1L24 A;  4ETA A;  3SN6 R;  2B75 A;  113L A;  1C46 A;  1L05 A;  4EKP A;  4ANR A;  4I7O A;  1C6N A;  1WTN A;  4FJR A;  4H9I A;  1QUO A;  1G7M C;  1L32 A;  2BQG A;  4IJ4 A;  2BQI A;  2BQK A;  3FI5 A;  4W55 A;  4I7M A;  1QDR A;  1IOR A;  1IWZ A;  2RAZ X;  1JKA A;  1P36 A;  207L A;  1L59 A;  1L40 A;  1PQO A;  1HEP A;  4XJB A;  1LSC A;  1QUG A;  4LZT A;  1CJ6 A;  1JJ1 A;  1G1W A;  1GBS A;  2I25 L;  3LN2 A;  3WXT A;  1L82 A;  4I7J A;  164L A;  5LIN A;  4HTN A;  1HEN A;  3WW5 A;  4GBR B;  4MST A;  3W6F A;  108L A;  1LJK A;  1QTB A;  1WTH A;  4C5F A;  141L A;  186L A;  2G4N A;  1XEI A;  4CJ2 A;  1GAY A;  4WMG A;  3TXE A;  5F9U A;  1VED A;  1QS5 A;  5ILF A;  3RNX A;  1L53 A;  1C65 A;  1LZG A;  1UIC A;  2DKV A;  1B5Y A;  1SSY A;  4NSH A;  1ALC A;  1P2C C;  1AKI A;  5FDJ A;  1IOT A;  1EL1 A;  5F14 A;  3GUM A;  1JKC A;  2OU0 X;  2IFF Y;  1LI3 A;  4BAF A;  1DI4 A;  1JJ0 A;  3TXI A;  4N1C C;  1W08 A;  2HEB A;  118L A;  254L A;  1L86 A;  1L08 A;  3OJP A;  4RW1 A;  2W1L A;  1G7H C;  1IWU A;  109L A;  4W57 A;  4BS7 A;  1L97 A;  1LYH A;  4M4O A;  1BQL Y;  5KXT A;  206L A;  1BGI A;  3WUL A;  1D6Q A;  1OUB A;  1GB0 A;  4HV2 A;  152L A;  134L A;  1LZA A;  1C6L A;  1L88 A;  3PDS A;  5I14 A;  1TBY A;  1GE1 A;  1JTT L;  2HUM A;  4GRV A;  1YQV Y;  4DD3 A;  1GD6 A;  3DMZ A;  1GFV A;  1L46 A;  1RE2 A;  4PRU A;  4NGJ A;  2IGC A;  5HMJ A;  3HH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...