1QUTA

The soluble lytic transglycosylase slt35 from escherichia coli in complex with n-acetylglucosamine
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
322
structure length
312
Chain Sequence
MVEPQHNVMQMGGDFANNPNAQQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQGPNGAWLRYRKKFITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALATLSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSGDGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGLTPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYTIC MUREIN TRANSGLYCOSYLASE B
publication title Crystal structure of Escherichia coli lytic transglycosylase Slt35 reveals a lysozyme-like catalytic domain with an EF-hand.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 108
structure length 312
sequence length 322
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 1999-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13406 SLT_2 Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.350 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Bacterial muramidase 1qutA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 1qutA02
2HEAA 1XEJA 4H8ZA 4LFPA 1IC7Y 4P2EA 4MCKA 1IOQA 5DN5A 4XN6A 1G7LC 1GBWA 4NGYA 1LHKA 5DN4A 4EOFA 3N9CA 1NWGA 4R0FA 3EMSA 4G4BA 2MEDA 2MEEA 3AJNA 1BB6A 1J1OY 4BADA 5LA8A 4DT3A 2W1LA 4WL7A 1YAMA 4IATA 1GBOA 8LYZA 3MGWA 2BQJA 4NY5A 1NF5A 1C08C 2MEBA 3E3DA 3WMKA 3G3BB 1GE4A 1GD6A 1HF4A 4BAPA 4C3WA 1LZ8A 1BHZA 4WM5A 3D3DA 4NSIA 2BQNA 4LYCA 1GFRA 4PHIA 1GB6A 1YKZX 4HJZA 1WQNA 3B0OA 1GF6A 1JISA 4CHXA 4WG7A 2BQMA 4KL7A 5APFA 2ZIJA 3ATNA 3WXUA 2H9JA 2ZWBA 3A8ZA 3OK0A 1BB4A 4NIJA 3A34A 1GBSA 4KPMA 5IHGA 1F0WA 2BQIA 4NGVA 5LVKA 4L41A 1IWWA 2CDSA 4H8XA 3P65A 1IP4A 4XENA 1HHLA 4WM3A 3F6ZA 4Z41A 1TCYA 2MEIA 1XGPC 5KXNA 4DDBA 1DPWA 1GFHA 3WUAA 5JENB 2LYMA 1LJKA 4CFOA 5KKJA 2HEDA 3WH1A 1CKHA 4W94A 1KXYA 154LA 4H1PA 1GBZA 1D0LA 1LZDA 5DM9A 5M1YA 1YQVY 4C5FA 1YAOA 1ZVHL 1IC5Y 1DXJA 1YL0X 1LSBA 2C8PA 2EQLA 1UC0A 3LZ2A 1QDTA 4PRQA 2FBDA 4DC4A 1GF3A 4J0LA 5KXRA 2EKSC 1LYSA 4AXTA 1GXV2 2MEGA 1LSPA 3N9AA 4KXIA 2I25L 1LMNA 1BWJA 1PZYA 4DWXA 1IP2A 2I26L 2Q0MX 1LZAA 4IASA 1GF5A 2HEBA 4A7DA 4OOTA 2F4GA 1GDXA 4XJBA 3P68A 4ZFPA 1CKGA 1D6QA 4HPIA 4OWEA 4ETAA 4QY9A 7LYZA 1CJ6A 2Z19A 4NEBA 4B1AA 2FBBA 3ULRA 4LT0A 4YOPA 1I56A 1IWUA 1HERA 1LKRA 3K3TA 4OWHA 4DD9A 1KXXA 5FHWA 2YBHA 5A3ZA 2I6ZA 5HNLA 2HEEA 3RZ4A 1OUGA 2ZQ4A 1LSDA 2BQFA 3N9EA 5KXXA 4B4EA 3AGIA 1ZMYL 3QY4A 3W6AA 1KIQC 4NWHA 1LZSA 4QGZA 4NGZA 1LSFA 2YBLA 1LJGA 4NG8A 2DQFC 1QQYA 1G7JC 3HBDA 2DQEY 3WYHA 1B5VA 4PPOA 4QDNA 5F81A 3TXBA 1TEWA 3LHMA 4DD2A 1IP1A 135LA 1GFKA 4H9IA 4GCEA 4HV2A 4YEMA 3WXTA 2BQAA 1JJ0A 2CWIA 4GCFA 1IP6A 4WM6A 1N4FA 1OP9B 1B7QA 4NHTA 1LZ6A 4TSBA 3ATOA 207LA 4NSGA 1OUJA 4N1CC 1B7MA 1CNSA 4G4HA 1XEKA 1F10A 3LYMA 3TMUA 1CJ9A 4CFPA 1AT6A 4NG1A 5A3EA 2ZQ3A 1VDPA 1C45A 1C7PA 1GB3A 5F9XA 1HFZA 3A95A 4LT3A 4LYZA 1IP7A 1LMPA 1NHEA 1B7LA 4X3BA 2HTXA 3AB6A 5ILCA 4HJYA 1UIEA 5C6LA 1TBYA 3WULA 4UWUA 5C6JA 1IORA 1GF0A 1GHLA 1IC4Y 1D0KA 4BS7A 1B0DA 3A92A 4PJ2C 1YILA 4B0DA 4LYBA 1HEPA 1QDRA 1ZVYB 1GB2A 5AMYA 1LSCA 1DQJC 2YBNA 3BKHA 4FJRA 3B0KA 3LYOA 1GE3A 3P4ZA 1GB0A 3G3AB 2DQCY 3IJVA 1LTMA 2LZTA 3LN2A 1SQ2L 3AZ7A 1JJ3A 1FN5A 1YAQA 1HFYA 5B59A 1YKXX 4EMNA 3GXRA 4NSHA 1GFTA 1REMA 1GAYA 1JKBA 1GB9A 4YEOA 2CGIA 1REXA 5IELA 5KY1A 1J1XY 4GN5C 5FDJA 1FKVA 2XBRA 1DPXA 3EXDA 1LZBA 1RE2A 4RLMA 2BQOA 2A7FA 4MSTA 1YROA 1GBXA 2DQGY 1NKHA 1NMMA 2EIZC 1CJ7A 1JEFA 1QUTA 1VDSA 1IVMA 1CJ8A 4OW1A 1BVKC 4H93A 1LJEA 1IWZA 4HTQA 1LMAA 2BQLA 2BLYA 4H9BA 5FSTA 1I20A 5FEKA 4ETBA 3A91A 1LHIA 4DYGA 5HQ1A 2BQHA 3TMWA 4WM4A 2BQEA 3EO5A 4BAFA 1DI5A 3A96A 1LJ4A 2DQDY 2F2NA 1LYOA 1HMKA 5KXOA 2ZIKA 1F6SA 1JITA 1E8LA 1UIFA 3WPLA 2LHMA 2YDGA 4DD3A 1IR7A 1UACY 1LYZA 4NGLA 3FE0A 1GB8A 1LJJA 1OUFA 5L9JA 1XGUC 4J7VA 4XJIA 1JWRA 2Z38A 2W1YA 5HMJA 2ZYPA 4XADA 1QSAA 1JHLA 1G7HC 4XJGA 3W3EA 1EQEA 4M6DA 4D9ZA 4J1BA 2X0AA 4AGAA 1UIGA 5B06A 2MEAA 4M4OA 4TWSA 4DDAA 5KXLA 2Z18A 3CB7A 3TXDA 1WVVA 3B72A 3CSQA 4WM1A 1LJFA 4B49A 4RLNA 1UA6Y 1IR8A 1NBYC 1LSAA 1MELL 1UUZC 2BQDA 3CT1A 4LGKA 1GF4A 4NGKA 1LKSA 5B05A 1FLUA 1GEZA 1DKKA 3CSRA 1KXWA 2D6BA 1F6RA 4H9EA 4NFVA 1GB7A 5HNCA 1GE1A 1H87A 1WQOA 1GWDA 2W1MA 3P66A 1LPIA 2BPUA 2CJLA 2IHLA 1UICA 5ILFA 3OJPA 1LMQA 1IIZA 5KXZA 3TXKA 1HEQA 2F30A 2BQGA 4NGOA 3TXGA 4Z3MA 4H91A 1HEOA 1YKYX 2G4QA 1JKAA 1BB7A 2NWDX 1EQ5A 2F4AA 1TDYA 3M3UA 5I53A 1QTKA 2LZ2A 1GB5A 4XYYA 5KXMA 3AGHA 3WUMA 1V7SA 1LZYA 4RDSA 5KXWA 5F16A 5LVJA 132LA 1NBZC 1OUHA 2DQIY 3AZ4A 3QE8A 4ETCA 3SP3A 1GDWA 5C6IA 2Z39A 4FDYA 1WTMA 4NHSA 6LYTA 1T6VL 1GXXA 1LZTA 2XJWA 1J1PY 4W96A 4H94A 1D0MA 1VATA 3A67Y 3W6EA 1HSXA 4DDCA 1LZ5A 5KXSA 1GFUA 1JKCA 1TAYA 5K7OA 1LJHA 1WQMA 3AZ5A 4LT2A 1AZFA 1AT5A 3RW8A 2BQCA 4H90A 2H9KA 3WW5A 1B7RA 1LYYA 1RFPA 4WM2A 1GFVA 1LZ9A 1YIKA 2A7DA 2XBSA 6LYZA 1IWYA 2ZNXY 1IOTA 1LSYA 4U3XB 3B0IA 1QSWA 1JKDA 5LXWA 1QUSA 3LZTA 1B5YA 1XGRC 5APEA 4H9FA 5IDDA 134LA 3RU5A 4TX7A 5KKIA 3RNXA 3TMXA 1UIAA 2EPEA 4NHQA 5LAGA 1VDQA 1BVXA 1LSMA 4HV1A 2LYOA 2LYZA 5J7CA 1EQ4A 1PS5A 2DQHY 1OQMA 2ZNWY 1G7IC 3FI7A 2G4PA 3HFMY 4H9CA 4WO9A 5LYZA 1CKFA 5KJ9A 1UIHA 1JJ1A 2Y8PA 1LMCA 5L3HA 1CKCA 4GN4A 4TUNA 1C43A 2MEFA 1I1ZA 3AW6A 4LYMA 4Z98A 5F9UA 1LZNA 5LYTA 1BB5A 1YAPA 4IJ4A 4H8YA 4ETDA 1DI3A 4OWBA 4WG1A 4LZTA 3WL2A 3ZEKA 1BGIA 3ZVQA 1UIBA 2FYDA 1LHLA 1B9OA 1OUEA 4N1EI 4PRUA 1BWHA 1B7PA 3BKVA 4NWEA 3W6FA 1VFBC 1ZV5L 2YBJA 3A3RX 1C46A 1WQQA 4YM8A 2VB1A 5FCPA 4WLDA 1GBYA 1RJCB 2W1XA 2H5ZA 1OUDA 4O34A 4DD7A 3A93A 3D9AC 2HECA 3TXIA 4YF2A 1GFGA 1B7OA 2RSCA 5L3IA 4UWVA 1BWIA 1WVUA 2GV0A 4WLYA 4XJFA 1OUIA 4B4IA 5LAFA 9LYZA 1GF9A 3M18B 5E9RA 5KXYA 3WPJA 1XSFA 1B5ZA 1EL1A 5F14A 4PGJB 1REZA 1CKDA 1B5UA 1KIRC 1LZCA 4YENA 4ZEEA 4MR1A 1V7TA 5EBHA 1OUCA 3TXEA 2AUBA 3GXKA 4H92A 1LJNA 4WO6A 4QEQA 1NDGC 1LSEA 193LA 1XFPL 194LA 2DQJY 4HSFA 5HLLA 3J4GA 1FBIX 4XJDA 1QIOA 1LMTA 1XGTC 4OWAA 4Z46A 1GFEA 1NDMC 5II3A 1HELA 1LMOA 1JTPL 2Z12A 1DZBX 1GF8A 3WPKA 1HSWA 3WVYA 5I4XA 1IWXA 1IP3A 1WQPA 4HTKA 4DD0A 5LVHA 1JSEA 4LYTA 3HBHA 4GLAA 4NGJA 1B7SA 1SLYA 3T6UA 2DKVA 3TMVA 1A2YC 2D4JA 4XJHA 5B1GA 5LIOA 3WUNA 4CJ2A 1LZRA 3WVXA 2DBTA 1LSNA 2HU1A 1IP5A 4ET8A 1LHHA 1GFJA 1W08A 1P2CC 1D9UA 1RI8B 4N8ZA 4KT3A 3P64A 5LA5A 1IOCA 1HC0A 1GF7A 1GPQC 1W6ZA 4NHIA 1FKQA 2DQAA 1OUBA 1IWVA 4J1AA 1LZEA 1A4VA 4G49A 4ET9A 2C8OA 3WU7A 4GLVA 4WOAA 1FDLY 1LHJA 1LZ4A 2WARA 2Z37A 1IO5A 1JIYA 1JTTL 1HEWA 1UBZA 3KAMA 4N0JA 3TXHA 1FLWA 3CT5A 1JPOA 2ZILA 3WU8A 1JSFA 4HP0A 2D91A 3QNGA 3TXJA 1LSGA 208LA 1GE0A 4LFXA 1H6MA 1AM7A 4ANRA 2D4KA 1IX0A 4NGWA 1DI4A 1FLYA 3B6LA 4DD1A 4H9AA 4OWCA 3W6CA 1AKIA 1HEMA 1G7MC 3A6CY 2HUBA 1BQLY 1VEDA 1LHMA 1LJ3A 1YANA 2MEHA 4LYOA 5APCA 5B07A 1WTNA 5T3FA 2YSSC 1IY4A 2ZYCA 3WU9A 1GE2A 1IWTA 4H9HA 1LZ1A 5APDA 5D5FA 3W6BA 3VWOA 4B4JA 1RCMA 4WLXA 3AZ6A 4LT1A 4WMGA 1HMLA 5B1FA 4HTNA 3EBAB 5D5CA 3WW6A 1XEIA 2G4NA 3T36A 3CT0A 4RW1A 4ZIXA 1BB3A 1OUAA 4R6CA 2B5ZA 5LYMA 1B2KA 1VAUA 4I8SA 1XGQC 3LYTA 5I4YA 2D4IA 4I0CA 5DLAA 1JUGA 3A94A 1LSZA 2BAAA 1MLCE 1NQIA 1QTEA 4NHPA 3AYQA 1INUA 4ETEA 2XTHA 4G4CA 1B5WA 5I4WA 3IJUA 3A90A 1IR9A 5FELA 1YL1X 4CGEA 3CQLA 1KIPC 5E4PA 5LVGA 2BLXA 4GN3A 5I54A 2Z2EA 1FLQA 2YBMA 2FYCA 1ALCA 4II8A 1LAAA 1GEVA 1B7NA 1DKJA 2Z2FA 1VDTA 2HU3A 1IEEA 2MECA 4GCDA 1LJIA 4HPEA 2PC2A 5LVIA 5HMVA 1LOZA 1Z55A 4GCBA 153LA 3RT5X 1HFXA 3ZVQB 3TXFA 5KXKA 1JTOL 133LA 1WQRA 3A6BY 4WL6A 1UIDA 4HJVA 5DL9A 3HBEX 1HENA 2YVBA 2BQBA 4GCCA 1LCNA 1B5XA 4TTDA 3J6KA 1REYA 4G9SA 5LINA 4RW2A 3AGGG 1GFAA 4N9RA 4NGIA 4TSCA 1D6PA 1O23A 4ML7A 2N5ZA 1IY3A 3CSZA 4NSJA 4N5RA 1T3PA 1IOSA 1UCOA 2BQKA 2HEFA 4OOOA 4WLTA 2IFFY 2YBIA 1GAZA 3A3QA 5KXTA 1HNLA 1C10A 1LZGA 5KXPA 5I5QA 3W6DA 4UWNA 4E3UA 3LYZA 3IWRA 3AW7A
chains in the Genus database with same CATH superfamily
4DR5M 4LFBM 1MU5A 1LHKA 3FRIA 3K9OA 3JR6A 3GLIE 1NY5A 3QAKA 3GULA 1L44A 3PNYA 2JXNA 1YE9A 8LYZA 2BQJA 3U6DA 2MEBA 3WMKA 3HJSA 1GD6A 1HF4A 1LZ8A 3HUKA 2BQNA 4PHIA 1GB6A 157LA 1WQNA 175LA 2QZ4A 4OX9M 4HJZA 2O5RA 4BB9A 3HTGA 2BQMA 4RKUF 2FOIC 2RB0X 1EFUB 3A8ZA 3OK0A 2DZOB 1C6DA 4NGVA 5LVKA 2Z6BA 253LA 1IP4A 1HHLA 5DYIA 4LJ9A 1QUHA 3DN4A 1DPWA 2WSEF 1L63A 187LA 3KVWA 4M9XA 5KKJA 2HEDA 4ARPA 154LA 1GBZA 2OOBA 1D0LA 1C65A 4C5FA 3KS4A 2MH8A 1N36M 2F47A 4GH9A 2EQLA 4JXJA 1GF3A 3DN2A 1GXV2 1E9SA 3LW5F 1LSPA 2MEGA 3HH5A 2RBOA 3N9AA 1LMNA 4IJEA 239LA 3HU8A 3F92A 1L75A 2Q0MX 256LA 5ITYA 1L24A 2HEBA 246LA 1GDXA 4B7FA 4ZFPA 1CKGA 4OWEA 4HPIA 4YHHM 2G3QA 1CJ6A 3ULRA 4LT0A 4LFCM 1IWUA 2CE7A 5IT9S 5A3ZA 1LI2A 3GLIA 2LVPC 1P56A 2CFOA 2KNAA 3FTFA 1L01A 3N9EA 3AGIA 4NWHA 1LZSA 4QGZA 3F8VA 3NY8A 1L69A 4I7JA 113LA 1PJJA 200LA 227LA 1L21A 2DQEY 3TXBA 4I4LA 1L11A 1QTCA 3LHMA 1C6CA 4KLNA 1GFKA 4DD2A 1L86A 1IFYA 4YEMA 2ZAOA 3WXTA 2Z4RA 3LCUA 163LA 3WHKA 158LA 131LA 1OP9B 4W51A 3ATOA 4NSGA 4I7TA 2YQZA 1CNSA 6LZMA 1C69A 3PDSA 1F10A 1SWZA 4LGYA 3LYMA 1JTMA 2Y0QA 1WHCA 3B9PA 1PQOA 1PQKA 1C7PA 1GB3A 1IXSB 1N77A 1CU2A 2E5LM 137LA 4LT3A 4LYZA 1IP7A 2KW0A 152LA 209LA 4X3BA 5C6LA 3WULA 3DA1A 2RGHA 1LYHA 1ZYTA 1IC4Y 4YXAC 1D0KA 145LA 3RGPA 1YILA 1ZVYB 5KPRA 2YBNA 1DQJC 5AMYA 3BKHA 1GE3A 2BNKA 1L97A 2DQCY 3IJVA 1LTMA 1SQ2L 2RAZX 1JJ3A 1HFYA 1G8PA 3DN8A 3HU1A 1Q3BA 1REXA 5IELA 4GN5C 2Z4SA 1L43A 198LA 4FWGA 5E26A 2OQ4A 2A7FA 1L76A 148LE 4ARLA 1J09A 1IVMA 1L38A 1BVKC 4H93A 4HTQA 5FSTA 4DR6M 2KZUA 4X64M 4DR7M 2QCUA 3IHPA 3W67A 1C1KA 3HH6A 4ARJA 1E8LA 3WPLA 3DNAA 1UACY 1LYZA 3FE0A 130LA 1LJJA 1CV3A 1L99A 4J7VA 4XJIA 1JWRA 3C7YA 3EIHA 1QSAA 1JHLA 4XJGA 4LF5M 4FWHA 3W3EA 1L12A 4D9ZA 2ZAMA 2R0IA 5B06A 1P3QQ 2QHOB 2RBQA 2UXDM 1C66A 2H1RA 2KZSA 3L2AA 4RLNA 3GQ4A 2BQDA 1GF4A 4NGKA 1LKSA 3DMXA 4IAPA 1FLUA 4NFVA 4F1IA 5HNCA 1GE1A 1H87A 1LPIA 2CJLA 2IHLA 5ILFA 4MH0E 2KRUA 3TXKA 4LJ6A 4NGOA 1R6BX 4IBBA 4Z3MA 1HEOA 1NVMA 2OTZX 2G4QA 114LA 191LA 2F4AA 3GP1A 1OFHA 3GLGA 4GEWA 1P36A 4GMQA 1D2NA 3AGHA 3SC3A 4NRVA 3M7GA 1LZYA 5KXWA 4IJFA 1KY0A 1OUHA 1NBZC 3SP3A 1GDWA 5C6IA 3LQQA 1V33A 2XJWA 1OWYA 1J1PY 4MGKE 1VATA 1HSXA 3C8RA 1C6NA 5EP3A 1WQMA 3C8SA 1L19A 1AT5A 1L34A 1C6GA 2QSFX 2BQCA 1LYYA 4YX7C 1KS3A 1LZ9A 220LA 1IWYA 1IOTA 1LSYA 3B0IA 1B6IA 1G3IA 3KSXA 1QSWA 1JKDA 1L93A 3FUTA 3K1JA 216LA 3W0LB 3T1HM 1R2ZA 4TX7A 144LA 3RNXA 2MR9A 3TMXA 3C3EA 180LA 2AHMA 1BVXA 2DVWB 3FI7A 1GL6A 2G4PA 1Q02A 3U6SA 1SX2A 1LMCA 4TUNA 1GABA 5F9UA 2MEFA 1DGHA 1BB5A 3WL2A 212LA 2QPAA 4PJZA 2FYDA 1LHLA 4N1EI 1L61A 1ZV5L 3A3RX 176LA 1AIPC 1HT1E 4O34A 3U6EA 1T8FA 2DZNB 2RSCA 1B7OA 3CDVA 1WVUA 4WLYA 1C60A 1R4GA 3M18B 3GLHA 5E9RA 4AQYM 5KXYA 3WPJA 4ARQB 2HL7A 1B5ZA 1EL1A 5F14A 177LA 1C61A 1C64A 4PGJB 3C82A 1SXJE 4MR1A 2K6BA 3L26A 1PM5A 1GL7A 3L64A 4WO6A 4QEQA 1NDGC 193LA 2A5YB 2DQJY 4HSFA 171LA 3J4GA 4XJDA 4OWAA 2A4TA 1LMOA 3WPKA 2Z12A 2NTGA 1XMOM 1IP3A 1K28A 4LYTA 2R46A 3HBHA 3T6UA 1B7SA 1SLYA 1D2YA 2DKVA 5EP4A 196LA 1A2YC 2VF8A 4DV6M 1L46A 2DBTA 3EIEA 4ET8A 1GFJA 4G6ZA 1P46A 4N8ZA 4KT3A 4IIWA 1GPQC 1L16A 1TDHA 1OUBA 1P64A 147LA 1LZEA 1L2CA 4G49A 102LA 4EKQA 2WARA 1IO5A 2O25A 1UBZA 3KAMA 1L65A 3U60A 1FLWA 3CT5A 2L6OA 149LA 3U6MA 1GE0A 5I54A 5LVGA 1AM7A 1IX0A 1DI4A 4LJ4A 1G7MC 2ANXA 4R3DA 1OFIA 1P2RA 2HUBA 4RF0A 5A3EA 2MEHA 1LJ3A 112LA 5C1BA 2XFTA 2ZYCA 1IY4A 1SXJB 5EP1A 1GE2A 3VKHA 3W68A 3VWOA 3SB6A 3T1YM 1HMLA 5B1FA 5D5CA 241LA 3TWKA 2XEPA 2MGWA 3WHLA 4RW1A 4ZIXA 2KNVA 2YR0A 1CU6A 3A45A 4R6CA 3PFIA 4LGMA 3LYTA 1MLCE 4S12A 1HNZM 4ETEA 3MK6A 1TH4A 2EUCA 3IJUA 5LZMA 1L14A 4CGEA 3HWLA 3PNVA 4AKIA 2Z2EA 3B7QA 2YBMA 1KW5A 4LF8M 1GEVA 2HCBA 1B7NA 2R6FA 4XK8F 1G1VA 1VDTA 2HU3A 165LA 5LVIA 4IBKA 1HJPA 2JY6B 1QANA 223LA 4M9ZA 1WQRA 5DL9A 1L08A 4GCCA 1SX7A 1VEKA 1LCNA 2JY7A 4G9SA 4TSCA 4DQJA 4NGIA 2JNHA 1G0QA 1L23A 3CSZA 4NSJA 4Y28F 4N5RA 1OV7A 3RZEA 3M0EA 3A3QA 1HNLA 1T43A 1L18A 1BVSA 3LYZA 1KNIA 2DNAA 2JY5A 1C6TA 4LFPA 1L70A 1IC7Y 3CF2A 1HNWM 210LA 4MCKA 1IOQA 5DN5A 1GBWA 1NY6A 3N9CA 1DYDA 1OVKA 2MEDA 1W5SA 3HJ8A 1J1OY 4JI7M 4BADA 5LA8A 3GUNA 4IATA 1GBOA 3DMZA 2B6XA 2X49A 1C08C 3KW6A 1CU5A 214LA 1GE4A 1L39A 2LBCA 3H4JA 4LYCA 4LZZA 1YKZX 3B0OA 5KPZA 4WG7A 1EIJA 4KL7A 5APFA 4R7GA 3ATNA 4L8RC 3QYBA 2O4WA 1BB4A 255LA 3DOAA 3A34A 3AFHA 3J2PB 4L41A 3SATA 1L57A 3CDQA 1N33M 4WM3A 2CWBA 1Z59A 2B75A 2MEIA 1I94M 4I5SA 1YLAA 2YFQA 2LYMA 1LJKA 1P2LA 3KDSE 1CKHA 1L36A 1KXYA 4W94A 3FYCA 4L6V6 4JN6A 3U61B 3MHVC 1YQVY 3HU3A 1WR1B 3I4YA 4DQ7A 1IC5Y 1DXJA 1YL0X 4PRQA 1QDTA 2FBDA 4REZA 160LA 1HR0M 3C80A 2EKSC 1QT7A 2XLJA 4KXIA 2I25L 3K9PA 1BWJA 1WXQA 4JI6M 2VQFM 4DWXA 3ZQJA 4IASA 3J27B 4WURA 2F4GA 4XJBA 199LA 4QY9A 2FBBA 1LKRA 2XSZA 3IG5A 4NSRA 1L73A 2YBHA 5FHWA 3SB5A 1G71A 2ZTCA 3KXEC 4G4QA 5HNLA 1LSDA 3FUWA 4B4EA 3W6AA 126LA 1KIQC 1ORYB 1D3NA 123LA 4NGZA 2YBLA 2M5ZA 1LJGA 4A3VB 229LA 2RRUA 2DQFC 1DYFA 3ZCBB 1G59A 1TEWA 135LA 2QARC 3SBJA 261LA 5ITTA 3THGA 2CWIA 3QAUA 4GCFA 1IP6A 225LA 2VDBB 2L7HA 5EXPA 5IWAM 207LA 2UUCM 4N1CC 1XEKA 1DYGA 3TMUA 3D4SA 1AT6A 4NG1A 2ZQ3A 5F9XA 1C45A 3D8LA 3C8QA 1L53A 2FH0A 3D8BA 3LQRA 4RF1A 3UK6A 2L7IA 2FE8A 233LA 5C6JA 1GHLA 3HU9A 4LF9M 1DYBA 3KP1E 1G0JA 4LYBA 1QDRA 1GB2A 4I7NA 1GLNA 143LA 3B0KA 1CUQA 3LYOA 4CIZA 1NO1A 3G3AB 1L90A 3TWLA 3LN2A 1FN5A 4DQ5A 1YAQA 1GFTA 3GPPA 1REMA 3GPUA 3CDTA 5GKNA 4CGYB 5FDJA 1FKVA 1TH2A 1SG9A 3EXDA 4LF6M 3UJNA 2CV2A 1YROA 1L71A 2APLA 3KFUG 244LA 190LA 2ANVA 1VDLA 1NMMA 3JAMS 1CJ7A 3I01M 8CATA 1QAQA 3U6OA 3UZUA 2HUMA 3FUVA 3J80S 1LMAA 1G41A 2BQLA 4H9BA 5FEKA 4ETBA 1LHIA 1P3NA 3A96A 1LJ4A 2DQDY 2OEAX 1HMKA 2R4JA 2NQ8C 1C6MA 1G0PA 3C83A 1KSFX 2Y20A 2LHMA 122LA 1LLHA 2JWSA 183LA 1GB8A 5L9JA 3E21A 4IBIA 4G4NA 3VKGA 2EO2A 2JZ0A 1L62A 2XH9A 2ZYPA 5ITQA 3HTFA 1EQEA 1UIGA 3OE8A 2MEAA 4OU7A 3VW7A 3HT7A 1C6PA 4TWSA 5KXLA 3CB7A 1K3XA 3HDFA 3B72A 5LMUM 3CSQA 1LJFA 4LDEA 1AUAA 4B3MM 1IR8A 1LSAA 3UONA 1L60A 1UUZC 3CT1A 2F2QA 4I8OA 140LA 3GLIB 2D6BA 3CSRA 4H9EA 4GHAA 1J7KA 4JYAM 1JB0F 3C3DA 2HWJA 2JA2A 4BBAA 3C7WA 1WTHA 1LMQA 1L91A 3NYAA 2BQGA 1SSWA 4DV3M 3OE0A 4DV2M 2L2DA 1PQDA 3WUMA 132LA 2DQIY 3F9LA 4AKGA 1L28A 1Q3CA 4NC6A 2Z39A 4FDYA 1OVJA 1WTMA 4NHSA 2G5GX 2L78A 3VDPA 1LZTA 1QZMA 1G0LA 4H94A 1I6SA 4OW0A 1LZ5A 5KXSA 2CV1A 1TAYA 5K7OA 1LJHA 4LT2A 2K47A 2L4FA 4Z8XA 4GRIA 162LA 3KOXE 2H9KA 4LJ8A 1B7RA 4WM2A 6LYZA 1C67A 188LA 3U6LA 184LA 1UM8A 4MB7A 237LA 2ZBKB 4NXMM 215LA 1V34A 2XQOA 2KDLA 3VLFB 1B5YA 170LA 5APEA 5IDDA 3RU5A 2V1UA 1JR3A 3VK8A 2EPEA 1QAOA 4NHQA 2C98A 5LAGA 4HV1A 2LYZA 3K92A 3GLFA 5LYZA 1DO0A 1CTWA 1G7IC 1L31A 1UIHA 3DZDA 1CKCA 1C43A 4M0WA 4IJ4A 2LCBA 4EJ4A 218LA 1L29A 3G3XA 4LZTA 2Q9DA 1E9RA 1BGIA 2LVNC 4PRUA 4IBGA 3Q8GA 1BWHA 3IECA 3BKVA 2YBJA 3U5ZA 5FCPA 2VB1A 4WLDA 4BLCA 2RBNA 3ZC7B 2HAKA 3GLGE 1DYEA 4R71A 2HECA 4YF2A 1GFGA 1HQCA 230LA 1OUIA 3Q8XA 2CEAA 4B4IA 1LYEA 192LA 4I7QA 3K2LA 3TPZA 1L06A 1T6HA 4P16A 3AOGA 3IG8A 1L10A 1REZA 3UGJA 1L68A 1KIRC 1B5UA 1XXHE 3TXEA 252LA 2AUBA 195LA 3MMPA 4H92A 5KQDA 109LA 3B89A 4LFAM 1OQYA 3GRYA 5BPVA 1XFPL 5FTMA 194LA 2ZM6M 1QIOA 1HNXM 3NBIA 5I4XA 3ILKA 1WQPA 4DKLA 4DR3M 3GUPA 4NGJA 3TMVA 1NNJA 2IGCA 1FNNA 3B7ZA 1L96A 2D4JA 2RAYX 5B1GA 2VF7A 3WVXA 2Z7JA 1MN3A 4B7HA 1IP5A 3ODUA 1W08A 1P2CC 1D9UA 110LA 5ITXA 1LI3A 5LA5A 4ET9A 2C8OA 1L27A 3WU7A 2HKJA 142LA 1JTTL 1HEWA 1KYIA 3GLGB 2UXCM 1JSFA 2D91A 3QNGA 150LA 3GQ5A 1H6MA 4DD1A 2X8AA 4NGWA 3B6LA 3HKPA 3SYKA 1L77A 3W6CA 1AKIA 3A6CY 4LYOA 1QSBA 2EA0A 3L29A 2KA6B 3GLHE 4IBFA 2QQ8A 5IZ7D 2YSSC 1TH3A 1NHBA 1QT3A 1Z5BA 1IWTA 3UMMA 1OV5A 5APDA 4LDLA 4B4JA 3L27A 3CGWA 4WMGA 4HTNA 3EBAB 3NY9A 3WW6A 2RBPA 1X37A 1XXHA 4MGIE 2MROB 1P37A 5LYMA 2D7EA 1SXJD 1B2KA 1F4IA 3TE6A 1L54A 1OIZA 2XTHA 4G4CA 5I4WA 3CF0A 3QWLA 4LCBA 3CQLA 2V6ZM 1KIPC 5E4PA 2CHGA 4QHTA 1Y8GA 1ALCA 2OU0X 4EKSA 1DGHB 1DKJA 2FS1A 1LYFA 2NTHA 4GRVA 1KW7A 4ZPUA 1LOZA 4GCBA 3HGIA 1DYAA 1L04A 1L80A 2FFJA 5KXKA 1IY0A 4WL6A 2DKLA 4HJVA 3HBEX 2YVBA 2QP9X 4TTDA 2O01F 4W5WA 1LI6A 1REYA 1XWIA 1ZAEA 3J6KA 1IY1A 4K5YA 4RW2A 4N9RA 1VDDA 1D3MA 1D6PA 4ML7A 2C9CA 1IY3A 1IOSA 2HEFA 1CV1A 2B74A 2IFFY 2YBIA 5KXTA 1IXZA 3GLHB 5I5QA 3W6DA 4UWNA 4B7GA 1N34M 103LA 4W57A 2HEAA 1S3SA 4H8ZA 4P2EA 5DYGA 2ZANA 4NGYA 2R65A 5EJCA 2LXEA 1CVKA 1NWGA 4R0FA 1ZQ9A 3AJNA 2MEEA 2UUAM 1XMQM 4L15A 2Q2EB 1YAMA 3MGWA 159LA 2D7HA 238LA 1WGNA 3SMPA 4BAPA 4C3WA 5FTJA 3FA0A 2VQEM 4NSIA 3A42A 1IBKM 1C6QA 1QT6A 2LH0A 4LZJA 3CTWB 3AOEA 1CU3A 1GF6A 3JR4A 3V2YA 4CHXA 1XB2B 2G8LA 2JZ1A 7CATA 3WXUA 1G0MA 2ZWBA 1NHGC 1L26A 219LA 4NIJA 1QAMA 1GBSA 5IHGA 128LA 1QUDA 2BQIA 2Z8YM 1LYDA 2CDSA 3K2RA 3P65A 4H8XA 4XENA 1L59A 3F6ZA 1TCYA 4Z41A 1XGPC 5KXNA 4DDBA 2OE4X 3WUAA 3HHWA 169LA 5JENB 2DZLA 4CFOA 3WH1A 1YSYA 3U60B 4H1PA 3L28A 2OTYX 1LZDA 3EMLA 1YAOA 2DWLA 2C8PA 3LZ2A 1LSBA 1UC0A 2LNHC 1K3WA 4PDGA 4DC4A 3TL4X 5KXRA 3G3WA 1IN5A 1LYSA 2LHCA 1T3TA 1L0JA 1FJGM 3SASA 1L25A 3FKEA 4FCWA 1IP2A 2I26L 3T15A 1GF5A 1D3FA 1D6QA 1IXRC 4B1AA 3CDRA 4DUZM 1I56A 4YOPA 1HERA 1LPYA 3K3TA 1V92A 4DD9A 4AQNA 1GVNA 3GUKA 1Z6TA 2I6ZA 4I7LA 3RZ4A 1OUGA 2F5QA 2OU8A 5KXXA 2BQFA 4QOZC 1OVHA 4DV4M 1ZMYL 186LA 1LSFA 4NG8A 3OE6A 1QQYA 1L00A 4KODA 4DJHA 5F81A 221LA 1IP1A 4H9IA 4GCEA 4WP2A 4MGZE 5LMNM 2RKOA 4WM6A 1N4FA 1LZ6A 224LA 1OUJA 5EXXA 205LA 259LA 4IBEA 3V76A 1HQYE 1CJ9A 4DR1M 3HZJA 1CU0A 201LA 4UN2B 1XJTA 2F32A 1D2WA 2UU9M 1Z5CA 129LA 243LA 1LMPA 4I7PA 2HTXA 1SSYA 3C58A 3SYLA 1LGUA 4UWUA 139LA 1GF0A 1B0DA 1L13A 5F3WA 1DYCA 3A92A 2Y0TA 4PJ2C 4B0DA 3KP0E 3GRVA 2HHHM 119LA 1ZMVA 1Z5AA 1LGXA 2JUJA 5B59A 1YKXX 1R5LA 4JI1M 146LA 2F5PA 3GXRA 4NSHA 4EKRA 5KPTA 3SARA 1GAYA 1L32A 1QQWA 1T8GA 3HT9A 2XBRA 2QENA 1DPXA 2J7NA 1RE2A 4RLMA 1C6KA 4MSTA 2XF3A 1GBXA 2DQGY 1L64A 1L09A 231LA 4EKPA 1L07A 1VDSA 1XHBA 4LRSA 1K82A 1OYUA 1IWZA 2R18A 1RU3A 2B3TA 4IBDA 3A91A 3AKZA 4DYGA 5HQ1A 3SHGB 3TMWA 1LWKA 2BQEA 4AI6A 3EO5A 4WM4A 1DI5A 222LA 2RB1X 2ZTDA 4ARMA 4OO9A 182LA 1ZMWA 1JITA 3A98B 1IR7A 4DD3A 2DHYA 1OUFA 4L78A 1XGUC 3GUIA 127LA 164LA 2CHVA 1QUOA 2Z38A 3C9PA 3E46A 3HHXA 1PQIA 4M6DA 4J1BA 2X0AA 4M4OA 155LA 1GJTA 2Z18A 1CUKA 4B49A 5I14A 4GITA 1C6AA 3W0FA 3L2XA 3BBZA 5L8RF 1NBYC 2B72A 2RGOA 2BJVA 1GEZA 1L30A 1GB7A 1WQOA 1GWDA 2W1MA 4GKJM 2C99A 1L1ZA 2OOAA 3G3VA 1W5TA 1QTBA 5EXTA 5FSWA 1C63A 1IIZA 5KXZA 1HEQA 2F30A 3FTEA 4YXCA 3U6PA 4AG6A 3VK7A 1JKAA 1EQ5A 4W56A 1TDYA 3J81S 1C6IA 1L2BA 4AG5A 1QTKA 2UXBM 1DGFA 1GB5A 1LGWA 5KXMA 2B6YA 118LA 3SFZA 1V7SA 4Z6YA 5LVJA 4EIWA 5F16A 1QTZA 3QE8A 4ETCA 4LJ5A 6LYTA 3K8ZA 3SMSA 1T6VL 1G0GA 1C6BA 4W96A 1D0MA 3A67Y 4DV7M 3W6EA 1PJQA 2DI0A 2DHRA 1KFVA 1AZFA 3DN0A 3DN6A 141LA 4H90A 2A7DA 3AJIB 4P17A 4QNMA 4RNAA 3VFDA 4XBOA 4U3XB 166LA 1L22A 2CP8A 1QT8A 151LA 2CUZA 1QUSA 4H9FA 3KOWE 236LA 1DV0A 107LA 1VDQA 3I4VA 4JI8M 4NRWA 1LSMA 2LYOA 2R44A 5KJ9A 1C68A 1IQPA 262LA 235LA 1JJ1A 1OAIA 4PT5A 4GN4A 4Z98A 1LZNA 1T8AA 1L83A 4H8YA 1DI3A 3BOSA 4WG1A 4FVMA 1DGBA 1PJTA 1JTNA 1L49A 1UIBA 2UUBM 3ZVQA 3W6FA 1B7PA 4YM8A 3GRRA 3T6PA 1GBYA 1XEPA 2W1XA 1PJIA 3HHYA 4G4OA 3A93A 2P5TA 3D9AC 5KO3A 5L3IA 4UWVA 4LDOA 4L16A 3KOYE 4W58A 2Q9EA 4FCTA 4I81A 9LYZA 1GF9A 1L1TA 5IREB 1XSFA 3I51A 1QS9A 1LZCA 4YENA 4ZEEA 2K9DA 1OUCA 3BXWA 3GRUA 1NSFA 2DAMA 4NXNM 3GO8A 1L40A 1L58A 1QT4A 5H37D 1L15A 1LMTA 3GPYA 3J7AS 1GFEA 1NDMC 5II3A 4G4RA 4LJAA 3SB8A 1DZBX 1C7YA 1HSWA 3WVYA 1P5CA 1LW9A 4I7SA 5LVHA 1JR3E 1L55A 251LA 1JSEA 3HUQA 4GLAA 3DFZA 4NSOB 3SN6R 2C96A 3GLFE 1XNRM 167LA 4DV1M 4W53A 2BWEA 4DBGB 2OO9A 4JI2M 1LSNA 3LZMA 1HC0A 4B3SM 1W6ZA 3QYEA 3FADA 3T38A 1E94E 1TDZA 1A4VA 3KOZE 4WOAA 1JIYA 1OWZA 1JPOA 2ZILA 5JI3E 3WU8A 4HP0A 1ZV1A 1R7RA 2Y21A 3FTCA 1L41A 208LA 4QOSA 4CHTB 1IY2A 3AOEC 3HH3A 2B6WA 3GPXA 4OWCA 3LVWA 4MGHA 1C6LA 3HUAA 1BQLY 1VEDA 1LHMA 1YANA 5T3FA 4ZPXA 3SBAA 104LA 1A5TA 1LZ1A 5D5FA 2RBRA 1RCMA 4WLXA 3AZ6A 3HHZA 3R8FA 3SAWA 3FYDA 1XEIA 1G06A 3CT0A 2F4VM 4JI5M 2B5ZA 1VAUA 4I8SA 234LA 1L89A 1XGQC 2D4IA 2O7AA 1JUGA 1LSZA 226LA 1QTEA 4NHPA 3AYQA 1L74A 1B5WA 3GLFB 3A90A 4EXMA 1C6HA 1CV4A 1NV8A 1OIPA 1FLQA 2LWXA 1T97A 1LAAA 1IBLM 1L82A 2MECA 1WGLA 3GQ3A 4OVZB 1LJIA 2PC2A 4HPEA 3FE3A 2GNOA 5ITXE 181LA 3FTDA 153LA 5ITUA 1HFXA 5DFLA 3U6CA 5EP2A 4KHPM 1N78A 3U5ZB 4CJ6A 133LA 1L66A 3A6BY 1IXSA 3C81A 1C6EA 4OVZA 4D81A 2JY8A 2LC9A 3AGGG 3OE9A 1GFAA 4FCVA 2DXIA 3CDOA 1T3PA 2QNJA 4OOOA 4WLTA 3B74A 3NBXX 1L52A 4W59A 1L02A 4E3UA 1CV6A 3GUMA 3IWRA 1XEJA 4ITQA 1CV5A 3B7NA 4CISA 1L94A 4XN6A 1G7LC 1QTHA 5DN4A 4EOFA 1QUGA 3EMSA 4HEOA 1E32A 4G4BA 197LA 1SXJC 1QVRA 1BB6A 3OTOM 1LYGA 4DT3A 213LA 1L05A 2OPFA 1L20A 2W1LA 4WL7A 1XC8A 4NY5A 3LMMA 1NF5A 3E3DA 2WSCF 2ERCA 5EQTA 3G3BB 3V2WA 1PQJA 1BHZA 4WM5A 3D3DA 1L45A 2QBYB 1GFRA 3PXGA 1JISA 4FW9A 3L25A 1VEJA 2L09A 3SAVA 1CX7A 4F2LA 2ZIJA 3C7ZA 2D7GA 2H9JA 2QBYA 2WZJA 189LA 4KPMA 1P7SA 1F0WA 3RGSA 4QNRA 1IWWA 1C6JA 1QT5A 1GFHA 1C6FA 1LV7A 3FD9A 1NHWC 4B3RM 3GUOA 4D80A 1GKIA 3HWSA 2RBSA 2CUUA 4W54A 1Q39A 2I7PA 5DM9A 5M1YA 1WJ7A 178LA 1ZVHL 2QB0B 4PDIA 2DAKA 3E4RA 4QHSA 4J0LA 2CHQA 1NJFA 1L56A 247LA 4AXTA 3HJQA 1L98A 4PCZA 1PZYA 3SHFA 2KEBA 1LZAA 1L50A 2K0BX 4A7DA 4OOTA 4DUYM 3P68A 1CUPA 4ETAA 7LYZA 4PK0A 3VDUA 2Z19A 4NEBA 108LA 4OWHA 1KXXA 2B73A 2L4EA 1XXHB 2XGNA 242LA 1IN8A 2HEEA 2EJSA 4YY3M 2C9OA 2ZQ4A 1MX0A 3HX3A 3AL0C 3QY4A 4JI4M 4GC5A 2CRUA 1L47A 2YNMD 1G07A 2CV0A 3TQSA 4KO8A 1G7JC 248LA 3HBDA 3WYHA 1B5VA 4PPOA 4QDNA 1TGUA 4HV2A 2BWBA 2BQAA 1JJ0A 2DWMA 3J7BA 1B7QA 4NHTA 4TSBA 1L67A 174LA 232LA 1B7MA 4G4HA 3E9SA 2N35A 3NWLA 1L42A 3PBLA 4CFPA 1VDPA 1N32M 1L92A 1HFZA 1LYIA 1DO2A 3A95A 1NHEA 4I7RA 1B7LA 1IBMM 120LA 3AB6A 5ILCA 1NV9A 1SWYA 1UIEA 4HJYA 3SB7A 1TBYA 2XFSA 1IORA 4BS7A 4AW4A 1L2DA 4GHLA 3HH4A 2JP7A 185LA 4M9SA 1HEPA 4LRTA 3DN1A 1LSCA 2I7NA 4FJRA 4I7KA 3P4ZA 4E97A 1GB0A 7LZMA 2EKFA 2LZTA 3AZ7A 4EMNA 4TUWA 1PRBA 5JI2E 1JKBA 1GB9A 4YEOA 3RFWA 4AKHA 2CGIA 5KY1A 1J1XY 4JV5M 111LA 1LZBA 2DWZB 2BQOA 1GJSA 1VQ1A 1NKHA 4K0KM 4EPFA 2EIZC 4LJ7A 5KQ8A 1JEFA 1QUTA 249LA 3TWMA 1CJ8A 3HTBA 4OW1A 1LJEA 1L37A 1LYJA 2BLYA 206LA 3CF6E 2MJ5B 1I20A 260LA 4WW0A 2BQHA 2LHGA 2BJWA 2KXEA 4BAFA 1PJSA 2F2NA 1LYOA 1L87A 5KXOA 2ZIKA 1F6SA 3RUNA 1IN7A 1UIFA 4ARQA 2YDGA 1I4WA 1IM2A 2LVAA 4NGLA 4PD2A 3KS8A 2LVOC 5FLXS 5C18A 1NNUC 2W1YA 5HMJA 4XADA 1G7HC 5E6JA 4AGAA 3PVSA 4DR4M 4JI0M 4DDAA 1C62A 4LY6A 2OE9X 1PGYA 3TXDA 1WVVA 4WM1A 1CX6A 1UA6Y 1ZWNA 1MELL 1EPYA 4LGKA 2KRKA 1ZURA 5B05A 1DKKA 1KXWA 1F6RA 4X66M 3P66A 3FUUA 2B6TA 1JQJC 2BPUA 1QZEA 1UICA 2X4AA 2C5RA 3OJPA 4Q7JA 1VG5A 3TXGA 2R4EA 1JQUA 4H91A 1YKYX 1HT2E 2DENA 2EKKA 2XSZD 1BB7A 2NWDX 3SAUA 3DMVA 3M3UA 5I53A 245LA 2LZ2A 4XYYA 2W82A 3HY5A 3ZH9B 3HT6A 4RDSA 1G4AE 254LA 3AV0A 3AZ4A 172LA 3DKEX 4DR2M 3MJ5A 2H5XA 3FI5A 2KHHA 1DGGA 1GXXA 1G0KA 1UFZA 4DDCA 4MM3B 1GFUA 1JKCA 1L88A 2O79A 1SXJA 3AZ5A 4II7A 3RW8A 5BR8M 1GO5A 3WW5A 1RFPA 1GFVA 1YIKA 2XBSA 4JI3M 2HUKA 4DAJA 2DWNA 2ZNXY 5FTLA 2XZUA 3LCVB 1QTDA 5LXWA 3HDEA 1VEGA 2M60A 3LZTA 1XGRC 3FRHA 5KKIA 134LA 4NOOB 1QTVA 1UIAA 1OKSA 1QSQA 1XJUA 5J7CA 1EQ4A 1PS5A 2B70A 1OQMA 2DQHY 2ZNWY 3HFMY 4H9CA 4WO9A 4LF7M 1CKFA 2Y8PA 2DAIA 1R2YA 1ZMUA 1IN6A 3A46A 3DN3A 5L3HA 2VIIA 3AW6A 1I1ZA 4LYMA 5LYTA 1XNQM 168LA 1YAPA 217LA 4ETDA 4OWBA 3ZEKA 4NL4H 1B9OA 1OUEA 1EE8A 4NWEA 3JR5A 1VFBC 1C46A 1WQQA 1D3JA 3HT8A 2LTUA 1RJCB 4X62M 5EXSA 1OUDA 2H5ZA 4DD7A 5A2QS 4D82A 3TXIA 5FTKA 2R45A 1BWIA 2GV0A 4XJFA 1PQMA 2OE7X 5LAFA 4ARMB 5DNYA 1G1WA 1L79A 4L4UA 1P6YA 2J7OA 1IN4A 240LA 4GC9A 1CKDA 1L03A 2RB2X 1V7TA 5EBHA 1OJLA 4X65M 3GXKA 3U6QA 1LJNA 1LSEA 257LA 5HLLA 1FBIX 4AZFA 4Z46A 1XGTC 1HELA 1JTPL 4W52A 1GF8A 4LF4M 1IWXA 4HTKA 156LA 4DD0A 3SB9A 1L35A 1TR8A 4XJHA 5LIOA 1L51A 3HU2A 3WUNA 4CJ2A 4HL4A 4I7MA 2J5YA 1LZRA 2R62A 1J5EM 2HU1A 1QS5A 1LHHA 4LG2A 1RI8B 1TLAA 3P64A 1IOCA 1GF7A 4M0DA 4NHIA 1NJGA 2F5SA 1FKQA 2DQAA 4I7OA 1IWVA 4J1AA 4GLVA 1FDLY 1LHJA 1LZ4A 2Z37A 5ITRA 3LVVA 1L48A 4N0JA 3TXHA 3FUXA 2DAEA 125LA 3H4MA 3U61A 3KSJA 4KT0F 3TXJA 4XGIA 1LSGA 1H6UA 1WIVA 4LFXA 2D4KA 4GIPA 4ANRA 1L17A 1FLYA 4H9AA 3GUJA 1HEMA 1OTRA 1L81A 5B07A 5APCA 1WTNA 4LZMA 3I04M 1L95A 1L8QA 3WU9A 4H9HA 3W6BA 1KY1A 2V1CA 1N75A 2F5OA 4W55A 4LT1A 2B7XA 3HTDA 1TF0B 3RE8A 2G4NA 3SBBC 1L72A 3T36A 2FNAA 1BB3A 2HULA 2KNZA 1OUAA 161LA 5I4YA 4I0CA 1YUBA 2F5NA 5DLAA 3A94A 2BAAA 4FWDA 2XZFA 1NQIA 1INUA 4IBJA 2LVQD 4EPIA 1IR9A 5FELA 1YL1X 4GBRB 2DAGA 4MGYE 1LWGA 2BLXA 4GN3A 1T6OA 2FYCA 4IBCA 2RH1A 2OU9A 4II8A 3M6AA 2Z2FA 4GCDA 4DV0M 173LA 1JR3D 1MJGM 1QYRA 4DV5M 5FTNA 1IEEA 1L33A 5HMVA 1Z55A 228LA 2Z3XA 3R9XB 3RT5X 3ZVQB 4HLQA 250LA 2WSFF 3TXFA 4B08A 1JTOL 1L0KA 1UIDA 1D9WA 1HENA 2BQBA 4FD2A 1B5XA 258LA 1TTEA 5LINA 4G3OA 4GKKM 1CV0A 1L84A 1O23A 2N5ZA 2LZMA 1L85A 2BQKA 2GQFA 1UCOA 4S0WA 211LA 1OAOC 1GAZA 115LA 1LZGA 1C10A 5KXPA 4B3TM 138LA 2B6ZA 3AW7A
chains in the Genus database with same CATH topology
1LHKA 3JR6A 3QAKA 3GULA 1L44A 8LYZA 2BQJA 2MEBA 3WMKA 1GD6A 1HF4A 1LZ8A 3HUKA 2BQNA 4PHIA 1GB6A 157LA 1WQNA 175LA 4HJZA 3HTGA 2BQMA 2RB0X 3A8ZA 3OK0A 1C6DA 4NGVA 5LVKA 2Z6BA 253LA 1IP4A 1HHLA 1QUHA 3DN4A 1DPWA 1L63A 187LA 5KKJA 2HEDA 4ARPA 154LA 1GBZA 1D0LA 1C65A 4C5FA 2F47A 2EQLA 1GF3A 3DN2A 1GXV2 2MEGA 1LSPA 3HH5A 3N9AA 2RBOA 1LMNA 239LA 3HU8A 1L75A 2Q0MX 256LA 1L24A 2HEBA 246LA 1GDXA 4ZFPA 1CKGA 4OWEA 4HPIA 1CJ6A 3ULRA 4LT0A 1IWUA 5A3ZA 1LI2A 1P56A 3N9EA 1L01A 3AGIA 4NWHA 1LZSA 4QGZA 3F8VA 3NY8A 1L69A 4I7JA 113LA 200LA 227LA 2DQEY 1L21A 3TXBA 3LHMA 1L11A 1QTCA 4DD2A 1C6CA 1GFKA 1L86A 4YEMA 3WXTA 163LA 158LA 131LA 1OP9B 4W51A 3ATOA 4NSGA 4I7TA 1CNSA 6LZMA 1C69A 3PDSA 1F10A 1SWZA 3LYMA 1JTMA 1PQKA 1PQOA 1C7PA 1GB3A 1CU2A 137LA 4LT3A 4LYZA 1IP7A 152LA 209LA 4X3BA 5C6LA 3WULA 4YXAC 1LYHA 1ZYTA 1IC4Y 1D0KA 145LA 1YILA 1ZVYB 5AMYA 2YBNA 1DQJC 3BKHA 1GE3A 1L97A 2DQCY 3IJVA 1LTMA 1SQ2L 2RAZX 1JJ3A 1HFYA 3DN8A 1REXA 5IELA 4GN5C 1L43A 198LA 2A7FA 1L76A 148LE 4ARLA 1IVMA 1L38A 1BVKC 4H93A 4HTQA 5FSTA 3HH6A 4ARJA 1E8LA 3WPLA 3DNAA 1UACY 1LYZA 3FE0A 130LA 1LJJA 1CV3A 1L99A 4J7VA 4XJIA 1JWRA 3C7YA 1QSAA 1JHLA 4XJGA 3W3EA 1L12A 4D9ZA 5B06A 2RBQA 1C66A 4RLNA 2BQDA 1GF4A 4NGKA 1LKSA 3DMXA 4IAPA 1FLUA 4NFVA 5HNCA 1GE1A 1H87A 1LPIA 2CJLA 2IHLA 5ILFA 3TXKA 4NGOA 4Z3MA 1HEOA 2OTZX 2G4QA 114LA 191LA 2F4AA 1P36A 3AGHA 1LZYA 5KXWA 1KY0A 1OUHA 1NBZC 3SP3A 1GDWA 5C6IA 2XJWA 1OWYA 1J1PY 1VATA 1HSXA 3C8RA 1C6NA 1WQMA 3C8SA 1L19A 1AT5A 1L34A 1C6GA 2BQCA 1LYYA 4YX7C 1KS3A 1LZ9A 220LA 1IWYA 1IOTA 1LSYA 3B0IA 1B6IA 1QSWA 1JKDA 1L93A 216LA 4TX7A 144LA 3RNXA 3TMXA 180LA 1BVXA 3FI7A 2G4PA 1SX2A 1LMCA 4TUNA 5F9UA 2MEFA 1BB5A 3WL2A 212LA 4PJZA 2FYDA 1LHLA 4N1EI 1L61A 1ZV5L 3A3RX 176LA 4O34A 1T8FA 2RSCA 1B7OA 3CDVA 1WVUA 4WLYA 1C60A 3M18B 5E9RA 5KXYA 3WPJA 4ARQB 1B5ZA 1EL1A 5F14A 177LA 1C61A 1C64A 4PGJB 3C82A 4MR1A 3L64A 4WO6A 4QEQA 1NDGC 193LA 2DQJY 4HSFA 171LA 3J4GA 4XJDA 4OWAA 2A4TA 1LMOA 3WPKA 2Z12A 2NTGA 1IP3A 1K28A 4LYTA 3HBHA 3T6UA 1B7SA 1SLYA 1D2YA 2DKVA 196LA 1A2YC 1L46A 2DBTA 4ET8A 1GFJA 1P46A 4N8ZA 4KT3A 1GPQC 1L16A 1OUBA 1P64A 147LA 1LZEA 4G49A 102LA 4EKQA 2WARA 1IO5A 1UBZA 3KAMA 1L65A 1FLWA 3CT5A 149LA 1GE0A 5I54A 5LVGA 1AM7A 1IX0A 1DI4A 1G7MC 2ANXA 1P2RA 2HUBA 5A3EA 2MEHA 1LJ3A 112LA 2ZYCA 1IY4A 1GE2A 3VWOA 3SB6A 1HMLA 5B1FA 5D5CA 241LA 4RW1A 4ZIXA 1CU6A 4R6CA 3LYTA 1MLCE 4ETEA 3IJUA 5LZMA 1L14A 4CGEA 3HWLA 2Z2EA 2YBMA 1KW5A 1GEVA 1B7NA 1VDTA 1G1VA 2HU3A 165LA 5LVIA 223LA 1WQRA 5DL9A 1L08A 4GCCA 1SX7A 1LCNA 4G9SA 4TSCA 4DQJA 4NGIA 1G0QA 1L23A 3CSZA 4NSJA 4N5RA 1OV7A 3RZEA 3A3QA 1HNLA 1L18A 3LYZA 1KNIA 4LFPA 1C6TA 1L70A 1IC7Y 210LA 4MCKA 1IOQA 5DN5A 1GBWA 3N9CA 1DYDA 1OVKA 2MEDA 1J1OY 4BADA 5LA8A 3GUNA 4IATA 1GBOA 3DMZA 2B6XA 1C08C 1CU5A 214LA 1GE4A 1L39A 4LYCA 1YKZX 3B0OA 4WG7A 4KL7A 5APFA 3ATNA 2O4WA 1BB4A 255LA 3A34A 4L41A 1L57A 3CDQA 4WM3A 2B75A 2MEIA 2LYMA 1LJKA 1P2LA 1CKHA 1L36A 1KXYA 4W94A 1YQVY 4DQ7A 1IC5Y 1DXJA 1YL0X 4PRQA 1QDTA 2FBDA 160LA 3C80A 2EKSC 1QT7A 4KXIA 2I25L 1BWJA 4DWXA 4IASA 2F4GA 4XJBA 199LA 4QY9A 2FBBA 1LKRA 1L73A 2YBHA 5FHWA 3SB5A 5HNLA 1LSDA 4B4EA 3W6AA 126LA 1KIQC 1D3NA 123LA 4NGZA 2YBLA 1LJGA 229LA 2DQFC 1DYFA 1TEWA 135LA 2QARC 261LA 2CWIA 4GCFA 1IP6A 225LA 207LA 4N1CC 1XEKA 1DYGA 3TMUA 3D4SA 1AT6A 4NG1A 2ZQ3A 5F9XA 1C45A 3C8QA 1L53A 233LA 5C6JA 1GHLA 3HU9A 1DYBA 1G0JA 4LYBA 1QDRA 1GB2A 4I7NA 143LA 3B0KA 1CUQA 3LYOA 3G3AB 1L90A 3LN2A 1FN5A 4DQ5A 1YAQA 1GFTA 1REMA 3CDTA 5FDJA 1FKVA 3EXDA 1YROA 1L71A 244LA 190LA 2ANVA 1NMMA 1CJ7A 2HUMA 1LMAA 2BQLA 4H9BA 5FEKA 4ETBA 1LHIA 1P3NA 3A96A 1LJ4A 2DQDY 2OEAX 1HMKA 1C6MA 1G0PA 3C83A 2LHMA 122LA 1LLHA 183LA 1GB8A 5L9JA 1L62A 2ZYPA 3HTFA 1EQEA 1UIGA 3OE8A 2MEAA 3VW7A 3HT7A 1C6PA 4TWSA 5KXLA 3CB7A 3HDFA 3B72A 3CSQA 4LDEA 1LJFA 1IR8A 1LSAA 3UONA 1L60A 1UUZC 3CT1A 2F2QA 140LA 3CSRA 2D6BA 4H9EA 3C7WA 1WTHA 1LMQA 1L91A 3NYAA 2BQGA 1SSWA 3OE0A 1PQDA 3WUMA 132LA 2DQIY 3F9LA 1L28A 2Z39A 4FDYA 1OVJA 1WTMA 4NHSA 2L78A 1LZTA 1G0LA 4H94A 1I6SA 1LZ5A 5KXSA 1TAYA 5K7OA 1LJHA 4LT2A 162LA 2H9KA 1B7RA 4WM2A 6LYZA 188LA 1C67A 184LA 237LA 215LA 2XQOA 1B5YA 170LA 5APEA 5IDDA 3RU5A 2EPEA 4NHQA 5LAGA 4HV1A 2LYZA 5LYZA 1G7IC 1CTWA 1L31A 1UIHA 1CKCA 1C43A 4IJ4A 2LCBA 4EJ4A 218LA 1L29A 3G3XA 4LZTA 2Q9DA 1BGIA 4PRUA 1BWHA 3BKVA 2YBJA 5FCPA 2VB1A 4WLDA 2RBNA 1DYEA 2HECA 4YF2A 1GFGA 230LA 1OUIA 4B4IA 1LYEA 192LA 4I7QA 1L06A 1T6HA 1L10A 1REZA 1L68A 1KIRC 1B5UA 3TXEA 252LA 2AUBA 195LA 4H92A 109LA 1XFPL 194LA 1QIOA 5I4XA 1WQPA 4DKLA 3GUPA 4NGJA 3TMVA 2IGCA 1L96A 2D4JA 2RAYX 5B1GA 3WVXA 1IP5A 3ODUA 1W08A 1P2CC 1D9UA 110LA 1LI3A 5LA5A 4ET9A 2C8OA 1L27A 3WU7A 142LA 1JTTL 1HEWA 1JSFA 2D91A 3QNGA 150LA 1H6MA 4DD1A 4NGWA 3B6LA 1L77A 3W6CA 1AKIA 3A6CY 4LYOA 1QSBA 2YSSC 1NHBA 1QT3A 1IWTA 1OV5A 5APDA 4LDLA 4B4JA 4WMGA 4HTNA 3EBAB 3NY9A 3WW6A 2RBPA 1P37A 5LYMA 1B2KA 1L54A 2XTHA 4G4CA 5I4WA 3CQLA 1KIPC 5E4PA 1ALCA 4EKSA 2OU0X 1DKJA 1LYFA 2NTHA 4GRVA 1KW7A 4ZPUA 1LOZA 4GCBA 1DYAA 1L04A 1L80A 5KXKA 4WL6A 4HJVA 3HBEX 2YVBA 4TTDA 1LI6A 1REYA 3J6KA 4K5YA 4RW2A 4N9RA 1D3MA 1D6PA 4ML7A 1IY3A 1IOSA 2HEFA 1CV1A 2B74A 2IFFY 2YBIA 5KXTA 5I5QA 3W6DA 4UWNA 103LA 4W57A 2HEAA 4H8ZA 4P2EA 4NGYA 1CVKA 1NWGA 4R0FA 3AJNA 2MEEA 1YAMA 3MGWA 159LA 238LA 4BAPA 4C3WA 3FA0A 4NSIA 1C6QA 1QT6A 1GF6A 3V2YA 1CU3A 4CHXA 3WXUA 1G0MA 2ZWBA 1L26A 219LA 4NIJA 1GBSA 5IHGA 128LA 1QUDA 2BQIA 1LYDA 2CDSA 3K2RA 3P65A 4H8XA 4XENA 1L59A 3F6ZA 1TCYA 4Z41A 1XGPC 5KXNA 4DDBA 2OE4X 3WUAA 169LA 5JENB 4CFOA 3WH1A 4H1PA 2OTYX 1LZDA 3EMLA 1YAOA 2C8PA 3LZ2A 1LSBA 1UC0A 4DC4A 5KXRA 3G3WA 1LYSA 1L0JA 1L25A 1IP2A 2I26L 1GF5A 1D3FA 1D6QA 4B1AA 3CDRA 4YOPA 1I56A 1HERA 1LPYA 3K3TA 4DD9A 4AQNA 3GUKA 2I6ZA 4I7LA 3RZ4A 1OUGA 2OU8A 5KXXA 2BQFA 1OVHA 1ZMYL 186LA 1LSFA 4NG8A 3OE6A 1QQYA 1L00A 4DJHA 5F81A 221LA 1IP1A 4H9IA 4GCEA 4WM6A 1N4FA 1LZ6A 224LA 1OUJA 259LA 205LA 1CJ9A 1CU0A 201LA 1XJTA 2F32A 1D2WA 243LA 129LA 1LMPA 4I7PA 2HTXA 1SSYA 1LGUA 4UWUA 139LA 1GF0A 1B0DA 1L13A 1DYCA 3A92A 4PJ2C 4B0DA 119LA 1LGXA 5B59A 1YKXX 3GXRA 4NSHA 146LA 4EKRA 1GAYA 1L32A 1T8GA 3HT9A 2XBRA 1DPXA 1RE2A 4RLMA 1C6KA 4MSTA 1GBXA 2DQGY 1L64A 1L09A 231LA 4EKPA 1L07A 1VDSA 1OYUA 1IWZA 3A91A 4DYGA 5HQ1A 3TMWA 1LWKA 2BQEA 3EO5A 4WM4A 1DI5A 222LA 2RB1X 4ARMA 4OO9A 182LA 1JITA 4DD3A 1IR7A 1OUFA 1XGUC 3GUIA 127LA 164LA 1QUOA 2Z38A 1PQIA 4M6DA 4J1BA 2X0AA 4M4OA 155LA 2Z18A 4B49A 5I14A 1C6AA 3L2XA 1NBYC 2B72A 1GEZA 1L30A 1GB7A 1WQOA 1GWDA 2W1MA 3G3VA 1QTBA 1C63A 1IIZA 5KXZA 1HEQA 2F30A 4YXCA 1JKAA 1EQ5A 4W56A 1TDYA 1C6IA 1QTKA 1GB5A 1LGWA 5KXMA 2B6YA 118LA 1V7SA 5LVJA 5F16A 1QTZA 3QE8A 4ETCA 6LYTA 1T6VL 1G0GA 1C6BA 4W96A 1D0MA 3A67Y 3W6EA 1AZFA 3DN6A 3DN0A 141LA 4H90A 2A7DA 4U3XB 166LA 1L22A 1QT8A 151LA 1QUSA 4H9FA 236LA 107LA 1VDQA 1LSMA 2LYOA 5KJ9A 1C68A 262LA 235LA 1JJ1A 4GN4A 4Z98A 1LZNA 1T8AA 1L83A 4H8YA 1DI3A 4WG1A 1L49A 1JTNA 1UIBA 3ZVQA 3W6FA 1B7PA 4YM8A 1GBYA 1XEPA 2W1XA 3A93A 3D9AC 5L3IA 4UWVA 4LDOA 4W58A 2Q9EA 9LYZA 1GF9A 1XSFA 1QS9A 1LZCA 4YENA 4ZEEA 1OUCA 1L40A 1L58A 1QT4A 1L15A 1LMTA 1GFEA 1NDMC 5II3A 3SB8A 1DZBX 1HSWA 3WVYA 1P5CA 1LW9A 4I7SA 5LVHA 1L55A 251LA 1JSEA 3HUQA 4GLAA 3SN6R 167LA 4W53A 1LSNA 3LZMA 1HC0A 1W6ZA 3FADA 1A4VA 4WOAA 1JIYA 1OWZA 1JPOA 2ZILA 3WU8A 4HP0A 1L41A 208LA 3HH3A 2B6WA 4OWCA 1C6LA 3HUAA 1BQLY 1VEDA 1LHMA 1YANA 5T3FA 3SBAA 104LA 1LZ1A 5D5FA 2RBRA 1RCMA 4WLXA 3AZ6A 1XEIA 1G06A 3CT0A 2B5ZA 1VAUA 4I8SA 234LA 1L89A 1XGQC 2D4IA 2O7AA 1JUGA 1LSZA 226LA 1QTEA 4NHPA 3AYQA 1L74A 1B5WA 3A90A 4EXMA 1C6HA 1CV4A 1FLQA 1T97A 1LAAA 1L82A 2MECA 1LJIA 4HPEA 2PC2A 181LA 153LA 1HFXA 133LA 1L66A 3A6BY 3C81A 1C6EA 2LC9A 3AGGG 3OE9A 1GFAA 3CDOA 1T3PA 4OOOA 4WLTA 1L52A 4W59A 1L02A 4E3UA 1CV6A 3IWRA 3GUMA 1XEJA 1CV5A 1L94A 4XN6A 1G7LC 1QTHA 5DN4A 4EOFA 1QUGA 3EMSA 4G4BA 197LA 1BB6A 1LYGA 4DT3A 213LA 1L05A 1L20A 2W1LA 4WL7A 4NY5A 1NF5A 3E3DA 3G3BB 3V2WA 1PQJA 1BHZA 4WM5A 3D3DA 1L45A 1GFRA 1JISA 1CX7A 2ZIJA 3C7ZA 2H9JA 189LA 4KPMA 1P7SA 1F0WA 1IWWA 1C6JA 1QT5A 1GFHA 1C6FA 3GUOA 2RBSA 2CUUA 4W54A 5DM9A 5M1YA 178LA 1ZVHL 2QB0B 4J0LA 1L56A 247LA 4AXTA 1L98A 1PZYA 1LZAA 1L50A 4A7DA 4OOTA 3P68A 1CUPA 4ETAA 7LYZA 4PK0A 2Z19A 4NEBA 108LA 4OWHA 1KXXA 2B73A 242LA 2HEEA 2ZQ4A 3QY4A 1L47A 1G07A 1G7JC 248LA 3HBDA 3WYHA 1B5VA 4PPOA 4QDNA 4HV2A 2BQAA 1JJ0A 1B7QA 4NHTA 4TSBA 1L67A 174LA 232LA 1B7MA 4G4HA 1L42A 3PBLA 4CFPA 1VDPA 1L92A 1HFZA 1LYIA 3A95A 1NHEA 4I7RA 1B7LA 120LA 3AB6A 5ILCA 1SWYA 1UIEA 4HJYA 3SB7A 1TBYA 1IORA 4BS7A 3HH4A 185LA 1HEPA 3DN1A 1LSCA 4FJRA 4I7KA 3P4ZA 4E97A 1GB0A 7LZMA 2LZTA 3AZ7A 4EMNA 1JKBA 1GB9A 4YEOA 2CGIA 5KY1A 1J1XY 111LA 1LZBA 2BQOA 1NKHA 4EPFA 2EIZC 249LA 1JEFA 1QUTA 1CJ8A 3HTBA 4OW1A 1LJEA 1L37A 1LYJA 2BLYA 206LA 260LA 1I20A 2BQHA 4BAFA 2F2NA 1LYOA 1L87A 5KXOA 2ZIKA 1F6SA 3RUNA 1UIFA 4ARQA 2YDGA 4NGLA 2W1YA 5HMJA 4XADA 1G7HC 4AGAA 4DDAA 1C62A 2OE9X 3TXDA 1WVVA 4WM1A 1CX6A 1UA6Y 1ZWNA 1MELL 1EPYA 4LGKA 1ZURA 5B05A 1DKKA 1KXWA 1F6RA 3P66A 2B6TA 2BPUA 1UICA 3OJPA 3TXGA 1JQUA 4H91A 1YKYX 1BB7A 2NWDX 3DMVA 3M3UA 5I53A 245LA 2LZ2A 4XYYA 3HT6A 4RDSA 254LA 3AZ4A 172LA 3DKEX 3FI5A 1GXXA 1G0KA 4DDCA 1GFUA 1JKCA 1L88A 2O79A 3AZ5A 3RW8A 3WW5A 1RFPA 1GFVA 1YIKA 2XBSA 2HUKA 4DAJA 2ZNXY 1QTDA 5LXWA 3HDEA 3LZTA 1XGRC 5KKIA 134LA 1QTVA 1UIAA 1QSQA 1XJUA 5J7CA 1EQ4A 1PS5A 4H9CA 2B70A 1OQMA 2DQHY 2ZNWY 3HFMY 4WO9A 1CKFA 2Y8PA 5L3HA 3DN3A 4LYMA 3AW6A 1I1ZA 5LYTA 168LA 1YAPA 217LA 4ETDA 4OWBA 3ZEKA 1B9OA 1OUEA 4NWEA 1VFBC 1C46A 1WQQA 1D3JA 3HT8A 1RJCB 2H5ZA 1OUDA 4DD7A 3TXIA 1BWIA 2GV0A 4XJFA 1PQMA 2OE7X 5LAFA 4ARMB 1G1WA 1L79A 1P6YA 240LA 1CKDA 1L03A 2RB2X 1V7TA 5EBHA 3GXKA 1LJNA 1LSEA 257LA 5HLLA 1FBIX 4Z46A 1XGTC 1HELA 1JTPL 4W52A 1GF8A 1IWXA 4HTKA 156LA 4DD0A 3SB9A 1L35A 4XJHA 5LIOA 1L51A 3WUNA 4CJ2A 4I7MA 1LZRA 2HU1A 1QS5A 1LHHA 1RI8B 1TLAA 3P64A 1IOCA 1GF7A 4NHIA 1FKQA 2DQAA 4I7OA 1IWVA 4J1AA 4GLVA 1FDLY 1LHJA 1LZ4A 2Z37A 1L48A 4N0JA 3TXHA 125LA 3TXJA 1LSGA 4LFXA 2D4KA 4ANRA 1L17A 1FLYA 4H9AA 3GUJA 1HEMA 1L81A 5B07A 5APCA 1WTNA 4LZMA 1L95A 3WU9A 4H9HA 3W6BA 1KY1A 4W55A 4LT1A 2B7XA 3HTDA 2G4NA 3SBBC 1L72A 3T36A 1BB3A 2HULA 1OUAA 161LA 5I4YA 4I0CA 5DLAA 3A94A 2BAAA 1NQIA 1INUA 4EPIA 1IR9A 5FELA 1YL1X 4GBRB 2BLXA 4GN3A 1LWGA 2FYCA 2RH1A 2OU9A 4II8A 2Z2FA 4GCDA 173LA 1IEEA 1L33A 5HMVA 1Z55A 228LA 3RT5X 3ZVQB 250LA 3TXFA 1JTOL 1L0KA 1UIDA 1D9WA 1HENA 2BQBA 1B5XA 258LA 5LINA 1CV0A 1L84A 1O23A 2N5ZA 2LZMA 1L85A 2BQKA 4S0WA 1UCOA 211LA 1GAZA 115LA 1LZGA 1C10A 5KXPA 138LA 2B6ZA 3AW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HEA A;  1XEJ A;  4H8Z A;  4LFP A;  1IC7 Y;  4P2E A;  4MCK A;  1IOQ A;  5DN5 A;  4XN6 A;  1G7L C;  1GBW A;  4NGY A;  1LHK A;  5DN4 A;  4EOF A;  3N9C A;  1NWG A;  4R0F A;  3EMS A;  4G4B A;  2MED A;  2MEE A;  3AJN A;  1BB6 A;  1J1O Y;  4BAD A;  5LA8 A;  4DT3 A;  2W1L A;  4WL7 A;  1YAM A;  4IAT A;  1GBO A;  8LYZ A;  3MGW A;  2BQJ A;  4NY5 A;  1NF5 A;  1C08 C;  2MEB A;  3E3D A;  3WMK A;  3G3B B;  1GE4 A;  1GD6 A;  1HF4 A;  4BAP A;  4C3W A;  1LZ8 A;  1BHZ A;  4WM5 A;  3D3D A;  4NSI A;  2BQN A;  4LYC A;  1GFR A;  4PHI A;  1GB6 A;  1YKZ X;  4HJZ A;  1WQN A;  3B0O A;  1GF6 A;  1JIS A;  4CHX A;  4WG7 A;  2BQM A;  4KL7 A;  5APF A;  2ZIJ A;  3ATN A;  3WXU A;  2H9J A;  2ZWB A;  3A8Z A;  3OK0 A;  1BB4 A;  4NIJ A;  3A34 A;  1GBS A;  4KPM A;  5IHG A;  1F0W A;  2BQI A;  4NGV A;  5LVK A;  4L41 A;  1IWW A;  2CDS A;  4H8X A;  3P65 A;  1IP4 A;  4XEN A;  1HHL A;  4WM3 A;  3F6Z A;  4Z41 A;  1TCY A;  2MEI A;  1XGP C;  5KXN A;  4DDB A;  1DPW A;  1GFH A;  3WUA A;  5JEN B;  2LYM A;  1LJK A;  4CFO A;  5KKJ A;  2HED A;  3WH1 A;  1CKH A;  4W94 A;  1KXY A;  154L A;  4H1P A;  1GBZ A;  1D0L A;  1LZD A;  5DM9 A;  5M1Y A;  1YQV Y;  4C5F A;  1YAO A;  1ZVH L;  1IC5 Y;  1DXJ A;  1YL0 X;  1LSB A;  2C8P A;  2EQL A;  1UC0 A;  3LZ2 A;  1QDT A;  4PRQ A;  2FBD A;  4DC4 A;  1GF3 A;  4J0L A;  5KXR A;  2EKS C;  1LYS A;  4AXT A;  1GXV 2;  2MEG A;  1LSP A;  3N9A A;  4KXI A;  2I25 L;  1LMN A;  1BWJ A;  1PZY A;  4DWX A;  1IP2 A;  2I26 L;  2Q0M X;  1LZA A;  4IAS A;  1GF5 A;  2HEB A;  4A7D A;  4OOT A;  2F4G A;  1GDX A;  4XJB A;  3P68 A;  4ZFP A;  1CKG A;  1D6Q A;  4HPI A;  4OWE A;  4ETA A;  4QY9 A;  7LYZ A;  1CJ6 A;  2Z19 A;  4NEB A;  4B1A A;  2FBB A;  3ULR A;  4LT0 A;  4YOP A;  1I56 A;  1IWU A;  1HER A;  1LKR A;  3K3T A;  4OWH A;  4DD9 A;  1KXX A;  5FHW A;  2YBH A;  5A3Z A;  2I6Z A;  5HNL A;  2HEE A;  3RZ4 A;  1OUG A;  2ZQ4 A;  1LSD A;  2BQF A;  3N9E A;  5KXX A;  4B4E A;  3AGI A;  1ZMY L;  3QY4 A;  3W6A A;  1KIQ C;  4NWH A;  1LZS A;  4QGZ A;  4NGZ A;  1LSF A;  2YBL A;  1LJG A;  4NG8 A;  2DQF C;  1QQY A;  1G7J C;  3HBD A;  2DQE Y;  3WYH A;  1B5V A;  4PPO A;  4QDN A;  5F81 A;  3TXB A;  1TEW A;  3LHM A;  4DD2 A;  1IP1 A;  135L A;  1GFK A;  4H9I A;  4GCE A;  4HV2 A;  4YEM A;  3WXT A;  2BQA A;  1JJ0 A;  2CWI A;  4GCF A;  1IP6 A;  4WM6 A;  1N4F A;  1OP9 B;  1B7Q A;  4NHT A;  1LZ6 A;  4TSB A;  3ATO A;  207L A;  4NSG A;  1OUJ A;  4N1C C;  1B7M A;  1CNS A;  4G4H A;  1XEK A;  1F10 A;  3LYM A;  3TMU A;  1CJ9 A;  4CFP A;  1AT6 A;  4NG1 A;  5A3E A;  2ZQ3 A;  1VDP A;  1C45 A;  1C7P A;  1GB3 A;  5F9X A;  1HFZ A;  3A95 A;  4LT3 A;  4LYZ A;  1IP7 A;  1LMP A;  1NHE A;  1B7L A;  4X3B A;  2HTX A;  3AB6 A;  5ILC A;  4HJY A;  1UIE A;  5C6L A;  1TBY A;  3WUL A;  4UWU A;  5C6J A;  1IOR A;  1GF0 A;  1GHL A;  1IC4 Y;  1D0K A;  4BS7 A;  1B0D A;  3A92 A;  4PJ2 C;  1YIL A;  4B0D A;  4LYB A;  1HEP A;  1QDR A;  1ZVY B;  1GB2 A;  5AMY A;  1LSC A;  1DQJ C;  2YBN A;  3BKH A;  4FJR A;  3B0K A;  3LYO A;  1GE3 A;  3P4Z A;  1GB0 A;  3G3A B;  2DQC Y;  3IJV A;  1LTM A;  2LZT A;  3LN2 A;  1SQ2 L;  3AZ7 A;  1JJ3 A;  1FN5 A;  1YAQ A;  1HFY A;  5B59 A;  1YKX X;  4EMN A;  3GXR A;  4NSH A;  1GFT A;  1REM A;  1GAY A;  1JKB A;  1GB9 A;  4YEO A;  2CGI A;  1REX A;  5IEL A;  5KY1 A;  1J1X Y;  4GN5 C;  5FDJ A;  1FKV A;  2XBR A;  1DPX A;  3EXD A;  1LZB A;  1RE2 A;  4RLM A;  2BQO A;  2A7F A;  4MST A;  1YRO A;  1GBX A;  2DQG Y;  1NKH A;  1NMM A;  2EIZ C;  1CJ7 A;  1JEF A;  1QUT A;  1VDS A;  1IVM A;  1CJ8 A;  4OW1 A;  1BVK C;  4H93 A;  1LJE A;  1IWZ A;  4HTQ A;  1LMA A;  2BQL A;  2BLY A;  4H9B A;  5FST A;  1I20 A;  5FEK A;  4ETB A;  3A91 A;  1LHI A;  4DYG A;  5HQ1 A;  2BQH A;  3TMW A;  4WM4 A;  2BQE A;  3EO5 A;  4BAF A;  1DI5 A;  3A96 A;  1LJ4 A;  2DQD Y;  2F2N A;  1LYO A;  1HMK A;  5KXO A;  2ZIK A;  1F6S A;  1JIT A;  1E8L A;  1UIF A;  3WPL A;  2LHM A;  2YDG A;  4DD3 A;  1IR7 A;  1UAC Y;  1LYZ A;  4NGL A;  3FE0 A;  1GB8 A;  1LJJ A;  1OUF A;  5L9J A;  1XGU C;  4J7V A;  4XJI A;  1JWR A;  2Z38 A;  2W1Y A;  5HMJ A;  2ZYP A;  4XAD A;  1QSA A;  1JHL A;  1G7H C;  4XJG A;  3W3E A;  1EQE A;  4M6D A;  4D9Z A;  4J1B A;  2X0A A;  4AGA A;  1UIG A;  5B06 A;  2MEA A;  4M4O A;  4TWS A;  4DDA A;  5KXL A;  2Z18 A;  3CB7 A;  3TXD A;  1WVV A;  3B72 A;  3CSQ A;  4WM1 A;  1LJF A;  4B49 A;  4RLN A;  1UA6 Y;  1IR8 A;  1NBY C;  1LSA A;  1MEL L;  1UUZ C;  2BQD A;  3CT1 A;  4LGK A;  1GF4 A;  4NGK A;  1LKS A;  5B05 A;  1FLU A;  1GEZ A;  1DKK A;  3CSR A;  1KXW A;  2D6B A;  1F6R A;  4H9E A;  4NFV A;  1GB7 A;  5HNC A;  1GE1 A;  1H87 A;  1WQO A;  1GWD A;  2W1M A;  3P66 A;  1LPI A;  2BPU A;  2CJL A;  2IHL A;  1UIC A;  5ILF A;  3OJP A;  1LMQ A;  1IIZ A;  5KXZ A;  3TXK A;  1HEQ A;  2F30 A;  2BQG A;  4NGO A;  3TXG A;  4Z3M A;  4H91 A;  1HEO A;  1YKY X;  2G4Q A;  1JKA A;  1BB7 A;  2NWD X;  1EQ5 A;  2F4A A;  1TDY A;  3M3U A;  5I53 A;  1QTK A;  2LZ2 A;  1GB5 A;  4XYY A;  5KXM A;  3AGH A;  3WUM A;  1V7S A;  1LZY A;  4RDS A;  5KXW A;  5F16 A;  5LVJ A;  132L A;  1NBZ C;  1OUH A;  2DQI Y;  3AZ4 A;  3QE8 A;  4ETC A;  3SP3 A;  1GDW A;  5C6I A;  2Z39 A;  4FDY A;  1WTM A;  4NHS A;  6LYT A;  1T6V L;  1GXX A;  1LZT A;  2XJW A;  1J1P Y;  4W96 A;  4H94 A;  1D0M A;  1VAT A;  3A67 Y;  3W6E A;  1HSX A;  4DDC A;  1LZ5 A;  5KXS A;  1GFU A;  1JKC A;  1TAY A;  5K7O A;  1LJH A;  1WQM A;  3AZ5 A;  4LT2 A;  1AZF A;  1AT5 A;  3RW8 A;  2BQC A;  4H90 A;  2H9K A;  3WW5 A;  1B7R A;  1LYY A;  1RFP A;  4WM2 A;  1GFV A;  1LZ9 A;  1YIK A;  2A7D A;  2XBS A;  6LYZ A;  1IWY A;  2ZNX Y;  1IOT A;  1LSY A;  4U3X B;  3B0I A;  1QSW A;  1JKD A;  5LXW A;  1QUS A;  3LZT A;  1B5Y A;  1XGR C;  5APE A;  4H9F A;  5IDD A;  134L A;  3RU5 A;  4TX7 A;  5KKI A;  3RNX A;  3TMX A;  1UIA A;  2EPE A;  4NHQ A;  5LAG A;  1VDQ A;  1BVX A;  1LSM A;  4HV1 A;  2LYO A;  2LYZ A;  5J7C A;  1EQ4 A;  1PS5 A;  2DQH Y;  1OQM A;  2ZNW Y;  1G7I C;  3FI7 A;  2G4P A;  3HFM Y;  4H9C A;  4WO9 A;  5LYZ A;  1CKF A;  5KJ9 A;  1UIH A;  1JJ1 A;  2Y8P A;  1LMC A;  5L3H A;  1CKC A;  4GN4 A;  4TUN A;  1C43 A;  2MEF A;  1I1Z A;  3AW6 A;  4LYM A;  4Z98 A;  5F9U A;  1LZN A;  5LYT A;  1BB5 A;  1YAP A;  4IJ4 A;  4H8Y A;  4ETD A;  1DI3 A;  4OWB A;  4WG1 A;  4LZT A;  3WL2 A;  3ZEK A;  1BGI A;  3ZVQ A;  1UIB A;  2FYD A;  1LHL A;  1B9O A;  1OUE A;  4N1E I;  4PRU A;  1BWH A;  1B7P A;  3BKV A;  4NWE A;  3W6F A;  1VFB C;  1ZV5 L;  2YBJ A;  3A3R X;  1C46 A;  1WQQ A;  4YM8 A;  2VB1 A;  5FCP A;  4WLD A;  1GBY A;  1RJC B;  2W1X A;  2H5Z A;  1OUD A;  4O34 A;  4DD7 A;  3A93 A;  3D9A C;  2HEC A;  3TXI A;  4YF2 A;  1GFG A;  1B7O A;  2RSC A;  5L3I A;  4UWV A;  1BWI A;  1WVU A;  2GV0 A;  4WLY A;  4XJF A;  1OUI A;  4B4I A;  5LAF A;  9LYZ A;  1GF9 A;  3M18 B;  5E9R A;  5KXY A;  3WPJ A;  1XSF A;  1B5Z A;  1EL1 A;  5F14 A;  4PGJ B;  1REZ A;  1CKD A;  1B5U A;  1KIR C;  1LZC A;  4YEN A;  4ZEE A;  4MR1 A;  1V7T A;  5EBH A;  1OUC A;  3TXE A;  2AUB A;  3GXK A;  4H92 A;  1LJN A;  4WO6 A;  4QEQ A;  1NDG C;  1LSE A;  193L A;  1XFP L;  194L A;  2DQJ Y;  4HSF A;  5HLL A;  3J4G A;  1FBI X;  4XJD A;  1QIO A;  1LMT A;  1XGT C;  4OWA A;  4Z46 A;  1GFE A;  1NDM C;  5II3 A;  1HEL A;  1LMO A;  1JTP L;  2Z12 A;  1DZB X;  1GF8 A;  3WPK A;  1HSW A;  3WVY A;  5I4X A;  1IWX A;  1IP3 A;  1WQP A;  4HTK A;  4DD0 A;  5LVH A;  1JSE A;  4LYT A;  3HBH A;  4GLA A;  4NGJ A;  1B7S A;  1SLY A;  3T6U A;  2DKV A;  3TMV A;  1A2Y C;  2D4J A;  4XJH A;  5B1G A;  5LIO A;  3WUN A;  4CJ2 A;  1LZR A;  3WVX A;  2DBT A;  1LSN A;  2HU1 A;  1IP5 A;  4ET8 A;  1LHH A;  1GFJ A;  1W08 A;  1P2C C;  1D9U A;  1RI8 B;  4N8Z A;  4KT3 A;  3P64 A;  5LA5 A;  1IOC A;  1HC0 A;  1GF7 A;  1GPQ C;  1W6Z A;  4NHI A;  1FKQ A;  2DQA A;  1OUB A;  1IWV A;  4J1A A;  1LZE A;  1A4V A;  4G49 A;  4ET9 A;  2C8O A;  3WU7 A;  4GLV A;  4WOA A;  1FDL Y;  1LHJ A;  1LZ4 A;  2WAR A;  2Z37 A;  1IO5 A;  1JIY A;  1JTT L;  1HEW A;  1UBZ A;  3KAM A;  4N0J A;  3TXH A;  1FLW A;  3CT5 A;  1JPO A;  2ZIL A;  3WU8 A;  1JSF A;  4HP0 A;  2D91 A;  3QNG A;  3TXJ A;  1LSG A;  208L A;  1GE0 A;  4LFX A;  1H6M A;  1AM7 A;  4ANR A;  2D4K A;  1IX0 A;  4NGW A;  1DI4 A;  1FLY A;  3B6L A;  4DD1 A;  4H9A A;  4OWC A;  3W6C A;  1AKI A;  1HEM A;  1G7M C;  3A6C Y;  2HUB A;  1BQL Y;  1VED A;  1LHM A;  1LJ3 A;  1YAN A;  2MEH A;  4LYO A;  5APC A;  5B07 A;  1WTN A;  5T3F A;  2YSS C;  1IY4 A;  2ZYC A;  3WU9 A;  1GE2 A;  1IWT A;  4H9H A;  1LZ1 A;  5APD A;  5D5F A;  3W6B A;  3VWO A;  4B4J A;  1RCM A;  4WLX A;  3AZ6 A;  4LT1 A;  4WMG A;  1HML A;  5B1F A;  4HTN A;  3EBA B;  5D5C A;  3WW6 A;  1XEI A;  2G4N A;  3T36 A;  3CT0 A;  4RW1 A;  4ZIX A;  1BB3 A;  1OUA A;  4R6C A;  2B5Z A;  5LYM A;  1B2K A;  1VAU A;  4I8S A;  1XGQ C;  3LYT A;  5I4Y A;  2D4I A;  4I0C A;  5DLA A;  1JUG A;  3A94 A;  1LSZ A;  2BAA A;  1MLC E;  1NQI A;  1QTE A;  4NHP A;  3AYQ A;  1INU A;  4ETE A;  2XTH A;  4G4C A;  1B5W A;  5I4W A;  3IJU A;  3A90 A;  1IR9 A;  5FEL A;  1YL1 X;  4CGE A;  3CQL A;  1KIP C;  5E4P A;  5LVG A;  2BLX A;  4GN3 A;  5I54 A;  2Z2E A;  1FLQ A;  2YBM A;  2FYC A;  1ALC A;  4II8 A;  1LAA A;  1GEV A;  1B7N A;  1DKJ A;  2Z2F A;  1VDT A;  2HU3 A;  1IEE A;  2MEC A;  4GCD A;  1LJI A;  4HPE A;  2PC2 A;  5LVI A;  5HMV A;  1LOZ A;  1Z55 A;  4GCB A;  153L A;  3RT5 X;  1HFX A;  3ZVQ B;  3TXF A;  5KXK A;  1JTO L;  133L A;  1WQR A;  3A6B Y;  4WL6 A;  1UID A;  4HJV A;  5DL9 A;  3HBE X;  1HEN A;  2YVB A;  2BQB A;  4GCC A;  1LCN A;  1B5X A;  4TTD A;  3J6K A;  1REY A;  4G9S A;  5LIN A;  4RW2 A;  3AGG G;  1GFA A;  4N9R A;  4NGI A;  4TSC A;  1D6P A;  1O23 A;  4ML7 A;  2N5Z A;  1IY3 A;  3CSZ A;  4NSJ A;  4N5R A;  1T3P A;  1IOS A;  1UCO A;  2BQK A;  2HEF A;  4OOO A;  4WLT A;  2IFF Y;  2YBI A;  1GAZ A;  3A3Q A;  5KXT A;  1HNL A;  1C10 A;  1LZG A;  5KXP A;  5I5Q A;  3W6D A;  4UWN A;  4E3U A;  3LYZ A;  3IWR A;  3AW7 A; 
#chains in the Genus database with same CATH topology
 4DR5 M;  4LFB M;  1MU5 A;  1LHK A;  3FRI A;  3K9O A;  3JR6 A;  3GLI E;  1NY5 A;  3QAK A;  3GUL A;  1L44 A;  3PNY A;  2JXN A;  1YE9 A;  8LYZ A;  2BQJ A;  3U6D A;  2MEB A;  3WMK A;  3HJS A;  1GD6 A;  1HF4 A;  1LZ8 A;  3HUK A;  2BQN A;  4PHI A;  1GB6 A;  157L A;  1WQN A;  175L A;  2QZ4 A;  4OX9 M;  4HJZ A;  2O5R A;  4BB9 A;  3HTG A;  2BQM A;  4RKU F;  2FOI C;  2RB0 X;  1EFU B;  3A8Z A;  3OK0 A;  2DZO B;  1C6D A;  4NGV A;  5LVK A;  2Z6B A;  253L A;  1IP4 A;  1HHL A;  5DYI A;  4LJ9 A;  1QUH A;  3DN4 A;  1DPW A;  2WSE F;  1L63 A;  187L A;  3KVW A;  4M9X A;  5KKJ A;  2HED A;  4ARP A;  154L A;  1GBZ A;  2OOB A;  1D0L A;  1C65 A;  4C5F A;  3KS4 A;  2MH8 A;  1N36 M;  2F47 A;  4GH9 A;  2EQL A;  4JXJ A;  1GF3 A;  3DN2 A;  1GXV 2;  1E9S A;  3LW5 F;  1LSP A;  2MEG A;  3HH5 A;  2RBO A;  3N9A A;  1LMN A;  4IJE A;  239L A;  3HU8 A;  3F92 A;  1L75 A;  2Q0M X;  256L A;  5ITY A;  1L24 A;  2HEB A;  246L A;  1GDX A;  4B7F A;  4ZFP A;  1CKG A;  4OWE A;  4HPI A;  4YHH M;  2G3Q A;  1CJ6 A;  3ULR A;  4LT0 A;  4LFC M;  1IWU A;  2CE7 A;  5IT9 S;  5A3Z A;  1LI2 A;  3GLI A;  2LVP C;  1P56 A;  2CFO A;  2KNA A;  3FTF A;  1L01 A;  3N9E A;  3AGI A;  4NWH A;  1LZS A;  4QGZ A;  3F8V A;  3NY8 A;  1L69 A;  4I7J A;  113L A;  1PJJ A;  200L A;  227L A;  1L21 A;  2DQE Y;  3TXB A;  4I4L A;  1L11 A;  1QTC A;  3LHM A;  1C6C A;  4KLN A;  1GFK A;  4DD2 A;  1L86 A;  1IFY A;  4YEM A;  2ZAO A;  3WXT A;  2Z4R A;  3LCU A;  163L A;  3WHK A;  158L A;  131L A;  1OP9 B;  4W51 A;  3ATO A;  4NSG A;  4I7T A;  2YQZ A;  1CNS A;  6LZM A;  1C69 A;  3PDS A;  1F10 A;  1SWZ A;  4LGY A;  3LYM A;  1JTM A;  2Y0Q A;  1WHC A;  3B9P A;  1PQO A;  1PQK A;  1C7P A;  1GB3 A;  1IXS B;  1N77 A;  1CU2 A;  2E5L M;  137L A;  4LT3 A;  4LYZ A;  1IP7 A;  2KW0 A;  152L A;  209L A;  4X3B A;  5C6L A;  3WUL A;  3DA1 A;  2RGH A;  1LYH A;  1ZYT A;  1IC4 Y;  4YXA C;  1D0K A;  145L A;  3RGP A;  1YIL A;  1ZVY B;  5KPR A;  2YBN A;  1DQJ C;  5AMY A;  3BKH A;  1GE3 A;  2BNK A;  1L97 A;  2DQC Y;  3IJV A;  1LTM A;  1SQ2 L;  2RAZ X;  1JJ3 A;  1HFY A;  1G8P A;  3DN8 A;  3HU1 A;  1Q3B A;  1REX A;  5IEL A;  4GN5 C;  2Z4S A;  1L43 A;  198L A;  4FWG A;  5E26 A;  2OQ4 A;  2A7F A;  1L76 A;  148L E;  4ARL A;  1J09 A;  1IVM A;  1L38 A;  1BVK C;  4H93 A;  4HTQ A;  5FST A;  4DR6 M;  2KZU A;  4X64 M;  4DR7 M;  2QCU A;  3IHP A;  3W67 A;  1C1K A;  3HH6 A;  4ARJ A;  1E8L A;  3WPL A;  3DNA A;  1UAC Y;  1LYZ A;  3FE0 A;  130L A;  1LJJ A;  1CV3 A;  1L99 A;  4J7V A;  4XJI A;  1JWR A;  3C7Y A;  3EIH A;  1QSA A;  1JHL A;  4XJG A;  4LF5 M;  4FWH A;  3W3E A;  1L12 A;  4D9Z A;  2ZAM A;  2R0I A;  5B06 A;  1P3Q Q;  2QHO B;  2RBQ A;  2UXD M;  1C66 A;  2H1R A;  2KZS A;  3L2A A;  4RLN A;  3GQ4 A;  2BQD A;  1GF4 A;  4NGK A;  1LKS A;  3DMX A;  4IAP A;  1FLU A;  4NFV A;  4F1I A;  5HNC A;  1GE1 A;  1H87 A;  1LPI A;  2CJL A;  2IHL A;  5ILF A;  4MH0 E;  2KRU A;  3TXK A;  4LJ6 A;  4NGO A;  1R6B X;  4IBB A;  4Z3M A;  1HEO A;  1NVM A;  2OTZ X;  2G4Q A;  114L A;  191L A;  2F4A A;  3GP1 A;  1OFH A;  3GLG A;  4GEW A;  1P36 A;  4GMQ A;  1D2N A;  3AGH A;  3SC3 A;  4NRV A;  3M7G A;  1LZY A;  5KXW A;  4IJF A;  1KY0 A;  1OUH A;  1NBZ C;  3SP3 A;  1GDW A;  5C6I A;  3LQQ A;  1V33 A;  2XJW A;  1OWY A;  1J1P Y;  4MGK E;  1VAT A;  1HSX A;  3C8R A;  1C6N A;  5EP3 A;  1WQM A;  3C8S A;  1L19 A;  1AT5 A;  1L34 A;  1C6G A;  2QSF X;  2BQC A;  1LYY A;  4YX7 C;  1KS3 A;  1LZ9 A;  220L A;  1IWY A;  1IOT A;  1LSY A;  3B0I A;  1B6I A;  1G3I A;  3KSX A;  1QSW A;  1JKD A;  1L93 A;  3FUT A;  3K1J A;  216L A;  3W0L B;  3T1H M;  1R2Z A;  4TX7 A;  144L A;  3RNX A;  2MR9 A;  3TMX A;  3C3E A;  180L A;  2AHM A;  1BVX A;  2DVW B;  3FI7 A;  1GL6 A;  2G4P A;  1Q02 A;  3U6S A;  1SX2 A;  1LMC A;  4TUN A;  1GAB A;  5F9U A;  2MEF A;  1DGH A;  1BB5 A;  3WL2 A;  212L A;  2QPA A;  4PJZ A;  2FYD A;  1LHL A;  4N1E I;  1L61 A;  1ZV5 L;  3A3R X;  176L A;  1AIP C;  1HT1 E;  4O34 A;  3U6E A;  1T8F A;  2DZN B;  2RSC A;  1B7O A;  3CDV A;  1WVU A;  4WLY A;  1C60 A;  1R4G A;  3M18 B;  3GLH A;  5E9R A;  4AQY M;  5KXY A;  3WPJ A;  4ARQ B;  2HL7 A;  1B5Z A;  1EL1 A;  5F14 A;  177L A;  1C61 A;  1C64 A;  4PGJ B;  3C82 A;  1SXJ E;  4MR1 A;  2K6B A;  3L26 A;  1PM5 A;  1GL7 A;  3L64 A;  4WO6 A;  4QEQ A;  1NDG C;  193L A;  2A5Y B;  2DQJ Y;  4HSF A;  171L A;  3J4G A;  4XJD A;  4OWA A;  2A4T A;  1LMO A;  3WPK A;  2Z12 A;  2NTG A;  1XMO M;  1IP3 A;  1K28 A;  4LYT A;  2R46 A;  3HBH A;  3T6U A;  1B7S A;  1SLY A;  1D2Y A;  2DKV A;  5EP4 A;  196L A;  1A2Y C;  2VF8 A;  4DV6 M;  1L46 A;  2DBT A;  3EIE A;  4ET8 A;  1GFJ A;  4G6Z A;  1P46 A;  4N8Z A;  4KT3 A;  4IIW A;  1GPQ C;  1L16 A;  1TDH A;  1OUB A;  1P64 A;  147L A;  1LZE A;  1L2C A;  4G49 A;  102L A;  4EKQ A;  2WAR A;  1IO5 A;  2O25 A;  1UBZ A;  3KAM A;  1L65 A;  3U60 A;  1FLW A;  3CT5 A;  2L6O A;  149L A;  3U6M A;  1GE0 A;  5I54 A;  5LVG A;  1AM7 A;  1IX0 A;  1DI4 A;  4LJ4 A;  1G7M C;  2ANX A;  4R3D A;  1OFI A;  1P2R A;  2HUB A;  4RF0 A;  5A3E A;  2MEH A;  1LJ3 A;  112L A;  5C1B A;  2XFT A;  2ZYC A;  1IY4 A;  1SXJ B;  5EP1 A;  1GE2 A;  3VKH A;  3W68 A;  3VWO A;  3SB6 A;  3T1Y M;  1HML A;  5B1F A;  5D5C A;  241L A;  3TWK A;  2XEP A;  2MGW A;  3WHL A;  4RW1 A;  4ZIX A;  2KNV A;  2YR0 A;  1CU6 A;  3A45 A;  4R6C A;  3PFI A;  4LGM A;  3LYT A;  1MLC E;  4S12 A;  1HNZ M;  4ETE A;  3MK6 A;  1TH4 A;  2EUC A;  3IJU A;  5LZM A;  1L14 A;  4CGE A;  3HWL A;  3PNV A;  4AKI A;  2Z2E A;  3B7Q A;  2YBM A;  1KW5 A;  4LF8 M;  1GEV A;  2HCB A;  1B7N A;  2R6F A;  4XK8 F;  1G1V A;  1VDT A;  2HU3 A;  165L A;  5LVI A;  4IBK A;  1HJP A;  2JY6 B;  1QAN A;  223L A;  4M9Z A;  1WQR A;  5DL9 A;  1L08 A;  4GCC A;  1SX7 A;  1VEK A;  1LCN A;  2JY7 A;  4G9S A;  4TSC A;  4DQJ A;  4NGI A;  2JNH A;  1G0Q A;  1L23 A;  3CSZ A;  4NSJ A;  4Y28 F;  4N5R A;  1OV7 A;  3RZE A;  3M0E A;  3A3Q A;  1HNL A;  1T43 A;  1L18 A;  1BVS A;  3LYZ A;  1KNI A;  2DNA A;  2JY5 A;  1C6T A;  4LFP A;  1L70 A;  1IC7 Y;  3CF2 A;  1HNW M;  210L A;  4MCK A;  1IOQ A;  5DN5 A;  1GBW A;  1NY6 A;  3N9C A;  1DYD A;  1OVK A;  2MED A;  1W5S A;  3HJ8 A;  1J1O Y;  4JI7 M;  4BAD A;  5LA8 A;  3GUN A;  4IAT A;  1GBO A;  3DMZ A;  2B6X A;  2X49 A;  1C08 C;  3KW6 A;  1CU5 A;  214L A;  1GE4 A;  1L39 A;  2LBC A;  3H4J A;  4LYC A;  4LZZ A;  1YKZ X;  3B0O A;  5KPZ A;  4WG7 A;  1EIJ A;  4KL7 A;  5APF A;  4R7G A;  3ATN A;  4L8R C;  3QYB A;  2O4W A;  1BB4 A;  255L A;  3DOA A;  3A34 A;  3AFH A;  3J2P B;  4L41 A;  3SAT A;  1L57 A;  3CDQ A;  1N33 M;  4WM3 A;  2CWB A;  1Z59 A;  2B75 A;  2MEI A;  1I94 M;  4I5S A;  1YLA A;  2YFQ A;  2LYM A;  1LJK A;  1P2L A;  3KDS E;  1CKH A;  1L36 A;  1KXY A;  4W94 A;  3FYC A;  4L6V 6;  4JN6 A;  3U61 B;  3MHV C;  1YQV Y;  3HU3 A;  1WR1 B;  3I4Y A;  4DQ7 A;  1IC5 Y;  1DXJ A;  1YL0 X;  4PRQ A;  1QDT A;  2FBD A;  4REZ A;  160L A;  1HR0 M;  3C80 A;  2EKS C;  1QT7 A;  2XLJ A;  4KXI A;  2I25 L;  3K9P A;  1BWJ A;  1WXQ A;  4JI6 M;  2VQF M;  4DWX A;  3ZQJ A;  4IAS A;  3J27 B;  4WUR A;  2F4G A;  4XJB A;  199L A;  4QY9 A;  2FBB A;  1LKR A;  2XSZ A;  3IG5 A;  4NSR A;  1L73 A;  2YBH A;  5FHW A;  3SB5 A;  1G71 A;  2ZTC A;  3KXE C;  4G4Q A;  5HNL A;  1LSD A;  3FUW A;  4B4E A;  3W6A A;  126L A;  1KIQ C;  1ORY B;  1D3N A;  123L A;  4NGZ A;  2YBL A;  2M5Z A;  1LJG A;  4A3V B;  229L A;  2RRU A;  2DQF C;  1DYF A;  3ZCB B;  1G59 A;  1TEW A;  135L A;  2QAR C;  3SBJ A;  261L A;  5ITT A;  3THG A;  2CWI A;  3QAU A;  4GCF A;  1IP6 A;  225L A;  2VDB B;  2L7H A;  5EXP A;  5IWA M;  207L A;  2UUC M;  4N1C C;  1XEK A;  1DYG A;  3TMU A;  3D4S A;  1AT6 A;  4NG1 A;  2ZQ3 A;  5F9X A;  1C45 A;  3D8L A;  3C8Q A;  1L53 A;  2FH0 A;  3D8B A;  3LQR A;  4RF1 A;  3UK6 A;  2L7I A;  2FE8 A;  233L A;  5C6J A;  1GHL A;  3HU9 A;  4LF9 M;  1DYB A;  3KP1 E;  1G0J A;  4LYB A;  1QDR A;  1GB2 A;  4I7N A;  1GLN A;  143L A;  3B0K A;  1CUQ A;  3LYO A;  4CIZ A;  1NO1 A;  3G3A B;  1L90 A;  3TWL A;  3LN2 A;  1FN5 A;  4DQ5 A;  1YAQ A;  1GFT A;  3GPP A;  1REM A;  3GPU A;  3CDT A;  5GKN A;  4CGY B;  5FDJ A;  1FKV A;  1TH2 A;  1SG9 A;  3EXD A;  4LF6 M;  3UJN A;  2CV2 A;  1YRO A;  1L71 A;  2APL A;  3KFU G;  244L A;  190L A;  2ANV A;  1VDL A;  1NMM A;  3JAM S;  1CJ7 A;  3I01 M;  8CAT A;  1QAQ A;  3U6O A;  3UZU A;  2HUM A;  3FUV A;  3J80 S;  1LMA A;  1G41 A;  2BQL A;  4H9B A;  5FEK A;  4ETB A;  1LHI A;  1P3N A;  3A96 A;  1LJ4 A;  2DQD Y;  2OEA X;  1HMK A;  2R4J A;  2NQ8 C;  1C6M A;  1G0P A;  3C83 A;  1KSF X;  2Y20 A;  2LHM A;  122L A;  1LLH A;  2JWS A;  183L A;  1GB8 A;  5L9J A;  3E21 A;  4IBI A;  4G4N A;  3VKG A;  2EO2 A;  2JZ0 A;  1L62 A;  2XH9 A;  2ZYP A;  5ITQ A;  3HTF A;  1EQE A;  1UIG A;  3OE8 A;  2MEA A;  4OU7 A;  3VW7 A;  3HT7 A;  1C6P A;  4TWS A;  5KXL A;  3CB7 A;  1K3X A;  3HDF A;  3B72 A;  5LMU M;  3CSQ A;  1LJF A;  4LDE A;  1AUA A;  4B3M M;  1IR8 A;  1LSA A;  3UON A;  1L60 A;  1UUZ C;  3CT1 A;  2F2Q A;  4I8O A;  140L A;  3GLI B;  2D6B A;  3CSR A;  4H9E A;  4GHA A;  1J7K A;  4JYA M;  1JB0 F;  3C3D A;  2HWJ A;  2JA2 A;  4BBA A;  3C7W A;  1WTH A;  1LMQ A;  1L91 A;  3NYA A;  2BQG A;  1SSW A;  4DV3 M;  3OE0 A;  4DV2 M;  2L2D A;  1PQD A;  3WUM A;  132L A;  2DQI Y;  3F9L A;  4AKG A;  1L28 A;  1Q3C A;  4NC6 A;  2Z39 A;  4FDY A;  1OVJ A;  1WTM A;  4NHS A;  2G5G X;  2L78 A;  3VDP A;  1LZT A;  1QZM A;  1G0L A;  4H94 A;  1I6S A;  4OW0 A;  1LZ5 A;  5KXS A;  2CV1 A;  1TAY A;  5K7O A;  1LJH A;  4LT2 A;  2K47 A;  2L4F A;  4Z8X A;  4GRI A;  162L A;  3KOX E;  2H9K A;  4LJ8 A;  1B7R A;  4WM2 A;  6LYZ A;  1C67 A;  188L A;  3U6L A;  184L A;  1UM8 A;  4MB7 A;  237L A;  2ZBK B;  4NXM M;  215L A;  1V34 A;  2XQO A;  2KDL A;  3VLF B;  1B5Y A;  170L A;  5APE A;  5IDD A;  3RU5 A;  2V1U A;  1JR3 A;  3VK8 A;  2EPE A;  1QAO A;  4NHQ A;  2C98 A;  5LAG A;  4HV1 A;  2LYZ A;  3K92 A;  3GLF A;  5LYZ A;  1DO0 A;  1CTW A;  1G7I C;  1L31 A;  1UIH A;  3DZD A;  1CKC A;  1C43 A;  4M0W A;  4IJ4 A;  2LCB A;  4EJ4 A;  218L A;  1L29 A;  3G3X A;  4LZT A;  2Q9D A;  1E9R A;  1BGI A;  2LVN C;  4PRU A;  4IBG A;  3Q8G A;  1BWH A;  3IEC A;  3BKV A;  2YBJ A;  3U5Z A;  5FCP A;  2VB1 A;  4WLD A;  4BLC A;  2RBN A;  3ZC7 B;  2HAK A;  3GLG E;  1DYE A;  4R71 A;  2HEC A;  4YF2 A;  1GFG A;  1HQC A;  230L A;  1OUI A;  3Q8X A;  2CEA A;  4B4I A;  1LYE A;  192L A;  4I7Q A;  3K2L A;  3TPZ A;  1L06 A;  1T6H A;  4P16 A;  3AOG A;  3IG8 A;  1L10 A;  1REZ A;  3UGJ A;  1L68 A;  1KIR C;  1B5U A;  1XXH E;  3TXE A;  252L A;  2AUB A;  195L A;  3MMP A;  4H92 A;  5KQD A;  109L A;  3B89 A;  4LFA M;  1OQY A;  3GRY A;  5BPV A;  1XFP L;  5FTM A;  194L A;  2ZM6 M;  1QIO A;  1HNX M;  3NBI A;  5I4X A;  3ILK A;  1WQP A;  4DKL A;  4DR3 M;  3GUP A;  4NGJ A;  3TMV A;  1NNJ A;  2IGC A;  1FNN A;  3B7Z A;  1L96 A;  2D4J A;  2RAY X;  5B1G A;  2VF7 A;  3WVX A;  2Z7J A;  1MN3 A;  4B7H A;  1IP5 A;  3ODU A;  1W08 A;  1P2C C;  1D9U A;  110L A;  5ITX A;  1LI3 A;  5LA5 A;  4ET9 A;  2C8O A;  1L27 A;  3WU7 A;  2HKJ A;  142L A;  1JTT L;  1HEW A;  1KYI A;  3GLG B;  2UXC M;  1JSF A;  2D91 A;  3QNG A;  150L A;  3GQ5 A;  1H6M A;  4DD1 A;  2X8A A;  4NGW A;  3B6L A;  3HKP A;  3SYK A;  1L77 A;  3W6C A;  1AKI A;  3A6C Y;  4LYO A;  1QSB A;  2EA0 A;  3L29 A;  2KA6 B;  3GLH E;  4IBF A;  2QQ8 A;  5IZ7 D;  2YSS C;  1TH3 A;  1NHB A;  1QT3 A;  1Z5B A;  1IWT A;  3UMM A;  1OV5 A;  5APD A;  4LDL A;  4B4J A;  3L27 A;  3CGW A;  4WMG A;  4HTN A;  3EBA B;  3NY9 A;  3WW6 A;  2RBP A;  1X37 A;  1XXH A;  4MGI E;  2MRO B;  1P37 A;  5LYM A;  2D7E A;  1SXJ D;  1B2K A;  1F4I A;  3TE6 A;  1L54 A;  1OIZ A;  2XTH A;  4G4C A;  5I4W A;  3CF0 A;  3QWL A;  4LCB A;  3CQL A;  2V6Z M;  1KIP C;  5E4P A;  2CHG A;  4QHT A;  1Y8G A;  1ALC A;  2OU0 X;  4EKS A;  1DGH B;  1DKJ A;  2FS1 A;  1LYF A;  2NTH A;  4GRV A;  1KW7 A;  4ZPU A;  1LOZ A;  4GCB A;  3HGI A;  1DYA A;  1L04 A;  1L80 A;  2FFJ A;  5KXK A;  1IY0 A;  4WL6 A;  2DKL A;  4HJV A;  3HBE X;  2YVB A;  2QP9 X;  4TTD A;  2O01 F;  4W5W A;  1LI6 A;  1REY A;  1XWI A;  1ZAE A;  3J6K A;  1IY1 A;  4K5Y A;  4RW2 A;  4N9R A;  1VDD A;  1D3M A;  1D6P A;  4ML7 A;  2C9C A;  1IY3 A;  1IOS A;  2HEF A;  1CV1 A;  2B74 A;  2IFF Y;  2YBI A;  5KXT A;  1IXZ A;  3GLH B;  5I5Q A;  3W6D A;  4UWN A;  4B7G A;  1N34 M;  103L A;  4W57 A;  2HEA A;  1S3S A;  4H8Z A;  4P2E A;  5DYG A;  2ZAN A;  4NGY A;  2R65 A;  5EJC A;  2LXE A;  1CVK A;  1NWG A;  4R0F A;  1ZQ9 A;  3AJN A;  2MEE A;  2UUA M;  1XMQ M;  4L15 A;  2Q2E B;  1YAM A;  3MGW A;  159L A;  2D7H A;  238L A;  1WGN A;  3SMP A;  4BAP A;  4C3W A;  5FTJ A;  3FA0 A;  2VQE M;  4NSI A;  3A42 A;  1IBK M;  1C6Q A;  1QT6 A;  2LH0 A;  4LZJ A;  3CTW B;  3AOE A;  1CU3 A;  1GF6 A;  3JR4 A;  3V2Y A;  4CHX A;  1XB2 B;  2G8L A;  2JZ1 A;  7CAT A;  3WXU A;  1G0M A;  2ZWB A;  1NHG C;  1L26 A;  219L A;  4NIJ A;  1QAM A;  1GBS A;  5IHG A;  128L A;  1QUD A;  2BQI A;  2Z8Y M;  1LYD A;  2CDS A;  3K2R A;  3P65 A;  4H8X A;  4XEN A;  1L59 A;  3F6Z A;  1TCY A;  4Z41 A;  1XGP C;  5KXN A;  4DDB A;  2OE4 X;  3WUA A;  3HHW A;  169L A;  5JEN B;  2DZL A;  4CFO A;  3WH1 A;  1YSY A;  3U60 B;  4H1P A;  3L28 A;  2OTY X;  1LZD A;  3EML A;  1YAO A;  2DWL A;  2C8P A;  3LZ2 A;  1LSB A;  1UC0 A;  2LNH C;  1K3W A;  4PDG A;  4DC4 A;  3TL4 X;  5KXR A;  3G3W A;  1IN5 A;  1LYS A;  2LHC A;  1T3T A;  1L0J A;  1FJG M;  3SAS A;  1L25 A;  3FKE A;  4FCW A;  1IP2 A;  2I26 L;  3T15 A;  1GF5 A;  1D3F A;  1D6Q A;  1IXR C;  4B1A A;  3CDR A;  4DUZ M;  1I56 A;  4YOP A;  1HER A;  1LPY A;  3K3T A;  1V92 A;  4DD9 A;  4AQN A;  1GVN A;  3GUK A;  1Z6T A;  2I6Z A;  4I7L A;  3RZ4 A;  1OUG A;  2F5Q A;  2OU8 A;  5KXX A;  2BQF A;  4QOZ C;  1OVH A;  4DV4 M;  1ZMY L;  186L A;  1LSF A;  4NG8 A;  3OE6 A;  1QQY A;  1L00 A;  4KOD A;  4DJH A;  5F81 A;  221L A;  1IP1 A;  4H9I A;  4GCE A;  4WP2 A;  4MGZ E;  5LMN M;  2RKO A;  4WM6 A;  1N4F A;  1LZ6 A;  224L A;  1OUJ A;  5EXX A;  205L A;  259L A;  4IBE A;  3V76 A;  1HQY E;  1CJ9 A;  4DR1 M;  3HZJ A;  1CU0 A;  201L A;  4UN2 B;  1XJT A;  2F32 A;  1D2W A;  2UU9 M;  1Z5C A;  129L A;  243L A;  1LMP A;  4I7P A;  2HTX A;  1SSY A;  3C58 A;  3SYL A;  1LGU A;  4UWU A;  139L A;  1GF0 A;  1B0D A;  1L13 A;  5F3W A;  1DYC A;  3A92 A;  2Y0T A;  4PJ2 C;  4B0D A;  3KP0 E;  3GRV A;  2HHH M;  119L A;  1ZMV A;  1Z5A A;  1LGX A;  2JUJ A;  5B59 A;  1YKX X;  1R5L A;  4JI1 M;  146L A;  2F5P A;  3GXR A;  4NSH A;  4EKR A;  5KPT A;  3SAR A;  1GAY A;  1L32 A;  1QQW A;  1T8G A;  3HT9 A;  2XBR A;  2QEN A;  1DPX A;  2J7N A;  1RE2 A;  4RLM A;  1C6K A;  4MST A;  2XF3 A;  1GBX A;  2DQG Y;  1L64 A;  1L09 A;  231L A;  4EKP A;  1L07 A;  1VDS A;  1XHB A;  4LRS A;  1K82 A;  1OYU A;  1IWZ A;  2R18 A;  1RU3 A;  2B3T A;  4IBD A;  3A91 A;  3AKZ A;  4DYG A;  5HQ1 A;  3SHG B;  3TMW A;  1LWK A;  2BQE A;  4AI6 A;  3EO5 A;  4WM4 A;  1DI5 A;  222L A;  2RB1 X;  2ZTD A;  4ARM A;  4OO9 A;  182L A;  1ZMW A;  1JIT A;  3A98 B;  1IR7 A;  4DD3 A;  2DHY A;  1OUF A;  4L78 A;  1XGU C;  3GUI A;  127L A;  164L A;  2CHV A;  1QUO A;  2Z38 A;  3C9P A;  3E46 A;  3HHX A;  1PQI A;  4M6D A;  4J1B A;  2X0A A;  4M4O A;  155L A;  1GJT A;  2Z18 A;  1CUK A;  4B49 A;  5I14 A;  4GIT A;  1C6A A;  3W0F A;  3L2X A;  3BBZ A;  5L8R F;  1NBY C;  2B72 A;  2RGO A;  2BJV A;  1GEZ A;  1L30 A;  1GB7 A;  1WQO A;  1GWD A;  2W1M A;  4GKJ M;  2C99 A;  1L1Z A;  2OOA A;  3G3V A;  1W5T A;  1QTB A;  5EXT A;  5FSW A;  1C63 A;  1IIZ A;  5KXZ A;  1HEQ A;  2F30 A;  3FTE A;  4YXC A;  3U6P A;  4AG6 A;  3VK7 A;  1JKA A;  1EQ5 A;  4W56 A;  1TDY A;  3J81 S;  1C6I A;  1L2B A;  4AG5 A;  1QTK A;  2UXB M;  1DGF A;  1GB5 A;  1LGW A;  5KXM A;  2B6Y A;  118L A;  3SFZ A;  1V7S A;  4Z6Y A;  5LVJ A;  4EIW A;  5F16 A;  1QTZ A;  3QE8 A;  4ETC A;  4LJ5 A;  6LYT A;  3K8Z A;  3SMS A;  1T6V L;  1G0G A;  1C6B A;  4W96 A;  1D0M A;  3A67 Y;  4DV7 M;  3W6E A;  1PJQ A;  2DI0 A;  2DHR A;  1KFV A;  1AZF A;  3DN0 A;  3DN6 A;  141L A;  4H90 A;  2A7D A;  3AJI B;  4P17 A;  4QNM A;  4RNA A;  3VFD A;  4XBO A;  4U3X B;  166L A;  1L22 A;  2CP8 A;  1QT8 A;  151L A;  2CUZ A;  1QUS A;  4H9F A;  3KOW E;  236L A;  1DV0 A;  107L A;  1VDQ A;  3I4V A;  4JI8 M;  4NRW A;  1LSM A;  2LYO A;  2R44 A;  5KJ9 A;  1C68 A;  1IQP A;  262L A;  235L A;  1JJ1 A;  1OAI A;  4PT5 A;  4GN4 A;  4Z98 A;  1LZN A;  1T8A A;  1L83 A;  4H8Y A;  1DI3 A;  3BOS A;  4WG1 A;  4FVM A;  1DGB A;  1PJT A;  1JTN A;  1L49 A;  1UIB A;  2UUB M;  3ZVQ A;  3W6F A;  1B7P A;  4YM8 A;  3GRR A;  3T6P A;  1GBY A;  1XEP A;  2W1X A;  1PJI A;  3HHY A;  4G4O A;  3A93 A;  2P5T A;  3D9A C;  5KO3 A;  5L3I A;  4UWV A;  4LDO A;  4L16 A;  3KOY E;  4W58 A;  2Q9E A;  4FCT A;  4I81 A;  9LYZ A;  1GF9 A;  1L1T A;  5IRE B;  1XSF A;  3I51 A;  1QS9 A;  1LZC A;  4YEN A;  4ZEE A;  2K9D A;  1OUC A;  3BXW A;  3GRU A;  1NSF A;  2DAM A;  4NXN M;  3GO8 A;  1L40 A;  1L58 A;  1QT4 A;  5H37 D;  1L15 A;  1LMT A;  3GPY A;  3J7A S;  1GFE A;  1NDM C;  5II3 A;  4G4R A;  4LJA A;  3SB8 A;  1DZB X;  1C7Y A;  1HSW A;  3WVY A;  1P5C A;  1LW9 A;  4I7S A;  5LVH A;  1JR3 E;  1L55 A;  251L A;  1JSE A;  3HUQ A;  4GLA A;  3DFZ A;  4NSO B;  3SN6 R;  2C96 A;  3GLF E;  1XNR M;  167L A;  4DV1 M;  4W53 A;  2BWE A;  4DBG B;  2OO9 A;  4JI2 M;  1LSN A;  3LZM A;  1HC0 A;  4B3S M;  1W6Z A;  3QYE A;  3FAD A;  3T38 A;  1E94 E;  1TDZ A;  1A4V A;  3KOZ E;  4WOA A;  1JIY A;  1OWZ A;  1JPO A;  2ZIL A;  5JI3 E;  3WU8 A;  4HP0 A;  1ZV1 A;  1R7R A;  2Y21 A;  3FTC A;  1L41 A;  208L A;  4QOS A;  4CHT B;  1IY2 A;  3AOE C;  3HH3 A;  2B6W A;  3GPX A;  4OWC A;  3LVW A;  4MGH A;  1C6L A;  3HUA A;  1BQL Y;  1VED A;  1LHM A;  1YAN A;  5T3F A;  4ZPX A;  3SBA A;  104L A;  1A5T A;  1LZ1 A;  5D5F A;  2RBR A;  1RCM A;  4WLX A;  3AZ6 A;  3HHZ A;  3R8F A;  3SAW A;  3FYD A;  1XEI A;  1G06 A;  3CT0 A;  2F4V M;  4JI5 M;  2B5Z A;  1VAU A;  4I8S A;  234L A;  1L89 A;  1XGQ C;  2D4I A;  2O7A A;  1JUG A;  1LSZ A;  226L A;  1QTE A;  4NHP A;  3AYQ A;  1L74 A;  1B5W A;  3GLF B;  3A90 A;  4EXM A;  1C6H A;  1CV4 A;  1NV8 A;  1OIP A;  1FLQ A;  2LWX A;  1T97 A;  1LAA A;  1IBL M;  1L82 A;  2MEC A;  1WGL A;  3GQ3 A;  4OVZ B;  1LJI A;  2PC2 A;  4HPE A;  3FE3 A;  2GNO A;  5ITX E;  181L A;  3FTD A;  153L A;  5ITU A;  1HFX A;  5DFL A;  3U6C A;  5EP2 A;  4KHP M;  1N78 A;  3U5Z B;  4CJ6 A;  133L A;  1L66 A;  3A6B Y;  1IXS A;  3C81 A;  1C6E A;  4OVZ A;  4D81 A;  2JY8 A;  2LC9 A;  3AGG G;  3OE9 A;  1GFA A;  4FCV A;  2DXI A;  3CDO A;  1T3P A;  2QNJ A;  4OOO A;  4WLT A;  3B74 A;  3NBX X;  1L52 A;  4W59 A;  1L02 A;  4E3U A;  1CV6 A;  3GUM A;  3IWR A;  1XEJ A;  4ITQ A;  1CV5 A;  3B7N A;  4CIS A;  1L94 A;  4XN6 A;  1G7L C;  1QTH A;  5DN4 A;  4EOF A;  1QUG A;  3EMS A;  4HEO A;  1E32 A;  4G4B A;  197L A;  1SXJ C;  1QVR A;  1BB6 A;  3OTO M;  1LYG A;  4DT3 A;  213L A;  1L05 A;  2OPF A;  1L20 A;  2W1L A;  4WL7 A;  1XC8 A;  4NY5 A;  3LMM A;  1NF5 A;  3E3D A;  2WSC F;  2ERC A;  5EQT A;  3G3B B;  3V2W A;  1PQJ A;  1BHZ A;  4WM5 A;  3D3D A;  1L45 A;  2QBY B;  1GFR A;  3PXG A;  1JIS A;  4FW9 A;  3L25 A;  1VEJ A;  2L09 A;  3SAV A;  1CX7 A;  4F2L A;  2ZIJ A;  3C7Z A;  2D7G A;  2H9J A;  2QBY A;  2WZJ A;  189L A;  4KPM A;  1P7S A;  1F0W A;  3RGS A;  4QNR A;  1IWW A;  1C6J A;  1QT5 A;  1GFH A;  1C6F A;  1LV7 A;  3FD9 A;  1NHW C;  4B3R M;  3GUO A;  4D80 A;  1GKI A;  3HWS A;  2RBS A;  2CUU A;  4W54 A;  1Q39 A;  2I7P A;  5DM9 A;  5M1Y A;  1WJ7 A;  178L A;  1ZVH L;  2QB0 B;  4PDI A;  2DAK A;  3E4R A;  4QHS A;  4J0L A;  2CHQ A;  1NJF A;  1L56 A;  247L A;  4AXT A;  3HJQ A;  1L98 A;  4PCZ A;  1PZY A;  3SHF A;  2KEB A;  1LZA A;  1L50 A;  2K0B X;  4A7D A;  4OOT A;  4DUY M;  3P68 A;  1CUP A;  4ETA A;  7LYZ A;  4PK0 A;  3VDU A;  2Z19 A;  4NEB A;  108L A;  4OWH A;  1KXX A;  2B73 A;  2L4E A;  1XXH B;  2XGN A;  242L A;  1IN8 A;  2HEE A;  2EJS A;  4YY3 M;  2C9O A;  2ZQ4 A;  1MX0 A;  3HX3 A;  3AL0 C;  3QY4 A;  4JI4 M;  4GC5 A;  2CRU A;  1L47 A;  2YNM D;  1G07 A;  2CV0 A;  3TQS A;  4KO8 A;  1G7J C;  248L A;  3HBD A;  3WYH A;  1B5V A;  4PPO A;  4QDN A;  1TGU A;  4HV2 A;  2BWB A;  2BQA A;  1JJ0 A;  2DWM A;  3J7B A;  1B7Q A;  4NHT A;  4TSB A;  1L67 A;  174L A;  232L A;  1B7M A;  4G4H A;  3E9S A;  2N35 A;  3NWL A;  1L42 A;  3PBL A;  4CFP A;  1VDP A;  1N32 M;  1L92 A;  1HFZ A;  1LYI A;  1DO2 A;  3A95 A;  1NHE A;  4I7R A;  1B7L A;  1IBM M;  120L A;  3AB6 A;  5ILC A;  1NV9 A;  1SWY A;  1UIE A;  4HJY A;  3SB7 A;  1TBY A;  2XFS A;  1IOR A;  4BS7 A;  4AW4 A;  1L2D A;  4GHL A;  3HH4 A;  2JP7 A;  185L A;  4M9S A;  1HEP A;  4LRT A;  3DN1 A;  1LSC A;  2I7N A;  4FJR A;  4I7K A;  3P4Z A;  4E97 A;  1GB0 A;  7LZM A;  2EKF A;  2LZT A;  3AZ7 A;  4EMN A;  4TUW A;  1PRB A;  5JI2 E;  1JKB A;  1GB9 A;  4YEO A;  3RFW A;  4AKH A;  2CGI A;  5KY1 A;  1J1X Y;  4JV5 M;  111L A;  1LZB A;  2DWZ B;  2BQO A;  1GJS A;  1VQ1 A;  1NKH A;  4K0K M;  4EPF A;  2EIZ C;  4LJ7 A;  5KQ8 A;  1JEF A;  1QUT A;  249L A;  3TWM A;  1CJ8 A;  3HTB A;  4OW1 A;  1LJE A;  1L37 A;  1LYJ A;  2BLY A;  206L A;  3CF6 E;  2MJ5 B;  1I20 A;  260L A;  4WW0 A;  2BQH A;  2LHG A;  2BJW A;  2KXE A;  4BAF A;  1PJS A;  2F2N A;  1LYO A;  1L87 A;  5KXO A;  2ZIK A;  1F6S A;  3RUN A;  1IN7 A;  1UIF A;  4ARQ A;  2YDG A;  1I4W A;  1IM2 A;  2LVA A;  4NGL A;  4PD2 A;  3KS8 A;  2LVO C;  5FLX S;  5C18 A;  1NNU C;  2W1Y A;  5HMJ A;  4XAD A;  1G7H C;  5E6J A;  4AGA A;  3PVS A;  4DR4 M;  4JI0 M;  4DDA A;  1C62 A;  4LY6 A;  2OE9 X;  1PGY A;  3TXD A;  1WVV A;  4WM1 A;  1CX6 A;  1UA6 Y;  1ZWN A;  1MEL L;  1EPY A;  4LGK A;  2KRK A;  1ZUR A;  5B05 A;  1DKK A;  1KXW A;  1F6R A;  4X66 M;  3P66 A;  3FUU A;  2B6T A;  1JQJ C;  2BPU A;  1QZE A;  1UIC A;  2X4A A;  2C5R A;  3OJP A;  4Q7J A;  1VG5 A;  3TXG A;  2R4E A;  1JQU A;  4H91 A;  1YKY X;  1HT2 E;  2DEN A;  2EKK A;  2XSZ D;  1BB7 A;  2NWD X;  3SAU A;  3DMV A;  3M3U A;  5I53 A;  245L A;  2LZ2 A;  4XYY A;  2W82 A;  3HY5 A;  3ZH9 B;  3HT6 A;  4RDS A;  1G4A E;  254L A;  3AV0 A;  3AZ4 A;  172L A;  3DKE X;  4DR2 M;  3MJ5 A;  2H5X A;  3FI5 A;  2KHH A;  1DGG A;  1GXX A;  1G0K A;  1UFZ A;  4DDC A;  4MM3 B;  1GFU A;  1JKC A;  1L88 A;  2O79 A;  1SXJ A;  3AZ5 A;  4II7 A;  3RW8 A;  5BR8 M;  1GO5 A;  3WW5 A;  1RFP A;  1GFV A;  1YIK A;  2XBS A;  4JI3 M;  2HUK A;  4DAJ A;  2DWN A;  2ZNX Y;  5FTL A;  2XZU A;  3LCV B;  1QTD A;  5LXW A;  3HDE A;  1VEG A;  2M60 A;  3LZT A;  1XGR C;  3FRH A;  5KKI A;  134L A;  4NOO B;  1QTV A;  1UIA A;  1OKS A;  1QSQ A;  1XJU A;  5J7C A;  1EQ4 A;  1PS5 A;  2B70 A;  1OQM A;  2DQH Y;  2ZNW Y;  3HFM Y;  4H9C A;  4WO9 A;  4LF7 M;  1CKF A;  2Y8P A;  2DAI A;  1R2Y A;  1ZMU A;  1IN6 A;  3A46 A;  3DN3 A;  5L3H A;  2VII A;  3AW6 A;  1I1Z A;  4LYM A;  5LYT A;  1XNQ M;  168L A;  1YAP A;  217L A;  4ETD A;  4OWB A;  3ZEK A;  4NL4 H;  1B9O A;  1OUE A;  1EE8 A;  4NWE A;  3JR5 A;  1VFB C;  1C46 A;  1WQQ A;  1D3J A;  3HT8 A;  2LTU A;  1RJC B;  4X62 M;  5EXS A;  1OUD A;  2H5Z A;  4DD7 A;  5A2Q S;  4D82 A;  3TXI A;  5FTK A;  2R45 A;  1BWI A;  2GV0 A;  4XJF A;  1PQM A;  2OE7 X;  5LAF A;  4ARM B;  5DNY A;  1G1W A;  1L79 A;  4L4U A;  1P6Y A;  2J7O A;  1IN4 A;  240L A;  4GC9 A;  1CKD A;  1L03 A;  2RB2 X;  1V7T A;  5EBH A;  1OJL A;  4X65 M;  3GXK A;  3U6Q A;  1LJN A;  1LSE A;  257L A;  5HLL A;  1FBI X;  4AZF A;  4Z46 A;  1XGT C;  1HEL A;  1JTP L;  4W52 A;  1GF8 A;  4LF4 M;  1IWX A;  4HTK A;  156L A;  4DD0 A;  3SB9 A;  1L35 A;  1TR8 A;  4XJH A;  5LIO A;  1L51 A;  3HU2 A;  3WUN A;  4CJ2 A;  4HL4 A;  4I7M A;  2J5Y A;  1LZR A;  2R62 A;  1J5E M;  2HU1 A;  1QS5 A;  1LHH A;  4LG2 A;  1RI8 B;  1TLA A;  3P64 A;  1IOC A;  1GF7 A;  4M0D A;  4NHI A;  1NJG A;  2F5S A;  1FKQ A;  2DQA A;  4I7O A;  1IWV A;  4J1A A;  4GLV A;  1FDL Y;  1LHJ A;  1LZ4 A;  2Z37 A;  5ITR A;  3LVV A;  1L48 A;  4N0J A;  3TXH A;  3FUX A;  2DAE A;  125L A;  3H4M A;  3U61 A;  3KSJ A;  4KT0 F;  3TXJ A;  4XGI A;  1LSG A;  1H6U A;  1WIV A;  4LFX A;  2D4K A;  4GIP A;  4ANR A;  1L17 A;  1FLY A;  4H9A A;  3GUJ A;  1HEM A;  1OTR A;  1L81 A;  5B07 A;  5APC A;  1WTN A;  4LZM A;  3I04 M;  1L95 A;  1L8Q A;  3WU9 A;  4H9H A;  3W6B A;  1KY1 A;  2V1C A;  1N75 A;  2F5O A;  4W55 A;  4LT1 A;  2B7X A;  3HTD A;  1TF0 B;  3RE8 A;  2G4N A;  3SBB C;  1L72 A;  3T36 A;  2FNA A;  1BB3 A;  2HUL A;  2KNZ A;  1OUA A;  161L A;  5I4Y A;  4I0C A;  1YUB A;  2F5N A;  5DLA A;  3A94 A;  2BAA A;  4FWD A;  2XZF A;  1NQI A;  1INU A;  4IBJ A;  2LVQ D;  4EPI A;  1IR9 A;  5FEL A;  1YL1 X;  4GBR B;  2DAG A;  4MGY E;  1LWG A;  2BLX A;  4GN3 A;  1T6O A;  2FYC A;  4IBC A;  2RH1 A;  2OU9 A;  4II8 A;  3M6A A;  2Z2F A;  4GCD A;  4DV0 M;  173L A;  1JR3 D;  1MJG M;  1QYR A;  4DV5 M;  5FTN A;  1IEE A;  1L33 A;  5HMV A;  1Z55 A;  228L A;  2Z3X A;  3R9X B;  3RT5 X;  3ZVQ B;  4HLQ A;  250L A;  2WSF F;  3TXF A;  4B08 A;  1JTO L;  1L0K A;  1UID A;  1D9W A;  1HEN A;  2BQB A;  4FD2 A;  1B5X A;  258L A;  1TTE A;  5LIN A;  4G3O A;  4GKK M;  1CV0 A;  1L84 A;  1O23 A;  2N5Z A;  2LZM A;  1L85 A;  2BQK A;  2GQF A;  1UCO A;  4S0W A;  211L A;  1OAO C;  1GAZ A;  115L A;  1LZG A;  1C10 A;  5KXP A;  4B3T M;  138L A;  2B6Z A;  3AW7 A; 
#chains in the Genus database with same CATH homology
 1LHK A;  3JR6 A;  3QAK A;  3GUL A;  1L44 A;  8LYZ A;  2BQJ A;  2MEB A;  3WMK A;  1GD6 A;  1HF4 A;  1LZ8 A;  3HUK A;  2BQN A;  4PHI A;  1GB6 A;  157L A;  1WQN A;  175L A;  4HJZ A;  3HTG A;  2BQM A;  2RB0 X;  3A8Z A;  3OK0 A;  1C6D A;  4NGV A;  5LVK A;  2Z6B A;  253L A;  1IP4 A;  1HHL A;  1QUH A;  3DN4 A;  1DPW A;  1L63 A;  187L A;  5KKJ A;  2HED A;  4ARP A;  154L A;  1GBZ A;  1D0L A;  1C65 A;  4C5F A;  2F47 A;  2EQL A;  1GF3 A;  3DN2 A;  1GXV 2;  2MEG A;  1LSP A;  3HH5 A;  3N9A A;  2RBO A;  1LMN A;  239L A;  3HU8 A;  1L75 A;  2Q0M X;  256L A;  1L24 A;  2HEB A;  246L A;  1GDX A;  4ZFP A;  1CKG A;  4OWE A;  4HPI A;  1CJ6 A;  3ULR A;  4LT0 A;  1IWU A;  5A3Z A;  1LI2 A;  1P56 A;  3N9E A;  1L01 A;  3AGI A;  4NWH A;  1LZS A;  4QGZ A;  3F8V A;  3NY8 A;  1L69 A;  4I7J A;  113L A;  200L A;  227L A;  2DQE Y;  1L21 A;  3TXB A;  3LHM A;  1L11 A;  1QTC A;  4DD2 A;  1C6C A;  1GFK A;  1L86 A;  4YEM A;  3WXT A;  163L A;  158L A;  131L A;  1OP9 B;  4W51 A;  3ATO A;  4NSG A;  4I7T A;  1CNS A;  6LZM A;  1C69 A;  3PDS A;  1F10 A;  1SWZ A;  3LYM A;  1JTM A;  1PQK A;  1PQO A;  1C7P A;  1GB3 A;  1CU2 A;  137L A;  4LT3 A;  4LYZ A;  1IP7 A;  152L A;  209L A;  4X3B A;  5C6L A;  3WUL A;  4YXA C;  1LYH A;  1ZYT A;  1IC4 Y;  1D0K A;  145L A;  1YIL A;  1ZVY B;  5AMY A;  2YBN A;  1DQJ C;  3BKH A;  1GE3 A;  1L97 A;  2DQC Y;  3IJV A;  1LTM A;  1SQ2 L;  2RAZ X;  1JJ3 A;  1HFY A;  3DN8 A;  1REX A;  5IEL A;  4GN5 C;  1L43 A;  198L A;  2A7F A;  1L76 A;  148L E;  4ARL A;  1IVM A;  1L38 A;  1BVK C;  4H93 A;  4HTQ A;  5FST A;  3HH6 A;  4ARJ A;  1E8L A;  3WPL A;  3DNA A;  1UAC Y;  1LYZ A;  3FE0 A;  130L A;  1LJJ A;  1CV3 A;  1L99 A;  4J7V A;  4XJI A;  1JWR A;  3C7Y A;  1QSA A;  1JHL A;  4XJG A;  3W3E A;  1L12 A;  4D9Z A;  5B06 A;  2RBQ A;  1C66 A;  4RLN A;  2BQD A;  1GF4 A;  4NGK A;  1LKS A;  3DMX A;  4IAP A;  1FLU A;  4NFV A;  5HNC A;  1GE1 A;  1H87 A;  1LPI A;  2CJL A;  2IHL A;  5ILF A;  3TXK A;  4NGO A;  4Z3M A;  1HEO A;  2OTZ X;  2G4Q A;  114L A;  191L A;  2F4A A;  1P36 A;  3AGH A;  1LZY A;  5KXW A;  1KY0 A;  1OUH A;  1NBZ C;  3SP3 A;  1GDW A;  5C6I A;  2XJW A;  1OWY A;  1J1P Y;  1VAT A;  1HSX A;  3C8R A;  1C6N A;  1WQM A;  3C8S A;  1L19 A;  1AT5 A;  1L34 A;  1C6G A;  2BQC A;  1LYY A;  4YX7 C;  1KS3 A;  1LZ9 A;  220L A;  1IWY A;  1IOT A;  1LSY A;  3B0I A;  1B6I A;  1QSW A;  1JKD A;  1L93 A;  216L A;  4TX7 A;  144L A;  3RNX A;  3TMX A;  180L A;  1BVX A;  3FI7 A;  2G4P A;  1SX2 A;  1LMC A;  4TUN A;  5F9U A;  2MEF A;  1BB5 A;  3WL2 A;  212L A;  4PJZ A;  2FYD A;  1LHL A;  4N1E I;  1L61 A;  1ZV5 L;  3A3R X;  176L A;  4O34 A;  1T8F A;  2RSC A;  1B7O A;  3CDV A;  1WVU A;  4WLY A;  1C60 A;  3M18 B;  5E9R A;  5KXY A;  3WPJ A;  4ARQ B;  1B5Z A;  1EL1 A;  5F14 A;  177L A;  1C61 A;  1C64 A;  4PGJ B;  3C82 A;  4MR1 A;  3L64 A;  4WO6 A;  4QEQ A;  1NDG C;  193L A;  2DQJ Y;  4HSF A;  171L A;  3J4G A;  4XJD A;  4OWA A;  2A4T A;  1LMO A;  3WPK A;  2Z12 A;  2NTG A;  1IP3 A;  1K28 A;  4LYT A;  3HBH A;  3T6U A;  1B7S A;  1SLY A;  1D2Y A;  2DKV A;  196L A;  1A2Y C;  1L46 A;  2DBT A;  4ET8 A;  1GFJ A;  1P46 A;  4N8Z A;  4KT3 A;  1GPQ C;  1L16 A;  1OUB A;  1P64 A;  147L A;  1LZE A;  4G49 A;  102L A;  4EKQ A;  2WAR A;  1IO5 A;  1UBZ A;  3KAM A;  1L65 A;  1FLW A;  3CT5 A;  149L A;  1GE0 A;  5I54 A;  5LVG A;  1AM7 A;  1IX0 A;  1DI4 A;  1G7M C;  2ANX A;  1P2R A;  2HUB A;  5A3E A;  2MEH A;  1LJ3 A;  112L A;  2ZYC A;  1IY4 A;  1GE2 A;  3VWO A;  3SB6 A;  1HML A;  5B1F A;  5D5C A;  241L A;  4RW1 A;  4ZIX A;  1CU6 A;  4R6C A;  3LYT A;  1MLC E;  4ETE A;  3IJU A;  5LZM A;  1L14 A;  4CGE A;  3HWL A;  2Z2E A;  2YBM A;  1KW5 A;  1GEV A;  1B7N A;  1VDT A;  1G1V A;  2HU3 A;  165L A;  5LVI A;  223L A;  1WQR A;  5DL9 A;  1L08 A;  4GCC A;  1SX7 A;  1LCN A;  4G9S A;  4TSC A;  4DQJ A;  4NGI A;  1G0Q A;  1L23 A;  3CSZ A;  4NSJ A;  4N5R A;  1OV7 A;  3RZE A;  3A3Q A;  1HNL A;  1L18 A;  3LYZ A;  1KNI A;  4LFP A;  1C6T A;  1L70 A;  1IC7 Y;  210L A;  4MCK A;  1IOQ A;  5DN5 A;  1GBW A;  3N9C A;  1DYD A;  1OVK A;  2MED A;  1J1O Y;  4BAD A;  5LA8 A;  3GUN A;  4IAT A;  1GBO A;  3DMZ A;  2B6X A;  1C08 C;  1CU5 A;  214L A;  1GE4 A;  1L39 A;  4LYC A;  1YKZ X;  3B0O A;  4WG7 A;  4KL7 A;  5APF A;  3ATN A;  2O4W A;  1BB4 A;  255L A;  3A34 A;  4L41 A;  1L57 A;  3CDQ A;  4WM3 A;  2B75 A;  2MEI A;  2LYM A;  1LJK A;  1P2L A;  1CKH A;  1L36 A;  1KXY A;  4W94 A;  1YQV Y;  4DQ7 A;  1IC5 Y;  1DXJ A;  1YL0 X;  4PRQ A;  1QDT A;  2FBD A;  160L A;  3C80 A;  2EKS C;  1QT7 A;  4KXI A;  2I25 L;  1BWJ A;  4DWX A;  4IAS A;  2F4G A;  4XJB A;  199L A;  4QY9 A;  2FBB A;  1LKR A;  1L73 A;  2YBH A;  5FHW A;  3SB5 A;  5HNL A;  1LSD A;  4B4E A;  3W6A A;  126L A;  1KIQ C;  1D3N A;  123L A;  4NGZ A;  2YBL A;  1LJG A;  229L A;  2DQF C;  1DYF A;  1TEW A;  135L A;  2QAR C;  261L A;  2CWI A;  4GCF A;  1IP6 A;  225L A;  207L A;  4N1C C;  1XEK A;  1DYG A;  3TMU A;  3D4S A;  1AT6 A;  4NG1 A;  2ZQ3 A;  5F9X A;  1C45 A;  3C8Q A;  1L53 A;  233L A;  5C6J A;  1GHL A;  3HU9 A;  1DYB A;  1G0J A;  4LYB A;  1QDR A;  1GB2 A;  4I7N A;  143L A;  3B0K A;  1CUQ A;  3LYO A;  3G3A B;  1L90 A;  3LN2 A;  1FN5 A;  4DQ5 A;  1YAQ A;  1GFT A;  1REM A;  3CDT A;  5FDJ A;  1FKV A;  3EXD A;  1YRO A;  1L71 A;  244L A;  190L A;  2ANV A;  1NMM A;  1CJ7 A;  2HUM A;  1LMA A;  2BQL A;  4H9B A;  5FEK A;  4ETB A;  1LHI A;  1P3N A;  3A96 A;  1LJ4 A;  2DQD Y;  2OEA X;  1HMK A;  1C6M A;  1G0P A;  3C83 A;  2LHM A;  122L A;  1LLH A;  183L A;  1GB8 A;  5L9J A;  1L62 A;  2ZYP A;  3HTF A;  1EQE A;  1UIG A;  3OE8 A;  2MEA A;  3VW7 A;  3HT7 A;  1C6P A;  4TWS A;  5KXL A;  3CB7 A;  3HDF A;  3B72 A;  3CSQ A;  4LDE A;  1LJF A;  1IR8 A;  1LSA A;  3UON A;  1L60 A;  1UUZ C;  3CT1 A;  2F2Q A;  140L A;  3CSR A;  2D6B A;  4H9E A;  3C7W A;  1WTH A;  1LMQ A;  1L91 A;  3NYA A;  2BQG A;  1SSW A;  3OE0 A;  1PQD A;  3WUM A;  132L A;  2DQI Y;  3F9L A;  1L28 A;  2Z39 A;  4FDY A;  1OVJ A;  1WTM A;  4NHS A;  2L78 A;  1LZT A;  1G0L A;  4H94 A;  1I6S A;  1LZ5 A;  5KXS A;  1TAY A;  5K7O A;  1LJH A;  4LT2 A;  162L A;  2H9K A;  1B7R A;  4WM2 A;  6LYZ A;  188L A;  1C67 A;  184L A;  237L A;  215L A;  2XQO A;  1B5Y A;  170L A;  5APE A;  5IDD A;  3RU5 A;  2EPE A;  4NHQ A;  5LAG A;  4HV1 A;  2LYZ A;  5LYZ A;  1G7I C;  1CTW A;  1L31 A;  1UIH A;  1CKC A;  1C43 A;  4IJ4 A;  2LCB A;  4EJ4 A;  218L A;  1L29 A;  3G3X A;  4LZT A;  2Q9D A;  1BGI A;  4PRU A;  1BWH A;  3BKV A;  2YBJ A;  5FCP A;  2VB1 A;  4WLD A;  2RBN A;  1DYE A;  2HEC A;  4YF2 A;  1GFG A;  230L A;  1OUI A;  4B4I A;  1LYE A;  192L A;  4I7Q A;  1L06 A;  1T6H A;  1L10 A;  1REZ A;  1L68 A;  1KIR C;  1B5U A;  3TXE A;  252L A;  2AUB A;  195L A;  4H92 A;  109L A;  1XFP L;  194L A;  1QIO A;  5I4X A;  1WQP A;  4DKL A;  3GUP A;  4NGJ A;  3TMV A;  2IGC A;  1L96 A;  2D4J A;  2RAY X;  5B1G A;  3WVX A;  1IP5 A;  3ODU A;  1W08 A;  1P2C C;  1D9U A;  110L A;  1LI3 A;  5LA5 A;  4ET9 A;  2C8O A;  1L27 A;  3WU7 A;  142L A;  1JTT L;  1HEW A;  1JSF A;  2D91 A;  3QNG A;  150L A;  1H6M A;  4DD1 A;  4NGW A;  3B6L A;  1L77 A;  3W6C A;  1AKI A;  3A6C Y;  4LYO A;  1QSB A;  2YSS C;  1NHB A;  1QT3 A;  1IWT A;  1OV5 A;  5APD A;  4LDL A;  4B4J A;  4WMG A;  4HTN A;  3EBA B;  3NY9 A;  3WW6 A;  2RBP A;  1P37 A;  5LYM A;  1B2K A;  1L54 A;  2XTH A;  4G4C A;  5I4W A;  3CQL A;  1KIP C;  5E4P A;  1ALC A;  4EKS A;  2OU0 X;  1DKJ A;  1LYF A;  2NTH A;  4GRV A;  1KW7 A;  4ZPU A;  1LOZ A;  4GCB A;  1DYA A;  1L04 A;  1L80 A;  5KXK A;  4WL6 A;  4HJV A;  3HBE X;  2YVB A;  4TTD A;  1LI6 A;  1REY A;  3J6K A;  4K5Y A;  4RW2 A;  4N9R A;  1D3M A;  1D6P A;  4ML7 A;  1IY3 A;  1IOS A;  2HEF A;  1CV1 A;  2B74 A;  2IFF Y;  2YBI A;  5KXT A;  5I5Q A;  3W6D A;  4UWN A;  103L A;  4W57 A;  2HEA A;  4H8Z A;  4P2E A;  4NGY A;  1CVK A;  1NWG A;  4R0F A;  3AJN A;  2MEE A;  1YAM A;  3MGW A;  159L A;  238L A;  4BAP A;  4C3W A;  3FA0 A;  4NSI A;  1C6Q A;  1QT6 A;  1GF6 A;  3V2Y A;  1CU3 A;  4CHX A;  3WXU A;  1G0M A;  2ZWB A;  1L26 A;  219L A;  4NIJ A;  1GBS A;  5IHG A;  128L A;  1QUD A;  2BQI A;  1LYD A;  2CDS A;  3K2R A;  3P65 A;  4H8X A;  4XEN A;  1L59 A;  3F6Z A;  1TCY A;  4Z41 A;  1XGP C;  5KXN A;  4DDB A;  2OE4 X;  3WUA A;  169L A;  5JEN B;  4CFO A;  3WH1 A;  4H1P A;  2OTY X;  1LZD A;  3EML A;  1YAO A;  2C8P A;  3LZ2 A;  1LSB A;  1UC0 A;  4DC4 A;  5KXR A;  3G3W A;  1LYS A;  1L0J A;  1L25 A;  1IP2 A;  2I26 L;  1GF5 A;  1D3F A;  1D6Q A;  4B1A A;  3CDR A;  4YOP A;  1I56 A;  1HER A;  1LPY A;  3K3T A;  4DD9 A;  4AQN A;  3GUK A;  2I6Z A;  4I7L A;  3RZ4 A;  1OUG A;  2OU8 A;  5KXX A;  2BQF A;  1OVH A;  1ZMY L;  186L A;  1LSF A;  4NG8 A;  3OE6 A;  1QQY A;  1L00 A;  4DJH A;  5F81 A;  221L A;  1IP1 A;  4H9I A;  4GCE A;  4WM6 A;  1N4F A;  1LZ6 A;  224L A;  1OUJ A;  259L A;  205L A;  1CJ9 A;  1CU0 A;  201L A;  1XJT A;  2F32 A;  1D2W A;  243L A;  129L A;  1LMP A;  4I7P A;  2HTX A;  1SSY A;  1LGU A;  4UWU A;  139L A;  1GF0 A;  1B0D A;  1L13 A;  1DYC A;  3A92 A;  4PJ2 C;  4B0D A;  119L A;  1LGX A;  5B59 A;  1YKX X;  3GXR A;  4NSH A;  146L A;  4EKR A;  1GAY A;  1L32 A;  1T8G A;  3HT9 A;  2XBR A;  1DPX A;  1RE2 A;  4RLM A;  1C6K A;  4MST A;  1GBX A;  2DQG Y;  1L64 A;  1L09 A;  231L A;  4EKP A;  1L07 A;  1VDS A;  1OYU A;  1IWZ A;  3A91 A;  4DYG A;  5HQ1 A;  3TMW A;  1LWK A;  2BQE A;  3EO5 A;  4WM4 A;  1DI5 A;  222L A;  2RB1 X;  4ARM A;  4OO9 A;  182L A;  1JIT A;  4DD3 A;  1IR7 A;  1OUF A;  1XGU C;  3GUI A;  127L A;  164L A;  1QUO A;  2Z38 A;  1PQI A;  4M6D A;  4J1B A;  2X0A A;  4M4O A;  155L A;  2Z18 A;  4B49 A;  5I14 A;  1C6A A;  3L2X A;  1NBY C;  2B72 A;  1GEZ A;  1L30 A;  1GB7 A;  1WQO A;  1GWD A;  2W1M A;  3G3V A;  1QTB A;  1C63 A;  1IIZ A;  5KXZ A;  1HEQ A;  2F30 A;  4YXC A;  1JKA A;  1EQ5 A;  4W56 A;  1TDY A;  1C6I A;  1QTK A;  1GB5 A;  1LGW A;  5KXM A;  2B6Y A;  118L A;  1V7S A;  5LVJ A;  5F16 A;  1QTZ A;  3QE8 A;  4ETC A;  6LYT A;  1T6V L;  1G0G A;  1C6B A;  4W96 A;  1D0M A;  3A67 Y;  3W6E A;  1AZF A;  3DN6 A;  3DN0 A;  141L A;  4H90 A;  2A7D A;  4U3X B;  166L A;  1L22 A;  1QT8 A;  151L A;  1QUS A;  4H9F A;  236L A;  107L A;  1VDQ A;  1LSM A;  2LYO A;  5KJ9 A;  1C68 A;  262L A;  235L A;  1JJ1 A;  4GN4 A;  4Z98 A;  1LZN A;  1T8A A;  1L83 A;  4H8Y A;  1DI3 A;  4WG1 A;  1L49 A;  1JTN A;  1UIB A;  3ZVQ A;  3W6F A;  1B7P A;  4YM8 A;  1GBY A;  1XEP A;  2W1X A;  3A93 A;  3D9A C;  5L3I A;  4UWV A;  4LDO A;  4W58 A;  2Q9E A;  9LYZ A;  1GF9 A;  1XSF A;  1QS9 A;  1LZC A;  4YEN A;  4ZEE A;  1OUC A;  1L40 A;  1L58 A;  1QT4 A;  1L15 A;  1LMT A;  1GFE A;  1NDM C;  5II3 A;  3SB8 A;  1DZB X;  1HSW A;  3WVY A;  1P5C A;  1LW9 A;  4I7S A;  5LVH A;  1L55 A;  251L A;  1JSE A;  3HUQ A;  4GLA A;  3SN6 R;  167L A;  4W53 A;  1LSN A;  3LZM A;  1HC0 A;  1W6Z A;  3FAD A;  1A4V A;  4WOA A;  1JIY A;  1OWZ A;  1JPO A;  2ZIL A;  3WU8 A;  4HP0 A;  1L41 A;  208L A;  3HH3 A;  2B6W A;  4OWC A;  1C6L A;  3HUA A;  1BQL Y;  1VED A;  1LHM A;  1YAN A;  5T3F A;  3SBA A;  104L A;  1LZ1 A;  5D5F A;  2RBR A;  1RCM A;  4WLX A;  3AZ6 A;  1XEI A;  1G06 A;  3CT0 A;  2B5Z A;  1VAU A;  4I8S A;  234L A;  1L89 A;  1XGQ C;  2D4I A;  2O7A A;  1JUG A;  1LSZ A;  226L A;  1QTE A;  4NHP A;  3AYQ A;  1L74 A;  1B5W A;  3A90 A;  4EXM A;  1C6H A;  1CV4 A;  1FLQ A;  1T97 A;  1LAA A;  1L82 A;  2MEC A;  1LJI A;  4HPE A;  2PC2 A;  181L A;  153L A;  1HFX A;  133L A;  1L66 A;  3A6B Y;  3C81 A;  1C6E A;  2LC9 A;  3AGG G;  3OE9 A;  1GFA A;  3CDO A;  1T3P A;  4OOO A;  4WLT A;  1L52 A;  4W59 A;  1L02 A;  4E3U A;  1CV6 A;  3IWR A;  3GUM A;  1XEJ A;  1CV5 A;  1L94 A;  4XN6 A;  1G7L C;  1QTH A;  5DN4 A;  4EOF A;  1QUG A;  3EMS A;  4G4B A;  197L A;  1BB6 A;  1LYG A;  4DT3 A;  213L A;  1L05 A;  1L20 A;  2W1L A;  4WL7 A;  4NY5 A;  1NF5 A;  3E3D A;  3G3B B;  3V2W A;  1PQJ A;  1BHZ A;  4WM5 A;  3D3D A;  1L45 A;  1GFR A;  1JIS A;  1CX7 A;  2ZIJ A;  3C7Z A;  2H9J A;  189L A;  4KPM A;  1P7S A;  1F0W A;  1IWW A;  1C6J A;  1QT5 A;  1GFH A;  1C6F A;  3GUO A;  2RBS A;  2CUU A;  4W54 A;  5DM9 A;  5M1Y A;  178L A;  1ZVH L;  2QB0 B;  4J0L A;  1L56 A;  247L A;  4AXT A;  1L98 A;  1PZY A;  1LZA A;  1L50 A;  4A7D A;  4OOT A;  3P68 A;  1CUP A;  4ETA A;  7LYZ A;  4PK0 A;  2Z19 A;  4NEB A;  108L A;  4OWH A;  1KXX A;  2B73 A;  242L A;  2HEE A;  2ZQ4 A;  3QY4 A;  1L47 A;  1G07 A;  1G7J C;  248L A;  3HBD A;  3WYH A;  1B5V A;  4PPO A;  4QDN A;  4HV2 A;  2BQA A;  1JJ0 A;  1B7Q A;  4NHT A;  4TSB A;  1L67 A;  174L A;  232L A;  1B7M A;  4G4H A;  1L42 A;  3PBL A;  4CFP A;  1VDP A;  1L92 A;  1HFZ A;  1LYI A;  3A95 A;  1NHE A;  4I7R A;  1B7L A;  120L A;  3AB6 A;  5ILC A;  1SWY A;  1UIE A;  4HJY A;  3SB7 A;  1TBY A;  1IOR A;  4BS7 A;  3HH4 A;  185L A;  1HEP A;  3DN1 A;  1LSC A;  4FJR A;  4I7K A;  3P4Z A;  4E97 A;  1GB0 A;  7LZM A;  2LZT A;  3AZ7 A;  4EMN A;  1JKB A;  1GB9 A;  4YEO A;  2CGI A;  5KY1 A;  1J1X Y;  111L A;  1LZB A;  2BQO A;  1NKH A;  4EPF A;  2EIZ C;  249L A;  1JEF A;  1QUT A;  1CJ8 A;  3HTB A;  4OW1 A;  1LJE A;  1L37 A;  1LYJ A;  2BLY A;  206L A;  260L A;  1I20 A;  2BQH A;  4BAF A;  2F2N A;  1LYO A;  1L87 A;  5KXO A;  2ZIK A;  1F6S A;  3RUN A;  1UIF A;  4ARQ A;  2YDG A;  4NGL A;  2W1Y A;  5HMJ A;  4XAD A;  1G7H C;  4AGA A;  4DDA A;  1C62 A;  2OE9 X;  3TXD A;  1WVV A;  4WM1 A;  1CX6 A;  1UA6 Y;  1ZWN A;  1MEL L;  1EPY A;  4LGK A;  1ZUR A;  5B05 A;  1DKK A;  1KXW A;  1F6R A;  3P66 A;  2B6T A;  2BPU A;  1UIC A;  3OJP A;  3TXG A;  1JQU A;  4H91 A;  1YKY X;  1BB7 A;  2NWD X;  3DMV A;  3M3U A;  5I53 A;  245L A;  2LZ2 A;  4XYY A;  3HT6 A;  4RDS A;  254L A;  3AZ4 A;  172L A;  3DKE X;  3FI5 A;  1GXX A;  1G0K A;  4DDC A;  1GFU A;  1JKC A;  1L88 A;  2O79 A;  3AZ5 A;  3RW8 A;  3WW5 A;  1RFP A;  1GFV A;  1YIK A;  2XBS A;  2HUK A;  4DAJ A;  2ZNX Y;  1QTD A;  5LXW A;  3HDE A;  3LZT A;  1XGR C;  5KKI A;  134L A;  1QTV A;  1UIA A;  1QSQ A;  1XJU A;  5J7C A;  1EQ4 A;  1PS5 A;  4H9C A;  2B70 A;  1OQM A;  2DQH Y;  2ZNW Y;  3HFM Y;  4WO9 A;  1CKF A;  2Y8P A;  5L3H A;  3DN3 A;  4LYM A;  3AW6 A;  1I1Z A;  5LYT A;  168L A;  1YAP A;  217L A;  4ETD A;  4OWB A;  3ZEK A;  1B9O A;  1OUE A;  4NWE A;  1VFB C;  1C46 A;  1WQQ A;  1D3J A;  3HT8 A;  1RJC B;  2H5Z A;  1OUD A;  4DD7 A;  3TXI A;  1BWI A;  2GV0 A;  4XJF A;  1PQM A;  2OE7 X;  5LAF A;  4ARM B;  1G1W A;  1L79 A;  1P6Y A;  240L A;  1CKD A;  1L03 A;  2RB2 X;  1V7T A;  5EBH A;  3GXK A;  1LJN A;  1LSE A;  257L A;  5HLL A;  1FBI X;  4Z46 A;  1XGT C;  1HEL A;  1JTP L;  4W52 A;  1GF8 A;  1IWX A;  4HTK A;  156L A;  4DD0 A;  3SB9 A;  1L35 A;  4XJH A;  5LIO A;  1L51 A;  3WUN A;  4CJ2 A;  4I7M A;  1LZR A;  2HU1 A;  1QS5 A;  1LHH A;  1RI8 B;  1TLA A;  3P64 A;  1IOC A;  1GF7 A;  4NHI A;  1FKQ A;  2DQA A;  4I7O A;  1IWV A;  4J1A A;  4GLV A;  1FDL Y;  1LHJ A;  1LZ4 A;  2Z37 A;  1L48 A;  4N0J A;  3TXH A;  125L A;  3TXJ A;  1LSG A;  4LFX A;  2D4K A;  4ANR A;  1L17 A;  1FLY A;  4H9A A;  3GUJ A;  1HEM A;  1L81 A;  5B07 A;  5APC A;  1WTN A;  4LZM A;  1L95 A;  3WU9 A;  4H9H A;  3W6B A;  1KY1 A;  4W55 A;  4LT1 A;  2B7X A;  3HTD A;  2G4N A;  3SBB C;  1L72 A;  3T36 A;  1BB3 A;  2HUL A;  1OUA A;  161L A;  5I4Y A;  4I0C A;  5DLA A;  3A94 A;  2BAA A;  1NQI A;  1INU A;  4EPI A;  1IR9 A;  5FEL A;  1YL1 X;  4GBR B;  2BLX A;  4GN3 A;  1LWG A;  2FYC A;  2RH1 A;  2OU9 A;  4II8 A;  2Z2F A;  4GCD A;  173L A;  1IEE A;  1L33 A;  5HMV A;  1Z55 A;  228L A;  3RT5 X;  3ZVQ B;  250L A;  3TXF A;  1JTO L;  1L0K A;  1UID A;  1D9W A;  1HEN A;  2BQB A;  1B5X A;  258L A;  5LIN A;  1CV0 A;  1L84 A;  1O23 A;  2N5Z A;  2LZM A;  1L85 A;  2BQK A;  4S0W A;  1UCO A;  211L A;  1GAZ A;  115L A;  1LZG A;  1C10 A;  5KXP A;  138L A;  2B6Z A;  3AW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...