1QVAA

Yeast initiation factor 4a n-terminal domain
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
213
structure length
213
Chain Sequence
QIQTNYQKVVYKFDDMELDEQLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic structure of the amino terminal domain of yeast initiation factor 4A, a representative DEAD-box RNA helicase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
molecule keywords INITIATION FACTOR 4A
total genus 71
structure length 213
sequence length 213
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 1999-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1qvaA00
4D0GA 1XMJA 4QM7A 5EJEA 4UXIA 2AK2A 1AJEA 3UWOA 4A8JC 1UJ2A 2A2ZA 3CR7A 1MO4A 3GEEA 5DN6D 4A0RA 3WYGA 2VLIA 3GJ3A 2WJVA 3RRYA 2J0UB 4JBXA 4KBFA 4BLPA 4MDEA 4MDFA 8OHMA 5JJKA 3GJ6A 3L8YA 4GI7A 3X1ZA 4ZI3A 4LBVA 4D82A 5G41A 2QT1A 2Z0MA 1CF4A 3FMFA 4XIGS 1E1RA 1ETUA 3RHFA 4LJ7A 5CDFA 5J4VA 5JCZA 2IK8A 2QEQA 1FZQA 4B35A 4Q1EA 5E7MA 4M1YA 4A6XA 4UNPA 2VHUA 1E4YA 1E32A 1EXMA 2YYZA 4AYWA 5JRZA 1XTJA 2ATVA 4L15A 1XTSA 1G4AE 1Q12A 2BMDA 3KXLA 2DFTA 1ZC4A 1CRQA 3Q72A 2QY9A 3WRYC 4B3CA 1FNNA 5EP3A 4EQ6B 2LKDA 1EFRD 4HDQB 4PAOA 1YR7A 2CNWD 4G1UC 3B82A 5F2EA 2VSFA 3EZ9A 1JPJA 2GK6A 2ZE8A 3MFYA 2QGNA 2ZU6A 4LBYA 3FOZA 1YKSA 1ZW6A 2J59A 5FPYA 2PLFA 3CH5A 3I3SR 3FE2A 4KYIB 4DWJA 4CEIB 4HI0E 2WIBA 2EFEB 1TL7C 3QXJA 3K0FB 1CR4A 4RD2A 5FUWA 1CBUA 2HCJB 3UG7A 2XTMA 1PZNA 2UZIR 1G7TA 3X1DA 2JJ1A 1Z06A 1P6XA 2QRNA 2XB4A 1W48A 2CVHA 4B43A 2FEOA 4X8LA 2ZIAA 4AIIA 3KQNA 1BH2A 4FMDB 2FSGA 3UWKA 3W6OA 2YOHA 5D3MA 4ZCMA 2ZI4A 3LQRA 3HDTA 4HAVA 1W7AA 3TSZA 3GLGA 1EK0A 1GNPA 2QTHA 5TV2A 3K0CA 4NZYA 1J99A 4Q21A 5KO2A 1COWA 4LGMA 3NEJA 2LKCA 5SZIA 1FUKA 1AS2A 5M04A 3X1WA 4DDUA 2FSFA 1WF3A 2O0KA 2X77A 3PG5A 721PA 1OHHD 1N6OA 1VYTA 2GZHA 4ACBA 3NKVA 2JDIA 2VA8A 1VCIA 3N70A 3I72A 3VKWA 2ZQ5A 3SHWA 2QT0A 1N6HA 2QMHA 1A2BA 2FNAA 4CRWB 2QE7A 5FTLA 3GCGA 1GG2A 3SJCA 2RHMA 4LV6A 3KJHA 2P6RA 5F9HA 2G77B 2ODEA 3NHBA 1ZCAA 4JLNA 4LV5B 2V7QD 3TKLA 2A5JA 4RCZA 4IFBA 4YDSA 2VL7A 3BIFA 3SC3A 4URZR 5BQ5A 4MRNA 3ADCA 1N6KA 3EZ7A 3KXKA 1T5IA 4AURA 2WPDA 3QKSB 5CITA 5BYKA 1AKEA 2YV5A 2D74A 1KI8A 5FPTA 2QI9C 2O8DA 1GVNB 1HQYE 2O5VA 3QENA 3VU9B 5JWOA 3IBYA 3K0FA 3B60A 1Z29A 3Q3JB 5HZKA 4TN1A 4G0NA 1AS3A 1CEEA 3GEIA 2ZYUX 1G3IA 4Q4HA 1R0WA 1BKDR 4PPQA 3MJRA 1XCMA 4HUQB 5UKDA 2IXFA 3PUZA 3REGA 2XX3A 1A5TA 4F4CA 2JLSA 3QUSA 2O52A 4HEJA 3AKYA 3ADKA 1TQ6A 1IJFA 4LPKA 4TYYA 3FKQA 1JR3A 2QU8A 2ZRDA 3LXXA 1KDRA 3RWOA 1Z6AA 1ZIOA 1YRAA 3R8FA 2VP0A 3PUXA 4KXFB 3M4YA 1HV8A 1QHYA 5FBRB 5JEDA 2KBFA 3EASA 5C1BA 1ZIPA 4HLUA 4URUR 1LTQA 4M9XA 1HY3A 2J5XA 4ZIRA 2J41A 1WRBA 3QJYA 4MQBA 2VP9A 2FFAA 3EA0A 4IVPA 4U5XA 5EXXA 3K0AB 2ZRLA 2GVZC 5CYPA 2WWHA 2FDCA 1LW7A 3EARA 1E2QA 3UMRA 1GFIA 4C7OA 2QN6A 1HA3A 4OJKA 2J9RA 4M8NE 4A4DA 1E79A 2ZS9A 821PA 1G5RA 5FL7D 1E2FA 1U98A 1YE8A 2OBLA 4NH0A 221PA 3ASZA 2F1IA 4JLOA 4TT3D 1BYUA 4WA7A 4KFRA 2AK3A 2D4HA 4NBSA 2GDJA 1LF0A 4HAYA 3CH4B 4BWYA 1ZCBA 4CGZA 5FUVA 4P4SA 1U0HC 1ZU4A 4XJXA 3SYKA 5GJBA 2FPKA 2DFNA 1KNQA 2BCJQ 1ESMA 1D2EA 3IQWA 4TL8A 4ZCIA 1OFTA 1G1MA 2XSZA 4KFTA 2MSDB 4LYAA 5JJLA 4OL0A 1RE0A 2FWRA 2VEDA 3HYTA 3MG9A 3NHAA 4D25A 3X1XA 3LW8A 5L3QB 3A6PC 1L4UA 3PQCA 2HCBA 2F1HA 2VHCA 4TLDA 4ARZB 2ZAOA 3EWAA 4XH9B 2ZI7A 4PANA 1NKSA 4QJ3A 5GJVC 4WVFA 1KIMA 5FUYA 4GZMA 2FN4A 3HJNA 4ON9A 4FMCB 3KL4A 2UVQA 2ZJ5A 3MSXA 1CR1A 4QNRA 3U5ZB 4URVR 1Z63A 2IYSA 2HDNB 4JBYA 5DHAA 3KZ1E 3LLMA 2NQ2C 1UBFA 2DFKB 2VF7A 4D81A 3QVVA 5JBQA 4O25A 4IFEA 1R0XA 4MYTA 2QM7A 4TSFA 1P73A 3IHLA 2VHTA 2ZSDA 1RJ9A 4LC0A 1WMSA 5JCPA 2HYIC 4IRUB 1ZD1A 2F9LA 1E1QA 1KYIA 2QUZA 3VFDA 1V5WA 4W5JA 4DLTA 3ZIAD 4PQFA 5GJWC 3V00A 4OHYA 1TQDA 4BLSA 2A5DA 4PZYA 5FTNA 5KU1A 1HEIA 4IDHA 1Z2CA 4ZPXA 3QG5A 1QHXA 1PLKA 1S9HA 2WBLC 4Z8XA 3GLIE 1US8A 1P9WA 3BH7A 3WNBA 2FX3A 2ZYWX 4PSKA 1BMFD 5FOSA 3BORA 1NVUQ 4WBSA 5KSPA 1GL9B 1W36C 2IXEA 1WBDA 4JKIA 4B32A 2R8RA 4B3GA 4L9WA 1ELOA 4M1KA 4Q9LA 1NVVQ 4Q9JA 5FOTA 3VR2A 1DAMA 1E2IA 1DAGA 1Q1EA 5IRCD 5BXQC 2PEZA 1P3JA 3DDCA 2FV8A 5BN5A 1NN3A 3TUZC 4BFZA 1U0JA 3GMTA 1CJKC 5CB6A 2G0TA 3JZAA 3L2OB 1H65A 4HDCA 4PZLA 3AVPA 4M21A 3ZH9B 3PEUA 1G3MA 1G291 1AQYA 1L7VC 3D31A 3ZVNA 3KQKA 4JBWA 4Q00A 4BE7B 2IBMA 2C2HA 3DL0A 4M9ZA 2ZPTX 2RGDA 1CIPA 4B74A 5CDFE 1E0KA 2PX3A 2ZJOA 4HZIA 3KQHA 1U9IC 4XSHA 3K70D 2ZSBA 5D3MB 1N0WA 1VCNA 2QSYA 3NBZC 4NYIR 4JVNA 4PPGA 1QF9A 4URYR 2O8CA 4D4MA 3QF4A 3SBDA 1ZD8A 1ANKA 3OHMA 3CWZA 3VU9A 2VP4A 3K9GA 3UXMA 2YINC 3CO5A 1Z07A 2WKPA 4FWIB 4US2R 3OE7D 4U02A 4LHXA 3NWJA 3BWDD 2Q6TA 4PXAA 1MR3F 4M22A 1UBGA 3BFVA 3SI7A 1U8YA 2OZEA 4ESVA 1QHHB 3REFA 5KOYA 3LDAA 1WA5A 2VSOA 2ZSEA 3QNUA 2Z43A 3TGPA 2IS1A 3AB3A 2NO9A 1JAHA 1DPFA 2RCNA 2I1VB 3EIQA 1M1YE 1ZUIA 4G5RA 4NPHA 1W5SA 1KI6A 1LNZA 4FW9A 4QBHA 3UMFA 1NMXA 1JBKA 3B1VA 2EWWA 1HH4A 3C5CA 2YOGA 3NBYC 2W2XA 2CDNA 4LUCA 4M0LA 3RS7A 1R8SA 2WJGA 4ZIRB 3C7KA 5J40A 1ZRHA 4LJ4A 4WOPA 2WSSA 2Q9AA 2QMUA 2V8OA 2O8DB 2WVJA 4DZZA 1FFHA 4HATA 3U6BA 1EWRA 2W6JD 4WAUA 2ZR7A 5AUQA 2JJ1D 2ZJAA 5E7JA 5E3HA 1YZTA 1KI1A 1NN1A 3ONWA 2NZJA 3CLVA 1HURA 4LPSA 3PEWA 4Z1MA 5K8LA 2B8WA 1YZKA 2I1QA 3WP1B 4KLNA 1GITA 4DDWA 1TAGA 2GJ9A 2GEVA 2P3SA 1IXZA 1E9AA 3R9IA 5JS7A 1EWQA 5JS8A 4TMTA 1GNQA 4JZKA 2OCAA 4US1R 4ABYA 2OHFA 4Q5IA 1SVIA 1E99A 1T9HA 3TSOA 3BC1A 2Z4SA 1M7GA 4LHWA 4ESHA 4IDPA 4YXWA 1OT3A 1VPLA 3AVYA 1D5CA 2ERXA 3CZQA 4DJTA 2FMXA 1Z6YA 2X1VA 2CL6X 3P1JA 3SNHA 2ZETA 4AWXA 1XD2B 3LO5A 4C0HA 1ZNYA 3ZZTA 4E07A 3U7HB 2ZU0C 4GPTA 3SQWA 2V6JA 1MT0A 1ZMXA 1YR6A 2F3RA 3PV0A 2VBCA 1QG4A 1E9EA 1OH5A 4MITA 2J7KA 2IEZA 2NO7A 2CHGA 1EX6A 2FG5A 5G3ZA 4HLQB 4HUTA 2ZVPX 1H8HD 1F6BA 3M0EA 2D2FA 4BECA 1KJYA 2ZRNA 3DZ8A 4NYIQ 1TUEA 3QBTA 1SXJD 1Q22A 5EE9A 4LI0A 1I2MA 1W2HA 2CCJA 2CCKA 3ND8A 3EPHA 1OSNA 1YR9A 2OLKA 4IOLA 3SN6A 1OH7A 2RGAA 5FBLB 5L3SB 2D06A 4R98A 1W4BA 2ORVA 4G5GA 5TARA 1R10A 2CL0X 1EFUA 1S4QA 1MO3A 1KDTA 3MWKA 5SZKB 5DNYB 2IS4A 2YNMA 1XU4A 1Q1BA 3N2EA 2JLRA 1Z0IA 1DELA 1RZ3A 1ZVQA 4DCSA 4OBEA 4BEBA 3LX8A 2GVDC 1KDPA 2E87A 4TMZA 4OJQA 1G4UR 4QOSA 1P9NA 2V9PA 4JLJA 4RKFA 1E0AA 4CT5A 2QA5A 1VIYA 4IXNA 4OK6A 1E1RD 3U3JA 5HE9A 1W1WA 2REBA 3A4MA 4GSYA 2AX4A 4V0LA 1RC8A 1DARA 4TYWA 2ZRJA 2DY1A 4Q1AA 1P62B 3TVDA 2KB0A 3VKGA 1J2JA 2ZRPA 3OAAD 3B1ZA 2JLYA 5DHFA 3QXCA 1YZGA 1W0KA 2YZ2A 3AP2A 3BE4A 2BMJA 1OPXA 5CIWA 4C7OB 1HQCA 1UKYA 2RHDA 1TQ2A 1G18A 2ZJBA 1MKYA 1P4SA 1E79D 2H18A 4OKSA 4Q7JB 3EPLA 2YVUA 4KLZA 2J0VA 1S0UA 5K8UA 421PA 1WP9A 5EXPA 3PEYA 4POAA 5HCIA 1SXJC 4AKGA 2BBTA 3CW2A 5DIFA 5KDLA 1OF1A 3KJEA 3CUEF 2GCPA 4DLRA 3PFIA 2P65A 3OEEA 2WSMA 3EWSA 1W5TA 4JLVA 4M1TA 2RGXA 4MRVA 1SKYE 4JT4A 1YZUA 4A1FA 1A7JA 621PA 3RRNA 2H8KA 2W2VA 3VKHA 1HE8B 1KKMA 1W47A 5B57C 4TLCA 1D6JA 1E2MA 3TW4A 2FGKA 1MOZA 5K8TA 1XJCA 3CZPA 1Q0UA 4Q4LA 1IAQA 2ZRCA 2CBZA 1ZNXA 1T5LA 4KVGA 5TY0A 1M74A 1OHHA 2ZUBA 1JJVA 1EFCA 1YJ5A 2OCBA 1RRCA 4M1WA 4DBLC 4CEHA 2BVNA 2QENA 1KI7A 3C4JA 5DLQC 2OO7A 1B0UA 2NPFA 3PITA 4Q1FA 4ZDJA 3UKDA 3MWLA 1KY3A 3TR0A 5A5GA 1VCMA 4BRWA 2EYUA 4G3XA 4KI0A 1JPNA 3ICQB 4JVMA 3CR8A 4MGZR 1W0JA 5C4GB 1UBEA 2ZRGA 4CZ2A 5EE5B 4DCUA 2IYWA 1JNYA 3BB4A 4Q02A 3B85A 5H1YA 2XZLA 2FEMA 3AV0B 4DUGD 1F2TB 2IYXA 1MABA 1VHLA 2GILA 2ZRMA 2GWHA 2BIFA 1KK1A 3D3QA 4QC2A 4TYQA 3IO5A 1T3SA 2P5TB 1UPTA 1O87A 3GFTA 1FP6A 5DO9A 3SJAA 3AVTA 4WIAA 2HEIA 3BGWA 3ND9A 4IKEA 1XFAA 3PVSA 4MKHA 1KJWA 3DMNA 3ZIAA 1QVRA 2O0HA 4LHZA 4MRRA 5JI3E 1DAKA 3OFND 4P4UA 2ZS8A 3KXIA 4DSNA 2IYVA 2KBEA 3IEUA 3H84A 1NSFA 1ZINA 4Q9HA 1UKEA 5IK2D 5J4HA 2GZAA 2XZOA 5JSZA 1HT1E 2WJHA 3CB4A 4DRZA 1R5NA 3NC0C 4MGYR 1XMVA 4MGIR 2H16A 1BMFA 2ZJ2A 1GKIA 2C95A 2QTVB 4NL4H 4LJ8A 4XVRA 3ZQ6A 3EA5A 3CBQA 1OFHA 1RPZA 3QY0A 1Z0FA 3AEZA 1TADA 2DHRA 3QXHA 1TMKA 3PIRA 1GP2A 2CE2X 3GLIA 3FMOB 3AH8A 4B34A 3ZD7A 3ZJYA 1G17A 1G8FA 1KI2A 2BBWA 1U99A 2ZE7A 1D2MA 1EFHA 1LF5A 4LZZA 3T1VA 4RJLA 3CX8A 4OI0A 4A2QA 2ZTSA 1NBMD 4XVQA 4WZ6A 1KAGA 1XTRA 3M6AA 1NSTA 4Q4AA 2AL7A 2JJ8A 2ONJA 1FMJA 1NY5A 3MLEA 1G16A 4IOMA 1G3UA 3WMFA 1G6HA 2GJ8A 1Z28A 1QRAA 3B1YA 2OXRA 4Q48A 4AKHA 2DWPA 1N0VC 4IOJA 1KHTA 1WQ1R 1XXHB 2Y8EA 3WMGA 4XTCS 2IXGA 2C99A 1RRPA 1RFLA 2B92A 2ZRBA 4I1VA 4TZ0A 1NNEA 1MO6A 2RMKA 1ZAKA 1SHZA 2ZRKA 4FWTA 2C9CA 4D26A 3TUIC 2ZREA 4HLUC 4PO9A 3X2SA 1IBRA 1UDXA 3NDPA 3OE7A 5BW8A 1U81A 1ZNZA 4B73A 1EFTA 3RNLA 4MKGA 3WNDA 3T35A 1W2GA 2BOVA 3L8ZA 3MAAC 4QGGA 3SHFA 4K81B 4LSGA 1IONA 1SVLA 3GLGB 5F98A 2DPXA 3CRMA 4KU4A 4LC1A 4RD6A 3GLHA 3WHKA 1CJVC 3I4LA 1GL7A 4GOKA 3W8RA 3C14C 3A1UA 3RWMB 3LAWA 3LNCA 3GEHA 1E3MA 2GRJA 3MRSA 3E1SA 5KPDA 3NBXX 5AUOB 3AF0A 1L4YA 1CRPA 2AHOA 2GBLC 4R9UC 1D9XA 2BV3A 1G8HA 2CK3A 2C5LA 4YMUA 1R5OA 3BK7A 2DWQA 4A0GA 4D6PA 4X8HA 1SVOA 2RGEA 2FOLA 2OBMA 1ZM9A 1FQKA 1OYWA 4PFSA 2YC4C 4A2WA 4ZDKA 4XTRA 4TQAA 3U4QB 3SS8A 4NYJQ 4LJYA 3VR5A 5AJVB 3BRWD 3P4XA 1P5ZB 4DT1B 3O47A 3ZS8A 2YOFA 4WZAE 4QGHA 1CS4C 5JSZB 4A15A 3IPXA 2ZJZA 1SXJE 3IGFA 5EUMA 3FHOA 2FFBA 2KE5A 2G83A 4MKFA 4OI4A 2ZR0A 3NEYA 4CEIA 3BAFA 2WKRA 3KJGA 1E9BA 1VG1A 4Z51A 4XWKA 3U2QA 5JMTA 2WICA 1XPRA 4JL6A 121PA 1II8B 4KITB 4U00A 4GL2A 3A1SA 5LPNA 3AF3A 1GAJA 1T3LA 4FIDA 3ZS9A 4CT4B 4TQ9A 3T1OA 2PX0A 1UKZA 4DLWA 4A6PA 3NBFA 3EIEA 4YQFA 4FXPA 1U0LA 1Z2AA 2GEUA 1XF9A 1E9CA 4LYFA 3FHTA 4HB2A 2OESA 4HZUB 3PUYA 3KKNA 3DZDA 1DTSA 4NCNA 3PUVA 4DIDA 3K9LA 3OIVA 2P67A 1D8TA 1B23P 5EE1A 5LD2B 3SQXA 2BBSA 4LJ5A 4NYMQ 3RS0A 2W6IA 2XEXA 5J4KA 3EPKA 3LVRE 2VYFA 4L16A 3MWYW 3QPUA 4ILEA 2WAXA 4DLZA 2CCGA 3GD7A 4OHZA 4QFMA 3B1XA 4HLCA 4FCTA 5SZJA 4EPTA 5AJYA 4Y0VA 1JR3E 1PV4A 2R6GA 3VAAA 4ERNA 4XVUA 1GTVA 2CLDX 2ZITA 1AM4D 4C0QC 1FMLA 1W4AA 1JXMA 4GMDA 1TF2A 1CU1A 4BEJA 4NHOA 4QHTA 3U44B 4JT2A 3MCAA 3LQQA 1E69A 1C1YA 2CL7X 1E2EA 3G82C 2ZXUA 1E2DA 3B1WA 2BMEA 2AWNA 1GRNA 2OG2A 4NONA 4E22A 3D6TB 4OHVA 4KCGA 1D2NA 5B64A 4AYXA 4IEEA 2P0EA 2LWIA 3LD9A 1JEDA 1NMZA 2OE2A 5DI3A 2O0JA 1BIFA 4IXMA 1X1RA 4LOAA 4EJSC 2AD1A 1N5JA 1HT2E 1TF5A 3S1AB 4BFVA 4DDTA 4AC9A 1NI3A 5FR1A 4AY2A 4RY2A 1KO4A 3KDSE 4C9BA 2AD5A 1VKJA 3W90A 2O8EA 3C8UA 2IW3A 2EQBA 2J0UA 4YMTA 1FPMA 3U6KA 4FI3C 2YWHA 1KK0A 3KJIA 2R6CA 1E94E 2MMGA 2C98A 1IN8A 3RRMA 3KKOA 1S1CA 2YWEA 3H1TA 4CYMA 3DM5A 4KHZA 3TAHA 3K1JA 2VF8A 2XNDD 1RYHA 2ERYA 4Z1MD 1Z22A 3OEED 3RS5A 1E98A 2QPAA 3RS2A 3PJRA 3TNFA 2GXAA 3IUYA 3SFZA 4G5OA 3SR0A 2OFWA 1CP2A 2RGGA 1DO0A 1H8ED 1XD2A 4JYCA 4TLBA 3TH5A 4O0MA 1JAIA 1S2MA 1II8A 2W6JA 3IHWA 5GJCA 1QZXA 1IN6A 2QM8A 4G01B 3P4YA 3BOSA 4OQNA 5FL3A 2QBYB 2BJWA 2NMVA 5CK5A 1JXOA 1KSJA 1NBME 2RKOA 4YXWD 4H1VA 4MYHA 4EPRA 1WDTA 1VG9B 1HUQA 2QNRA 3Q7PA 3VMFA 4DC9A 5JLJA 3HU2A 4X8OA 3K09A 4HZUA 1U2RA 1WXQA 3KKPA 3K70C 4NCIA 2OEPA 1Z0JA 2VO1A 1XEXB 2GF0A 4QJ5A 1II9A 1RRFA 1N5KA 2JEOA 3NH9A 1N2CE 1EESA 3T1TA 1P2VA 3E2IA 3A4LA 1UFQA 1DVRA 2RGBA 1CKEA 3LXRA 2ZRFA 2N1BA 4II7A 2ZS7A 2BC9A 2JASA 3T15A 4EUNA 4MUBA 4RFSA 2HLDD 2WJIA 3WXMA 1DBSA 1G7CA 4LHVA 3QEJA 1JEEA 4Q1DA 5G3YA 4QM6A 2WV9A 4P31A 4BZXA 5CYOA 4GOXA 1IY2A 1P60A 2MMCA 1NVVR 2GNOA 2QMEA 4A36A 2WJYA 4V0KA 3I92A 2Q3HA 2JAQA 2OM2A 5EP1A 3EIHA 1ESNA 3I62A 3MUFA 2WWFA 3RRZA 2ZM5A 1GKUB 1RW4A 2J45A 3OIYA 4LBZA 4LHYA 2O8CB 2IF0A 3VX3A 2DCUA 2CHVA 2JJ2A 1NIJA 3NVAA 4UQOA 4RZUA 3L0PA 5C4MA 2V7QA 2Z6VA 3Q85A 3D7MA 4GZLA 1KDOA 1T3HA 1DAEA 4CEJB 1ZUHA 2FPMA 3VTKA 1S96A 3FKSA 3THYB 1OW3B 4C0JA 1UDWA 2PMDA 3KFVA 3DKVA 1E0JA 4HYYA 3AUXA 4WW0A 5KUTA 2XXAA 4IW3B 4H9GA 1M7HA 3T06B 3I8XA 2DB3A 1JALA 1MRNA 4AG6A 2IYRA 2G88A 5HCNA 2IC5A 2WWIA 3AP1A 4YONB 3CNLA 4Q18A 2UZ3A 4GOJA 3A1WA 3K9HA 4N0EA 4PC2A 4BPBA 1NMYA 4B6FA 3I5YA 4PO1A 3BXZA 4I99A 3MD0A 2NZ8A 1W46A 5CM8B 1KKLA 2XTZA 1QG2A 5K8IA 4D4LA 4EPWA 1VDZA 1XCGB 1NKTA 2ODBA 4PR0A 3LH5A 2QAGC 1G21E 4P32A 4IHQA 2Z5FA 4FCWA 2A5FA 1AZTA 2G3YA 3TLXA 2ECKA 2VSXA 1IXSB 2WKQA 3UATA 1OFUX 3CONA 2AFIE 1A2KC 1YRBA 4KBGA 4PX9A 3DHWC 1G3RA 3B8HA 3EPJA 4UNSA 1T0JB 4L8GA 5L3SA 3DPUA 5DISB 3SFVA 1SHKA 4M1MA 5FPHA 3Q8XB 3SYNA 2BCGY 1OXXK 2HJVA 2IUUA 4ARZA 2XB2A 4NYJR 5KPJA 2FU5C 4Q01A 4F93B 1IHUA 4B75A 1AK2A 4A0HA 3R9WA 1S3SA 1G41A 2V54A 1XB2A 5DYIA 2HYDA 1FUUA 1IJEA 3HR8A 2IEYA 2GAOA 3A58B 3OF5A 4KV9A 1LS6A 2XSZD 1W0JD 4PSVA 2B6HA 5H8WA 3F0TA 1SGWA 1RIFA 1X8KA 3CNOA 4MUAA 1F60A 3TRFA 5J47A 4TLEA 4URXR 2RGCA 3L0SA 2R6DA 4JLAA 1SXJB 3BFXA 4A8JA 2OT3B 4B33A 2OFOA 3FMIA 4B2PA 3AKDA 1T6NA 1QHSA 4DB4A 3EZ2A 4TYNA 4JJZA 4US0R 3CF2A 3QKRB 4L9SA 4PAMA 5TXGA 4YC7A 4PPNA 4QKQA 3HR7A 2CJWA 1JQJC 1IY0A 3IBGA 3L82B 3UMSA 2YC2C 2RGNC 1GNRA 5DSZA 1TU4A 3F5FA 2XAUA 2AKAB 3JZMA 1TEVA 2PT5A 4HDOB 4JLBA 2OXCA 5KTYA 1E2PA 2EFCB 4TSFD 2IWHA 2C03A 2BKEA 1IXRC 3OIUA 5AWFC 5D3QA 2V6IA 3NH6A 1KMQA 4GDFA 1AIPA 1FTSA 2W00A 5G53C 3EW9A 2IWRA 3GLHE 3U7EB 2AWOA 4DCNA 5CJ2A 3GLHB 1AKYA 1XJQA 2F43B 5HKKA 1FNMA 2DBYA 2ZRHA 4Q19A 1N5LA 4Q4JA 4BFWA 1AA9A 2YJTD 5ELXA 4E5UA 3MJHA 1XRJA 1K5GA 4M53A 5AK0A 1XCPA 1GZSA 1Z0DA 3TJZA 4C0KA 4NTZA 5JZVA 2IYLD 3VHLB 2C77A 4EAQA 2HXSA 3JVVA 1KZ7B 4DT1A 3WP0A 4WZBE 2E9SA 1BO6A 1XEWY 2WM9B 3FMPB 1XMSA 4IJMA 4PC7A 4UNRA 5TDHA 1UKVY 2OAP1 4V02A 4A82A 3R7WB 4RD0A 4KODA 2CMKA 4F38A 2H5EA 5FUXA 2BBOA 3RS3A 1XEFA 4BLOA 1L2TA 1Y63A 1NN0A 3CPJB 1ZP6A 2G0NA 2WJJA 1SULA 5DI3B 3D8BA 3EZ6A 3WYFA 4IVQA 5B30A 1ZU5A 3K09C 1SVWA 3T5DA 2PJZA 2QZ4A 3K0CC 1OJLA 2JLVA 2RAPA 5B2ZA 2FSHA 3DOEA 3T1QA 1TEXA 4AI6A 3CKLA 3FVQA 4O2LA 2ANBA 3W5JA 4WXPA 4KYUA 1NG9A 3ZYCA 1N3BA 2WWGA 2ZUCA 3AF4A 4MH0R 5CK4A 2ZI5A 2YWGA 2IYUA 2QTFA 5KHOC 1QHNA 4KFUA 4A8JB 5KNBA 3ZLJA 2MSEB 4BLTA 4ZCLA 4C3ZA 3IQXA 1E6CA 1R7RA 3K8YA 1F3OA 2CLCX 1CJTC 4JVLA 5JHHB 3A1VA 2A9KA 2GESA 1UBCA 1YQTA 5AJWA 2F1JA 3PEVA 3SDZA 2EFDB 4V03A 3C15C 5FTMA 3ZQJA 1NJGA 1GRQA 4P4TA 5AJZA 1NL3A 1GRRA 5DI9A 1IM2A 3QQ5A 4W7SA 4B2LA 1H8EA 2B7BA 4KFSA 1W49A 4UXHA 1FX0B 1GSIA 3IIKA 4GP7A 1EGAA 1RYFA 4KJZA 1P7CA 2ZANA 3FFAA 3KKQA 3N2IA 2W0MA 3IIMA 5DH9A 1ZM7A 2VPPA 2WSSD 3GJ5A 1MH1A 5FOWA 2JLUA 2XJ4A 1XTKA 1M34E 3B9QA 4K46A 2ZVQX 1XTQA 2EU8A 1DS6A 2F7SA 3QXSA 3PUWA 1UAAA 2XXAB 1XPOA 4IVRA 3SJBA 2IX3A 1DAHA 1U9IA 1QVAA 3KUDA 2PCJA 2IUTA 2BKUA 1XX6A 5BN3A 1YR8A 1Z8FA 1XD9A 2B7CA 4Q1CA 2EYQA 5GVRA 1F2UB 3VR3A 2O8BA 3ZVLA 3GLIB 2JIZA 1YU9A 2F9MA 4D0LB 3NTUA 4MYUA 4YMSA 3CPEA 1P2UA 3RSOA 2VP5A 1I4TD 3QXXA 1FW6A 2BMFA 4FD2A 4B3BA 4CW7A 3IIJA 1OE0A 3P26A 4GMXA 2F3TA 2WTUA 3AKEA 1XEWX 1J7KA 1JECA 4OQLA 4HAXA 1SKQA 1XDBA 4EJSB 4Z54A 2P5SA 5EE0A 1HE1C 2P2LA 1OIVA 5SZHB 4TL6A 3TUJC 2DFLA 3LW7A 5FTJA 4LV8B 1NF3A 1W36D 2FSIA 5LDDC 1KO7A 4LRWA 5F9FA 2NTYC 2VH5R 3TQCA 4RZ2A 3PR1A 1DADA 4GP6A 1EX7A 1DG1G 3PENA 1H8HA 2QAJA 4TWZA 5L3RA 4LCBA 5JFGA 3ZVMA 2AXPA 4TQUS 1T8UA 1TNDA 4X8MA 2W83A 3OEHA 1E4VA 3GQBA 3RDPA 3S1AA 4UKDA 2XJ9A 4DXAA 1Y3AA 1KO1A 4J0QA 2D7CA 2LCFA 4G5SA 2ODWA 2JATA 2RH5A 3FTQA 1GIAA 1QHHA 3BB1A 2V4ZA 4KSBA 1G6OA 1S3GA 5P21A 1KSHA 2A5YB 2XOKD 4PTLA 1KZGB 1K6MA 2KSQA 2GJKA 1ZM4A 1TPZA 4QL3A 1J8MF 3LVQE 2Z83A 4R2HA 1OYYA 4M4SA 3NC1C 3FGNA 1M8PA 1E2LA 4FMBB 1EFRA 1VCOA 2KI5A 3QKUA 1F2UA 3ECCA 1IQPA 3GJ4A 4CEJA 3DKPA 1NN5A 4F7WA 2X2FA 4RZXA 3VNUA 1PJRA 2AR7A 3LLUA 4MYCA 1G8PA 2TMKA 2D7DA 1P9RA 4BFXA 3OAAA 4EPXA 1JQLB 1J70A 1LB1B 1W0KD 1OB5A 3KUCA 2PT7A 2XNSA 3TIFA 3SZRA 2REOA 1T91A 4PQRA 1X1SA 1C9KA 3TBKA 1OXUA 4PHFA 2OAQ1 1U90A 2XNDA 1GDDA 2WMOB 3AVWA 3HPRA 4MRSA 4DKXA 1C4OA 2NO1A 3GJ8A 2FZLA 3HP1A 2ZE6A 4OQMA 2PBRA 2XZPA 2RB4A 3G5UA 4QBFA 2WAYA 3KTAA 1NIPA 4I1OA 5FBWB 4RD1A 5BYJA 3LRPA 2QAGB 1JB1A 1VYVA 1RVDA 1PUIA 2BWJA 1GILA 4B6EA 5IT5A 1M6NA 5A0FA 5LD2C 2PLRA 1N6IA 4EKDA 1TU3A 4N0DA 3THXB 5C18A 2WZQA 2JDID 4LYHA 1LY1A 1SKYB 3FFBA 2HLDA 3FDIA 4I1SA 3RSLA 4DLVA 1J90A 3OIWA 1W4CA 4JSYA 1ZNWA 4AK9A 1G64A 5J4YA 2ZUDA 3L43A 5AR1A 3RABA 2QP9X 1FQJA 3L0OA 2OFXA 4QRHA 2BHRA 2FFQA 4XSGA 4JS0A 1T8TA 4Q7MB 2G9NA 1N25A 1LS1A 1VG8A 1Z47A 4N1AA 2NO0A 1G8GA 4ZKEA 3AUYA 4C0LA 4FN5A 5CB8A 3RANA 4A92A 2R9VA 3A1TA 1Z6GA 4IEIA 3AVUA 2WOJA 2GF9A 1CULC 4BZQA 2MSCB 1G8YA 2N42A 4I81A 4HLDA 5C46F 2CEAA 2KWIA 4NMMA 3ZZUA 3CRQA 2IHYA 2O8FB 2ZRIA 3QIAA 2C9OA 3I1FA 1YVDA 4RCYA 3TVTA 1KTVA 3AVOA 3GLFE 3VHXA 1WBBA 2CLSA 1E2JA 2QSZA 1ZM3A 3QOFA 3DOFA 4YDHB 1PUJA 3OFNA 3WY9A 3K53A 5KDOA 2NGRA 1OXVA 3H2YA 1TF7A 4AYTA 5HKKD 3U61B 3ZGXA 3BD9A 5IK2A 3BBPA 4NCHA 1P2SA 4GRAA 2FGJA 3IDQA 4V0MA 4XD7D 1NLZA 4BFSA 2I3BA 5AJXA 2IHBA 5HE8A 2VHJA 4HB0A 4D0NA 4R7ZA 4M9QA 5FBVB 3FKSD 1UM8A 2R2AA 3UG6A 3THYA 4I4LA 4EQ6A 1P72A 1IN5A 1XXHE 1Z0KA 4ASUA 2H1LA 2W58A 2ZJ8A 4P3YA 1RRGA 4QJ4A 5C2JB 3QSYA 1X3SA 1XZPA 4TMXA 1T0HB 3CIOA 1JJ7A 1R6BX 5EUQB 2JLQA 5KSZA 3W3AA 4ZO4A 2HUPA 5LB2A 4IDQA 3FB4A 2G6BA 4HUQA 2BDTA 4F92B 5GVSA 2D3WA 3EX7C 1KK2A 4TT3A 3KB2A 1N6NA 4QBGB 2GHIA 4B48A 3GLGE 3UANA 4QG7A 3R9XA 1E2HA 1NLFA 2FF7A 4DDVA 3NDBB 3U3MA 4C2UA 3K0EA 3KX2A 4FMCF 1JR6A 2IUSA 2FH5B 5E4FA 3RLFA 3IPYA 1S9DA 3QE0A 3R20A 3HPQA 3NG1A 4BFTA 1TUIA 1XJ0A 3SOPA 4JIMA 3CRVA 2AFHE 3KQLA 2V1XA 1E9DA 1R5BA 5TVKA 1N6PA 3QKSA 1AQUA 1R0ZA 2JLWA 2JGNA 2GJAA 3CWQA 3QBVA 3VQTA 1D9ZA 2D2EA 3GJ7A 3QKTA 3KQUA 1VECA 1KO8A 4ZI2A 2ASEA 3QKRA 2EFGA 2ORWA 1U8AA 3I5XA 1TTTA 3Q9LA 2QMOA 2NIPA 1X6VA 4RFSB 4ITRC 2JCSA 2Q3FA 4BLRA 3V4FA 4NCJA 3TW8B 1E9FA 3QPWA 3BH6A 1KI6B 3GFOA 4QXAA 3ICEA 3U60B 2PJRA 2FJUA 1UADA 3DO6A 3AF1A 3GJXC 4HAWA 3TQFA 3UIEA 4BASA 1PVOA 3U7FB 1AGRA 1US8B 1DAIA 3DMDA 3P27A 1E1QD 1YZLA 3EAQA 2C9YA 5BWMA 2FZ4A 1ZUNB 5JHGB 4PHTA 1K5DA 1OFIA 2W2TA 3CF6R 4DSTA 3FPAA 3VR4A 3B2EA 2GETA 2DR3A 4B2IA 2R6FA 4B47A 1OKKD 3TAUA 4OI2A 4B3DA 2IF2A 4EFNA 2EWVA 5FBQB 1Q3TA 4BRUA 2QQEA 4DSOA 4QHSA 2ZSFA 3U3RA 3QF7A 4TTQA 2J0SA 1XBTA 1ZBDA 1UF9A 1F5NA 4TTPA 2E1RA 4KO8A 3RC3A 4PPFA 4D80A 3UPUA 2J7PA 4LYJA 1A4RA 4M1OA 2ZYTX 1I4LD 1ZC3A 3OZXA 4JVSB 3LX5A 3CX6A 5IF9A 1Q1QA 4EDHA 1E96A 4PC6A 3GLFB 2J3EA 4B3FX 4FCVA 4G5QA 1XD8A 5KNCA 3EG5A 3KB1A 1Z83A 3H86A 1BYIA 2JLXA 3VX4A 1G7SA 2ZRAA 3H0KA 4C2TA 3O8DA 1X8LA 1SVMA 4M2LA 1K8RA 2NG1A 4PZZA 2OLJA 1W4RA 2ZSAA 2PZGA 4W5WA 3IEVA 1BOFA 3AVQA 1MABB 2H17A 3SJZA 2H57A 3G0HA 3VR6A 2FE4A 2NOAA 5DN6A 3VR1A 4PSAA 3OEHD 1GM5A 3E70C 2ODNA 1P2TA 2FFHA 2F6RA 1Z0AA 2PZFA 2C04A 1IOZA 2QGZA 4DLXA 4L5BA 5JWRA 3WNCA 4IDNA 4C0SA 3BJIC 3V4RA 4B76A 2PEYA 4V0ME 3QPVA 5F3WB 1G19A 1I4DD 2GEDA 2YHSA 1DG3A 4P4SB 4TL7A 2PL3A 2HT6A 2XOKA 1UEJA 2R6AA 4JLDA 5B58C 2PMKA 3ZZ0A 1NLYA 2A7QA 2GK7A 2N46A 3HU3A 3ETLA 3SU8A 2B21A 1XZQA 1WE2A 5LBIA 4F91B 5KYKA 4U7DA 1Q44A 4DCTA 4LDJA 1WCV1 3TMKA 1KK3A 1Z3IX 2ZYVX 2AKYA 5GADl 4DHEA 1OLOA 3LY5A 1R0YA 3QI2A 4QNMA 4AG5A 1X86B 2Q9CA 1XWIA 5FOXA 4YMWA 3K0AA 1W44A 4RD3A 4PC1A 1PLJA 2IS2A 1E2GA 2A5GA 3AGQA 5L3VA 4PAQA 4EFMA 2QROA 2PCLA 4HSEA 4TMWA 1CJMA 1OXTA 2V3CC 4GT1A 1KMHA 2G1KA 4C30A 3T12A 2HF8A 3RC8A 2R62A 1NVWQ 3AKCA 1OXSC 2YKGA 3THWA 4AKIA 5HPYB 3F3YA 1NVXQ 4P33A 3AVVA 5EQTA 2WWYA 2OCPA 1KI3A 4MKIA 4Z8YA 2Q3MA 3B7GA 1RJ9B 2CNWA 1XEXA 4MGKR 4EFLA 5EE3A 1DAFA 1P61B 1NP6A 2DYKA 1ZD9A 2YWFA 4K8OA 3C41J 3TR5A 4DLSA 3AM1A 1GL6A 4V0NA 4Q4HB 5KSOA 3O8BA 3U3KA 4KSCA 3GJ0A 3SE0A 1AZSC 4NCKA 5KDDA 3LBIA 3SEAA 4D2IA 3ZDQA 2JIZD 1KMHB 4JL8A 1MO5A 1CR0A 4LX0A 3TK1A 2VHQA 2PH1A 2QP3A 5EXSA 2KJQA 1GUAA 2REXB 3ZVRA 2WHXA 1E0SA 2H92A 3QF4B 4H1UA 4IDOA 4JJKA 4YMVA 4TTRA 1EG7A 5KSYA 1LFDB 1F2TA 1LV7A 3GPLA 3AP3A 3LV8A 1BS1A 3ADDA 2VIIA 1G20E 2WIAA 2QE7D 5H70A 4A2PA 1S1MA 2X8AA 3UK6A 2RGNA 3MMPA 4NU0A 3W6PA 4LJAA 4RD4A 4C0AC 4PO8A 5L8VA 2H7VA 3HU1A 1XP8A 4OQFA 3IILA 3QVUA 1TQ4A 3AQ4A 3JVUA 2QRZA 3R7WA 5CM9C 4BLQA 1MV5A 3A8TA 1NRJB 3W3ZB 4HAZA 4LJ9A 5HZHA 3ADBA 2FPLA 4AKEA 1N0UA 3CRRA 2DWOA 4P0TA 2Q21A 3ASYA 4GBMA 2C8VA 5J5CA 2FA9A 1DO2A 5HR5A 3J81k 2EVWX 2JA1A 3O8RA 4HB3A 4OQXA 4W5HA 5FOUA 1Q1ZA 1SQ5A 2QPTA 3CPHA 4OHWA 1G3QA 1OV4A 2ONKA 5EZ5A 3QEOA 1KJZA 2IYTA 3IKJA 4NKRA 2JJ2D 2Q9BA 1IN7A 3PXGA 4QBIA 3WBKA 2GBLA 5TB5A 1QHGA 1Q21A 4RSGA 4ZKDA 4O3MA 1HYQA 2CHQA 3U44A 3U3OA 2EFHB 2QPOA 2O8FA 4OK3A 3THWB 1A82A 4QHYA 1FOEB 3WRXC 1XNJA 6Q21A 2ZR9A 5ANRB 4F4IA 4JMPA 1AS0A 1G7RA 1T4GA 1LVGA 4E09A 2XTNA 4PC3A 3CX7A 1TX4B 4OI1A 1FL9A 2OV2A 2F43A 4NE2A 2V1UA 1HTWA 2HV8A 3SBEA 1R8QA 2ZAMA 2CJWB 3W34A 5JI2E 1GWNA 1VIAA 4NDZA 4CF7A 2ZI6A 5FPSA 3LFUA 4TYPA 2V55B 5FL7A 1U8ZA 2WWWA 3AF2A 3GFPA 2QAGA 2OUKA 2IL1A 2VP6A 3SYLA 4JLMA 4LY6A 4FMDF 2GAAA 4CIDA 3THXA 2O8EB 1KI4A 3LBHA 4JL5A 4BFYA 1KY2A 4ACAA 2QQ0A 1ZM2A 1S8FA 2GCNA 521PA 2AXNA 5FPKA 2ORIA 1Q3HA 2CXXA 5EZ6B 2C96A 1KNXA 1J8YF 3NXSA 4N3NA 3BERA 4UJ5A 2OBNA 1N6LA 2QP4A 2NO6A 1G9XA 2VQSA 1E9RA 5FFMA 4C4PA 2GZDA 1Z08A 3FHCB 1GOTA 4BGDA 5KNDA 2XITA 1Z6TA 4KAXA 3VNVA 4DEYA 4Q1BA 2GXUA 1M7BA 1IY1A 2IA5A 3K9NA 4HAUA 4M9SA 1CXZA 2HF9A 3Q7QA 1N5IA 5G40A 5LB4A 4W9MC 2J1LA 4TLAA 2IT1A 1FX0A 1IN4A 4PHHA 4EPVA 2IYQA 1Q20A 2GXSA 3I73A 2QORA 1G5TA 1SVSA 1ZYUA 3K0SA 5JJIA 4UNQA 5DYGA 3WYAA 2GCOA 5AUNB 4DUGA 5H68A 3FWYA 4TL9A 2G1JA 1G5PA 4Q66C 1Q57A 2CE7A 4TMKA 1COWD 3RVBA 4TMVA 3THOA 1XPUA 4Q03A 4JLPA 4LJ6A 5FH9A 2X2EA 1N6RA 5JWHA 2WWXA 1VYUA 1KOFA 2R65A 2ZEJA 1OIWA 1WB9A 3I32A 3KKMA 4DLUA 4DLYA 2WOOA 1O3YA 3DM9B 3CM0A 5E7IA 2BEJA 1XTIA 2IS6A 4NYMR 5BN4A 3DEFA 3F8TA 3RS4A 5IHPA 1E2KA 2GCOB 3BS4A 3T61A 4C0BA 3U4QA 2P6UA 1CLUA 1KAOA 4MRPA 2HT1A 3LWNA 4GNKA 4Q4AB 1R2QA 3W9YA 5A4JA 4RKEA 1OH8A 3OESA 2BJVA 2WPDD 5FR2A 1SVKA 3FYHA 1ONBA 2P6NA 4F4JA 4L4UA 1SZPA 2I4IA 3B13B 4S35A 1II0A 5DE3A 2VTKA 4ASUD 1KSGA 4HB4A 3T5GA 3I61A 1JI0A 4I1UA 3TSWA 1NBMA 4Q7LA 1RKBA 4DIEA 4BUJA 2IYZA 4XD7A 2NPIA 3B5JA 2QL6A 5FOVA 4MA4A 4BFUA 3A37A 3A4NA 1MRSA 3BB3A 1VTKA 1JR3D 4BQSA 3U7GA 3B9PA 1E9SA 1PLLA 1XMIA 3P20A 4DEXA 2HXYA 1KGDA 4XOIA 4XWAA 4R2IA 5JEEA 2ZI9A 1VG0B 1AGPA 2R44A 3CF0A 1OB2A 2BEKA 4V0OA 2OILA 2X19A 2W0SA 3NIBA 3WMEA 1E2NA 3E5HA 3EXAA 4R71A 4AD8A 3CNNA 2J0QA 1F48A 3RAPR 2O8BB 1XXHA 1ZJ6A 2EW1A 5L3QA 3I8SA 3M1IA 2A3RA 4B3XA 1Z6XA 3RYTC 2GJSA 2BM1A 3LA6A 4Y0AA 4ZDIA 4DVGA 3N5CA 2OSBA 4Q9KA 4A9AA 2PZEA 3W5IA 4PHGA 2VRWA 4UJ3A 4ZDWA 4ZV4A 4B44A 5JRJA 4DB2A 3EZFA 1NY6A 5E95A 3BFKA 4RFVA 5CIQA 1YHNA 4LWZA 1NG1A 2CK3D 3KFXA 2ZJYA 2F55A 5FI1B 4Q9IA 4E03A 4S2EA 3EC1A 4UXJA 2L0XA 4UNNA 2QG6A 5AUPB 3BH0A 3Q5EA 3MGCA 3W8NA 4D4JA 4A0FA 1CJUC 4Q47A 3L0IB 3T34A 2F1RA 3EC2A 4Q7KA 5CLQA 2UKDA 4DSUA 2GXQA 3H4MA 4TZ6A 3HYRA 1YZNA 4QGAA 1U94A 2XGJA 1ODFA 2A30A 2OCYC 3LBNA 5EP4A 5FTKA 1QHIA 4O2RA 4YLGA 5FI0B 3Q5DA 4RVCA 4DCVA 1A1VA 1DEKA 3IO3A 2QBYA 2SHKA 4JYBA 5HTKA 1FTNA 1CTQA 1V43A 4B71A 4CEHB 3R8CA 4CVNA 4QGFA 3V9PA 1X8JA 2GKSA 1GKYA 1OKKA 2ZE5A 1QDEA 1VHTA 3B6EA 1VMAA 4OHXA 5EXTA 2BM0A 2C78A 3DVLA 3C16C 1R4AA 1OIXA 3ZD6A 3C5HA 2J87A 2ANCA 4RZ3A 2Z4RA 4LK2A 1UEIA 2IYYA 3GLFA 1AN0A 4JKYA 5DGXA 3HWSA 3TE6A 2GA8A 4EJSA 4XWOA 1OH6A 3WBJA 3GP8A 2VP2A 5CJPA 1P75A 3X1YA 4EPYA 2AN9A 5J4LA 1FP7A 2A78A 4NP6A 4LBWA 1KSFX 4JLKA 3KTAB 3AVXA 2GTPA 2WMNB 2JLZA 4WXRA 1CR2A 3B78A 1KO5A 2J7PD 5EP2A 4URWR 2W6ID 4FINA 4CDGA 2ZI3A 3P32A 4D4KA 3PCRB 4JSTA 5CLLA 4OK5A 2Q0HA 4EIWA 4IOKA 1DE0A 3AGPA 4BZPA 4M1SA 3O8CA 4PQYA 1L8QA 1SXJA 1NJFA 3QG1A 2ZROA 1Z5ZA 2ATXA 4OYHA 5JECA 1W36B 2CVFA 1I2DA 2HJGA 3WHLA 1QBKC 5TMPA 1DOAA 2J46A 3W6NA 3K70B 1KI9A 2K5UA 5IDVA 2D62A 3CRW1 3A36A 4KVAA 4Q4JB 1M2OB 3MWJA 1YZQA 2B8TA 4GFDA
chains in the Genus database with same CATH superfamily
4NU6A 4CM4B 3LT4A 3OQPA 5IDQA 5AMXA 4BNNA 3DF9A 2YNMD 1YB7A 2NVBA 1AJEA 1R0CA 3UF0A 4QTUB 3K7EA 5JMWA 1IN1A 2HJSA 5GQSA 3H5OA 2XT6A 1P1HA 3QNWA 3I2JA 2VLIA 2IHTA 3AEKA 3C97A 4B3TB 1X3LA 1SHUX 3L8YA 3LT0A 5CJJA 3OJWA 4Z7JA 4JHXA 4LBVA 4EP1A 4D82A 3U44A 5DHQA 5G41A 4NJEB 3B51X 2R11A 4IIBA 1CF4A 3JQQA 3QFRA 1ETUA 4FHFA 4XIGS 3H3FA 4LJ7A 3RTDA 4B3SB 3D1JA 4B35A 1I1NA 4IYRA 5E7MA 2P6OA 3D59A 5DTIA 4A6XA 1N9GB 4UNPA 3I9KA 3NQ41 1VHJA 3L6DA 5ILGA 1E4YA 3LECA 4AYWA 3BWCA 1QIEA 4Q3AA 1FSSA 5C7YA 1YU6A 2ATVA 1XPRA 5H5JA 5AM3A 1ADBA 4YQYA 4X54A 2Q7DA 5KOYA 1AHNA 1Q12A 3O38A 4GMGA 1M2JA 4PS1A 2P6PA 2DFTA 2JAWA 3I2GA 4NBWA 2X22A 1HKHA 2CXHA 3OOJA 4R0VA 2AC4A 5I3CA 1RMQA 3WRYC 4S05A 1QX3A 2YS6A 1WXEA 3W5BA 4EQ6B 3AIOA 3DCIA 4RCVA 1NUPA 1M75A 3GN2A 1N8NA 4MS1B 3V9AA 1QRUA 3W2TA 2FN8A 4OLHA 5KYTA 3UH0A 2VSFA 1KQOA 4R68A 2XUGA 5HQ3A 1IZYA 1H6CA 2VRBA 1EUDA 2ZE8A 2FQXA 3MFYA 4C6TB 2QGNA 4BP1A 1U2QA 4YP9A 4L4ZA 3EG9B 4RWZA 4F3NA 4P53A 1LVUA 2J59A 4UZEA 2NYUA 4B84A 2PLFA 3CH5A 3FE2A 4RKWA 4R1NA 5A71A 3F6RA 5ECGC 2Y92A 3KEGA 4KQGA 1B6TA 3WISA 4HI0E 5HGXA 5G0SA 2EFEB 1F8XA 3QXJA 1I2CA 1YH3A 1GU7A 4JJAA 4LFCB 3DD5A 3DL7A 1G7TA 2OHGA 5KU7A 2JJ1A 2QRNA 1BN7A 3A4TA 2YDYA 1CUYA 1FXUA 1DLJA 1UDRA 1W48A 3CR3C 2UYYA 3QHPA 1WPXA 4OMCA 3DFIA 3M8KA 5TLSA 4FMDB 2OD9A 3GLSA 3UWKA 2IITA 2X4GA 2EL7A 4LJSA 4ZCMA 2GGSA 1CY4A 3LQRA 2Q6OA 4HAVA 2OCXA 4DDMA 3DW3X 1O08A 3PNKA 3F9RA 3GLGA 2W9XA 1EK0A 1TOAA 2NNLD 3KEOA 5D85A 4BV8A 4FEEA 5IXYA 4RK6A 2A1UA 4AZ3A 3K73O 1RT9A 1YZ3A 1VMIA 2LKCA 2JNWA 4O4LA 2R6ZA 2OGWA 4GAEA 4RGVA 4DMRA 1TIPA 2B61A 4DDUA 1AX9A 2PGIA 721PA 4YYZA 3GH1A 3GZJA 3RVQA 2BEUB 1QQ7A 1VYTA 3DLAA 2GZHA 3AF5A 3HEBA 3PFBA 4LFBB 2QJTA 3I72A 3WLAA 4EECA 1U7WA 3EEFA 4UQPA 1ITZA 2QT0A 4MRMA 2Z6UA 1QWSA 1H1LA 3HJUA 1C7IA 1HDEA 5IJ0B 4X64B 2ZBDA 4Q3OA 2RHMA 5AKKA 1UOPA 1JE0A 3CE9A 2BTQB 3DC2A 4Y2JA 1SOVA 4MR9B 5IP5A 4BX8A 1YF3A 3LLCA 3MJFA 2DJIA 4F11A 2WPNA 2P6RA 2G77B 4IHJA 4JQSA 4FN4A 3E23A 5BR7A 2AOTA 2Z1DA 1D5WA 3KSZO 1JSCA 4JFAA 4RCZA 4IFBA 5K3BA 1GAQA 1GLNA 1L5LA 3ADCA 3EZ7A 1WDWB 4J03A 3KXKA 2WPDA 3QKSB 4KYVA 1JDJA 2QX4A 5BYKA 1AKEA 2YBEA 2YV5A 1SCKA 2Q5FA 2QI9C 2RARA 3C1OA 4W8GA 4XXHA 3ZBPA 5J59A 3T5AA 1BE6A 3GI1A 1QC5A 2TMYA 3LPCA 4M9RA 5CFRA 1Z39A 2NSHA 3PKJA 3LP6A 1BGVA 1S2IA 3AZOA 5JXJA 4TN1A 1FFEA 1CEEA 4FBLA 3NU1A 3FNFA 3PI7A 2BGNA 1Q16A 2W22A 2CFRA 4MS3A 5EWJB 5GINE 2PU7A 1XCMA 3OT5A 4TVKA 3ZCRA 2I1LA 2QTTA 2ZTHA 2JANA 1A5TA 3N07A 1DMRA 2NTVA 1QP8A 4HEJA 3AXSA 2OCDA 1QMPA 1TQ6A 2EF0A 1IJFA 4LPKA 2J5QA 3FKQA 1JR3A 1W88A 2ZRDA 1KDRA 4TWRA 3UC5A 5DW0A 5I7WA 4IKEA 5B3KA 4QUIA 1YRAA 3PZRA 4TLMB 1PO7A 3RYFA 5EJIA 5KNBH 3PUXA 4KXFB 4F3CA 4DR4B 5ALRA 5ALXA 1QHYA 2VJAA 5K0GA 2CEKA 1PQPA 3H6HA 3MGKA 1ZIPA 4YWHA 1DO8A 4URUR 1HYGA 3FTDA 4OG2A 5IKEA 4HG2A 1ECBA 1LTQA 2I6SA 4RE6A 5JC8A 2JIRA 4HWPA 3U31A 3P0RA 1WS6A 4G0ZA 4ZOAA 4YASA 4ZIRA 5TX7A 3DEYX 3QJYA 4FR0A 3OOWA 1FSPA 3PNOA 2VOEA 4KQKA 1M2WA 2QN9A 3K0AB 3MB5A 3U7QA 4LRTB 2FDCA 4BTVA 3GLRA 3OJCA 5IVHA 1E2QA 1QKKA 2BHNA 3AETB 3KOWA 5AKZA 2A84A 4IIDA 4IZ6A 1M5RA 4IRMA 3K8ZA 4A4DA 4K40A 4RKRA 1E79A 1E61A 3PNVA 1TYBE 4R0NA 4XYLA 5C7IO 1EGMB 5CCXA 2OBLA 4PTYA 3TWOA 4MDYA 221PA 3ASZA 1JG4A 2F1IA 4WKBA 4R41A 2AK3A 4IWXA 4QUHA 4F5YA 5TVGA 5DXAA 3AV3A 3ONDA 3WIEA 1TVEA 2HU8A 1SVNA 3IAS1 5AD1A 5HRAA 3HP4A 5IVKA 4BNYA 5B3JA 3V8NA 2BDUA 2CDRA 3N2KB 1B2LA 1CFZA 4QLOA 5EZYA 3SYKA 3SZLA 5BN3B 2FPKA 3GRCA 3M34A 2DFNA 4I14A 2BCJQ 2UZ4A 4NCBA 5AXAA 2J3MA 1UZAA 1KQNA 3COJA 4CQLA 1XZBA 2PRIA 2WDPA 1OFTA 4HNSA 1OTXA 4R8VA 1RQLA 2G5PA 1EIZA 2JS7A 1BKYA 3JAKA 4RK1A 1OX5A 1RE0A 4CFZA 1TRKA 3H11A 2AJDA 3LW8A 4Q3DA 3VA7A 3U4CA 4Z1OA 1B8UA 3EXEA 2VHCA 2GX6A 4TLDA 2ZAOA 4QASA 1YZFA 3TBFA 2EEZA 4PANA 1NKSA 2V5VA 1PGJA 2AXEA 2VUHB 3MF4A 1XSEA 4PM4A 3UT5B 2X5OA 2FN4A 2VHVA 3K5IA 5KQRA 2OWDA 3U9SA 2Z6AA 3GNSA 3R4CA 2G0AA 2PSHA 1XDZA 4MI3A 3A6JA 4GEGA 4KN9S 3REQA 2QRJA 1YTLA 4P3PA 2JD0A 5DHAA 4ECEA 1SG0A 4PN7A 1Q84A 2VNJA 2DFKB 2ODTX 5TQ0A 1EJBA 1LK0A 2V6GA 3CLRC 5DF1A 4CMIB 4F1KA 1S8NA 2E82A 1QXSA 3NOVA 4MYTA 3KSBC 4D96A 3UWSA 1CB7A 2HHCA 4M54A 2OM6A 2IPNA 4GNRA 2ZTMA 3VNSA 1RJ9A 3N0TA 1N2OA 1WMSA 2Z8YA 4GPBA 2BKVA 2FHSA 3GT7A 4IRUB 4UEOA 3VU3A 5JAPA 2HKIA 2XA2A 5K0TA 3PS9A 3BA1A 2F67A 2XT0A 4FYJA 1Q6YA 4JCOA 4P1ZA 1SUEA 2O3QA 3VFDA 3W2GA 4V1CA 2J32A 3BMNB 3V00A 3ZIAD 5K2OA 4BLSA 1B0ZA 4ZC1A 4E2FA 2XGGA 5FTNA 3JU3A 3BJRA 4ZJUA 4PW0A 1HEIA 4IDHA 5KU1A 2R0QC 1YTUA 1Q91A 1FJXA 3BF8A 3QG5A 3S8EA 3NIGB 3RFTA 3KQVA 1Z7GA 4U5QA 1H9BA 1PLKA 1ORVA 2COKA 4Z8XA 1IG3A 5CCDA 1XDUA 2BGLA 1P9WA 3BH7A 2WHRA 4H31A 3T3HA 5BWBA 4B6JA 4DRYA 5F77A 1UDCA 1CT9A 1LXCA 3QNMA 5FOSA 5T67A 1U1GA 4BN4A 1ZK1A 5ERXA 3C87A 1NVUQ 3IAUA 1B3BA 1VP9A 3OU7A 1IC6A 1RYEA 3HE3A 3I04A 5EKXA 5KSPA 4G8BA 4B32A 4B3GA 1M2GA 3PP8A 1SH7A 5H02A 4AQDA 2XVMA 2A0FA 4ZHSA 4U6NA 2JZCA 1E2IA 3RH0A 4D3YA 5IRCD 3H3XA 2VWGA 2PEZA 1LFAA 4NE9A 2FV8A 3WR5A 1NN3A 3TOZA 4HO1X 1G6KA 1U0JA 4DEVA 3HBLA 5CB6A 3T41A 3SR4A 4AF6A 3DTVA 4Y2HA 3ZH9B 3BXEA 4WK0B 3D31A 3ZVNA 1ABFA 5CW1A 4WGFA 4Q00A 5KYWA 4WJLA 2CD7A 2ZPTX 3T5TA 1CIPA 4C78A 1WXWA 5K0JA 3JQAD 2J48A 2PX3A 2ZJOA 3N3BC 4HZIA 5G1PA 4E4YA 2JJMA 2D54A 2PVCA 1N0WA 2QSYA 4PPGA 2IHKA 2J9FA 4WFIA 4DF3A 4MR7B 5BW5A 2AZTA 5FA6A 1QLJA 1W96A 3RTCA 4D4MA 5KB3A 1Q7BA 3RKSA 3N0RA 2EC5A 1A8QA 3P0FA 5ESRA 4L28A 1KAEA 3GVXA 3OT1B 4BBJA 4FWIB 1N33B 4US2R 3FNHA 5LIRA 1NVEA 2E49A 2Z9DA 3LS2A 4WD3A 2VQ3A 1N4DA 3WNQA 4ED9A 3IE0A 3FLBA 1B41A 2EW8A 1DFGA 2IEGA 3A31A 1YMQA 1ZD3A 2AF4C 3BWDD 4JBNA 1U0EA 1M1ZA 1OUMA 1Q0LA 1GGEA 4ND5A 5E8JA 3PPVA 3BFVA 3GROA 5G0WA 3SI7A 5A2QA 2IXDA 3FPJA 2CXTA 4L8WB 4ESVA 3M4NA 2ZR8A 3D54D 1WUKS 4KSYA 1FDOA 1FFXA 1W93A 2FW1A 2VSOA 3AFMA 3QNUA 2EIHA 5DCUA 3TGPA 4V2IA 1HX7A 1IWBB 2NO9A 1JAHA 2HCRA 2B20A 3OQJA 1KVSA 3PNPA 1M3SA 3FCOA 4I1YA 1PG0A 3RSCA 5JC1A 4FHDA 3QMWA 3CJTA 4C87A 1W5SA 4TTAA 4O4HA 4CG3A 1JLKA 2I29A 1A8SA 4MWZA 3B1VA 1ORDA 3KHUA 2M6RA 3LYHA 3H99A 5EFZA 3C5CA 1CUSA 4LUCA 4EGQA 16PKA 2PA3A 5ICGA 1JYEA 1ZR4A 5J40A 3DLPX 1QLHA 3FPSA 2Q9AA 1NVKA 4HNUA 5A3JA 3J7TA 5JT1A 1GG5A 4LF7B 2ZR7A 3RWBA 1PWYE 4G0XA 3P71T 3VKUA 3J7AC 5EHNA 3UVEA 2CFSA 3ONWA 1SCNE 4EELA 3DLTA 3X2EA 3CLVA 1HURA 5L4LA 3M9LA 4OHMA 4C20A 4O59O 1REQB 5I9LA 3KRTA 5JARA 2A9QA 1XLTC 1GQSA 4K9QA 5BR8B 1LLUA 4JGBA 3L04A 2I1QA 1O9GA 4QEDA 3GUCA 4DDWA 2FZEA 2GJ9A 2QW0X 2R1UA 1YFZA 2UUOA 3JAWB 4EVIA 3NKLA 3NOOA 4ZQCB 1GNQA 3DA8A 4NZMA 4V39A 4J9UE 3FTEA 1MJGA 2OCAA 1U0GA 3IERA 4ABYA 2OHFA 4N0PA 1SVIA 1E99A 2D1QA 5A2GA 1FNCA 1YJCA 3EGVA 4LHWA 3RJZA 3WRYA 3ITKA 4E13A 1K89A 3GY0A 2D7JA 1MW9X 1NMSA 4LEIA 4YXWA 2G6TA 3PKZA 3AVYA 3VH2A 1MMFB 2ERXA 4PYRA 4DJTA 4GUAA 2GBGA 2X1VA 3I0ZA 3P1JA 4S1WA 5E6SB 1PX2A 2YY7A 5FAKA 1RAHA 4QICA 3SX4A 4JYZA 3LO5A 4DHWA 5JZSA 5DP1A 1ID8A 4GLBA 1M83A 1GY8A 3DUFA 4WI1A 1JW9B 4RQTA 6YASA 1XZNA 1ZMXA 1AUPA 1QLWA 2VBCA 3QLUA 4MITA 1TO6A 2NO7A 4HHEA 5IC6A 6NULA 3OQ1A 1KY5A 2ZVPX 5EVJA 2WG2A 1USIA 3M0EA 3L6RA 4ME6A 4CCAA 1YD7A 1IBCA 3ZCTA 4RHYA 1RLIA 1T4CB 4EZBA 5AESA 4Z0NA 1T15A 4PX2A 1W2HA 3ND8A 5CGQB 3H4VA 2RGAA 5L3SB 2VQFB 1QF6A 1BG6A 4LYGA 3QOXA 4W6ZA 1TM5E 3ESDA 2O2IA 3HDQA 4MB2A 4R98A 5BW4A 4UU8A 4G5GA 1VA5A 1SG9A 2GN0A 1R10A 1E6MA 3HNPA 4ZEVA 5KYGA 2IHUA 4L9RA 1ZY2A 5DHUA 3W5HA 3TPZA 4G81A 5SZKB 4FC7A 2BZ1A 2NVUA 4LZLA 2JLRA 5DN9A 4DR1B 1CERA 1ZVQA 4BMNA 3PFCA 4KXQA 2GXAA 2XYQA 2CLKB 2C94A 4QREA 1KDPA 4M1QA 4TMZA 2J3JA 2Q5HA 3OSUA 4NFSA 1LWOA 3QELA 4PLZA 2R1VB 4D3ZA 4HV4A 4FYXA 1P9NA 4J29A 3WMWA 3JZIA 1VIYA 3AJAA 2AE1A 3N6VA 1JLMA 3NORA 5T4EA 5EMNA 5ULLA 3A4MA 3G0CA 4RK5A 3L6OO 1IEWA 2IY8A 5I7OA 2X42A 2ZRJA 1I7QB 5IKMA 1FDSA 1P62B 2KB0A 1J2JA 4MQMA 2ZRPA 3NOQA 2C4TA 1GGNA 3S5UA 2JLYA 4DR6B 3AY7A 4BDTA 1YDGA 2YZ2A 1VA4A 3AP2A 3KHKA 1KIAA 3PX3A 3BSWA 5IC5A 3ZDEA 3D6VA 4B80A 4C7OB 2JGDA 7REQB 3O8LA 3INYA 3KCQA 2RHDA 1G18A 3N8KA 4P80A 3S55A 1A88A 4OKSA 4NK5A 1WUHS 2XEDA 4YALA 2YVUA 2DUUA 3M3PA 3TDNA 1WVIA 3NVDA 4RQBA 1USVA 1BFDA 2UZ0A 421PA 5K8UA 4DLNA 3OF2A 3M5PA 4I50F 4J4BA 4X97A 5EXPA 1DTEA 3TS1A 4POAA 5HCIA 3IAEA 4W1RA 1SXJC 2F59A 2AB0A 5ICMA 2CMDA 3HM9A 1QPZA 3AEUA 3GRUA 4HXEB 3A1CA 1HFEL 2P65A 3QBJA 3CHYA 4BVFA 2FZWA 5AOCA 1WAMA 1W5TA 4M1TA 4OKNA 3WMXA 4J07A 4LOIA 1YZUA 4QSMA 2PZ8A 3QTTA 1UT6A 2EBHX 1HE8B 4L07A 3KQSA 5K8TA 3NGXA 1T1JA 4MHOA 1OFVA 4KVGA 2WG1A 5TY0A 4RVFA 1NBHA 1FBTA 4F72A 1EFCA 1P7ZA 5CDYA 4YQFA 4M1WA 4M7RA 3C3YA 3F5MA 2BVNA 2QENA 3OKCA 1KI7A 2I4OA 5DXFA 2BW0A 4XYEA 3NP9A 5DLQC 3WE7A 2OO7A 3X43A 1Z5OA 3MWGA 3PITA 5DSTA 4G0MA 1EHCA 4AT1A 2Z6QA 1KY3A 3TR0A 4G85A 5DM60 4TYMA 2E3JA 5IN5A 3AW9A 3OZAA 1VB3A 1XHEA 4CDRA 4MGZR 4CZ2A 1W0JA 4EYKA 4W1QA 3PGLA 1E0DA 2IYWA 1JNYA 3BB4A 3IRVA 3B85A 5H1YA 4DLKA 4A2CA 4MLZA 2FJPA 1Y5NA 4JB2A 2ZRMA 3ZXIA 1P1RA 5EVCA 4C6HA 1N7GA 3IO5A 3K2EA 3OSZA 4IUCS 2C2ZA 2PDAA 4QODA 1UPTA 2Y71A 4TSKA 2O59A 2DBVO 3AVTA 2G71A 1HZZA 1O5TA 1VQ1A 1WO8A 2A1TR 3BGWA 2AQIA 1JA1A 3O4HA 1SCAA 3DMNA 3PVSA 3C98A 4IJQA 4HEA1 3ZIAA 3ZWQA 3K71B 4Y6QA 4LHZA 1O03A 5JI3E 3CQ9A 4P4UA 2Q3EA 2ZUFA 5JNTA 5FTWA 1TUBB 1C41A 3KXIA 3QRWA 4WXHA 3RKRA 4DSNA 3B3QA 3HVHA 1JX6A 2K7FA 3AUAA 4TUYB 4O4JF 1UKEA 1UXIA 1SKMA 3HFRA 2Y0CA 2WJHA 2O2CA 4L0QA 4JYMA 1JHXA 2J3HA 2OKCA 2H0RA 2FSUA 1XMVA 5F1PA 4AX4A 2ZJ2A 5IJ9A 4WZAA 1YBVA 5JH7F 2YWXA 3E81A 1MP0A 1TYAE 2CLFB 1PEYA 1U3FA 3F90A 1BHO1 1MZVA 1RP7A 4KOAA 3D3KA 3U3XA 2XGMA 4AJNA 1CNFA 3QY0A 4GVPA 4BQIA 1I33A 1YQDA 4UOEA 2OP0A 1IXYA 1YAHA 1FFAA 1K08A 4HDSB 1NYTA 3AH8A 2PSFA 3FMOB 2FDRA 1G17A 3DP9A 2W4QA 3ZJYA 5K20A 4DUZB 1G8FA 4Z9YA 4DADA 4DQLA 4GSKA 4JEHA 4KZKA 3WRXA 1D2MA 3WBBA 1FDUA 2LRHA 1T1SA 4QDZA 1LF5A 2HQSA 4ALJA 2YV2A 1ACMA 3NTOA 3T52A 1E5XA 4JBGA 4DRZA 4OHBA 4ENVA 4R1SA 4Z2AA 4RMHA 1K75A 4JJ8A 1KPIA 3PNQA 4GG1A 5FV4A 1J42A 1TVCA 3M6AA 4MYDA 3NAMA 4QUJA 1SCDA 3MLEA 3S2FA 4D44A 3ERCA 1TZJA 4DQKA 1EVLA 4BMDA 1OAKA 1Z28A 3WYCA 3IXQA 1JFSA 2X13A 2DWPA 1T9CA 3HHPA 2ID9A 4XVCA 1BROA 2XY4A 1P0FA 3U09A 3ZJVA 2EWMA 2IXGA 4U2GA 4BN0A 3FMVA 1RRPA 5INTA 3H9GA 1UMCB 2VK8A 3B12A 1RQNA 3WGHA 2COEA 2RMKA 2ZRKA 2D8AA 5CB0A 4D26A 3VJRA 4B4DA 4ID3A 2ZREA 3TUIC 2R00C 3JQRA 2YMPA 3I39X 3HB7A 3NDPA 2NUPB 2FTKE 3HA3A 1K8YB 2I7TA 1A50B 3N2ZB 3FWPA 3PHJA 3I6ZA 4FHCA 1YACA 3GBVA 1W2GA 3L8ZA 2H2IA 4F9GA 3KL2A 3R3XA 2QUIA 2BUBA 3CJQA 2R6JA 5BSUA 1SVLA 1ZVMA 5LYJB 3PTLA 5KQSA 3UMGA 5GONA 3DCJA 3RAJA 1N32B 1C4KA 1TQ8A 1TZBA 3C3PA 3CRMA 1M2KA 3GLHA 1M6HA 4HH0A 4HTFA 4MV7A 4D9HA 3KU1A 2NUBA 3WHKA 3W8RA 2P30A 4RK4A 1SA0B 3UJ9A 3RWMB 2JGRA 3LAWA 3LNCA 1WY5A 4FX5A 2W8BB 4P6VF 2JH3A 3NBXX 2DF8A 4RXMA 2YYAA 4E46A 3R3ZA 1KJ9A 2VAXA 2MT9A 3OWHA 4MTLA 1Z4QA 3BK7A 3NDJA 3PXDA 3SVTA 3OZSA 4X8HA 2PRZA 5CDGA 3R3UA 3L93A 3RQSA 2YN0A 4PFSA 3RE1A 2X9NA 1K8QA 5DBGA 3DAOA 2W2KB 3E7WA 4R51A 4E2WA 2ZZKA 1THMA 3DS8A 1QK4A 4TQAA 3UTCA 2PX4A 1U8FO 3SS8A 3EAGA 4WEOA 1E92A 2B1RA 2JI6A 1JDUA 1M72A 1WDMA 3D6MA 4PQGA 3O47A 2JEZA 3DMPA 1TVKB 1F2VA 2O6LA 3KQQA 2WTEA 2PXHA 4RORA 1CS4C 2BSAA 1Z26A 4WLOA 1I7LA 2DWUA 3GA0A 4A15A 3DE5X 2ZJZA 1IOVA 3E3NA 3FHOA 2BCEA 4XCXA 5EIOA 3D7RA 5FPSA 5FHQA 1GKLA 4EEXA 4C4RA 2ZR0A 3UQZA 3G23A 3JALA 2QX8A 3EODA 4BEVA 4CEIA 1Y0BA 2I6QA 2WKRA 3WNVA 2EZUA 1HO3A 3PC2A 1JJBA 4XWKA 1PL8A 4PX5A 5KNCH 3BRCA 1KMNA 1YASA 4OLJA 1E7QA 1VJ0A 4JL6A 4YAEA 2GT1A 1OLUA 3A1SA 2R00A 1WKVA 4RWEA 1XZKA 3WWEA 2Z1NA 1GAJA 3AF3A 1WXXA 3PL1A 4Y2XA 4FIDA 1JQBA 1HKUA 3G9UA 1YJXA 4CT4B 1AGNA 1MC8A 4AUNA 2HSEA 4CBVA 1AGXA 2A5LA 4ZAVA 1C0IA 2OORC 2AZDA 2BTOA 3D1LA 4R3UC 4A6PA 4OMFG 1DBPA 1WW2A 4ENQA 3C48A 3EIEA 1RP1A 4RDHA 3WFJA 1H93A 2ZVJA 5BV1A 4IGEA 5DMHA 1Y7TA 1Q2UA 1E9CA 3FHTA 5ICCA 3QMPA 4RLQA 4RIIA 2ZZMA 3PUYA 3GGDA 4OIMA 3BGVA 2H1SA 2GFQA 4CN9A 5JBIA 3PUVA 3IP5A 4YJ2F 3LHKA 1GZ6A 1XRPA 2P67A 1JHUA 2XNKA 2KHZA 4LYDA 4NYMQ 1XOIA 3EUWA 5J4KA 2GZ2A 1XZLA 4HFRA 4ZAZA 1HDRA 3WK7A 4L16A 2B4QA 3PHIA 3RU2A 1PBTA 4I08A 4O2AA 1RZRD 3FYTA 3UENA 1XLTA 3HKCB 2Q3JA 4ZT2A 2CCGA 2R85A 1XTZA 5LFAA 1GZ3A 1RZVA 2PAFA 2PUTA 2R4QA 4FCTA 2CBXA 4BKQA 4EPTA 1USGA 1PR4A 4KQJA 3TLMA 2CLDX 4G1BA 2VS1A 2ZITA 4F8YA 4Z4CA 2XBLA 1K06A 1FMLA 1JXMA 2V7EA 2ZM6B 1CU1A 1TZ2A 3FAZA 2RK4A 3U44B 4NI5A 3WVNA 4IMIB 1E2EA 1E1YA 4K6GA 4YTEA 2ZUEA 3HNOA 1OWMA 4RIGA 1XAGA 3ACBA 3QMMA 2HJWA 3QWHA 5EA2A 5K1ZA 4N76A 2X8JA 1HM5A 3UPDA 1MIHA 2DUMA 4OHVA 1EZ4A 4JI4B 4KCGA 1E59A 3DBLB 4IIXA 4ZVMA 5B64A 3F2VA 1LCIA 3RROA 2NTEA 4IXMA 2PT6A 3HBFA 1X1RA 1WUTA 4UHCA 2VXOA 4LOAA 5DBOA 4C2AA 2AD1A 1TF5A 3AUJB 4OUDA 5SY9A 1ABEA 1RQXA 5JO0A 3CKMA 3PEFA 2PVPA 1MJNA 1TDJA 2BGGA 5E1MA 4AY2A 2Q99A 5FR1A 3W3AH 3OM0A 4M83A 4RY2A 5JPDA 1USUA 2B98A 4C9BA 1O6ZA 1UBJS 4H3HB 2IW3A 3P9XA 4MWCA 4TVOA 1Z0ZA 2XQKA 3M6FA 2O48X 4DJEC 4E08A 4YMTA 1FPMA 4HN4B 3ORYA 5JS2A 4CMGA 1RQGA 3PE3A 4FI3C 4CG1A 3VAZA 5JCXA 1SUPA 3QVKA 2P9TA 2YWHA 4GS5A 1KK0A 2F1OA 2C98A 3FF1A 4MVCA 2DRIA 1Q7RA 1SHLA 2EQ5A 2IJGX 2QD2A 2YWEA 1CLEA 3K1JA 5F35A 2R66A 5LYJF 4AICA 4U6QA 3KXPA 1TEZA 5F7OA 4Z1MD 2XUHA 1Z22A 3RQIA 3PJRA 2Z8XA 4EUKA 1CD5A 1QH1B 2E4VA 2WNHA 3VHRA 4B09A 3N1UA 3SFZA 3JQPA 5IJ9B 1FP2A 4QQ8A 4MVJI 3PXBA 1G8KA 1CP2A 2BDEA 2ISSD 5AKHA 3FMGA 2GS9A 1DO0A 1H8ED 3A25A 1CIJA 3H0CA 3JSAA 4GGOA 3N2YA 4JYCA 4TLBA 3TH5A 1II8A 4FCCA 2QG9A 1CQZA 1QZXA 3P4YA 4PLWA 2QRGA 3BOSA 4QVKA 4LN1A 3U62A 4YUZA 4TZKA 2UXCB 3BSYA 5FL3A 2QBYB 4PBTA 2ZAYA 4NZ9A 1VXOA 1L8AA 3MGBA 1NBME 3B3GA 3LBFA 5F73A 3IAHA 2QRQA 4MYHA 1L1FA 1DKRA 2FPIA 4ZMSA 1WDTA 1WZIA 1K0UA 2G1AA 3Q7PA 3T6KA 1G9TA 3DFKA 3WK6A 1ZVKA 5LQSA 4CV3A 1GUBA 3HU2A 3LDUA 1AZWA 3E8XA 4RH3A 4AUMA 1U2RA 3HL0A 3KKPA 2VF4X 1PGNA 4NCIA 3T4XA 1GTSA 3NBKA 1B43A 1X7HA 3AEUB 3BG5A 2VO1A 1KZ4A 1XEXB 4FFVA 1N5KA 3EGXB 5CRIA 2Z9BA 3UW1A 4QU9A 3A4LA 4MWDA 3AUTA 3ZWYA 4IDFA 3TZKA 3A9WA 5K0BA 2XOXA 3H1GA 4II7A 1H2RS 2A35A 3WTCA 2A59A 4RFSA 4ZHQA 3EVNA 3CB2A 3WXMA 2DTDA 2FY8A 4MB0A 3ROGA 3QEJA 1JEEA 5DWVA 3PSAA 3W6ZA 2B94A 1KDZA 4C3UA 3RUPA 4QARA 4JASB 1G20B 4XYGA 3UWMA 2GNOA 1X77A 2WJYA 1VE5A 3AVVA 1B2RA 1J2YA 2Q3HA 1P45A 4LKOA 4ISBA 5C1IA 4D98A 5EP1A 5LP6F 4GXQA 4NPCA 4ZOLB 1T34A 3UJDA 4QT0A 5F5NA 2YHIB 1JSXA 1CRLA 4FPXA 1MB3A 2W2OA 1YB2A 1GKUB 1QGUB 2J45A 2GRAA 2H0AA 2X23A 1C30A 4LBZA 3EEQA 4NZZA 4EUSA 2DCUA 2HRQA 2JJ2A 1NIJA 3O2NA 1H2BA 2V7QA 2HWYA 3WIVA 4GZLA 2LNDA 3DT9A 5KYUB 1EDDA 1KDOA 2PYIA 5EEHA 5HEKA 2QUHA 1QS0A 2V65A 1GUYA 1ZUHA 2FPMA 3VTKA 2QIOA 3FKSA 1QFXA 3A9CA 4GEKA 4R4JA 3RS8A 3F6YA 1HGXA 1UDWA 2JH9A 3KBOA 3ME5A 1DINA 1WOYA 2RHTA 3A3OA 4KDCA 4KWTA 3T1HB 1J4AA 1AV6A 3AUXA 4X1YA 5JYEA 4FUTA 1LK5A 2QI9F 1NXOA 1TPYA 1Z8NA 3BVPA 1M7HA 3T06B 2P4EA 2DB3A 2MYPA 2GM9A 5EMJA 2BLNA 5JYCA 1GTL1 3ORQA 4DDHA 2YJNA 4F5EA 3AP1A 4WCFA 4MK4A 1V1RB 1O4VA 4N3AA 1CEYA 4BGIA 3LVBA 2SCUB 4QWWA 5L6MB 2FPPA 1QH9A 2C9BA 1HSZA 1V11A 3ABRB 4M0DA 1I8TA 3N0VA 3BXZA 4EX7A 3DE7X 5REQA 5BYAA 1DHRA 4CDMA 1W46A 1ORWA 3FSEA 1S7CA 4GUDA 4MVJM 5A0VA 1K6JA 3ZDCA 2HSZA 3K1TA 4KK3A 5EJ4A 2VKQA 1VDZA 1YVRA 1SBIA 1XCGB 4P2BA 3TQOA 4PR0A 3V8BA 1YBMA 3H75A 3SSNA 1YI0A 2N1MA 3O4VA 3ZR4B 5CTAA 5D5QA 2XB8A 2I1WA 1SBQA 4CPDA 3IJEB 2MDTA 1EM8B 4UDYX 3HY6A 3CONA 2CLOB 1A2KC 1YRBA 4PU0A 3MMNA 3DHWC 2O07A 2OG1A 3ULKA 3P2OA 4UNSA 4TV8A 3LOQA 5BSFA 1TJ4A 4YCLA 5T4BA 2RGUA 1PGOA 3DPUA 2RI6A 1ZH4A 3RT7A 3MTAA 3QVGB 5KREA 2BCGY 2P9EA 4U2DA 4BWFB 1N2XA 4JI0B 2OLEA 3DNPA 3F3MA 5IYZA 5KPJA 1ODTC 2FQYA 1MAVA 1T0PA 1K2VN 4MWGA 3F47A 3TX2A 1CUGA 3SY8A 1S3SA 3DWFA 4JR0A 5I6DA 1UP4A 4XDGA 2HBYA 1IEXA 5ER6A 3EIUA 5THKA 3GRFA 3O1IC 3M6XA 3A58B 3EDRA 1UBOS 2IHVA 5IAKA 2XSZD 3GEPA 4J0HA 5H8WA 3F0TA 1T9ZA 4U2EA 1RIFA 3U26A 1F60A 5KMGB 1XAIA 4KH1A 5L45A 3BXPA 2RGCA 1W35A 1XCJA 1N2CA 4V38A 1SXJB 3F1LA 3PQ8A 1W87A 1E63A 2C2WA 2P78A 2B1GA 2OT3B 1P5FA 3QYAA 4QAJA 4B6QA 4U7WA 3AKDA 4HQNA 2APJA 3B36A 2WHPA 3U48A 3UBTA 4DB4A 1RXCA 3LO8A 5IT4A 1QGAA 3E5RA 1FB5A 4WK4B 3DDZX 4AS2A 4RA6A 4US0R 3V8MA 3E3AA 2CDBA 2NP7A 4L9SA 4PAMA 5TXGA 1PP4A 4QKQA 5KYXA 3A27A 3VC7A 1QE5A 3GGGA 1IY0A 3IBGA 2RGNC 1MZPA 2IHNA 1DTWA 2HIHA 2NXJA 3F5FA 2XAUA 3JZMA 3G8CA 4MIEA 5F1KA 4JLBA 4OQDA 1AF7A 1WTCA 3RTBA 3S2UA 2JFUA 4KC0A 4EMSA 3VC1A 3N28A 5LQUA 4KH0A 3UW3A 5KTYA 1W19A 4LE2A 4MQ4A 5FB3A 2Q3BA 4WFKA 4AJ2A 4PX3A 3DMRA 3FOAA 4FT4A 3DLCA 1YMVA 3TQIA 3VHQA 5BNZA 5IG2A 4OH7A 4N39A 4C3OB 1TK9A 2VBFA 5IBRA 3ZCPA 5G53C 1C8KA 3W4IA 5IFKA 3RUIA 2AWOA 3INTA 2DHCA 2C3UA 1QFJA 2ZJFA 3HU5A 3M6UA 3M6VA 4M0MA 1WETA 1FDWA 5CJ2A 1UZMA 2AW3A 2XB6A 3KOZA 1CF2O 2DBYA 1IZ0A 4E5VA 4QUDA 4Q19A 4GF5A 1Z38A 5CXXA 3A04A 1P0QA 1VLQA 1AA9A 1CNMA 2YJTD 5H3LA 2XUFA 5ELXA 1YB4A 1GPH1 2JI7A 4OP1A 3I76A 2F4VB 1KYXA 1UPCA 3PQ6A 4FDTA 4FILA 3DHEA 4C0KA 2BPOA 2JGAA 1GU0A 2IYLD 4EAQA 1J23A 3IUPA 4PGMA 2NU9B 4PG7A 3IXLA 4K6MA 3VO1A 3TEJA 3WP0A 1HNZB 3UKOA 3WZ2A 5C53B 5TDHA 2YJ6A 3VZCA 4UAJA 4BNLA 4KXMA 4CV1A 3G2KA 3MS2A 3DBIA 5J9FA 4W8OA 4E6EA 1I6WA 4JNKA 2BBOA 3ZE6A 5C51B 4FFWA 1EA5A 1D2RA 4LF8B 3JQ9A 3KWJA 4FK8A 1JDNA 3OX3A 1ZP6A 4F7DA 5IPFA 4C4OA 1EB8A 4UCFA 3EZ6A 3JQAA 3MAJA 4IVQA 3N0WA 1GPLA 1SVWA 4P93A 4F2HA 3K0CC 2JLVA 1OJLA 5A6SA 2BZGA 3RIHA 2RAPA 4ZOBA 3PXXA 5B2ZA 2FN7A 1T9GR 3T1QA 3DZGA 1M1NA 3FVQA 4O2LA 2YMQA 3ESQA 4KX5A 1QIJA 3CIFA 4KYUA 3SKXA 1Q92A 3ZYCA 1N3BA 2WRZA 1VFPA 2QX7A 3R3SA 4MH0R 4PHCA 5CK4A 1JMYA 4Q12A 4CMJA 2IYUA 2QTFA 3EMBA 3VPCA 5A5DA 1ZKMA 3IE2A 4LSZA 2P27A 2D0PB 4C3ZA 3W2HA 1C2TA 1NBOA 2OHVA 2QVGA 3C3DA 1FS6A 5DLEA 2GN6A 3H7AA 1NUTA 3T7IA 2CYBA 3A1VA 4PIMA 2ECQA 3QUTA 4DV6B 4JJ6A 3ESXA 5H83A 3PEVA 2VUTA 2PZLA 1N2IA 2ECFA 3WLPA 4GRIA 3ZQJA 5FTMA 5LOVB 3NATA 1NJGA 2O3JA 5AP9A 2GZRA 1G42A 2OFPA 2R2GA 2O2SA 3CZMA 3FLMA 1EXDA 2O1SA 2VRCD 4RETA 4R6XA 3ROFA 2QL9A 4NFLA 2JFNA 5JASA 2A1TS 3HN2A 1NJ2A 4F84A 3UWPA 3IOYA 1XMXA 3E48A 5B1DA 1WBJB 2HOQA 4KFSA 4RHFA 5LJIA 3PC8C 1FX0B 1AC5A 1BCSB 4M87A 5KJCA 5COBA 4GP7A 1ZR2A 2HJRA 2PFSA 4P5DA 3L4BA 4INJA 4IAOA 3FFAA 3H9JA 1R8XA 4UEKA 4JP8A 1MH1A 2JLUA 4Z3DA 3GJSA