1QVAA

Yeast initiation factor 4a n-terminal domain
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
QIQTNYQKVVYKFDDMELDEQLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic structure of the amino terminal domain of yeast initiation factor 4A, a representative DEAD-box RNA helicase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
molecule keywords INITIATION FACTOR 4A
total genus 71
structure length 213
sequence length 213
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 1999-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qvaA00
3NDPA 3TQCA 4E5UA 1U0JA 2A5FA 2GJAA 4LBYA 4Q18A 3W3AA 4W7SA 3U4QB 4DT1A 1YZKA 3TK1A 5J4HA 2PZFA 1E0AA 1OPXA 1W5SA 1E2GA 2FFHA 5JCZA 5EZ5A 2EQBA 2ONKA 3F0TA 2NGRA 3OEHD 4HAVA 3DDCA 1NN0A 3B1XA 1XU4A 4GOXA 3TQFA 4XIGS 5DO9A 5FOVA 3UMFA 1G5RA 3VX4A 5TMPA 3RRMA 3BK7A 2H5EA 4IEIA 1G3RA 2CK3A 2NZ8A 3AVPA 1ZCAA 2GRJA 3LLUA 4XJXA 2MSCB 1XXHE 4X8MA 4AYXA 2A5YB 4JT2A 2FSGA 4B6FA 1FMLA 1W46A 3H2YA 3A37A 3I8SA 2D74A 2REOA 4URWR 1S8FA 4PR0A 4HATA 4GFDA 2WSSA 4A6XA 4ESVA 2CLCX 3AF2A 4HAUA 2CCJA 4Q7JB 2J41A 3D7MA 5TARA 2W58A 1R0ZA 4OYHA 3RANA 1G3QA 1FQJA 1NMZA 1RYFA 2VSOA 4HAWA 1DADA 2OO7A 2J7PD 2P6NA 2RGAA 4KAXA 3M1IA 1UADA 2ZYWX 1N6IA 4LJ4A 4PSVA 2QSYA 4Z1MA 1KI9A 1OFHA 3WP0A 2W6IA 1A1VA 1Z0IA 1W7AA 1AA9A 4GOJA 1GITA 1JPNA 5L3SB 3VNUA 5KHOC 4ILEA 1G3IA 4US2R 3EZFA 2OEPA 1TAGA 2H1LA 2XJ4A 1QRAA 2JGNA 3H1TA 3THOA 3VHXA 3GLHE 1E2JA 1FX0B 1G16A 1G20E 2ERXA 2ZSAA 5E4FA 1OLOA 5BN4A 3DMDA 3T1QA 1WE2A 1IN8A 3K0CA 1HUQA 4GI7A 3RRNA 3S1AB 2ZS7A 2J9RA 3QEJA 1MR3F 2G9NA 4MDEA 3W5JA 2IK8A 3U44A 3SQXA 1UBEA 1XWIA 3QKUA 4A6PA 1ETUA 2IEYA 2W83A 3OHMA 3B1WA 3BE4A 1WQ1R 4M9XA 2OCPA 1NSTA 3CR8A 1C1YA 1GNRA 1HT1E 1XTKA 3P27A 4LX0A 5DYGA 3ZS8A 4EFMA 2GVZC 1HTWA 5KNBA 3THWA 2GJSA 3WBKA 1RRCA 3Q5EA 3K0FA 3U3MA 3AKYA 3TAHA 2HT6A 3K09A 1N0VC 3BH0A 3O8BA 1XCGB 4AWXA 5JS8A 1DELA 1P7CA 3AF4A 3LBHA 4U00A 1SXJA 2IUTA 5JEDA 1X86B 2BC9A 2J0UB 2O8FA 1SKQA 2GEVA 3IIMA 1AS3A 2OESA 1P2TA 1U0HC 4P32A 3GEHA 1T3HA 2AHOA 2IYSA 4XSGA 3VX3A 2A7QA 1R2QA 5AWFC 4GZLA 3Q3JB 3SE0A 5KPDA 1Y3AA 4B3DA 1RYHA 3WNDA 2QBYB 3A1TA 2C9YA 3UMRA 5KDDA 5FOSA 4EDHA 1SKYB 1IXZA 1G8HA 3B5JA 2HJVA 3LVRE 4B43A 3BWDD 1DS6A 1ZAKA 4IXMA 1YZTA 1EX6A 1W44A 2BBSA 2BCGY 2YWEA 4G5OA 4MKFA 3LD9A 2O8DA 4IVPA 3CLVA 2ZI3A 4KLZA 3AKEA 4RD2A 4Q9LA 2P67A 4IFEA 1MABB 1FL9A 4QGGA 3EWAA 4OHXA 5EXTA 2NIPA 4UXIA 4OBEA 5IK2A 4C0KA 3W6NA 2HYIC 1S96A 3PUYA 4FCTA 3WNCA 4M1YA 3QPWA 2RHMA 1WXQA 1AZSC 1KJZA 1CJVC 3BH7A 4PZYA 1N6OA 2F43A 2C04A 2WJGA 4WIAA 1LF5A 3VR6A 1P9WA 1TPZA 2FZLA 2ZJOA 2VH5R 1UBGA 2A5DA 1MO3A 2ZRHA 5C1BA 4PC3A 2GK6A 3G5UA 4B2IA 3BOSA 4JVMA 5FR1A 2R9VA 4NCIA 4P31A 4URXR 1GKUB 3K0FB 3LBIA 2DFTA 1HT2E 1FNMA 1UEJA 1VCMA 1X8JA 2IA5A 4RD4A 2CVFA 5D3MA 2WTUA 3THWB 1KSHA 1QVAA 3CRQA 4MKGA 1E2FA 3D8BA 3IIKA 1OIXA 3ETLA 4EPVA 3TUIC 1AQUA 2ZVPX 4L16A 2ZUDA 1UPTA 1R5OA 3QVVA 4I1OA 2W2XA 2DFKB 1F2TB 1SXJC 2O0JA 3DM5A 3TVTA 4RKEA 3B1YA 4XOIA 2ZAOA 4MGYR 1R8SA 3SYNA 4HUTA 2ORWA 3DO6A 3VR5A 1S2MA 1YU9A 3TSOA 1IOZA 1EXMA 2JIZA 5TVKA 2LKCA 1W36C 1XZPA 1P60A 3CUEF 2XTMA 3K70D 3ZDQA 4FIDA 4QG7A 1CRQA 1XNJA 2VIIA 4UJ3A 3NC1C 2XGJA 1E79A 2V4ZA 4RCYA 1RC8A 3W5IA 4DWJA 4D6PA 1TTTA 3ADDA 4ASUA 1Q0UA 3QKRA 1OH6A 4IDQA 4IXNA 1FQKA 1NIJA 1N0UA 2AR7A 3THYA 4OI2A 2N46A 5UKDA 3LX5A 4YC7A 3ADBA 2P6UA 1YZNA 4MRSA 2A3RA 4RFVA 4F38A 1OKKD 3X1WA 1CJTC 2YOFA 2O52A 4Q9IA 3P32A 3OF5A 1X1SA 4ITRC 1E9DA 2ZRKA 4A0FA 4Q9KA 2F1HA 4BFWA 4JLAA 5EXXA 4A0HA 1DG1G 4FI3C 4D4JA 4V0MA 4A0GA 3N70A 1TUEA 3WP1B 2BMFA 2CBZA 3CNLA 5KNCA 4Q9HA 1TQ6A 2HF9A 3IO3A 3VQTA 4EPTA 1IQPA 4QRHA 1DPFA 5B30A 1D6JA 5CB8A 3GLGB 3GEIA 3I62A 4C30A 2QN6A 4BECA 3OEHA 4LSGA 4TTQA 5BQ5A 5FPSA 3K70B 3DOEA 1BOFA 3TSWA 1A82A 2O5VA 4Q01A 4RFSA 5EP1A 1DO2A 4NYIQ 4KJZA 5FPTA 1M74A 3VU9B 2R6DA 2F1IA 3FYHA 3R7WB 4BFSA 5KSOA 4FD2A 1PUIA 1VIAA 4GNKA 4DEXA 2HCBA 2CMKA 1NBMD 2QEQA 1YR6A 2GJ8A 1TU4A 4G5RA 1VDZA 5FTNA 3RWOA 1NNEA 1S9DA 4F4CA 4C3ZA 4R9UC 3Q7QA 4B73A 2O8CA 4IDHA 3AGQA 2QT0A 3AEZA 4HLUA 2XJ9A 3PUXA 2IXGA 1VG0B 3T5DA 1E32A 2W6ID 3ZVLA 3ICEA 5FOXA 2QM7A 3NBYC 4YMSA 2V1XA 3LV8A 4EPXA 4B76A 2ZRMA 1W47A 1KSGA 5KO2A 3GMTA 2J7PA 3T06B 2V6IA 4P4SA 2EU8A 2KE5A 5LB4A 2PMKA 1K8RA 1ZIPA 2JJ8A 2RGEA 1QG2A 1E9EA 2H92A 2X77A 3QG5A 4ZDWA 3WMEA 1IN6A 3KL4A 3EZ6A 5FBRB 1I4TD 1W4BA 1YR8A 4UNRA 2BBTA 3QSYA 3S1AA 4BWYA 1AQYA 3CX8A 2ZANA 4KODA 1AGPA 3C5CA 3GEEA 3IHWA 4FCWA 3QEOA 3F3YA 1Z29A 1EWRA 2QA5A 2GETA 4GDFA 2PCLA 1ZD8A 5AUQA 3CONA 2ZSBA 4L4UA 3SYLA 1ZJ6A 1UDWA 1N25A 1P9NA 2OBMA 4C0SA 3K9GA 4F91B 1P2UA 1E1RA 4PTLA 3WBJA 4DLSA 3GLGA 2DY1A 3B85A 2Z43A 4BGDA 1II9A 2VRWA 5EE9A 2A30A 3UANA 2REXB 1W4CA 5CYPA 2JJ2A 4PSKA 1XD9A 4UNSA 3T5GA 1QHYA 1ESMA 2VF8A 1OH8A 3PVSA 3R9IA 1Q1QA 3NDBB 3ICQB 3BD9A 1KMHA 4ZI2A 3RC3A 3NXSA 2ZS9A 4F4IA 3B7GA 4DDWA 3L2OB 3H0KA 5IK2D 2V8OA 2YHSA 3P26A 5JJIA 3FHTA 3PEYA 4E22A 1ZUNB 2QPAA 3NC0C 4UNNA 5CM9C 4NE2A 1QZXA 2C99A 2VSXA 1GRQA 1IONA 2GXQA 3B1VA 4RJLA 2ZROA 2QQ0A 3C8UA 2VA8A 2VL7A 4WBSA 1KI6A 2HCJB 3KJHA 2QMUA 3MWKA 2WWHA 4JS0A 4KXFB 4P4SB 1E2NA 3AQ4A 4PHTA 2AK2A 4MGKR 2BKEA 2KBEA 4Z8XA 1RPZA 4L9WA 2O0KA 2QSZA 3KFVA 2WIAA 1HQCA 4FCVA 1OXTA 1AN0A 4KFRA 3EPKA 3CNOA 3LO5A 5KPJA 3IPXA 5H70A 1CTQA 3ZQJA 3DHWC 1N2CE 1JXOA 5FTJA 4FWIB 2JLVA 2W0SA 4JKIA 4AIIA 1HY3A 3W8RA 5EP4A 1N6PA 2C95A 3LA6A 4HZUB 4B6EA 4Q03A 3TUJC 3HU3A 4RFSB 1A2BA 1G17A 4GMXA 4DDVA 2CE7A 1E9FA 5JWOA 1JEDA 2EFGA 3GJXC 4B3XA 2QQEA 2OFOA 3DZ8A 2CCGA 2IYVA 1M2OB 3AGPA 3LWNA 3MCAA 3KQNA 4ZIRB 4PC6A 2ORVA 4DDTA 3SZRA 4DLYA 2BM0A 2QPOA 3AVTA 2RHDA 3HJNA 4AYWA 1RRFA 2ZRFA 4DRZA 3IUYA 4AG5A 4OQNA 1E2DA 3EPHA 1CXZA 1PUJA 1U8YA 3GFOA 1M7BA 3CWQA 4NL4H 3VNVA 1ZC3A 3RS7A 5HE8A 4K8OA 1XPOA 4XTRA 1E2QA 1JI0A 2WIBA 2PJZA 2GEDA 2NPFA 4M9QA 1BYUA 521PA 1VCNA 3K9NA 2JDID 3FHCB 1W2HA 3TE6A 4LC0A 4TMXA 2ZPTX 2QL6A 4QC2A 2CL6X 3SFZA 2PLRA 2ZRIA 4V02A 5FBWB 2ZRBA 5DYIA 4DEYA 4J0QA 1DTSA 3QUSA 3REGA 5CK5A 1G8FA 1TQ2A 1XJ0A 5SZKB 1OFTA 1CS4C 1H8HD 3U4QA 1U0LA 2CK3D 2ODBA 3F5FA 3KXIA 2OM2A 2LCFA 1JB1A 1F2UA 5CJPA 2F43B 3SJAA 1L7VC 2WSMA 1E99A 2HT1A 3EZ9A 2A78A 4V0NA 5FTMA 4C0QC 3FHOA 3SR0A 4C0JA 3TBKA 3GD7A 2QU8A 1GOTA 2AWOA 5LBIA 2ZR7A 3C14C 1VYUA 3BFVA 1M6NA 1H8EA 3L8ZA 5FL7D 4DSTA 4JL5A 3OAAD 3U7FB 2WKPA 4LYHA 3RS4A 1X8KA 1X1RA 4F92B 4ZCLA 4JLPA 4Q1EA 1N6HA 3U6KA 4GZMA 5FI0B 5FL3A 5ANRB 2JLQA 2FSHA 2FGKA 3VTKA 1D2EA 1UJ2A 5FOTA 4AY2A 2IYLD 2N42A 1PLJA 2UKDA 5IDVA 1YVDA 4WAUA 4XTCS 2PX3A 5KTYA 3AP2A 4NDZA 2EFDB 4KFSA 1LFDB 1SVMA 3ONWA 5EE5B 1KI4A 3GCGA 3QY0A 5LD2B 4W5JA 2WOJA 1OFIA 1Y63A 2FSIA 4E03A 3NBFA 3EC1A 2FJUA 1KAGA 1XBTA 2DWOA 3PENA 5DI9A 2BMDA 4TMWA 1XMJA 4TQUS 3CRW1 1O3YA 3NIBA 4DIEA 3K53A 3FFAA 5AJWA 3EWSA 4A82A 3A1VA 4ZDKA 3QKSB 3QPUA 2BVNA 3AKCA 3IIJA 1Z06A 2R44A 3LFUA 4JKYA 4OK3A 4QGFA 4KLNA 4TZ0A 3ASYA 1Z07A 2ZE6A 5JSZB 4TYQA 2REBA 1JALA 1AKEA 1NLZA 2ECKA 3NG1A 2A5GA 1PJRA 2QUZA 1EK0A 1H65A 2CHQA 4JJZA 4MQBA 4UJ5A 1C4OA 2G0NA 3BERA 1DG3A 1GTVA 2W2TA 5FBLB 5BXQC 1GKYA 1XJQA 4TL6A 3AVUA 1R5BA 1P73A 4LWZA 1G7CA 1T8TA 4JYCA 1ONBA 4LGMA 2F3TA 1HE1C 4MUBA 1N5LA 2B7CA 4C7OB 1T0HB 4MYCA 1OJLA 2JAQA 3MWJA 4A2QA 4KI0A 1SXJD 1ZCBA 2X2FA 4B3GA 5EXSA 4LHZA 1XFAA 4QL3A 2IWRA 2XX3A 4HI0E 1G8PA 4P3YA 5HR5A 1WDTA 4A4DA 3TIFA 2OUKA 4A15A 1FP7A 3EX7C 4R2HA 2WV9A 3MG9A 5DHAA 3OFNA 1TF5A 2XNDA 3LBNA 2GZHA 1KNQA 1KI3A 2CVHA 1Z08A 1E2MA 2QPTA 1PZNA 5TXGA 1KK0A 1E2IA 1XRJA 1SVOA 3B2EA 4HDCA 3MSXA 3THYB 5EUQB 3HPRA 3EZ2A 3NKVA 3QPVA 4DLWA 1N6RA 4ZIRA 1GRRA 1LTQA 4IFBA 2PT7A 3QQ5A 2OSBA 2ZYVX 5AJZA 1HV8A 4IDOA 3ZQ6A 1X3SA 2GF0A 2GDJA 4EFNA 2QM8A 1NMXA 1SVIA 4UQOA 2IWHA 1VIYA 3REFA 3LW8A 1IY0A 3NH6A 2O8EA 1R8QA 3BB1A 3U6BA 3RVBA 2ZJ2A 2ASEA 2DWPA 2RMKA 1H8ED 2GNOA 4YONB 5FL7A 3P4YA 4RZXA 1HURA 1S1MA 3TW8B 4B75A 4NU0A 1CR4A 1IY1A 2JCSA 2D62A 3SJCA 2ODNA 4BEBA 1KO8A 2R6FA 3D3QA 4B35A 2V54A 5IHPA 1H8HA 4UXHA 4AK9A 4WZ6A 3BAFA 2RGXA 2OE2A 3NWJA 1BS1A 2RGBA 4DZZA 2FEMA 1BH2A 5KYKA 4XD7D 3THXA 1E2HA 2OT3B 1DBSA 3QXSA 1I4DD 2V7QD 1GUAA 1IAQA 2OXCA 2J3EA 5FTLA 1FW6A 3PEUA 4Q7LA 2ONJA 1CJMA 4OHVA 1FZQA 1GVNB 1XMIA 4AD8A 1FOEB 1XCMA 2VO1A 2BWJA 2FF7A 3SNHA 1ODFA 3CPEA 1JQJC 1G19A 3LH5A 2JDIA 1LVGA 5HCIA 4JLBA 2J87A 2KSQA 5FFMA 1AZTA 5AJYA 4OI4A 1EFRA 3EXAA 4EQ6A 4QHYA 3KKNA 3PCRB 2QY9A 4W5WA 1G4UR 2ZI9A 5BYJA 1GM5A 2X19A 2PT5A 3KQUA 1KSJA 2IUUA 1TU3A 2ODWA 3UMSA 1SHZA 3KKMA 3K70C 3GLIA 1LS6A 1WB9A 3Q7PA 5JZVA 2BMEA 4NTZA 5L3QB 4MA4A 1A7JA 2ZI4A 1XX6A 2IC5A 4Q4AA 1P3JA 4U5XA 2WJYA 5LB2A 2GJKA 2WICA 1VHTA 3SBDA 3SHFA 3PV0A 4V0OA 2ZIAA 2WPDA 1FTSA 1YHNA 4JVSB 3VHLB 1W0KA 2BIFA 2EWVA 1JECA 1IXSB 2PX0A 1G8YA 1QHGA 4RZ2A 5DN6A 3VFDA 4DSNA 2AWNA 5GJBA 4FMBB 4MYTA 1KOFA 1G4AE 4BLRA 4M53A 4MDFA 1VG1A 1IY2A 2FX3A 3IBGA 5BN3A 2QGNA 5HTKA 3KKOA 4ESHA 1XTQA 1DAHA 2NO9A 2OLJA 3K0EA 4WZBE 2EW1A 3W6OA 1S9HA 4TLCA 2W6JA 1MABA 3MAAC 3EA5A 4KSCA 4M1SA 3QE0A 4AYTA 3X1ZA 4MKIA 1QDEA 5FTKA 1ZD1A 1QHSA 2XNSA 2XITA 4FMDB 4MGIR 4GOKA 2GILA 4PC7A 4FINA 4HAZA 4CEIB 4NONA 1XZQA 1MRSA 3B8HA 2ZU0C 4JLVA 4Q1CA 3X2SA 3GP8A 1E1QA 3CRVA 1ZU5A 1XTJA 4NCNA 4S35A 5GJWC 1MO4A 3F8TA 2DR3A 4BZQA 1DEKA 2XTZA 5J4VA 4KBFA 4TMVA 1DVRA 5SZJA 2EWWA 2PEZA 3HP1A 5GVSA 2YJTD 2ZYTX 2Z83A 2BEJA 1FMJA 4BFYA 5GVRA 3EC2A 1TL7C 1XXHA 1LS1A 4PQRA 1JXMA 2VHTA 3K9LA 4WXPA 2JLXA 3PR1A 4Q19A 3NBXX 3TR5A 1OYYA 3GLFE 4BZPA 2IS6A 1AK2A 1W2GA 3GLIB 2ZRJA 2DCUA 4GSYA 4DCSA 5E7IA 4DCNA 2CCKA 3ADKA 4Q4AB 4QJ3A 1EWQA 5EP2A 1SXJE 3FKQA 5HZKA 5FI1B 3UXMA 3L0SA 1N0WA 4M0LA 3W90A 4D0LB 3HDTA 1Z47A 3G82C 4V03A 3C15C 1QHXA 4ZCIA 4PANA 3AVQA 3QIAA 4QBFA 2SHKA 2R62A 3WHKA 1L8QA 4HSEA 1VMAA 1U99A 3GJ7A 2KB0A 1TX4B 5GJCA 4CYMA 2O8FB 3RS5A 1L4YA 2QGZA 1Z6XA 2PCJA 4V0LA 1SXJB 2E9SA 3SS8A 3T35A 1OHHD 1GL6A 2GAAA 3SJBA 3KQLA 4DB4A 1LB1B 2V6JA 1U81A 721PA 3A4NA 1OSNA 4DVGA 3I72A 1XPUA 1DOAA 2IYYA 1KK2A 5DSZA 4HB3A 2XTNA 3E5HA 4YLGA 2P65A 2JLRA 1WA5A 2CL7X 1OXUA 1Z83A 3EW9A 2WAXA 4JBXA 4Q66C 3RSOA 3WHLA 4LY6A 4OQMA 1KO7A 3BB4A 5BYKA 1OH5A 2W2VA 1ZM3A 1G3MA 2WBLC 4PAQA 4TMZA 1XMVA 3CWZA 4KO8A 2AK3A 4B3CA 1FX0A 4LUCA 4A8JB 2IF0A 3CIOA 5FH9A 1NBMA 4PQYA 2AKAB 4LI0A 3MRSA 2DFLA 1DARA 5G40A 3AF1A 2QG6A 1F6BA 1U9IA 5FPKA 4CF7A 2JLUA 3VR3A 4NKRA 3TSZA 1WBBA 1G291 2G1KA 2QMOA 3QJYA 1RIFA 1ZNZA 4G0NA 2BOVA 3C16C 3I92A 3RS3A 1U8AA 1D9XA 1V5WA 4ZO4A 3SYKA 3GQBA 2VEDA 4QGHA 1S3GA 5FOWA 2Q0HA 3DPUA 3SFVA 2WVJA 4EAQA 3I5XA 2IYQA 3GJ4A 2GCPA 1VTKA 3OFND 4CT4B 4MYUA 5E7MA 5JFGA 2IBMA 2VP9A 1TEVA 2E1RA 3KJIA 1Q1EA 2X1VA 3MGCA 2HYDA 4EUNA 4ON9A 2KBFA 3B78A 2IYUA 4Q02A 1VYTA 4CVNA 4JSYA 1E0JA 2ZM5A 4C0HA 4TT3A 4TSFD 2VLIA 2WWXA 4YMTA 3LX8A 4LZZA 1RFLA 1S3SA 2IYXA 3E1SA 1P6XA 4NPHA 3SU8A 2VHCA 2OLKA 5G41A 1XF9A 2FMXA 3HR7A 3OEED 2NTYC 2C98A 5LPNA 1G18A 4M1KA 4PFSA 1SVWA 1VG9B 3TNFA 4AG6A 4D82A 2YOGA 3ZD6A 5HE9A 1SVKA 2OAQ1 3Q5DA 2KWIA 4JLKA 3WYAA 3EPLA 1LNZA 4MITA 1M7GA 3QBVA 2J0UA 4ZI3A 4LPSA 3H84A 3EARA 2B92A 3KTAB 2BM1A 3KB1A 3CRMA 1L4UA 5DISB 3FTQA 3MWLA 5KOYA 3I73A 1CIPA 2AL7A 2WMNB 1ZU4A 2PJRA 1J90A 2IEZA 5CK4A 1RE0A 2FU5C 1R10A 1HA3A 3GPLA 1E3MA 4Q4HB 1OKKA 2WZQA 2GCOA 4A36A 1W36B 1B23P 1YZLA 3OE7A 3TGPA 2OCBA 3K9HA 3QXHA 4Q5IA 2RAPA 1XB2A 2MMCA 3QI2A 1IN5A 1N6LA 5K8UA 4DLVA 4PO8A 3SQWA 4ASUD 3A4LA 4Q1FA 1CR0A 4YMWA 3W8NA 3ZZTA 3AP1A 2FDCA 2C9CA 4ABYA 3PQCA 4TSFA 1JR3A 2DYKA 1JAHA 2FFQA 2GZAA 3CB4A 3OIYA 2IS1A 2GA8A 2ZRAA 3AP3A 1CR2A 1AS2A 4PSAA 1SKYE 1TEXA 1MOZA 2OCAA 4CEJA 4QNMA 2VP2A 2IS4A 4HLUC 2YINC 2B6HA 3RAPR 3K0AA 1JR3D 1AS0A 2DHRA 2NPIA 2VSFA 3MD0A 5A0FA 3K1JA 5FUWA 3FKSA 1D2NA 1US8A 4PC2A 5JMTA 2WWGA 4L15A 2QT1A 1IM2A 4DJTA 1FUKA 4XWOA 3IGFA 2LKDA 2OBNA 2XSZD 2ZJYA 1F60A 2ZXUA 3N2IA 3FOZA 4BLSA 5C2JB 3EASA 4TTPA 2HLDA 2ZQ5A 1FPMA 3PIRA 5L3SA 3J81k 1KI8A 1UBCA 3BBPA 2CHGA 2RGCA 3UWOA 2OG2A 2P2LA 5AJVB 3AVVA 3GJ3A 4W9MC 4C0BA 5CLQA 4B3FX 1T3SA 4PHGA 4JLNA 3KXKA 2PH1A 4IDPA 4DLUA 1NY6A 3ND9A 4A92A 4BEJA 1KK1A 2CJWB 4RCZA 1QG4A 2FPKA 3FMOB 1D9ZA 4DT1B 3D31A 4LRWA 4PHFA 2ZRDA 3L8YA 4LCBA 1A4RA 3DVLA 3LRPA 4X8OA 4PO1A 4JVNA 4BQSA 3CRRA 5AK0A 2O8BB 1ZNWA 4WW0A 3X1YA 4NZYA 4LYAA 1S1CA 4DCUA 1NI3A 5KDOA 3TAUA 4II7A 3C4JA 3CM0A 4NP6A 3AUYA 2GXSA 4YDHB 2FOLA 3LW7A 1E9BA 4V0ME 4B71A 4U02A 2OAP1 1E9SA 1XMSA 1SVLA 4DBLC 1G21E 1R6BX 4C9BA 3FB4A 2EVWX 2Q9CA 4ZV4A 1ZRHA 3TMKA 1N6KA 1CLUA 2XSZA 1US8B 3WRYC 4FMCF 3BC1A 3K0AB 4Z8YA 1EFHA 4XSHA 2H8KA 2XAUA 2H7VA 4G5SA 4HEJA 5AUNB 4E07A 5L8VA 2H17A 4URZR 4Z51A 1UF9A 2YV5A 1KJWA 4Q1BA 3RC8A 2Z0MA 1Z63A 4Q47A 2OZEA 2AD5A 2QORA 4QBIA 4XVRA 3PUWA 4HB0A 2JJ1D 3A58B 3AV0B 4RZ3A 3TR0A 1HQYE 4C0LA 2XZLA 2WKRA 2YZ2A 3OE7D 3P20A 3RDPA 3UPUA 5AR1A 3CF6R 4LPKA 1P2SA 2P5TB 4LV5B 2ZSEA 1F2TA 5J5CA 2G77B 3W34A 5J4YA 3QNUA 2R65A 2ZETA 4S2EA 3FMFA 3WYGA 4N3NA 2QAGA 4F93B 2VTKA 4HB2A 1NVWQ 3B9PA 2GBLA 1DO0A 4BE7B 1KDRA 2ZSDA 1Q21A 2BJWA 3AB3A 5CJ2A 2VHUA 1EGAA 3N2EA 4Q7KA 2BDTA 2ZE5A 2ORIA 4JLJA 2YOHA 4EQ6B 5F2EA 1A2KC 1NIPA 1JR6A 1XEWX 3AVOA 5BWMA 4BASA 1OH7A 2O8EB 3RNLA 3HU1A 3G0HA 1WF3A 5F3WB 1X6VA 4CIDA 4GP6A 1K5GA 2EYUA 3GLHB 5DHFA 5FBQB 4PXAA 5JECA 2QZ4A 1DAFA 4QM6A 2FN4A 1R0YA 1ZUHA 4UNPA 2HXYA 3U3RA 4LHYA 2LWIA 1I4LD 2FA9A 2IYTA 4U7DA 4NYJR 3U60B 4LYJA 4BLTA 2QMHA 3MLEA 1IXRC 2Q6TA 1UKVY 4R71A 5DNYB 4EPWA 1KI6B 1EFCA 2ANCA 3L0OA 1QVRA 5CDFA 1ZYUA 4B74A 3WNBA 4N1AA 3QOFA 2J45A 3WY9A 3Q9LA 1NVVQ 4N0DA 4O0MA 4C0AC 4KYIB 3X1XA 2GCNA 2R6GA 4KHZA 1D2MA 2NZJA 3O47A 1Z8FA 2FWRA 4OQFA 4CEJB 3VR2A 2VP6A 2C2HA 5GJVC 1RZ3A 3CF2A 3IHLA 4JBYA 4KFUA 4LDJA 2G88A 3SHWA 5J40A 1T9HA 1YR9A 1ZIOA 4OK6A 1YZUA 4ARZA 1QHIA 1OYWA 1JBKA 2OCYC 1COWA 1MO6A 3OIVA 1G6HA 1DAMA 2J7KA 2XOKA 4HUQA 1GIAA 5J47A 4EFLA 1N5IA 2G0TA 1Z0DA 1P75A 4FW9A 1JEEA 1T91A 2GVDC 2QAGC 1M7HA 4HAXA 4LOAA 2EFCB 4OHWA 1C9KA 3TRFA 2GXUA 4R7ZA 4O25A 4LBWA 3M0EA 2CLDX 3I32A 2IT1A 3H86A 2MMGA 3QXXA 2ZRNA 4LJ6A 1CP2A 1CJUC 3KUDA 3K09C 1T5LA 1BO6A 1T0JB 4QGAA 1NL3A 3RABA 5FUVA 2FG5A 4NCHA 3B60A 1Q3HA 2ZE8A 3HYRA 2ZJ5A 4OK5A 2D2EA 4A8JC 1UKZA 3QF4B 4HLCA 3ZGXA 1E2LA 2YWFA 3A8TA 4DXAA 3O8CA 3R9WA 2R8RA 1Q1BA 5TB5A 3LY5A 1G5TA 3QBTA 2GXAA 3RWMB 4XWKA 4AKGA 2JLZA 3IDQA 3KKPA 2L0XA 2WWYA 5B58C 3T12A 4NYMQ 5KSYA 4D80A 1DAEA 4LJ5A 1GWNA 1M1YE 2VHQA 4LHVA 2RKOA 4Z54A 2IYRA 2WPDD 4OQLA 4Q4JB 4WZAE 3EPJA 1QHHA 5CYOA 4AKIA 2GAOA 1MO5A 2I1VB 3A36A 3HU2A 1IN4A 1XTSA 4B2LA 1Z5ZA 3DZDA 3LNCA 5AUOB 2V7QA 4PAMA 3Q8XB 2IHBA 2WAYA 1KMHB 3A6PC 4PPNA 1JR3E 1Z6AA 2IXFA 3PEVA 2C03A 2JLYA 1ZINA 3V9PA 2JATA 3JZAA 4LHXA 2FFBA 4QBHA 5IF9A 1OW3B 4O2RA 1J70A 1Z6YA 121PA 2O8DB 2VF7A 1W1WA 2FV8A 4RSGA 2UZIR 4O3MA 1ZNXA 1II0A 1R4AA 2BHRA 4JL8A 4A0RA 4WXRA 3KKQA 1PV4A 4UXJA 2GEUA 3KDSE 3DKVA 5EE3A 2EFHB 2Z5FA 1NLYA 4HAYA 5HKKD 3KUCA 4L8GA 2ZRGA 4POAA 2DFNA 5EE0A 2HV8A 5FPHA 4PPGA 4NYJQ 1NG1A 2F55A 3K8YA 3IEUA 1OXSC 4TLAA 5TDHA 4TMTA 3UG7A 5KSZA 4G5GA 1KGDA 3UWKA 5KNDA 4TWZA 4EJSC 4BLPA 2I1QA 1AIPA 3EG5A 1NJGA 1EG7A 3GFTA 2ZUCA 4KSBA 4Q00A 5LDDC 4Q48A 1OFUX 3IPYA 2C8VA 4JT4A 2J0VA 1Q3TA 3HWSA 5J4LA 2J0SA 2JA1A 2RGGA 1Z0JA 2ERYA 4MH0R 5SZHB 1TQDA 4IOKA 3WMGA 4TYWA 1FFHA 2IS2A 4N0EA 2NG1A 5EJEA 2P6RA 3FFBA 4LJ7A 2O8BA 2NO1A 4C2UA 2NO0A 1CU1A 2G83A 3N5CA 4MRNA 1YRAA 4IJMA 2N1BA 3AUXA 1NJFA 4JLOA 1KO5A 3MUFA 1W48A 2AX4A 1KIMA 1GL9B 4AURA 2CJWA 4UKDA 3BGWA 821PA 4YDSA 5FPYA 4JL6A 3CO5A 4MKHA 4LK2A 5ELXA 4G5QA 4JYBA 3VAAA 1BMFA 2WOOA 3CZQA 2BEKA 5H68A 2IUSA 5C18A 1CULC 2OV2A 3ZZUA 3OZXA 1GRNA 2ZEJA 5CIWA 1LY1A 1TADA 1NMYA 4M2LA 4ZPXA 3I61A 1W36D 3ZD7A 1XD8A 2QMEA 5FOUA 1NSFA 4D26A 1YZQA 2Q3MA 4TYNA 3E2IA 4M22A 4D25A 1E1QD 2YYZA 1ELOA 4C7OA 1MKYA 1P61B 4DUGA 4AKHA 1P4SA 1U98A 2EYQA 1F5NA 2GJ9A 4RD0A 5L3VA 1KKMA 4MRRA 3JVVA 4I1SA 4ARZB 4D4MA 3B9QA 4ACAA 4GMDA 5E95A 4XD7A 2JLSA 1OXXK 2RGNA 4GL2A 2DPXA 3W6PA 2HJGA 2ZJBA 3CX6A 2WJVA 1YQTA 3UATA 2CNWA 1E79D 4C2TA 4P4TA 1NN1A 2A9KA 1KY3A 1P5ZB 3BFXA 1Z0AA 3U61B 1KAOA 2ZITA 2WJIA 5JCPA 3VU9A 3MMPA 1KDOA 1RW4A 3TH5A 2QTHA 1KI1A 4LV8B 2XB4A 4FMCB 1YR7A 2NOAA 2QP9X 5JHGB 1BMFD 2H57A 3GLGE 3ZYCA 5D3QA 1J8YF 3CX7A 1T4GA 3K0SA 4HB4A 1TQ4A 1U90A 4YXWA 3OIUA 3GLHA 1Z2CA 1UEIA 2BBOA 2ZYUX 5EXPA 4B32A 1Z22A 2FNAA 3SEAA 3UKDA 1KDTA 3LQQA 1G1MA 1N5JA 8OHMA 1P72A 2NO7A 2Q3FA 2HXSA 2ANBA 4BLQA 2RB4A 2H16A 1SGWA 2XZPA 3ZZ0A 3LQRA 4B34A 1VKJA 2CHVA 4QHSA 3TLXA 1KO1A 4RD6A 2CEAA 3T61A 1NY5A 3ZJYA 1SZPA 2JASA 2Z6VA 4R2IA 4BRUA 2ATXA 4QOSA 4D0NA 2DWQA 1J7KA 4LJAA 1KO4A 4H1VA 4I4LA 4LYFA 3P1JA 4Q21A 3KFXA 4HLDA 3BIFA 2UZ3A 4DLXA 2IW3A 3BORA 3LXRA 2CXXA 1ZD9A 2PZGA 3JVUA 4CZ2A 5L3QA 2D3WA 2QI9C 2QTFA 1I2MA 5JLJA 2C9OA 1W0JA 1CJKC 2YC2C 3GJ5A 1NVVR 3OAAA 2OFWA 4DIDA 4TLBA 4M1MA 3M6AA 5CLLA 1T6NA 3HYTA 3IKJA 4BUJA 5K8TA 1J2JA 1G6OA 1QHHB 2CL0X 3QXJA 2VHJA 3GJ6A 2WJJA 3NHAA 4XVQA 1JAIA 1FP6A 4JMPA 5KDLA 1RRGA 3FGNA 4DB2A 1VPLA 3MFYA 2OILA 4F7WA 4URYR 4Y0AA 3CBQA 4QFMA 5FBVB 5DGXA 3EA0A 4DKXA 4HZIA 1YZGA 3BJIC 2EFEB 3KJEA 2JJ1A 3C5HA 3IQXA 1XP8A 2PMDA 1UAAA 3EAQA 1XCPA 1SVSA 4QKQA 5M04A 5JJKA 4MRPA 3RYTC 4RY2A 3T34A 5IT5A 3PEWA 2NMVA 1XEWY 1E0KA 2Y8EA 3OESA 2IXEA 2C77A 2AFIE 5JSZA 2FSFA 4XWAA 1G9XA 1N5KA 2QAGB 4DHEA 3BH6A 1W49A 3ND8A 2QE7A 4I1VA 2XNDD 5E7JA 4URVR 3CKLA 5D3MB 2J46A 3MJHA 4L9SA 4NYMR 1UKYA 5JBQA 2HUPA 4LBZA 4BFTA 2GK7A 2QTVB 4MYHA 4RZUA 4XH9B 1G7SA 1ZMXA 5KSPA 1Q44A 3I8XA 5HZHA 4WA7A 3FMPB 1IJEA 4PO9A 3NTUA 4C4PA 4PZZA 1HH4A 3V00A 2P5SA 2HLDD 3U3OA 4LJYA 4NHOA 5DLQC 4Z1MD 2GZDA 1DAIA 4X8LA 1P2VA 4XVUA 3IO5A 2I4IA 1GFIA 4TLDA 3IEVA 1L2TA 4BFXA 2XB2A 3L0PA 4BFZA 5LD2C 1GP2A 1II8B 2UVQA 2CE2X 2WJHA 2WKQA 4OL0A 3PXGA 3U5ZB 4TYYA 4QJ5A 3FPAA 3P4XA 3RS0A 1OXVA 4X8HA 3ZVMA 2GF9A 1EX7A 1J99A 2D7DA 1KTVA 2OBLA 3D6TB 4YXWD 1WMSA 1ZUIA 1AKYA 2NQ2C 5DI3A 4WVFA 1Z3IX 4YQFA 2HF8A 2KJQA 1GNQA 1T3LA 3QG1A 2W6JD 3PUZA 3ZH9B 4D2IA 4H9GA 3T1TA 2ZS8A 1OF1A 3WYFA 1G7TA 4NYIR 3VKWA 1KI7A 2P0EA 2QRNA 1MT0A 3I3SR 4CT5A 4OJQA 3BXZA 1DAKA 2GCOB 5EQTA 2P3SA 3HPQA 2C5LA 4HYYA 1RRPA 3OEEA 2XZOA 4Q9JA 1SQ5A 2DB3A 1ZNYA 5HPYB 3QXCA 1I2DA 1VHLA 1R0XA 1WBDA 5JJLA 2BBWA 2B7BA 3UK6A 1R0WA 1IBRA 1WP9A 3AF3A 4TL7A 1MV5A 4V0KA 1PLKA 1E0SA 4IVQA 2CLSA 3ZIAD 4DLTA 1TUIA 2BJVA 2AXNA 3FMIA 1Q20A 1KMQA 3FWYA 3FVQA 3MJRA 1ZM2A 2F1JA 2ZE7A 3QF4A 4JZKA 2O0HA 3M4YA 1OB5A 2MSDB 3DM9B 1Q57A 3KXLA 3MWYW 3RS2A 1K6MA 2VYFA 3BB3A 3QENA 3TJZA 1WRBA 3ZIAA 5J4KA 1VYVA 2J59A 2FEOA 1O87A 4TQ9A 1UFQA 2RGNC 2ZU6A 4HUQB 5IRCD 1VECA 2PBRA 5JHHB 4GP7A 3E70C 4HDOB 4BPBA 1EFRD 3VKGA 2GKSA 1DAGA 4R98A 4CEHA 3RSLA 3R8CA 2ZRCA 1AM4D 3A1SA 4O2LA 2YKGA 3DMNA 4RVCA 2WSSD 4B3BA 5CM8B 1NN5A 2V3CC 4CEHB 4OI0A 1U9IC 4LJ9A 4US0R 5AUPB 2AN9A 2FH5B 5FR2A 2WMOB 3K0CC 3VR4A 3EIQA 2QP3A 1QBKC 1RKBA 2D06A 4LV6A 2D7CA 2ZI7A 4P0TA 1G7RA 3L0IB 2ATVA 1E9AA 1T5IA 1NBME 4IEEA 1YKSA 3AH8A 3Q72A 5DE3A 2QE7D 2RCNA 5FUYA 4IW3B 2MSEB 3KQKA 1B0UA 2VBCA 4MUAA 2GBLC 4KVGA 4PPFA 1YE8A 2AKYA 1HEIA 1W4AA 4TL9A 2OFXA 2KI5A 2FZ4A 1U2RA 2ZR9A 1XTIA 4TZ6A 2ZJZA 4H1UA 2XOKD 4Y0VA 1OV4A 3CNNA 4DSUA 3GLFA 3CH5A 3KB2A 5DH9A 3ASZA 4ZCMA 1E98A 3ZLJA 1UM8A 1M34E 2WWFA 4Q4JA 1UBFA 3NEYA 4IHQA 1VG8A 1G64A 1XTRA 5TV2A 1XXHB 2O8CB 4M1WA 3THXB 3KQHA 1Z28A 2H18A 2V55B 3C7KA 3W3ZB 3ADCA 4A2WA 1W4RA 4EPYA 3SDZA 2GHIA 4JJKA 1CKEA 3PITA 4KCGA 3SI7A 2GWHA 2CDNA 3AKDA 2VP5A 2PZEA 3B6EA 4D4KA 1E96A 3O8RA 2F1RA 1E1RD 1IN7A 1JQLB 2G1JA 4BFVA 3RHFA 2OHFA 3L82B 1XEFA 3GJ0A 2C96A 1NP6A 1G41A 1W0KD 221PA 1BIFA 4JVLA 4QNRA 4W5HA 4DDUA 5GADl 2AD1A 5K8LA 2PLFA 1GZSA 2ODEA 3EZ7A 3KX2A 1JPJA 3X1DA 4G3XA 4B47A 4BRWA 3T1OA 3TUZC 3AVYA 1X8LA 3BFKA 3QVUA 5B2ZA 1XDBA 4QXAA 3T1VA 2ZREA 1EFTA 3NVAA 1TF7A 1TNDA 4DSOA 1XPRA 1ZC4A 2JLWA 4EJSB 1GAJA 3U3JA 2QROA 2IL1A 1GG2A 4YMUA 3DOFA 1FTNA 4KVAA 3JZMA 4NBSA 2GTPA 1R7RA 4ERNA 1F2UB 2ZI6A 3CF0A 3WMFA 1WCV1 1II8A 1E69A 1W5TA 3PJRA 2ZJAA 1E2PA 3KTAA 3QKRB 1LW7A 4NCJA 2R6AA 5H1YA 1SHKA 5EZ6B 3NHBA 1M8PA 4PHHA 2TMKA 2Z4RA 1GILA 3PUVA 3GLFB 4F4JA 2F9MA 4URUR 4K81B 2XEXA 4IVRA 3EIHA 1JJ7A 4IOLA 4A8JA 4DCTA 1KK3A 5HKKA 2G3YA 3V4FA 1P62B 1TF2A 3DL0A 1YRBA 4WOPA 4DLRA 4ZKDA 4CEIA 4KFTA 1OIVA 1QHNA 5FUXA 3U2QA 1ZM4A 2JEOA 5L3RA 1FNNA 2IYWA 4K46A 1VCIA 5JWRA 1A5TA 1E4YA 4RD1A 4AC9A 2W0MA 1KJYA 1GDDA 4JSTA 4BFUA 3TVDA 1Z6GA 2A5JA 3T15A 5JEEA 4A2PA 4A1FA 4M9SA 2V9PA 3IBYA 3NH9A 3I1FA 3ECCA 4BLOA 1NG9A 3QF7A 4OHZA 2YNMA 1YJ5A 2BKUA 2K5UA 4A9AA 1DE0A 4DLZA 1NRJB 3C41J 1D8TA 3UG6A 1CR1A 3SC3A 4MRVA 3V4RA 2C78A 4LC1A 4ZDIA 2ZSFA 5K8IA 2ZJ8A 3RRZA 3VR1A 1JNYA 4BZXA 3LLMA 1ZP6A 1AGRA 5H8WA 4DUGD 1KHTA 4HDQB 2D4HA 4D4LA 3DKPA 4KV9A 1Z0KA 3U44B 1KSFX 5BW8A 3RLFA 1RJ9A 1XD2B 1Z6TA 5JI3E 3AM1A 3KJGA 1ESNA 5E3HA 4JBWA 1N3BA 1J8MF 4AKEA 4YMVA 3W9YA 5P21A 1S0UA 4P4UA 1Z2AA 4AI6A 1GNPA 1F48A 1ZBDA 2A2ZA 3B1ZA 4QHTA 3ZVRA 4G01B 3R8FA 1BKDR 2XXAB 5DIFA 4GBMA 4CW7A 4KBGA 1NN3A 4QM7A 2QBYA 2F6RA 5C4GB 3KZ1E 3BS4A 3A1UA 4PQFA 1Q12A 2RGDA 2ZVQX 4EJSA 3GLIE 4G1UC 3B13B 3A1WA 4ZKEA 2R2AA 4EIWA 2G6BA 5G53C 1E6CA 4IOMA 2ZI5A 3CR7A 3WXMA 1E2EA 1OE0A 2QAJA 1VCOA 2IX3A 1BYIA 1KZGB 2QNRA 4RD3A 4CDGA 5A4JA 1TMKA 3HR8A 3UIEA 5TY0A 1D5CA 1NVUQ 2Q9BA 2YWGA 1N6NA 4LHWA 3GJ8A 1ZW6A 1EESA 3O8DA 1MH1A 1SULA 5EE1A 1COWD 3SN6A 2B8TA 2ZR0A 4ZDJA 1ZM7A 2HEIA 3LAWA 4M9ZA 4JIMA 4KITB 5CDFE 4OHYA 3ZS9A 3DEFA 4UNQA 2YVUA 2Q21A 4M8NE 5DI3B 1KZ7B 1HYQA 1P9RA 2FE4A 4Q1AA 4US1R 3U7GA 3EIEA 1MRNA 2BV3A 5AJXA 3LVQE 2FFAA 4QJ4A 2B21A 4DCVA 3CPJB 4Q1DA 3WRXC 1KYIA 3AVXA 3VKHA 1HE8B 4B2PA 3IQWA 2Z4SA 3TKLA 1K5DA 4PZLA 1UDXA 1AJEA 3FKSD 2R6CA 3CH4B 4FXPA 5HCNA 2FGJA 4MGZR 4IKEA 4PX9A 1S4QA 3PG5A 3SBEA 2VP4A 2ZRLA 1NF3A 5CB6A 4EPRA 3U7HB 4EKDA 2VPPA 4L5BA 2WHXA 4TTRA 1IHUA 4OI1A 4D81A 1CF4A 1RVDA 1PLLA 3B82A 1R5NA 1T8UA 3QKSA 4LBVA 4I99A 5KU1A 5F9FA 1XEXB 1KY2A 4B44A 1G8GA 4OKSA 4LJ8A 1OHHA 2F7SA 4PPQA 5B57C 1PVOA 3H4MA 5EUMA 4OQXA 3GFPA 2IHYA 2VP0A 621PA 1E2KA 1XEXA 5JI2E 5JRZA 3A4MA 1NLFA 2IYZA 2QP4A 2X2EA 3U7EB 4JLMA 4OJKA 3I5YA 1OIWA 1OT3A 3OIWA 5C4MA 2VQSA 1E9RA 4RKFA 6Q21A 2F3RA 3NBZC 1KKLA 421PA 2ZUBA 1E94E 5KUTA 4M4SA 3SJZA 3I4LA 2I3BA 2WM9B 4HLQB 4QBGB 2CNWD 3BRWD 5F98A 2DBYA 3Q85A 4KU4A 1JJVA 2J1LA 2PEYA 3CW2A 2FPMA 1ANKA 2BMJA 4PAOA 2F9LA 2JIZD 5EP3A 2Q3HA 3IILA 1U94A 2XXAA 1G3UA 4I1UA 2ZTSA 4JLDA 5B64A 1FUUA 5BN5A 4Q4LA 1EFUA 3FDIA 2D2FA 1G5PA 2B8WA 2NO6A 4TN1A 2FPLA 4KYUA 4ACBA 4GPTA 1KI2A 3LDAA 5G3YA 1UKEA 1Z0FA 1NKTA 3AVWA 5JS7A 2BCJQ 4D0GA 1ZM9A 4TYPA 1ZVQA 1E4VA 1GL7A 3PFIA 1GSIA 1E9CA 1CBUA 3R7WA 1XJCA 2YWHA 1NKSA 5JWHA 3RRYA 4P33A 5CIQA 2V1UA 2RH5A 2WWIA 2QRZA 3L43A 4IOJA 1V43A 5CITA 3R9XA 5F9HA 1Q1ZA 3R20A 4FN5A 2AXPA 3SOPA 4CGZA 1NVXQ 4TT3D 2PL3A 4FWTA 3ZVNA 2GESA 1KNXA 1KDPA 4IDNA 4B33A 4DC9A 3NEJA 3U3KA 1CRPA 3VMFA 4M1OA 1RJ9B 1XD2A 4NMMA 4NH0A 5SZIA 4GT1A 4TQAA 1QF9A 2JJ2D 3FE2A 3AF0A 2X8AA 5DN6D 4B48A 4E09A 2QENA 2Q9AA 4HZUA 4TMKA 4CRWB 4FMDF 3CPHA 2J5XA 4M21A 5A5GA 2ZAMA 1W0JD 4M1TA 5G3ZA 1LV7A 2IF2A 2YC4C 3CZPA 2OXRA 4GRAA 2HDNB 1GKIA 1Q22A 2ZRPA 5C46F 3TW4A 2J0QA 1F3OA 1LF0A 2WWWA 5JRJA 4NCKA 4TLEA 4IRUB 1OB2A 1U8ZA 2E87A 4TL8A 3LXXA 3QKTA 4PC1A 4I81A 4Q4HA 2W00A 1CEEA 4Q7MB 1IJFA 2AFHE
chains in the Genus database with same CATH superfamily
3NDPA 3TQCA 5DGDA 3U4HA 4ZOLA 4E5UA 4EB6B 5IVPA 3G13A 1IJBA 4N7BA 3HVRA 4KC0A 3FFXA 4LBYA 3JYPA 2P62A 1T0UA 1D0VA 1PDOA 4S1WA 5CYFA 1N2CA 3D4IA 3K30A 1OPXA 4FYPA 1E2GA 1KEUA 1C1XA 1NAHA 4YK7A 4XPIA 3KT0A 2ONKA 2CNKA 1J42A 4RADA 1JDVA 1I36A 2H1WA 1T8WA 2Z8YA 3DDCA 1KEWA 4R2WA 4ZOAA 3TQFA 3LPCA 4XIGS 3VX4A 4UE2A 1LPSA 5KZMB 2C2MA 2VJCA 3IPRA 1BWPA 3LOQA 2QM3A 2AFHB 3UK6A 2BUCA 4IEIA 2CK3A 2R8YA 1M0TA 1W19A 3PC7A 4KQ9A 4P7BA 4XVCA 2X0FA 3BL6A 2GRJA 3CINA 3LLUA 4XJXA 1AA6A 3T5CA 1GLNA 1XXHE 1WG8A 3N9IA 1FNCA 1QX3A 4Z99A 4ZZIA 1ORTA 3KJNA 1NLMA 3WQHA 5EWMA 3I8SA 3OPNA 2H52A 4U0KA 2NM0A 4ZAWA 4URWR 3RRJA 5M34A 4X6XA 4HDKB 4ZO7A 3CF4G 2C9DA 2IEGA 3DCIA 1TM5E 4HATA 4ESVA 2WPNA 3K7EA 1LLFA 1A9QA 4HAUA 4BU1A 3BIOA 2ZTLA 5DYTA 2GWRA 3V1YA 5I4IA 3D7MA 3E9DA 1CUAA 4P08A 3T3EA 2X1LA 2VSOA 4HAWA 4KWEA 3PNQA 4UQLA 5BXYA 1YXMA 2QRLA 4YAKA 5DM70 2H2FA 2JAWA 3QLJA 3M1IA 1FFAA 3MW8A 4LJ4A 3FFWA 4NI5A 4PSVA 4Z1MA 1KI9A 1OFHA 4G1BA 2W6IA 1A1VA 4K9NA 1OPRA 2CN1A 3SQLA 1W7AA 3L05A 4GOJA 4IDGA 1A0OA 3J7TA 1UJMA 2X13A 3D0OA 3GQBB 4L8LA 4UHDA 1RAFA 4BBJA 4ILEA 4D8XA 1TIPA 4QU0A 1AGXA 1TAGA 4HNAB 1QRAA 2JGNA 4A5OA 3THOA 3GLHE 3H5OA 1G16A 2GF2A 2J5RA 4WOJA 5GGYA 3F9IA 5BW6B 1KZHA 4BDSA 4CQMB 2I2AA 3DMDA 1A9PA 1NYTA 3HZHA 3LC7O 1XRPA 3T1QA 1W6UA 1TM4E 2WC1A 3GLVA 4RETA 5FWNA 2CB0A 4O08A 4Q0MA 5TJHA 4A10A 2ZG6A 1MR3F 2IOFK 2B4QA 3CZMA 2G9NA 3VOSA 4BQQA 4DNQA 4MDEA 4IIJB 3W7VA 4A6PA 2IVZA 3P19A 5ELMA 5K05A 1VKOA 2I65A 3HLYA 3SX2A 3H2BA 3OHMA 4EATA 3B1WA 3KAQA 1QQAA 3E3NA 4F1KA 1E7MA 2BLLA 3K1AB 5CU7A 3CR8A 3GY0A 4BAUA 1RWXA 1HT1E 3PHBE 3IAEA 5KNBA 3THWA 3NUGA 1P4GA 2GR9A 2GJSA 1GPNA 3KQSA 2PTHA 4HRAA 1U28C 4ZHQA 1LC3A 2ZB2A 3S5UA 1O6GA 4MUKA 2Y1CA 1CF9A 1XT6A 3L6EA 4P3NA 5DKFA 4CKZA 3WWZA 1NASA 1XCGB 1GSAA 3I04M 3O8BA 4K05A 3I9OA 5TX7A 3LBHA 3K5HA 1IJKA 1TVKA 3LDFA 3U4CA 4DGQA 4YBRA 5CW2A 2OD9A 4MX8A 5K8VA 3VPFA 2IUTA 3RJMA 4GM0A 3GI1A 4RGBA 5JEDA 2J0UB 2GEVA 2XDQB 1EFVB 1Q16A 3BXGA 2Z2YA 3B36A 2O2SA 4DRXA 1Z4PX 1PG0A 3L5KA 4LQCA 1T3HA 2QV7A 2IYSA 3P96A 4XSGA 2QJTA 1KR5A 4EY3A 1KVQA 2ZBRA 5G02A 4AY4A 3H2GA 3KL2A 4NEQA 1LDNA 4DV0B 3DKKA 1UPUA 1A9RA 1R4NA 2G06A 4P34A 1NNI1 2XYGA 4RIGA 1V41E 4EDHA 1FP4B 3OWOA 3U81A 4YRDA 2PZJA 1IXZA 1G8HA 5C8YB 3TYXA 1C4XA 3LVRE 2NU8B 3BILA 4ISBA 1C3XA 3JVEA 3NV7A 1W44A 4MKFA 3RI3A 4MUMA 2G36A 5G1PA 3H1EA 3CLVA 2ZOSA 1AH2A 3OLVA 4GUDA 1OI4A 2ZWMA 1VBNA 1C7QA 2YJ5A 2ZSIA 4IFEA 4RD2A 1MABB 5HK8A 3RU7A 3ZNPA 4OHXA 4Z1OA 2QDXA 1OT5A 4ZHQF 1ZOSA 2HU2A 3TZEA 3M4ZA 4UOZA 3ZXUB 4QULA 3L4EA 3PFCA 5JASA 4QLAA 2RDMA 1JXQA 5IK2A 4I6JA 4C0KA 5AOCA 5GY7A 3QFHA 1M5TA 5F52A 3ETEA 3BK2A 1WV1A 3WLAA 1N92A 2NZVG 3QPWA 4B7UA 1TZCA 3BFJA 1AZSC 3FHLA 4B6OA 1XNRB 3RKUA 3BH7A 4PZYA 4OOFA 2F43A 2C04A 4IPTA 4DA9A 1V3UA 1LF5A 1G8MA 2WU8A 2Y1KA 1SPXA 2ZZNA 3ICWA 1TXGA 2FZLA 2ZJOA 2VH5R 2X23A 2A5DA 3RKRA 1LI7A 3I9KA 1MO3A 2NWQA 4I6GA 2O3TA 3IIEA 2P1RA 2V3VA 4J7UA 1R88A 1UBTS 4C7BA 1PDVA 4J1TC 4L6IA 4GX2A 4NCIA 3RWBA 5DGHA 5I01A 2BSQA 5EKDA 3IIIA 3OUZA 3TLEA 1KETA 1EDOA 1M67A 1TU0A 4FMPA 5D3MA 1ZJ4A 5GZ6A 3CRQA 2XA2A 4FGKA 3D5QA 4MKGA 1E2FA 2IDZA 3LHFA 2UYGA 1SHTX 3ETLA 4WOKA 4EPVA 3EQ9A 2ZVPX 4NXNB 1R5OA 4F2WA 4RCVA 5KNLA 2JFFA 1LPPA 3IE1A 4EG1A 1SXJC 4OREX 3DM5A 2AJ8A 2O2JA 4RKEA 3B1YA 4XOIA 3SYNA 3FY4A 4HUTA 3DUWA 3VR5A 1JG4A 1S2MA 3K5WA 5BNWA 1E8MA 2JIZA 1N2CB 1QF6A 2QN2A 2GSDA 3G2NA 4Q4DA 5IARA 3PRJA 3UW1A 3FOFC 2V7XA 1E5VA 1CRQA 1GZVA 4NRDA 1Q1GA 2YW9A 3ORRA 4UJ3A 4JLSA 4LKRA 4P2BA 2YQ5A 4WSOA 3V34A 4Z3OA 4IDQA 1FQKA 4BO8A 4A26A 4O3FA 4ZMBA 3RFUA 2AR7A 3U4IA 1KARA 4TTVA 4WY5A 1L3BA 4RAQA 2F1KA 4K6KA 3IVGA 3OPXA 3K05A 4C1BA 1SCBA 3ADBA 1TB4A 5HRUA 2QIPA 3GLKA 4MRSA 1JX6A 3BCHA 2XODA 1VKRA 3Q87B 5SV2A 2D2XA 2QX8A 3WFZA 1FEZA 3FCAA 4CM9D 4E14A 1QO0A 1RWKA 4MWSA 4EHAA 2BH2A 1XZHA 2O52A 2G8LA 1ZI9A 3P32A 5EPEA 1X1SA 4ITRC 1DEHA 3MT7A 3RYIB 4Z4FA 4ND4A 1GTL1 4H08A 4Q3CA 4Q9KA 5DTRA 4BFWA 2DGDA 4AX4A 4IIJA 4E7PA 1DG1G 3FXAA 5DM60 4WE3A 3HA5A 1TUEA 1ZH8A 4UARA 2CBZA 3IVRA 4H7FA 2XUJA 4MQEA 4R9RA 5MGNA 1TQ6A 5A5VA 1TYCA 2HF9A 4LHSA 3A04A 4RTPA 1EFPB 4Q93A 2GCEA 1BGWA 2O0MA 4CNQA 5A4AA 1CYDA 4EY7A 5B30A 4HWOA 3JD2A 4E15A 3H9UA 3VYTB 4ER6A 4EHLA 1IB6A 1FYFA 2X22A 1MGOA 4KI7A 1YNOA 5EP1A 1KHHA 2XKJE 4KJZA 4MLPA 4RSMA 3RVJA 3IT1A 1U3GA 2B25A 3TINA 2L69A 5AKZA 4BKUA 2R60A 4FD2A 1LCIA 2QEQA 2A0YA 1NBMD 5D3KA 2D3TA 5E4TA 1X7YA 2GJ8A 1HC7A 2IITA 4G5RA 3WL8A 4DV3B 1T1EA 1S9DA 3GGOA 1V3VA 3O4HA 4KQFA 5HIAA 4QU5A 4DILA 2ZQYA 3AEZA 3A14A 3JZIA 3KYCA 2NAFA 4S1VA 3ESAA 3ZVLA 1YRHA 2BY4A 2QM7A 5FOXA 3NBYC 3U1TA 2NU8A 4QOJA 4H59A 2PA3A 3RFCA 4DDHA 4EPXA 2DT5A 2ZRMA 4MV4A 5CHYA 3ZV5A 1WQ3A 3DYIA 1VPVA 3KS9A 3F2IA 3T06B 3WIBA 8LDHA 2PWAA 4B4OA 2VXOA 3BTVA 2R79A 4HMPA 1ZIPA 2RGEA 5HM6A 1QG2A 3O5AA 1JKMA 2NYAA 2VHEA 4CLXA 1JIVA 1RLTA 1N0IA 4TZKA 1JFLA 2QR2A 5FBRB 4WECA 1AGYA 1RP1A 2E6KA 4JK3A 4KQWA 1IXKA 4UD2A 3QSYA 1C30B 3WTBA 2YR0A 3BN3A 5EIOA 3NVMB 3CX8A 4BWYA 5L40A 2ZANA 3NNNA 1F7UA 1YAJA 4BNGA 5HILA 1A9YA 4MJLA 4X7MA 1F2VA 4CUKA 2X42A 4OB6A 1Z29A 2QA5A 3H4VA 1KFCB 3V8PA 4I19A 1Y1RA 3WG9A 3CONA 1ZJ6A 2FQWA 3D3WB 1YV9A 1EJBA 4RK1A 1N75A 1UDWA 1W30A 3E7FA 5KAPA 1P9NA 3F7OA 4A8HA 3K9GA 4C0SA 5AK4A 2EBHX 3DBOB 3R4VA 4MW1A 3Q2IA 1E1RA 4RHTA 5LYJB 1JBQA 2II6A 3GLGA 4LMPA 3AIMA 4MVJD 2GK3A 2A30A 3H1BA 1L7XA 2NLOA 4YGYA 4PPYA 2OY0A 1F9EA 4PIVA 4PSKA 1QC5A 3WGLA 1ESMA 2RKWA 1ODIA 3EIOA 3Q11A 2GO1A 1P3DA 2AOUA 1U9ZA 1Z6PA 2G9QA 4ZA2A 3R9IA 3SSMA 5ICEA 3NDBB 1CEYA 2HOQA 2GEKA 1KMHA 2VAXA 3DNPA 4S12A 1EM8A 1LRJA 2FEAA 2OB1A 3STXA 3E9NA 1M1YB 2QTNA 3PC4A 3DSRA 2UUBB 4IQFA 1W1UA 5D01A 2QTMA 2YHSA 3R7DA 4LWOA 3CG4A 3P2OA 5JNRA 1EUCB 4E46A 1M75A 2I91A 5JJIA 2K2QB 1EZ1A 3RIMA 3B5EA 1Q0TA 5T64A 5CM9C 3PNLA 1C41A 3ZWMA 1UPBA 4NE2A 4F8YA 1NFQA 3EVGA 1DWPA 1N2OA 3B1VA 1FBNA 4M0PA 3N75A 3C8UA 3D3NA 1GYRA 2VL7A 2K2WA 3NWOA 2EWMA 1KI6A 3PUKA 2QMUA 1X9GA 2WWHA 4JS0A 4IFIA 4PHTA 3HP4A 2YH2A 3B12A 2BKEA 2NU9B 4HLNA 2C2WA 3VM6A 3NJ4A 1B16A 2F17A 1ZJJA 4X7PA 1TI7A 1X87A 2QSZA 4U2CA 3ZY6A 3ZLUA 3AEKB 3AF6A 1SD5A 3QKIA 4LISA 1AN0A 3QLEA 3R74A 4MJXA 3EPKA 3MINB 3JU3A 4HF7A 2B2CA 3CNOA 1ZIDA 4FHGA 5T57A 4O4LB 1NYLA 4MHOA 2P6PA 1YVEI 3QEMB 3TQHA 1N2CE 1BEEA 1UL1X 2C4KA 4FGUA 1PK9A 4R54A 2B5WA 4HPXB 4BXOA 1F8XA 4UPDA 1XKQA 2W0SA 4W8HA 4AIIA 3RAEC 3ECAA 3RTCA 3G2JA 1H9BA 1N6PA 3QWIA 4B6EA 2M2IA 2OA0A 3TUJC 2ZBDA 3O82A 2PGLA 2YXEA 1M5RA 3UM9A 1G17A 5JWOA 5JU6A 5EJ8A 2ADMA 2DQ4A 2BRUA 4FYMA 4DJ5X 1W35A 1WMAA 1P5FA 1GARA 3AIOA 3PGJA 3LWNA 4ZIRB 3OCWA 2JVKA 3KKLA 4UPEA 5HKOA 3AVTA 5JTTA 2HZ7A 3DEIA 3N59A 2F62A 2Q4RA 5IBCA 3ZHUA 1JLLA 1TCAA 3P0RA 4WBNA 5C5DA 1CXZA 1TD9A 1U8YA 1YS6A 3FYUA 1D4AA 3QLUA 4G4SP 4N48A 3DXFA 1TYEB 2FPIB 3ZXSA 3L6UA 4CMGA 1ZC3A 4UFPA 2C9MA 2ZCVA 4ZC8A 1EP3B 1E2QA 2O23A 1JI0A 2PJZA 2Z95A 1DFGA 3KHKA 4R7TA 1M0SA 4E1AA 2VJOA 2NPFA 2C82A 2CD9A 5EG5A 2YWDA 1F8UA 3Q2OA 3UT0A 3GUCA 1GKKA 3FHCB 4KDEA 3C24A 2FQXA 2FCAA 3NHWA 4OGGA 1FXSA 4QVIA 4QC2A 2PSDA 3LC0A 5H3HA 5CUQA 1E4EB 1GUZA 2FLVA 1JEQB 4GGMX 5FBWB 4BNHA 4LVCA 1E64A 3G9XA 3KBBA 5DYIA 2GPBA 1DTSA 3QUSA 5HMMA 5CK5A 3E05A 4J03A 3OZDA 3GUZA 1G8FA 4LZNA 2X5KO 3PFGA 1OX4B 4J7XA 4P5PA 1H8HD 3U4QA 3F5FA 4TZTA 1HE5A 1F2UA 1JHDA 3D8UA 1L7VC 3CUSA 5C7IO 2HT1A 4FUTA 1OWMA 1J8VA 4XB2A 4V0NA 4Z9YA 3FHOA 2V45A 3SR0A 2JAOA 5JV5A 2VBFA 4DV6B 1RWWA 1ZW1A 5GM2A 1VYUA 5IDQA 3BFVA 1PZFA 3LCJA 2UXCB 1AMOA 4JL5A 1SCIA 3I9FA 2EJTA 4LYHA 4NX2A 2NXEA 4NBKA 4NULA 5K6TA 2J85A 1T4CA 3K9CA 1SCKA 2DM6A 4Q1EA 4GZMA 5FI0B 1K98A 2QJOA 5KYXB 5ILOA 1RHRA 3C70A 2Q46A 5C53B 3H9BA 4YB8A 1JJFA 2OGSA 4DMMA 1A9SA 3EWIA 1EGHA 1L7DA 3VHXB 1UJ2A 4ZCTA 5KTPA 5IVHA 1PLJA 1RWMA 1QIEA 2ZAIA 4FYWA 2X0DA 1YVDA 3G7SA 3I58A 4XTCS 1YUNA 1NE2A 1EXWA 2G07A 3GP3A 3UMBA 2YVKA 2ZVJA 1SVMA 5HQJA 1JDNA 5CLJA 2JIPA 3K4QA 3PCXA 5ALMA 3AM5A 2OZKA 3UWDA 5EE5B 4BATA 4UZFA 4AP9A 4XRRA 5JZ9A 3SJ7A 3MTJA 1AUOA 4K9KA 2Q50A 4TSKA 3UMJA 1I3NA 2GVNA 1TZBA 1GG8A 1C0PA 1M6EX 2WOJA 4LAFA 4MVCA 3NUQA 1XBTA 5BV7A 2WRZA 4FEYA 4F3TA 1V8ZA 3LIIA 3R3UA 4A73A 1SZDA 1XMJA 3CRW1 3HUTA 1L1EA 2PSSA 1MB3A 3EIFA 4Q12A 4XE5A 3K53A 3FFAA 4ICIA 4JP5A 5AJWA 5DT9A 5T8KA 3T3IA 4A82A 3QKSB 3AERB 2P9ZA 1V8DA 5DHPA 1MO2A 1CQJA 2QB5A 1BDIA 3UAYA 2JI8A 3DJFA 4RORA 3IIJA 3LFUA 4JKYA 4OK3A 4QGFA 3VR4D 2WQ7A 2HZBA 5E4JA 2XYHA 5FLYA 2Y99A 9LDBA 4FE4A 3ANNA 1O97D 3TW8A 3X2FA 1Z4JA 2GHTA 2AOTB 3GBPA 1NLZA 2ZULA 4OGFA 1NJ1A 4JDUA 3G5AA 4QUHA 3SQDA 4YV0A 5CFNA 1W87A 3JWJA 5J3JA 2WI8A 1PGPA 2QUZA 1X7GA 5JVDA 3FAKA 1AKWA 4NV3A 1ABFA 4MRMA 3OTGA 1TT7A 5KQPA 2YHBA 3B3QA 3N2KA 2W2TA 4N6OA 4W9RA 5FBLB 3TPCA 3UICA 3WLIA 5BXQC 3E27A 4K3UA 1CG6A 2R8ZA 2J5BA 2P2YA 4CL8A 3H6HA 5B4TA 1G7CA 1IATA 1T8TA 5DWDA 5C8VA 1JLMA 3DMFA 5AKJA 1L5LA 2NUTA 3E9QA 2P35A 1AHNA 3GFBA 3KR0A 4YAGA 1VBMA 3V1KA 2D59A 3MWJA 4HN4B 3PQ8A 2XDWA 5IDXA 3EDMA 5F51A 2DJIA 4S05A 1WB5A 4B3GA 2C4NA 1QF7A 2F00A 4FYIA 4LHZA 4QL3A 3IMKA 2IWRA 4BRSA 1AB6A 4KZKA 3V46A 4DLAA 4ZI7F 5HR5A 1SUPA 3IV6A 4EJ2A 3AZQA 1DEAA 3EX7C 2WV9A 3OFNA 2IP1A 3BUSA 1TJ5A 2XNDA 4PX3A 4QDXA 2DT8A 3LYAA 2QX9A 3MJVA 5E6RA 2DE0X 4PHCA 1VRCA 2NU7A 3RNOA 5E1OA 1PZNA 3VV3A 5A1JA 2ORYA 3B2EA 3ITKA 3EDRA 3LNTA 3MT0A 3OM9A 3NKVA 2AYYA 3QPVA 3PXXA 3QWBA 3DC7A 3VC2A 1GRRA 1J1ZA 1FFBA 4IFBA 2OSBA 5AJZA 2VT3A 3COVA 1JR4A 4QFBA 2N1MA 3NIDB 4UULA 4NU6A 3G23A 3IFSA 2IHZA 2QM8A 4DC1A 4EFNA 3WLMA 2AEEA 2IWHA 2JFHA 4EMTA 4X97A 1S8OA 3CB2A 1NMEA 2H4WA 2LUOA 3K1TA 3NH6A 4LZWA 1JG2A 2O8EA 1R8QA 3KOUA 1UAYA 1Y34E 1ZH2A 3EZXA 3LQ2A 4HGOA 1SIOA 2C97A 5K51A 2G40A 1U8EA 3BE6A 1DJNA 1G5QA 1GHTA 2FUG6 3VOAA 2ZRQA 1MF7A 4LVUA 1SCQA 4PLHA 3GGGA 4K1LA 1AOXA 2O50A 1RACA 4C87A 5ICCA 2AG6A 1QCDA 4CIWA 2JCSA 4ZZ1A 4PLVA 3BMCB 4QUKA 1FJHA 4JR0A 3SJCA 4GECA 5JQGA 5CLHA 5SYNA 1RHKA 2V54A 3LWZA 1N4AA 3KNZA 2RGXA 2AS0A 2OE2A 3LYHA 3RB8A 4GMHA 3RVDA 4JHLA 4MO2A 2FEMA 5CT9A 1BXGB 3L1VA 2ODAA 4K9SA 2Q5QA 4J0HA 1Z7GA 4B4WA 2OFFA 1TLLA 4BOYA 4KAAA 3T7IA 3PGVA 1FW6A 4Q7LA 1CY0A 4EUSA 1F8FA 1KE1A 1AKVA 1FZQA 1QVZA 3MJEA 2GA9A 5KWJA 1XMIA 2I6TA 3K0KA 3HRKA 1DIOB 1I3KA 2BWJA 1EK1A 2FF7A 2PV0A 2VO1A 1RTKA 2Y0PA 3EYWA 4YROA 4N4AA 1ODFA 2AC4A 3CBGA 1JQJC 4J0JA 1G19A 4R1PA 5D2CA 4QARA 4PRLA 2XKKA 5HCIA 3EXIB 3WOHA 2YZMA 4MWTA 1AZTA 5AJYA 3FR7A 1EFRA 3EXAA 3ST7A 2EATA 1SG6A 4Q7QA 2RHHA 1UAGA 3WLJA 2Q2NA 5JQWA 2Q1WA 2QLLA 3AFOA 2QY9A 3PCRB 1M8KA 2JCGA 4JQYA 4NFSA 3HVIA 2ZI9A 2X19A 3AWDA 1L7NA 3FNFA 5H80A 1Z4NA 3Q98A 5LLSA 4QYTA 1CNFA 1D6SA 1KFBB 1SOMA 3TJRA 4D9EA 1BVHA 2FW0A 2C3YA 1CZRA 1EB9A 4C43A 3Q7PA 1FVOA 8ADHA 3MTQA 5JZVA 5KEIA 1HQKA 4NARA 1WUHS 2IC5A 1X7YB 4N12A 5KKCA 1IQRA 2DBQA 3N2LA 2Z98A 4AF8A 4MAAA 3SKVA 4LJKA 3SBDA 1VHTA 3GARA 3FCCA 5HDBB 4JVSB 4Y18A 1TRKA 5T3UA 3VHLB 3WX0A 4OU5A 1SUDA 1RMYA 2I6FA 2OCIA 5AHRA 1NSYA 2OK7A 2PX0A 3MWFA 4UM8B 2RHLA 5DN6A 4N0MA 4RIHA 2UZ1A 3JQGB 1G4AE 1ZLXA 4MIOA 4TUYF 4BLRA 4MDFA 1C50A 2FX3A 2I6UA 3IMFA 3Q4GA 1U31A 3T7DA 5BN3A 1PWXA 2GBGA 2H54A 3KBOA 2QGNA 5HTKA 3D7RA 4ZEXA 3SIWA 1DAHA 3CLRC 4BVKA 1UUFA 3QUQA 3EQ8A 3SZOA 1RQLA 2PQMA 3EHEA 3A3KA 3K0EA 3OSZA 1ADBA 3F8WA 5JS2A 4DQVA 3HXOA 4LOLA 3HCEA 1EJ6A 4KMMA 3TM4A 3EA5A 4KSCA 4M1SA 4RJJA 5CVEA 4AQDA 1USKA 2VHXA 3R4CA 3UT6A 2XNSA 3L1JA 4GOKA 1N33B 2GARA 1XHLA 3H1GA 1NZJA 4FINA 4I0WB 4HAZA 5EXDA 1XZQA 1MRSA 3B8HA 4Q1CA 1VFNA 1H6AA 1OAOA 5ILGA 5I7UA 3GP8A 3HTXA 3CRVA 2I54A 5J1TB 1HO3A 5T4EA 2VBIA 1KJNA 2HU8A 1NV9A 3KQQA 4IHKA 2OCLA 4NCNA 3RREA 1MX3A 1K1EA 1V11A 4J16A 3QVGB 2EGHA 2J30A 3ELDA 1Y5IA 1OBFO 3EVDA 3K32A 3N7AA 5LNK6 4KBFA 4TMVA 4FLFA 3L49A 2JRLA 1DVRA 5SZJA 4C4OA 5I7WA 3HP1A 3FJOA 2YJTD 2GB4A 1MB0A 3KQMA 2ZYTX 3IAM6 1QK4A 4WINA 4BFYA 3T3NA 3I0MA 5FWYA 4X54A 3LGAA 1RYZA 4L07A 4QATA 1R6VA 1FSSA 1XXHA 2FN8A 3FPFA 3FTEA 4NY1A 3E9CA 1X7WA 1MHTA 1LLCA 2I29A 3NBXX 5GV7A 3ZNQA 3X3HA 3FGPA 4TWIA 1RRCA 3EPRA 4QIHA 2XF2A 1AGNA 1IU9A 3LKZA 5E7IA 4R3WA 3L01A 5EPUA 4X90A 5JFOA 2DPGA 1MX5A 1N2XA 1SXJE 3FKQA 5HZKA 1WPRA 4HQOA 5FI1B 1N0WA 1RLIA 3O3OB 4M0LA 4RHXA 5FXMA 5KX5F 1RMTA 4OXQA 3UHAA 5BO5A 1Q14A 5AKLA 2IBTA 3PTAA 4YRRA 3JD3A 4QBFA 3OD1A 1ZESA 3S2SA 4HSEA 3S8YA 2MJLA 4PWYA 3ENWA 4LOIA 5JXWA 1N1MA 1VMAA 4RH1A 1U99A 4XJSA 4Q39A 1FK8A 2Q3EA 1TX4B 1NW5A 4HTFA 3PL5A 3T0GA 5EY5B 4K5QA 1JWLA 1SXJB 3HGQA 1ENPA 2GFQA 1L8OA 1Z7WA 3GFFA 4PBTA 3T35A 4DNXA 3P71T 9GPBA 3EFHA 4PG4A 1MZPA 1LB1B 2V6JA 4D9CA 4GM4A 4Q6BA 3MYRA 4WOCA 1OGYA 3F67A 4EARA 3MS7A 1OA0A 3LUFA 5LC1A 3T7EA 3VPSA 1Y4ZA 4QRIA 2VUIB 3CH7A 3BULA 4ZOBA 1XPUA 1RCUA 4GC5A 3MMZA 13PKA 4UM5A 2C0QA 5A6SB 3BMCA 4LFBB 1Z83A 4Q66C 4E4TA 4OQMA 3VYUB 3VBCA 4XEHA 3BB4A 5BYKA 5KX5A 2W2VA 1ZX1A 4KDCA 2DR0A 3S2ZA 3M2TA 5AMXA 1PJ8A 2PUAA 3CLTC 1BDMA 4PAQA 3DBVO 3S70A 3JCZA 5CW1A 4O59O 5AH0A 4ZU6X 3JTMA 1LI4A 5GZ3A 4LUCA 4L76A 1TRHA 4A8JB 2X3UA 2GH1A 3UUEA 3Q6MA 4MZDA 2AKAB 4LI0A 5AVOA 3CLUD 3ILHA 4FX2A 1YHZA 2X41A 1F6BA 1BQEA 1UJCA 3MTEA 2VDWB 2YWXA 4I6EA 3KSUA 3VR3A 4R5MA 1WBBA 2QMOA 5FTWA 3DMYA 3BMXA 4I4TB 1ZNZA 2EGUA 3E8SA 2RE8A 3JQBC 2C83A 3RSQA 3C16C 4Y7CA 4DY4A 3T1HB 3C7DB 1FTQA 1X2EA 2XHEA 1V5WA 3U56A 5AESA 3GQBA 1HF3A 3SFVA 2WHPB 3HXLA 2WVJA 4LC9A 2GCPA 3OFND 3TTYA 1R1DA 4MYUA 2O06A 3BQMB 1R12A 1PT8A 2X4IA 2IBMA 3OJOA 4X61A 3Q8WA 2IZ0A 2JAPA 1H05A 1J9GA 3P5SA 2KBFA 3B78A 3P0IA 1WBJB 2VSQA 2WUVA 3BFPA 3FCEA 2QD4A 3ZGVA 1E0JA 1XZGA 4HXGA 1GFWA 4ZAZA 1X74A 4LCEA 4TT3A 3I6YA 4AJJA 4TSFD 2WWXA 1H3EA 3AL3A 4G1VA 4PXYA 2HC9A 4YO8A 4KQ6A 4BMDA 1Z13A 3RK0A 4C88A 3EDCA 4BFLA 4EBFA 4EF5A 4UU1A 3TQTA 3W2FA 2HBQA 3E61A 4NPHA 3SGLA 2XHZA 3SU8A 4MVYA 4N3BA 4ED9A 4XKJA 3LQFA 2B69A 1L5HB 3PWSA 1XF9A 3IA7A 1A77A 2XLBA 3SC6A 2JI6A 2C98A 1WHSA 4M9RA 1Z68A 5FORA 1G18A 4M1KA 3TNFA 1GVHA 4LXTA 3V5NA 3RC9A 3DG9A 3KHTA 2F67A 2HDHA 3OLYA 3ZJUA 5AVYA 1XYYA 5F2NA 1SH7A 2XRYA 3CR3C 5F1PA 4ZI3A 1U7TA 1X0XA 3DP9A 2B92A 1EVQA 2WUWE 5C80A 3WGMA 3UWSA 1A9OA 4MKZA 2WMNB 1OBCA 1P7WA 5BQXA 5JZSA 3SBXA 2FN7A 2FVXA 1RE0A 2V0CA 2H9AA 1SXHA 2E4XA 2P4HX 3IT0A 5HQTA 1V8OA 4B3RB 1BA3A 1K3TA 2AOTA 2OCBA 1QCYA 3AYXB 4CMJA 5GMOA 1U3FA 3GLSA 2MMCA 3BQ9A 2UU9B 2IHNA 1CIJA 3QI2A 4MMXB 5BT8A 1T36A 4AUMA 1UZAA 1P1CA 3KAPA 3C3EA 1F0KA 4D3ZA 2ZUEA 4EYQA 2XRZA 2Y1WA 4F2GA 1CR0A 2HIMA 4YMWA 3B6MA 3ZZTA 4BZWA 4EKIA 1JDBC 5LJIA 3FBTA 3MHPA 3C2QA 2FHSA 1SD1A 4K03A 1JAHA 3U3XA 3ELBA 2GA8A 5JARA 1RJGA 3AP3A 2PNFA 2P2ZA 3LGSA 3U7QB 4DIUA 2C4WA 3WAJA 1RXVA 1NUQA 2O1SA 4AJ1A 1Y0BA 5I7VA 1J2TA 2PGAA 4R51A 1MOZA 1G38A 5EHXA 3CLTD 4QNMA 1H6BA 2IS4A 3L1KA 4JB3A 4P4LA 3WV5A 1SR8A 3R7AA 3K0AA 4A8PA 3VDRA 1JR3D 2NPIA 2DHRA 2Q3BA 4EGCB 4EI9A 4TV9B 5FUWA 3WRVA 1XAGA 1R37A 4BNDA 1US8A 3DE7X 4UEJA 1RAHA 5DM0A 2VUHB 2ON6A 4JEMA 3W9SA 5JMTA 1DXHA 1LX7A 2FWIA 1MG5A 5FWDA 1ADGA 4BNWA 3A7DA 2NPOA 1VJCA 4DJTA 2GS9A 2QT9A 4XWOA 1E1DA 2LKDA 2QV0A 4FD3A 2QG4A 3IUBA 3K2IA 4DCCA 1T4CB 1F60A 1CVIA 1TMGE 2NSLA 3N2IA 4ILKA 5BOSA 2YVLA 2ZXUA 2HLDA 2ZQ5A 4D3SA 4JH0A 3PIRA 2VAMA 1N2BA 1XSEA 4JJ6A 3UMMA 5HGJA 3F4KA 5F5LA 3QX7A 1WULS 1O95C 4URHA 4WXHA 1JH8A 3LP6A 4IIEA 3QLVA 5C37A 3A6DA 2FPGB 2JHAA 2RGCA 2VDNB 5JROA 1PNOA 1R16A 1J0BA 2BN4A 4GH5A 4IXTA 5KWSA 3AVVA 3GJ3A 5CLQA 2QRHA 4B3FX 3TTXA 2N0SA 3AHJA 1H66A 1VIMA 5EWJB 2BPOA 4Q4CA 1RBQA 1WNTA 2NV6A 3B5IA 3FMOB 3GH1A 4Q1VA 2NXWA 1OFGA 4DT1B 2R1TA 1Q6ZA 3PQ3A 2ZRDA 3DUFB 3L8YA 4LCBA 5LOVB 1VJ1A 4FFLA 4RLSA 3JSAA 3O2QB 1MDBA 4NFHA 3R0QA 2C4TA 4ABTA 5B3AA 1KKUA 4BB6A 4NZYA 1S1CA 1T5TA 2H4YA 1QANA 5JFTA 1SK9A 4QX6A 1LJ8A 1NI3A 3DA8A 4LSZA 1P81A 1IK4A 4UBLA 5B53A 1CQJB 5IKOA 3CM0A 1GGKA 3NYIA 3UJ9A 4UBMA 2QLMA 3I1IA 3IOBA 4WUVA 1RADA 4QAJA 3PGLA 1QXSA 1UINA 1T4DA 4B71A 3AI2A 2NN3C 1T35A 1XMSA 1SVLA 2OAP1 2X6TA 3FNBA 4BV3A 5CXUA 2IIQA 4LFCB 2VR1A 2XBLA 4HNUA 4ZV4A 4JROA 4DV1B 4OHKA 5C81A 1H2WA 4M88A 2DVMA 1H0HA 1US8B 4JB2A 3WRYC 1VPDA 1UCFA 1EFHA 4WKOA 5BW5A 2XAUA 3RVNA 2NSDA 2QYTA 4E07A 5AUNB 5L8VA 4YRSA 4AUNA 3PRKE 2H17A 2HCTA 4URZR 3TLMA 4P92A 3ZW9A 2Y9PB 3ICOA 2JKYA 5DU2A 2QORA 2D2VA 5FUBA 2YX1A 3U0VA 4DABA 4I3FA 1V45E 4BX9A 4C0LA 2YZ2A 3RDPA 3P20A 3OBBA 3BMNA 5LQJA 5ALHA 3PDHA 4ZU1X 3UJ7A 3LT2A 2YV4A 4E2FA 4G1MB 2IELA 4LPKA 2G04A 4RTRA 5FO1A 4LV5B 4HQKA 5TS2A 4V1CI 2ZSEA 1OI3A 2O5CA 3AM4A 3TRIA 1O9HA 3QEMA 2G77B 1BHJA 3W34A 3IS3A 4KWIA 4S2EA 1FMFA 3WYGA 2QXYA 2O2XA 2QAGA 2QTLA 1QOPB 4F93B 4M37A 3NO4A 1U2EA 1QAOA 4L0CA 2P79A 1U3CA 4RTKA 5IN4A 4W1RA 5CJ2A 5IP5A 3E48A 2D8MA 1PK8A 1JQDA 4JLJA 2YOHA 4XUCA 4EQ6B 1NIPA 4N40A 3W4KA 1SD2A 3WLQA 2X4GA 3DZFA 7MHTA 1OLSA 3D0RA 4MPRA 4KFCA 4BASA 2WJ6A 5ETJA 2Q4BA 3RNLA 5BWLA 5C7OO 2SECE 1XMQB 3G0HA 1X6VA 1QCCA 4DMFA 4GP6A 1VL1A 4AS1A 1LQUA 1YI8A 1PS8A 3NOXA 2QZ4A 1DKNA 4WKCA 2FN4A 4X1OA 3VC7A 2KYRA 1Z35A 2O3JA 1YMQA 4DARA 3PLNA 4LHYA 3H8JA 3NYWA 2DCMA 4KQCA 3T94A 2FTKE 4DDMA 3GDFA 1GNTA 2I33A 4JCOA 4QSMA 3SF8A 4C7XA 2I3GA 1X7ZA 1BDJA 1FFCA 2Q6TA 3RCBA 1NJ8A 3HN7A 4HFMA 4WDQA 4R71A 4OXKA 5B1SA 3ZOZA 3GIDA 3MPUA 4EPWA 3M1LA 4BS9A 1WCIB 5KCMA 1I01A 3RSFA 2WM8A 2VQFB 1ZYUA 5CVJA 3V2GA 2ICAA 4PN7A 3L1IA 3WY9A 4YRFA 4O0MA 5DNCA 2A0WA 4O2AB 2ZWPA 1SKBA 2HK6A 4KV7A 2F8SA 4KYIB 1YIAA 3EQ6A 3X1XA 4KHZA 2R6GA 1F2DA 4C1NA 1D2MA 3COZA 4B8YA 2PFGA 1E7RA 4D9GA 2VP6A 1Y8AA 2COKA 3NP7A 3ZHXA 2MYUA 2UDPA 3DQZA 3GH3A 2PJUA 3IHLA 1ZQ9A 2Q6VA 3B51X 1OX6A 1YR9A 4OK6A 1XKLA 2HL6A 2K87A 1YZUA 2AV6A 3FNIA 1LBEA 1OYWA 1QHIA 3IE2A 1J25A 2OCYC 1COWA 1MO6A 3D81A 3B48A 3KE9A 4JC5A 2A9FA 5FADA 4FGSA 1U1FA 2I3DA 5KYUA 3UJBA 2J7KA 2W2NA 1FFDA 1N2ZA 5DTQA 2G0TA 1OI2A 1YMVA 2GBFA 3OZCA 4FW9A 3UV7A 2X58A 2ZUSA 5K0JA 1DT3A 3OECA 1PJSA 3F9CA 1C9KA 4FB5A 1JF8A 5MDHA 2F4NA 3RGGA 4LY0A 3Q8MA 1MJFA 3M0EA 4LBWA 1GN9A 3JQFA 4ZGGA 3S0JA 5DBHX 1UBOS 1QYXA 4TKZA 2DOKA 4EK9A 1UK7A 1T0JB 4QGAA 1NL3A 3RABA 3HA7A 5FUVA 2QN7A 2HPZA 3KU1A 4BLUA 3B60A 1GQRA 5T6BA 4Z4IA 5U1PA 3EGDB 2A1TS 3HYRA 4DQUA 1SOWA 1EJ0A 2OYSA 5JNLA 2YZGA 2FCRA 2ZYSA 3L7IA 1D2GA 4HLCA 3N6XA 4RC9A 5DI3A 2QX7A 2VJMB 5HKLA