1QVCA

Crystal structure analysis of single stranded dna binding protein (ssb) from e.coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
145
Chain Sequence
b'ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINGLE STRANDED DNA BINDING PROTEIN MONOMER
publication title Roles of functional loops and the C-terminal segment of a single-stranded DNA binding protein elucidated by X-Ray structure analysis.
pubmed rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 15
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1qvcA00
1E1OA 4DR6L 3M3YH 4QQBX 3CCMA 1QVGA 3RZDH 3MXNB 2GN5A 5C44H 1HNXL 1N34L 4YWLA 3I7FA 4B3RL 2YTXA 1BKBA 3PO2G 2ID0A 3CCJA 4GLVB 4A93G 5H1SE 4GKKL 2UUBL 4A3BH 2UUAQ 4GS3A 2R93H 4L5TA 1PH6A 4B3MQ 2WP8J 3KF8B 1B70B 4HJ8A 1PVOA 1QVFA 3H3VH 1HJPA 4NXNL 3UDFA 5M3MH 1PH8A 2JJQA 4JI1Q 1OXVA 4BA1I 4A4IA 1K8GA 1QUQB 4DV6L 4A3DH 3PV0A 4PZ7A 3J81i 1G291 1D7QA 3J81c 3A5UA 4R4OA 2RF4A 1X9NA 1EIYB 4R4TA 3CCLA 2JEAI 3KJPA 2N8NA 1VQAA 3UDXA 4DUZQ 4JYAL 1J5EL 3TEHB 2F4VL 5JEAJ 5IWAQ 3A5ZB 4APVA 5M5XH 3JAMi 4LF8Q 3TRZA 4YHHL 5BR8Q 4X64Q 3JAMc 2VQFQ 2B63G 1VQCA 1SE8A 2OCEA 1MJEA 2V1CC 5LMNL 5IYDG 4DR3L 1UE1A 4A76A 4LFBQ 2PQAB 4A3LG 1NMFA 1R9TH 2E5LQ 1XPOA 4R4CA 1Y1VH 4LFAQ 4RG1A 3CAMA 3M9BA 4PMWA 1X65A 3RN2A 3KDFA 4DR5L 2D0OA 1C7YA 1CUKA 4C3IH 2AKWB 2EIFA 3L0OA 4BY1H 3HOWG 2NN6I 1X54A 4OWXB 1I94Q 1EIFA 4LF5L 1HNXQ 3S2HH 1N34Q 2XGTA 2R92G 1LTLA 2N49A 5LMNW 2ASBA 2OQKA 1XNRL 3HOZH 2UUBQ 3CMAA 3I55A 4GKKQ 1WI5A 2IHFA 2K4KA 3F2DA 5M3FG 3U4ZA 3Q8DA 5FLMG 4B3TL 1X3GA 1YZ6A 4O2DA 4NXNQ 1VCIA 5C0XJ 1FJGL 2L15A 3W1GA 4IFDG 1HZBA 2BA0A 4GKJL 3GTJH 3G6EA 4DR2L 1CSPA 1VQEA 5DLQE 1Q86C 5JJIA 4P75A 4C3HH 3HOYH 2CKZB 1VS0A 4DV6Q 3S17H 3PIPA 1VQLA 1OXXK 4LF7L 4JBKA 2NVTH 3PUXA 4OWTB 3UE1A 4WJ3M 4LF9L 2HQLA 2UUCL 2JA8G 1K0RA 2K50A 1GKHA 4PG3A 4JI2Q 4QY7A 2ZJPA 2JA9A 1EOVA 2PI2E 1KIXA 3PO3G 3S2DH 4MTNA 1HZAA 4JYAQ 1J5EQ 2K75A 2WFWA 3PUYA 4X65L 1Q1EA 3NBHB 1EYGA 2KHIA 3AQQA 3F8TA 3M7NA 2OTLA 1HZ9A 1FGUA 2JK8A 1SRUA 3LGJA 4BBRG 2Q2HA 2E2HH 1CKNA 2VNUD 4KHZA 2AMCB 5HGQA 3VDYA 5LMNQ 2UXDL 4DR3Q 4DUYL 5IYCH 4HIOA 1NY4A 4JOIA 2JA5H 5C4XH 2BA1A 2YU9H 1TWCH 5HY6A 1VQPA 2KENA 5IE8A 4DV5L 3UDGA 4H02A 3K7AH 4IJHA 3RLNA 1JJ2A 1VQNA 4EQ5A 1AE2A 2NZOA 1X6OA 4DR5Q 4IOAA 1V9PA 3KYHC 3A74A 1L1OA 3NEMA 1GD7A 1UWVA 4A3JG 1K8AC 3CC4A 4DV4Q 1VQKA 1OXTA 5EAYA 2I0QA 3F1ZA 2NVYH 1E24A 3GTQH 1N9WA 4LF5Q 2HHHL 2E8GA 2EQSA 4JG2A 4P74A 3G4SA 4DV0Q 1PH9A 1IBML 2A8VA 3BU2A 1XNRQ 2IY5B 4Y52H 1KAWA 1VQ7A 4JBMA 3CCSA 2DGYA 2YV5A 4B3TQ 4HIMA 4NPSA 5LMUL 4LF4Q 4NXML 2VUMG 4LUZA 4GKJQ 4A3KG 2UXCL 1I3QH 4UP9A 3UDIA 3CF5A 4DR2Q 3STBC 2R7ZG 4BBSH 4OONA 4A3FH 2ZJQA 2QGQA 4C3JH 4EX5A 1UEBA 3HOVG 4OX9L 3OW2A 4LF7Q 2E2JH 2DUDA 3H15A 1QUQA 3GO5A 3NELA 2ZM6Q 1TWFH 1YITA 1RIPA 3M4OH 1QVCA 3B6YA 1IXRA 4HJ7A 3ULPA 3CPWA 1VQIA 4PZ6A 2MNAA 1VQ9A 4JI6Q 4LF6L 1SN8A 1YVCA 3PUVA 4LW1A 1L0WA 5IP9H 4X65Q 3J7ZC 3CCQA 3CCVA 1M90C 3AEVA 2HIXA 1HNWL 4L5SA 2WB1E 4DV1L 2VL6A 3PUWA 2VW9A 1Y1WG 1E22A 1SR3A 1I50H 3H0GH 5FJ8G 1NJIC 2QEXA 3FKIH 4IPGA 4JI3L 3UE0A 5JEAG 2JA7G 2UXDQ 1JJGA 3KJOA 5E7NA 3KF6B 5GROA 1VQDA 4JI7L 3NENA 2UXBL 1AE3A 1GM5A 4HJ9A 2B29A 4DV5Q 4GLAC 3S1NH 5AJ3L 3CC2A 5ELOA 3HFZB 3L7ZC 3PF5A 4JI0L 3GTLH 4DPGA 5C3EH 3T1HQ 3ICEA 1KXLA 1S3OA 2AWOA 3I4NG 2MFIA 4POFA 4MZ9A 5GADC 2IX0A 3HKZE 1TXYA 4QL5A 4K0KL 3EIVA 4X66Q 1GO3E 5C44G 2LSSA 3SGIA 4JC0A 3CMEA 2VY3A 1WCMH 2Q2IA 4A3EH 1IBMQ 4LWCA 4R4IA 3J80i 4A3BG 4A3IH 3J80c 1B8AA 1NBWA 1N36L 5IP7H 1P8LA 4JV5L 1V43A 1YHAA 4PZ8A 4TVAB 5M3MG 3CXCA 5LMUQ 5IYBH 1A8VA 3S1RH 1PH2A 4NXMQ 3I4MH 3W1BA 4DNIA 1A62A 2NZHA 1QZHA 1RL2A 1YHQA 4A3DG 5K36G 1EQRA 1KC8C 4OO1G 1YBYA 4OX9Q 2JE6I 2R6GA 1EQQA 4TQUS 5C0XG 4C2MH 1VQGA 1IL2A 3I56A 3TREA 2F3IA 2Q2TA 5M3FH 2IX1A 2MO0A 4DR6Q 2CWPA 4R4QA 2K5HA 3GTOH 4B3RQ 3A0JA 3PGZA 4LF6Q 1JT8A 3T1YL 4Y7NH 3TS0A 2Q2UA 1HR0L 1XPUA 5GAHC 1WJJA 2WB1G 1HNWQ 1IZ6A 4DV1Q 2MQHA 3PUZA 3CCRA 1Q1BA 2AWNA 4YCWA 3PIOA 4JBJA 1EUJA 1I5FA 2OQ0A 4JI3Q 3S1MH 5J3BA 3PO3H 4AH6A 5C4JH 1E3PA 3MEFA 2Z6KC 1PA6A 4JI7Q 2UXBQ 4XTCS 1JE5A 1Y1VG 4YY3L 3HOXH 2MO1A 4QGUA 1UE5A 3K80C 4A3CH 1SLJA 1WOCA 2N3SA 4P73A 1G6PA 3F2BA 1VQFA 4JI0Q 2R7FA 3CCUA 4IPCA 1GVPA 1KRTA 3RLOA 3M85A 2RHSB 4BY1G 1N33L 2I5LX 4BXXH 2F4VQ 1CKMA 4DV3L 3HKZG 1HR0W 3GD7A 3CCEA 3FP9A 3GTPH 4YHHQ 1FL0A 4K0KQ 2CCZA 2LXKA 3KDFB 4IJLA 2Z6KA 2B3GA 1TWGH 1O7IA 4X6AH 4DR4L 3AFPA 2K5VA 4JV5Q 3BZKA 2PI2A 1K9MC 1MJCA 1P16A 2F52A 4A3JH 2VZAA 4BY7H 3KFUA 3J7A5 2D62A 3HOUH 1E1TA 2VS1A 3HOYG 4KI0A 3M4PA 2NVXH 2D0PA 4O0AA 1G51A 4RMFA 3FHWA 4GLXA 1IYJB 2WAQE 1PH5A 3BJUA 2PMZE 1W2BA 3RLFA 1PHJA 1CSQA 1HH2P 1QZGA 3T1YQ 3E0EA 1X3FA 4YWKA 2N78A 3S16H 2ZJRA 4IO9A 1FJGQ 4ALPA 4A3GH 4A3MH 4IFDI 4WJ4A 3S1QH 1VQMA 2UU9L 1A63A 1NE3A 3OYYA 5IYCG 1IBLL 4UY8C 2JA5G 1VQHA 1K73C 3PO2H 5C4XG 5GQOA 2A1AA 5IWAL 4A93H 1H95A 1CKNB 4YY3Q 3S14H 1EWIA 1Q7YC 4LF9Q 3K0XA 1UE6A 4YWMA 2UUCQ 2ALYB 2RHQB 3GTMH 3E9IA 4DR7L 4AIMA 2Y0SE 1VQ4A 4JI8L 1SMXA 1N33Q 4AQYL 4DV3Q 4DK3C 1XNQL 4DV7L 5JJKA 1XTDA 2OWOA 1ASZA 4B3SL 3RN5A 3OTOL 2VQEL 5GAGC 2ZTDA 4IPDA 4UP7A 3STBD 1L1OB 4P72A 4DUYQ 3G48A 4DR4Q 4KHPL 3M4QA 1YEZA 3RR5A 4L5QA 2ATWA 2NN6G 2CFMA 4LFCL 1B7YB 2PQAA 4GOPB 1NTGA 1I94L 1JMCA 4AYBE 3PCOB 4DV2L 2E2IH 2B63H 4BBSG 4A3FG 3CQZH 3RZOH 1Z9FA 4GNXB 3U58A 1YI2A 3CD6A 5IY0A 5IYDH 2WAQG 3HKSA 3I2ZA 4DKAC 4KLKA 4A3LH 1MIUA 4JI4L 1LYLA 1K3RA 1YHBA 3D0FA 4GN5A 3J81j 2HHHQ 3WWVA 1WFQA 3F2CA 1C9OA 1D8LA 4JBWA 4LNQA 4UP8A 1VQJA 2KBNA 5IP9G 2R7DA 1Q81C 2R93G 1SFOH 1YJNA 1UE7A 3HOWH 4R1JA 2BH2A 3S15H 3S24A 1BBWA 2UXCQ 1X56A 1CKOA 3H0GG 3ULLA 1HNZL 4JI2L 3FKIG 2UU9Q 2LXJA 2PNHA 4P71A 3GDEA 4MNOA 1IBLQ 3TQYA 1XMQL 2R92H 3PF4A 1OXSC 1T9HA 2JQOA 3AYHB 3PSIA 4L5RC 2I5MX 1U5KA 3K8AA 4ME3A 4QIWE 3G71A 2QA4A 2HT1A 2GVBA 1XJVA 5M5WH 1FVIA 5FLMH 2JA6H 1TWHH 2K52A 3JC66 4UPAA 4DR7Q 2Y0SG 5C3EG 1PFSA 4DK6C 3ERSX 3KLWA 3RNUA 4JI8Q 5GAEC 1TWAH 2ZTCA 3U4VA 4AQYQ 3AFQA 1XNQQ 4DV7Q 1IBKL 1YNXA 4JCVE 4IOCA 1VQ6A 4DAYB 4B3SQ 3OTOQ 2VQEQ 1Q46A 1WCMG 2RCNA 5FLXc 4A3EG 2JA8H 1W3SA 1AH9A 3ER0A 4A3IG 4KHPQ 1VQBA 5IP7G 5JJLA 2ES2A 1YJ9A 1PYBA 2HIVA 3KOJA 5IYBG 4DV4L 4AYBG 1N8RC 1VQ8A 4LFCQ 3I4MG 1PV4A 1KL9A 1N32L 4DV2Q 4JI5L 4YCUA 5AJ3Q 4BBRH 3CC7A 1MKHA 1Z47A 2A19A 1J6QA 4DV0L 2H5XA 3D31A 1ASYA 1Y14B 1PYSB 1JJCB 1NMGA 4NB3A 2XTIA 4JI4Q 4POGA 4LF4L 1L2FA 5IT9c 3K7UC 4GN3B 1HZCA 3U50C 1XMOL 1DGSA 4LUOA 2ZTEA 2FXQA 3CPFA 1OXUA 3HOZG 1N36Q 4DR1L 1XPRA 5M5YH 4X62L 1U0LA 2I5HA 1OTCA 3H3VI 1K83H 4JOIC 1S72A 1PH1A 2IT1A 2K14A 1X3EA 2KCTA 4FDBA 2ZM6L 1HNZQ 2BH8A 1JB7A 4QJFA 2YTVA 1E7ZA 1LUZA 4YCVA 2CWAA 1XMQQ 4IFDJ 4OO1I 1BBUA 4JI6L 5C0XI 2OTJA 1X55A 3HOXG 4J15A 2UUAL 4B3ML 1L1OC 1LM0A 2GVAA 4A75A 4A3CG 3GTGH 1Q8KA 3EN2A 3ZJYC 4HJAA 1VQOA 1KQSA 2VUMH 4A3KH 1PH3A 4JI1L 4HIKA 4HJ5A 1S40A 2AHOB 1PH7A 1M1KC 4GOPC 2R7ZH 4BXXG 1C0AA 3EBEA 1Q82C 3HOVH 1Q12A 4IPHA 1IBKQ 3CP0A 1HR0Q 2KCMA 4GNXC 1V1QA 1KD1C 3L2PA 2JEBI 3ULJA 4OWWB 3BZCA 1PH4A 3DM3A 3T1HL 4DUZL 1KRSA 1VQ5A 1YJWA 2YTYA 2CQOA 2Z0SA 4BA2I 3KF6A 3E9HA 2KHJA 3IRBA 4LF8L 2EXDA 3W5OA 4BY7G 4X64L 5BR8L 4X66L 2VQFL 1N32Q 4JI5Q 3HOUG 4GOPA 1Y1WH 1I6HH 1A0IA 4HIDA 5FJ8H 2C35B 2JA7H 1BVSA 3TS2A 3K81C 4GNXA 4LFBL 1YIJA 2E5LL 4LUVA 5ELNA 4LFAL 2JA6G 1XMOQ 1KHIA 2IHEA 2K5NA 4DAMA 3DLLA 1EFWA 2NVQH 1WYDA 3CW2C 3GTKH 2YYZA 4GN4B 4OXPA 4XIGS 4DR1Q 3I4OA 4X62Q 3I4NH 4A3GG 4A3MG 1SROA
chains in the Genus database with same CATH superfamily
4DR6L 2DY7A 2CW0C 5CV4A 2YTXA 4L6TB 2ID0A 4IURA 4GKKL 2UUBL 4GS3A 4B3MQ 1QVFA 3FPPA 1PLFA 4NXNL 1PH8A 1NSNS 3C46A 2JJQA 4RGNA 1OXVA 4BA1I 4K8JA 1PMRA 3RZOB 3SK5A 4A3DH 4OO1H 4R8NA 3J81i 1BCPB 3V05A 3GV6A 2QEJC 1EIYB 1A6XA 1RJTA 5CBEE 2N8NA 1VQAA 4ZKCB 2J7ZA 5IWAQ 2F1MA 5EPJA 5FO9B 4YHHL 2B63G 1SFOB 3GQBA 3D4DA 2OCEA 3QWNA 1UE1A 3M7GA 4LFBQ 2PQAB 2R92B 1NMFA 1H9KA 1SAPA 1Y1VH 4WFN3 3CAMA 1BR9A 1STHA 4Q0FA 1EYDA 2G9DA 3RN2A 3KDFA 5I9OA 1C7YA 1HFNA 4BY1H 3L0OA 2KVMA 3AMUA 1X54A 4H44C 1I94Q 1PRTC 1EIFA 3DWQA 4JK1C 3ZYYX 2JA8B 1FD7D 3CMAA 3I55A 3F2DA 2K4KA 2DNEA 3U4ZA 1X3GA 5KYLA 5ELFA 4IUQA 2BA0A 2GA4B 1F2ZA 1Q86C 4BBRB 1PYWD 1VS0A 4DV6Q 1RF2D 2D9UA 3PIPA 2EDGA 2XWBB 4KD4A 1K0RA 4JI2Q 3U58A 2ZJPA 2JA9A 1EOVA 1HZAA 1G6ZA 4WJWA 4JYAQ 2K75A 3A7LA 1R4QB 3FVQA 2JK8A 3JAME 1KTKA 5LMNQ 4CDEC 4DR3Q 4DXGA 4HIOA 5HY6A 2B8GA 2RCFA 4GZYC 4H02A 4IJHA 1VQNA 1ESFA 3EJIA 3GTGB 1PFMA 1CZWA 1B50A 1B4OA 1L1OA 2R7ZB 1UWVA 5EAYA 3F1ZA 2HCCA 5CMDA 1E24A 1AW7A 1N9WA 5E1FA 2E8GA 5DEHA 4K14A 2F0EA 1XNRQ 4Y52H 1JC7A 1KAWA 3TBIB 4OIKA 1A3VA 2YV5A 2VUMG 2NN6H 2UXCL 2F0VA 2L0CA 3UDIA 3STBC 4A3FH 1G91A 1STAA 5IGBA 1W6KA 2ZM6Q 1TWFH 3T16A 3M4OH 3B6YA 1IXRA 2A74C 2PQEA 3CPWA 1VQIA 2MNAA 1SN8A 1YVCA 4LW1A 4XXEA 4X65Q 3GTKB 3AEVA 1JORA 1NJIC 3PUWA 1E22A 3BYYB 3H0GH 5FJ8G 2D5DA 2QEXA 1E2WA 1F9PA 3NENA 5J1ZA 2B29A 4DV5Q 2ZXPA 5IGGA 3S1NH 2CW0D 3CC2A 2K7VA 3PF5A 1Q90A 4JI0L 5C3EH 1KXLA 3OW7A 1S3OA 3E6ZX 2MFIA 2BCOA 3EIVA 4X66Q 1KLGD 2XNAC 3BG3A 3CMEA 2VY3A 3LNNA 4CJ1B 1IBMQ 3J80i 1N36L 5LMUQ 3ND9A 4NXMQ 1DZ1A 4RCOA 1A8VA 3I4MH 3W1BA 1A62A 2NZHA 1SNPA 5M5XB 4NW2A 1YHQA 1AZPA 4ZQ3A 5K36G 5EKLA 4RGOS 2R6GA 2A68D 5C0XG 3R2IA 1IL2A 2F3IA 2IX1A 1UUPA 2MO0A 2EY2A 4LF6Q 2L11A 1JOKA 2O5IC 4Y7NH 1IZ6A 3P75A 3SK8A 4JBJA 1DOKA 1PA6A 4RCNA 4JI7Q 2UXBQ 4XTCS 1JE5A 3NXWA 3EROA 4A3CH 3F2BA 3CCUA 3RLOA 4BXXH 4KK7A 1CKMA 4DV3L 3HKZG 3HOYB 1EZ8A 3FP9A 3UI2A 3CCEA 4K0KQ 4G7HC 4G4KA 3PMFA 2Z6KA 2B3GA 4QF4A 2K5VA 3BZKA 5ELBA 5EGTA 3KFUA 4HR7B 4KI0A 1D1KA 3NTIA 3SK4A 1PXUA 3HGBA 4MIUA 4RAUC 3BJUA 2PMZE 1TWCB 5JPNC 1JR0D 1MSHA 3K7AB 1PHJA 3MXPA 3MXNA 1X32A 2ENBA 3D3RA 1LTBD 1X3FA 3H3VC 2SNMA 3U9OA 2N78A 2EYLA 4IO9A 4A3GH 4IFDI 4JVZA 1A63A 2QCPX 3OYYA 5FLXE 2JA5G 1VQHA 2RQXA 4A93H 1H95A 5G3LF 1EWIA 2ALYB 3MAQA 4AIMA 5E3FA 4JPBW 1VQ4A 1VF5C 4DK3C 4DV7L 3SVMA 4RGTA 2EZVA 1XTDA 2OWOA 1F2MA 3RN5A 2PMZB 4IPDA 3Q24A 3STBD 4DUYQ 1IYUA 1SJED 3BDOA 3OIPA 1PTOF 4U68A 3RR5A 3NPPA 5CC4A 4XQJA 1JMCA 4AYBE 2N88A 4DV2L 4CJ0B 3F2UA 3RZOH 2B2TC 1Z9FA 1ONLA 2WAQG 3HKSA 1YNND 3I2ZA 2SDFA 4KLKA 4UHVA 1MIUA 1QOHA 1WFQA 4XYQA 5J39A 3OWEB 5EPKA 2I07B 1SFOH 1XXGA 3I8ZA 4ZUJA 1HNZL 4P71A 2R92H 1OXSC 1WCMB 2JQOA 3K5OA 1ET6A 1O7ZA 1U5KA 2EYOA 3G71A 4A3IB 2F0SA 1R4PB 4UPAA 4AYBB 4ABNA 4DK6C 1SYCA 3ERSX 3KLWA 5ISRA 4JI8Q 3RNUA 2ZTCA 1BNZA 4EGVA 3LWEA 1XNQQ 3TZDA 1M8AA 3NK9A 4IOCA 5EBCA 4DAYB 1STNA 4C2MB 1Q46A 4TKOB 4A3EG 2JA8H 4BWGB 2WACA 5FK9C 5IP7G 5JJLA 4DNTB 1PYBA 2WIIB 3KOJA 5IYBG 4DV4L 1N8RC 4LFCQ 1PV4A 1H9JA 4BBRH 1MKHA 5A2QE 2EY1A 1Y14B 4CDDC 2XRSD 1NMGA 3HRZC 3KUPA 1UAPA 2SEBD 2BE5C 1E2VA 3K57A 4IALA 1DGSA 5CBAE 3KBXA 3NP8A 2F0PA 2FXQA 1LTRD 5I6WA 1XPRA 3H3VI 3NBIA 2NUCA 1S72A 1I4GA 1PH1A 3QR8A 1F9QA 5C4HA 2E74C 1HQMC 4K5VA 5IT9L 1GHKA 2H1EA 4HEDA 3HOXG 2UUAL 2KOLA 1L1OC 1ILPA 5M9OA 1SE2A 3GTGH 1Q8KA 1VQOA 1PH3A 4HIKA 1F2LA 4GOPC 2R7ZH 4BY7B 2DNCA 3EBEA 4K6DA 1Q82C 4EQPA 1IBKQ 2C5CA 4RGMA 2KEDA 4DU9A 4GNXC 1CZGA 2JEBI 4QUFA 4B9XA 2OT2A 4KKUA 2E75C 2PW5A 4RHRA 4DUZL 4A3KB 1B3QA 4F7XA 1CTMA 4LF8L 3D6WA 4X64L 5BR8L 2VQFL 3S16B 3HOUG 5FOBB 1O7LA 3VYRA 4HIDA 2LY7A 3TS2A 4C56C 5I2XA 1GUSA 3SK6A 2CH4W 2LMCB 2PO4A 4LFAL 1KHIA 3S14B 2VB3X 3CW2C 3GTKH 3T53B 4IUTA 5EBDA 4A3MG 4QB4A 4QQBX 1QVGA 1HNXL 4B3RL 3PO2G 3G7LA 3CCJA 4GLVB 3TMEA 5H1SE 4DNRB 3BYTB 4L5TA 1ZYRD 1B70B 2BOSA 1J9OA 4DK1A 1PVOA 2F0DA 4M8AA 2Z4IA 1MBYA 5C5LA 2B63B 3IAYA 4A4IA 1SNQA 4XYOA 1RTNA 1D7QA 3N52A 1D5XC 1LLRD 1LTSD 2KUMA 2PPBC 1BCPF 2DJFC 4R4TA 4DAYA 3CCLA 5L37A 3KJPA 3R93A 4IUVA 4EQNA 3MXUA 3IL8A 3TSSA 1RD9D 2H4OA 3L9AX 1HUNA 5M5XH 3J7AF 3TRZA 2HUGA 3JAMc 5DM73 3H94A 4KHVA 1Q8IA 2V1CC 2K5WA 4A3LG 2E5LQ 4R4CA 2K1BA 1EWHA 3J7AV 4RG1A 3HG9A 2XN9C 5C4ZA 4QCLA 3M9BA 4PMWA 5M5WB 1X65A 4DR5L 2D0OA 4C3IH 2EIFA 1RODA 1EZ6A 4F88A 3T13A 5CV5A 1F77A 1SSOA 1UEAB 2D2CC 2N49A 5LMNW 1QJOA 4GKKQ 2UUBQ 1B53A 5FLMG 2F0KA 4IUPA 5C0XJ 4NXNQ 3W1GA 4IFDG 3G6EA 3W3AA 3RD4A 5DLQE 4N9TA 5JJIA 4P75A 3HOYH 1DXMA 1HTPA 2MPMA 2RKSA 4LF7L 3PUXA 4OWTB 5LHY1 3OOCA 3J81E 2EYHA 2RDHA 1KIXA 5KNBA 3I90A 1PZKD 2K32A 2WFWA 1AP0A 1Q1EA 2KHSA 3F8TA 5CV7A 3MXGA 1HZ9A 1SRUA 2BE5D 2VNUD 3ERQA 2AMCB 1A2UA 2OF1A 2UXDL 3SDZA 3C3LA 4RKBA 4JW0A 1RDPD 5C4XH 1TWCH 4K5WA 3K7AH 2L5TA 1EY5A 4CKBA 2VUMB 1AEXA 4IOAA 3KYHC 1B1ZA 1GD7A 4K2KA 1OXTA 2I0QA 2EVBA 2HHHL 4JG2A 3ND8A 4P74A 3SEBA 4DV0Q 3BU2A 1LT5D 1VQ7A 2IWHA 1C48A 3CCSA 4HIMA 4LF4Q 4LUZA 1BQQT 4A3KG 1HFGA 4OONA 2ZJQA 1SYEA 2QGQA 4NKLA 1B3AA 3HOVG 1Z6HA 4DXFA 1NNXA 3GO5A 2WKCA 1QVCA 4N9PA 2OXPA 2P5ZX 3VYUA 4FF2A 4FYDA 3IFDA 4JI6Q 5IP9H 1M90C 2VL6A 1Y1WG 2JA7G 4IPGA 4JI3L 5JEAG 3RZDB 2ICEC 5C5MA 3KF6B 2Q8IB 2FFKB 5IGCA 5AJ3L 1X3QA 3K6OA 3M4YA 4P2CB 3T1HQ 3KLSA 3I4NG 2K04A 2A68C 4POFA 5KNCA 1QILA 5KNDA 2IX0A 3HKZE 4QL5A 5C44G 3SGIA 4JC0A 1WCMH 4A3BG 4A3IH 2M2LA 1DYQA 1ML0D 1Q3LA 3MA2B 1C8CA 1P8LA 4JV5L 1V43A 4QUCA 4L63B 4PZ8A 5M3MG 3CXCA 1PH2A 3OPOA 4H13C 4DNIA 2FMCA 4CDCC 3JAML 1KC8C 1YBYA 1KAAA 4TQUS 2R61A 4C2MH 4DK0A 3TREA 1SE4A 2F0LA 2Q2TA 5EQ0A 3RUZA 1R9TB 4R4QA 2K5HA 2HD3A 3S1RB 4RKLA 1HRJA 3PGZA 4ID6A 4ZKBB 3T1YL 3TS0A 1CFMA 2QKIC 5GAHC 1GUWA 2WB1G 3FMCA 2AWNA 4YCWA 3HKZB 1TY2A 1EUJA 1I5FA 1ET9A 4KJNA 3MEFA 3VR5A 4FO2A 5JOBA 4YY3L 1UE5A 3K80C 4UAIA 1SLJA 3NQIA 4JI0Q 2F03A 2RHSB 2F4VQ 3DUZA 3H09A 1HR0W 3GD7A 3PQIA 3S17B 1KABA 2NVTB 2LXKA 3VR2A 4IJLA 1TWGH 4KTAA 1O7IA 1LT3D 3AFPA 2DN8A 1TS3A 2LFNA 3J80E 4FF4A 1P16A 2F52A 2AUKA 5ELCA 4BY7H 3D8GA 2E2HB 4G7ZC 2VS1A 5T1IA 1GUGA 4C3HG 3OMGA 1G51A 4I7ZC 1TR5A 2WAQE 2JSOA 1I6VC 2JA5B 1TKWB 4IUNA 3P7JA 1CSQA 1STEA 5CR3A 3FDTA 3A8KE 3EVQA 4I7AA 3E0EA 1PRTF 1GXDC 3S16H 2ZJRA 1FJGQ 1BUVT 4ALPA 3KK7A 1PDQA 2NVYB 3GTQB 1FYCA 3WOFA 5IYCG 1GJXA 1J8IA 1QCBD 1S5CD 5HURA 5GQOA 5IWAL 1CKNB 3S14H 4LF9Q 3CRLC 4YWMA 2UUCQ 1K3BC 1PTOH 1S5BD 3E9IA 4DR7L 1NR4A 1I3QB 5IOCA 1YNNC 1JB3A 4AQYL 4DV3Q 2EJGC 4ZLTF 3NHHA 5JJKA 2E2JB 2WAQB 3OTOL 2VQEL 5GAGC 4KY5A 3I70A 2WKDA 2V4DA 3X3NA 4N8X1 2L12A 3M4QA 1NUCA 1YEZA 2RDGA 2WINB 2CFMA 2PQAA 4L8JA 1I94L 2B63H 4BBSG 4C3JG 4XT3B 1I50B 1JCKB 1EY6A 1WTOA 4DKAC 1BXTA 4X3UA 1EY9A 1LYLA 3J81j 1S5DD 3WWVA 5JAVA 1C9OA 4HN7A 4JBWA 4LNQA 1QWYA 2KBNA 3GTLB 2R7DA 1YJNA 1UE7A 4R1JA 2BH2A 3EQLC 2E76C 1X56A 3ULLA 1I4HA 3DMUA 4JI2L 1LT6D 3BZDB 3FKIG 1U4PA 2LXJA 1D6EC 1XMQL 5CV8A 1CT1D 4A3EB 4L5RC 5CV9A 4QIWE 5JVG3 2GVBA 3DWAA 1XJVA 5M5WH 2MUYA 2K52A 2RA4A 4HSPA 3NWTA 2NTTA 2Z4HA 3AFQA 3SHLA 4DV7Q 5I4DA 1YNXA 3HS0C 4XT1B 5M3FB 3EA6A 1H9SB 1AH9A 3ER0A 5DAUA 1EU3A 1EWCA 1D2BA 1VQ8A 1KL9A 4DV2Q 3CC7A 1Z47A 2A19A 3S1MB 3D31A 5FLXL 1CHQD 4ZRZA 5C4JB 4NB3A 1TU2B 5C3WA 2XTIA 4O42A 1JQYD 4POGA 4QIWB 5IT9c 2B2WA 1HZCA 3HOXB 1D1IA 3OMCA 2Z8LA 3VYTA 3CPFA 3QIAA 4G57A 4DR1L 4X62L 2I5HA 4F87A 2K01A 2ZM6L 2G5DA 4HTHA 1HNZQ 1ZKOA 1E7ZA 1ENFA 3NE5B 4RHSA 2QDBA 4DFAA 4IFDJ 1M4VA 2IL8A 4ULLA 4OO1I 1X55A 3VA7A 5F2DA 4FXKC 4LAAA 2GVAA 4HMIA 1RCVD 2NTSA 2VUMH 1LTGD 3A54A 4JI1L 4HJ5A 1PH7A 2AHOB 1PRTB 3HOUB 5EKIA 4FXDA 4IPHA 1HR0Q 2NVXB 2EYMA 1NR2A 2KCMA 2G9HD 5IGFA 1JWUD 3L2PA 4PQXA 3BZCA 1PH4A 4OL7A 3DM3A 1VQ5A 1XWEA 2CQOA 2B2YC 3IRBA 1VMPA 5EPLA 4X66L 1T5XD 4A3MB 5FJ8H 1CK1A 1DD2A 1ZYRC 4PMCA 3PO2B 2IHEA 3W2DA 1EFWA 4FP5D 1QNUA 5E4XA 3GTMB 4XIGS 4X3SA 1TQOA 3VR3A 1E1OA 1EYCA 3RZDH 1ICWA 1N34L 4YWLA 3I7FA 2A69D 1BKBA 5C6AA 2PZUA 4QMGA 3PIO3 3A55A 2UUAQ 1PH6A 3KF8B 1IW7C 4C1NK 3UDFA 2KECA 3MVVA 2E2IB 2KJXA 2DY8A 3CQZB 1K8GA 1QUQB 1V8QA 5K36H 5A2QL 4PZ7A 5C0XH 3H91A 3J81c 4NP5A 3A5UA 2RF4A 1X9NA 3VYSA 2C9OA 4DUZQ 4KY7A 1LABA 1J5EL 4J8QA 5JEAJ 4APVA 4FF1A 1TS2A 4KN4C 4LF8Q 5BR8Q 2DJGC 5I2YA 4X64Q 2KCCA 2VQFQ 1VQCA 3S15B 1SE8A 2FINB 3U9SA 2PCFB 5IYDG 4A76A 5DNFA 1R9TH 5FKAC 3MFYA 1XPOA 4LFAQ 3FRPB 5A35A 4XDXA 5C3XA 4HMJA 1PFBA 2I46A 3HOWG 2NN6I 1TWAB 4H7BA 4LF5L 1HNXQ 5EJWA 1JOOA 1LTLA 1QNKA 2OQKA 2IHFA 5M3FG 2JA6G 3Q8DA 4B3TL 5IODA 1YZ6A 4O2DA 4GKJL 1O80A 2L15A 4F8MA 1HZBA 3Q22A 4DR2L 1VQEA 4RH6A 2SNSA 3S17H 1OXXK 1DJRD 2NVTH 2F0OA 3OHXC 2HQLA 1G6PA 1NCVA 2K50A 5ELDA 4QY7A 4WORA 1HTLD 4MTNA 1XTCD 2QF7A 3M7NA 2OTLA 1FGUA 3LGJA 2E2HH 1KDAA 5G3LD 4KHZA 1BOSA 2F0WA 2A6EC 1JWSD 4DUYL 3CU7A 3KLRA 2JA5H 1F2YA 2BA1A 2K5DA 1VQPA 2KENA 4HCSA 1W6JA 2X6GA 4K6LA 2Q8TA 1SDFA 3QOLA 1PZJD 4DR5Q 1ZEQX 2XWJB 1FNVA 3A74A 3NEMA 1STGA 1VQKA 4WRDA 3HOVB 1PTOD 4ZK9B 2NVYH 3E3XA 3GTQH 1B2TA 1PH9A 1BCPC 4OEMB 4KN7C 2IY5B 2F0UA 3I72A 4JBMA 2DGYA 4NPSA 1CHPD 1ZXTA 1I3QH 3KF8A 4UP9A 1DONA 1S5FD 4EX5A 3A56A 1Y1WB 1H9RA 4OX9L 3OW2A 2JA7B 4ZCKA 2E2JH 4LF7Q 2DUDA 1IYVA 1QUQA 3NELA 1SNOA 4M1UB 3VA5A 1YITA 2JXMB 4HJ7A 3ULPA 4PZ6A 1VQ9A 2NVQB 3D4RA 1U9RA 1II3A 1IKMA 3CCVA 1HNWL 2HIXA 3L3OC 2WB1E 4DV1L 3I4NB 1SR3A 1I50H 3M3YB 3UE0A 2UXDQ 1JJGA 1Y8PB 2F0NA 5E7NA 5C44B 5GROA 1SBBB 4Q5VA 1KDBA 1VQDA 1GM5A 4CBVA 2LKVA 4A3BB 2R93B 2AQ2B 5ELOA 3GTLH 3L7ZC 5M3MB 1BF4A 4DPGA 2RBMA 2AWOA 3DWPA 4EQOA 1TXYA 1IW7D 2K6AA 2Q2IA 4K8IA 3CRKC 3J81L 4A3EH 2XVSA 1Y69U 1V1PB 3J80c 5IP7H 2K5QA 1YHAA 3BVZA 4TVAB 5IYBH 5E4WC 3K0YA 2WB1B 1QZHA 1RL2A 4FVMA 4A3DG 1EQRA 4OO1G 2CQAA 1VQGA 2QW7A 3I56A 5M3FH 4DR6Q 2CWPA 1F9RA 5CYUA 3A0JA 2PW7A 4B9WA 3NTHA 2EYFA 3DHQA 2MQHA 3TP6A 3PUZA 3CCRA 3TDQA 1Q1BA 4DAPA 3S1MH 4JI3Q 2B2WC 4CJ2C 4AH6A 3S2HB 5C4JH 2Z6KC 1DOMA 3QO2A 1XX8A 1Y1VG 3HOXH 3HOZB 4QGUA 1KNAA 2EY6A 2XRQD 4P73A 1VQFA 2B39A 1TVXA 1K28A 3N6RA 4BY1G 3GTJB 1N33L 2B2UA 4C3HB 4YHHQ 1FL0A 1DCZA 3KDFB 1CQFA 2A73B 3MWYW 1EU4A 4X6AH 4DR4L 3T56B 3S2DB 4JV5Q 3I91A 1MJCA 5JVH3 1K9MC 5D14A 4IQZA 2D62A 3HOUH 5KGUA 5K5PA 3M4PA 2NVXH 1EEID 1WTVA 4RMFA 3FHWA 1PH5A 3HEJA 2RSOA 1W2BA 2YU9B 1K8OA 4ZYSA 2A6ED 1HH2P 1SYGA 3T1YQ 1WTXA 4YWKA 1EY4A 3H6MA 1I4RA 4A3MH 1EL0A 1VQMA 2UU9L 1NE3A 1IBLL 5IGEA 1WTWA 4UY8C 3E0JA 1K73C 3PO2H 2A1AA 1SNDA 4YY3Q 3K0XA 2RHQB 3GTMH 5EKKA 1BCPD 2L9HA 1SMXA 4BBSB 4C3JB 1KDCA 4KJOA 2IPKD 1E2ZA 4B3SL 3BS1A 1PZID 2BDNA 2ZTDA 4UP7A 5CGKA 1L1OB 3G48A 4KHPL 3IKJA 4KV6A 3NTKA 4CKEA 1EIGA 4L5QA 1CA6A 2NN6G 1SMYD 4GOPB 1NTGA 2E2IH 4A3FG 3CQZH 2M00A 3TZUA 4GNXB 3CD6A 1YI2A 3FKIB 5IY0A 4TSSA 1IKLA 3Q23A 4A3LH 4JI4L 3PIP3 1YHBA 5BN3A 2MGSA 1SYFA 1D5MC 1I4PA 5KYIA 1D8LA 4B08A 3DM1A 1Q81C 2R93G 2HQEA 3S15H 3S24A 1BBWA 3WDNA 4UDUC 3H0GG 4FF3A 2UXCQ 1O7YA 2B2TA 3QB3A 2PNHA 3GDEA 4MNOA 3TQYA 3PF4A 1T9HA 3AYHB 3C1FA 4X3KA 3PSIA 2I5MX 1JWMD 3K8AA 2HT1A 1CM9A 3J80L 5FLMH 2HCIA 5TSSA 4DR7Q 1STBA 1TIID 2Y0SG 2K33A 5C3EG 4IFDH 1WD1A 3I3CA 5GAEC 1TWAH 1Z7TA 1FR3A 3U4VA 4AQYQ 1O78A 1VQ6A 3NWSA 4OIJA 3OTOQ 2VQEQ 1C4QA 5FLXc 4DN4M 1W3SA 3GTOB 2ES2A 3OSOA 1YJ9A 1EQVA 1XYIA 3I4MG 1B9NA 1N32L 4JI5L 4YCUA 5J22A 1J6QA 2HDLA 4DV0L 1SE3A 4OHJA 3K5MA 2MP1A 2F3VA 3SE0A 3PO3B 1JJCB 1MSGA 4LF4L 1ICFB 4GN3B 1XMOL 2ZXRA 4LUOA 5KIXA 1YNJD 1OXUA 3HOZG 1UNSA 1N36Q 3P20A 1GUOA 2IT1A 5HGTA 2KCTA 4FDBA 3GTPB 2BH8A 4QJFA 2F0TA 3AU7A 4ZUIA 3K59A 4IN3A 1XMQQ 2ICIA 2JN4A 1BBUA 3QOJA 4JI6L 1AFPA 1S5ED 4OELB 4J15A 3BDLA 4B3ML 1LM0A 5FO8B 1HA5A 4A3CG 3ZJYC 4HJAA 1KQSA 4A3KH 4A3JB 1S40A 1RTOA 2EYJA 4BXXG 1C0AA 3HOVH 4ILWA 4Z9CB 3A7AB 3AB9A 3R8BA 4OWWB 4U673 2K05A 3T1HL 1KRSA 1DM0B 5D3IB 2F3WA 3KF6A 4CKCA 2KHJA 2XSCA 4GOPA 1Y1WH 4RA8A 1VMCA 2A69C 1GHJA 3S1QB 2JA7H 3K5NA 5JEAH 4R9WA 1BVSA 4MHEA 4GNXA 4LFBL 2EE1A 3GP7A 3FEWX 1ENAA 3TP8A 3DLLA 2NVQH 4DR1Q 4X62Q 3I4NH 5LL6S 4A3GG 1SROA 2NYZD 3M3YH 3R3OA 3CCMA 3MXNB 2GN5A 5C44H 2QDLA 4A93G 3MFGA 4A3BH 2R93H 2WP8J 4HJ8A 3H3VH 1HJPA 5M3MH 4KMUC 4JI1Q 1I4XA 4E6IA 2B2VA 2CVRA 5KEEA 4DV6L 3PV0A 1G291 1EQTA 4R4OA 4N8FA 2JEAI 4CGYB 1MGSA 3UDXA 5CV6A 3O13A 5I6YA 4JYAL 3TEHB 2F4VL 3A5ZB 1EFID 3JAMi 3MC0B 2O5JC 1EYAA 3HOWB 1MJEA 2O2LD 2PYKA 3QJYA 1A3TA 5LMNL 1BBXC 4DR3L 1KNEA 2J4XA 3K5LA 2FHTA 1EEFD 1V1OA 2JA6B 1TWHB 1VDZA 1CUKA 4PV1C 2AKWB 1CI3M 2RDFA 2AUJD 2TSSA 4OWXB 1AN8A 1L0XB 1H9MA 1HA6A 3S2HH 4BS9A 1N34Q 2XGTA 2R92G 3Q6SA 2ASBA 1OO9B 1XNRL 3HOZH 1STYA 1WI5A 3SR1A 4C3IB 4YIJA 1FJGL 2B2UC 1VCIA 4KD3A 3GTJH 3J7YW 1CSPA 1E0BA 4C3HH 2CKZB 4CDFC 1Y8OB 3C1EA 1VQLA 1MHWC 4JBKA 3UE1A 4WJ3M 4LF9L 2N55A 1PRTD 2UUCL 2JA8G 1GKHA 4PG3A 5D65A 2PI2E 3WOEA 1LV9A 4C1NI 3PO3G 3S2DH 1J5EQ 3PUYA 4X65L 1HCZA 1EYGA 3NBHB 2KHIA 3AQQA 4PMBA 4LMQD 1PTOC 2AQ3B 5M5YB 4LJZC 4BBRG 1K83B 2Q2HA 1CKNA 5IGDA 2AQ1B 2F0HA 5HGQA 3VDYA 3X3MA 2F4IA 5IYCH 1NY4A 4JOIA 2YU9H 3DEPA 4H0LC 5I9PA 5IE8A 1BO0A 4DV5L 3UDGA 1HHVA 1RKNA 1JJ2A 4EQ5A 1AE2A 2NZOA 1X6OA 2Z1CA 2FJ2A 2EXZA 1WTRA 3D4WA 1V9PA 3ITPA 3VR6A 4A3JG 1K8AC 3CC4A 4DV4Q 5C4XB 1EY7A 4LF5Q 1X3PA 3G6JB 2L55A 2EQSA 2A8VA 3G4SA 2EOTA 1IBML 2X6LA 3HP3A 1KLUD 3NSWA 4B3TQ 1ILQA 5LMUL 4NXML 4GKJQ 1HQRD 3CF5A 4DR2Q 2R7ZG 4BBSH 2F0GA 1T5EA 3Q0AA 4C3JH 1UEBA 1I6HB 3H15A 3SXHA 4ODGA 3MHBA 1U4LA 2SOBA 1F9SA 1ENCA 1RIPA 2QILA 1A15A 3NQTA 4KY6A 3OWFA 4LF6L 4NDXA 3PUVA 1L0WA 3J7ZC 2A6HC 3CCQA 4MTKA 4L5SA 2VW9A 3T51B 3S9WA 4K5XA 3FKIH 1SXTA 1JOQA 3KJOA 2EYPA 4JI7L 2UXBL 3FPUB 1AE3A 3IFTA 4J1MA 4HJ9A 2M9VA 4J6HA 2X69A 1HXYD 4GLAC 2CH4A 1LTTD 2HDMA 2B8FA 3HFZB 3ICEA 4NMZA 2L4NA 4I65A 1H9SA 1IL8A 2RVLA 4MZ9A 1JICA 5GADC 1RHPA 4A3DB 1LTAD 4K0KL 3EFXD 1LT4D 1GO3E 2LSSA 2WV6D 4R8IA 4HCEA 4LWCA 4R4IA 1B8AA 1NBWA 3VR4A 3S1RH 1TS5A 3MEHA 4KKTA 4OX9Q 2JE6I 2Q8RE 1EQQA 5JJZA 3KLSX 3CHBD 4V190 2EPBA 4PNYA 2VXWA 1LACA 1Y1VB 3GTOH 4B3RQ 4IZ8A 3RMHA 1JT8A 4MN3A 2Q2UA 1HR0L 1XPUA 3D6CA 1MI2A 1WJJA 2CHBD 1HNWQ 4BY1B 4DV1Q 3NBHA 2BDOA 3PIOA 1AZQA 2OQ0A 5J3BA 3PO3H 5ELEA 1E3PA 2NWGA 2FMMA 5D3DA 4XQQA 2XIWA 4X3TA 2MO1A 4KKSA 1WOCA 1HPCA 2L1BA 2N3SA 1L0YB 1QE6A 2R7FA 5COYA 4IPCA 1GVPA 3BVGA 1CQVA 1KRTA 4C3IG 2MHVA 3M85A 2I5LX 1B9MA 3GTPH 1WD0A 3DXJC 2CCZA 2ZXOA 2PZWA 3BDCA 1LTID 4FXGC 2PI2A 1FGBD 4A3JH 2VZAA 4HSVA 2R3ZA 3J7A5 4G7OC 1E1TA 3HOYG 1G2SA 4DAVA 3CKIB 2D0PA 4O0AA 3NUCA 1TWGB 3LWUA 4GLXA 1IYJB 2F0IA 1GOZA 2KQ3A 4OGQC 3RLFA 3MTSA 1QZGA 1I4QA 2MJ8A 4WJ4A 3A8IE 3C2PA 3S1QH 1SNCA 4LK1C 5T1GA 1EY0A 5C4XG 3HZXA 5DM63 1SMYC 1EY8A 1SYBA 1Q7YC 1UE6A 1G8ZD 2EJMA 4CHTB 3TP5A 2Y0SE 1SNMA 3V2TA 4XQNA 4JI8L 1N33Q 4FNFA 4V0BA 2J0TD 5AFWA 4A3FB 1GUTA 3I73A 2Z9HA 2K28A 3K58A 1XNQL 1VF7A 4S3SA 2E2DC 1ASZA 5IT9E 1U4MA 1SJHD 1TWFB 3OIQA 1PTOB 4P72A 4DR4Q 3M4OB 2B2VC 3TP7A 1HUMA 4TRDA 1QG7A 2ATWA 4LFCL 1B7YB 1S4ZA 2RSNA 4K2LA 1MD2D 1TT2A 3PCOB 3KBGA 1G2TA 2F0QA 3H0GB 1WTQA 1ESRA 5IYDH 3ONAB 3R2TA 2A6HD 3V96A 1K3RA 2F0FA 3D0FA 4GN5A 2HHHQ 3URYA 3F2CA 3S1NB 4UP8A 1VQJA 5IP9G 1D5ZC 2Y0SB 5C3EB 2F0JA 3HOWH 1K0SA 2NB0A 1CKOA 2LS01 2UU9Q 1IBLQ 1FNUA 1TY0A 3DEOA 2NZ1D 1LO5D 2QA4A 4ME3A 3BVMA 2IW3A 1FVIA 1NAPA 2JA6H 2Z6BA 1TWHH 3JC66 4ME5A 1PFSA 3I4MB 1GUNA 5BN4A 1IBKL 2ZT9C 4JCVE 3LX0A 4B3SQ 1FNWA 1PFNA 1WCMG 2RCNA 4EVOA 1YNJC 4A3IG 4KHPQ 1VQBA 1B44D 2EY5A 2HIVA 3GV3A 4AYBG 4Y7NB 2F0MA 5AJ3Q 1IHZA 1CA5A 2H5XA 3T4AC 3MZ5A 1ASYA 2VB2X 1PYSB 4JI4Q 3I4LA 2JYOA 2PNRC 1L2FA 1K8MA 3K7UC 3U50C 4O1NA 2ZTEA 5NUCA 1EIHA 1TS4A 2JP1A 2IJ0A 4DF7A 1OTCA 5M5YH 1U0LA 1K83H 2KA7A 4JOIC 2K03A 2K14A 1X3EA 1JB7A 2YTVA 1LUZA 4YCVA 5CORA 1SYDA 2CWAA 1WVLA 1A3UA 5C0XI 2NBFA 2OTJA 2KEEA 2EJFC 1JE4A 4DA2A 4A75A 3EN2A 3TN2A 5BN5A 1Y8NB 1M1KC 4DGZA 5LL6X 1U4RA 4ZAIA 1Q12A 3CP0A 4RWSC 1BDOA 5JPMC 1V1QA 2OEOA 1WTPA 1KD1C 3ULJA 3E5SA 4IUUA 1YJWA 2YTYA 5IIFA 1A2TA 2IX3A 2Z0SA 4BA2I 3E9HA 1QB5D 2EXDA 3W5OA 2O4XA 4BY7G 5FO7B 1N32Q 2TMPA 4RFBA 4JI5Q 4A3GB 1I6HH 1A0IA 2C35B 1WTHA 2PZTA 1EOTA 3K81C 4HAEA 2A5HA 1YIJA 2E5LL 4LUVA 5ELNA 1SEBD 4A93B 1XMOQ 1DOLA 2K5NA 4DAMA 2KCNA 1WYDA 2B2YA 2YYZA 3A8JE 3P1HA 4GN4B 4OXPA 5KRUA 3I4OA 3QG1A 1V1PA 3RLNA
chains in the Genus database with same CATH topology
1E1OA 4DR6L 3M3YH 4QQBX 3CCMA 1QVGA 3RZDH 3MXNB 2GN5A 5C44H 1HNXL 1N34L 4YWLA 3I7FA 4B3RL 2YTXA 1BKBA 3PO2G 2ID0A 3CCJA 4GLVB 4A93G 5H1SE 4GKKL 2UUBL 4A3BH 2UUAQ 4GS3A 2R93H 4L5TA 1PH6A 4B3MQ 2WP8J 3KF8B 1B70B 4HJ8A 1PVOA 1QVFA 3H3VH 1HJPA 4NXNL 3UDFA 5M3MH 1PH8A 2JJQA 4JI1Q 1OXVA 4BA1I 4A4IA 1K8GA 1QUQB 4DV6L 4A3DH 3PV0A 4PZ7A 3J81i 1G291 1D7QA 3J81c 3A5UA 4R4OA 2RF4A 1X9NA 1EIYB 4R4TA 3CCLA 2JEAI 3KJPA 2N8NA 1VQAA 3UDXA 4DUZQ 4JYAL 1J5EL 3TEHB 2F4VL 5JEAJ 5IWAQ 3A5ZB 4APVA 5M5XH 3JAMi 4LF8Q 3TRZA 4YHHL 5BR8Q 4X64Q 3JAMc 2VQFQ 2B63G 1VQCA 1SE8A 2OCEA 1MJEA 2V1CC 5LMNL 5IYDG 4DR3L 1UE1A 4A76A 4LFBQ 2PQAB 4A3LG 1NMFA 1R9TH 2E5LQ 1XPOA 4R4CA 1Y1VH 4LFAQ 4RG1A 3CAMA 3M9BA 4PMWA 1X65A 3RN2A 3KDFA 4DR5L 2D0OA 1C7YA 1CUKA 4C3IH 2AKWB 2EIFA 3L0OA 4BY1H 3HOWG 2NN6I 1X54A 4OWXB 1I94Q 1EIFA 4LF5L 1HNXQ 3S2HH 1N34Q 2XGTA 2R92G 1LTLA 2N49A 5LMNW 2ASBA 2OQKA 1XNRL 3HOZH 2UUBQ 3CMAA 3I55A 4GKKQ 1WI5A 2IHFA 2K4KA 3F2DA 5M3FG 3U4ZA 3Q8DA 5FLMG 4B3TL 1X3GA 1YZ6A 4O2DA 4NXNQ 1VCIA 5C0XJ 1FJGL 2L15A 3W1GA 4IFDG 1HZBA 2BA0A 4GKJL 3GTJH 3G6EA 4DR2L 1CSPA 1VQEA 5DLQE 1Q86C 5JJIA 4P75A 4C3HH 3HOYH 2CKZB 1VS0A 4DV6Q 3S17H 3PIPA 1VQLA 1OXXK 4LF7L 4JBKA 2NVTH 3PUXA 4OWTB 3UE1A 4WJ3M 4LF9L 2HQLA 2UUCL 2JA8G 1K0RA 2K50A 1GKHA 4PG3A 4JI2Q 4QY7A 2ZJPA 2JA9A 1EOVA 2PI2E 1KIXA 3PO3G 3S2DH 4MTNA 1HZAA 4JYAQ 1J5EQ 2K75A 2WFWA 3PUYA 4X65L 1Q1EA 3NBHB 1EYGA 2KHIA 3AQQA 3F8TA 3M7NA 2OTLA 1HZ9A 1FGUA 2JK8A 1SRUA 3LGJA 4BBRG 2Q2HA 2E2HH 1CKNA 2VNUD 4KHZA 2AMCB 5HGQA 3VDYA 5LMNQ 2UXDL 4DR3Q 4DUYL 5IYCH 4HIOA 1NY4A 4JOIA 2JA5H 5C4XH 2BA1A 2YU9H 1TWCH 5HY6A 1VQPA 2KENA 5IE8A 4DV5L 3UDGA 4H02A 3K7AH 4IJHA 3RLNA 1JJ2A 1VQNA 4EQ5A 1AE2A 2NZOA 1X6OA 4DR5Q 4IOAA 1V9PA 3KYHC 3A74A 1L1OA 3NEMA 1GD7A 1UWVA 4A3JG 1K8AC 3CC4A 4DV4Q 1VQKA 1OXTA 5EAYA 2I0QA 3F1ZA 2NVYH 1E24A 3GTQH 1N9WA 4LF5Q 2HHHL 2E8GA 2EQSA 4JG2A 4P74A 3G4SA 4DV0Q 1PH9A 1IBML 2A8VA 3BU2A 1XNRQ 2IY5B 4Y52H 1KAWA 1VQ7A 4JBMA 3CCSA 2DGYA 2YV5A 4B3TQ 4HIMA 4NPSA 5LMUL 4LF4Q 4NXML 2VUMG 4LUZA 4GKJQ 4A3KG 2UXCL 1I3QH 4UP9A 3UDIA 3CF5A 4DR2Q 3STBC 2R7ZG 4BBSH 4OONA 4A3FH 2ZJQA 2QGQA 4C3JH 4EX5A 1UEBA 3HOVG 4OX9L 3OW2A 4LF7Q 2E2JH 2DUDA 3H15A 1QUQA 3GO5A 3NELA 2ZM6Q 1TWFH 1YITA 1RIPA 3M4OH 1QVCA 3B6YA 1IXRA 4HJ7A 3ULPA 3CPWA 1VQIA 4PZ6A 2MNAA 1VQ9A 4JI6Q 4LF6L 1SN8A 1YVCA 3PUVA 4LW1A 1L0WA 5IP9H 4X65Q 3J7ZC 3CCQA 3CCVA 1M90C 3AEVA 2HIXA 1HNWL 4L5SA 2WB1E 4DV1L 2VL6A 3PUWA 2VW9A 1Y1WG 1E22A 1SR3A 1I50H 3H0GH 5FJ8G 1NJIC 2QEXA 3FKIH 4IPGA 4JI3L 3UE0A 5JEAG 2JA7G 2UXDQ 1JJGA 3KJOA 5E7NA 3KF6B 5GROA 1VQDA 4JI7L 3NENA 2UXBL 1AE3A 1GM5A 4HJ9A 2B29A 4DV5Q 4GLAC 3S1NH 5AJ3L 3CC2A 5ELOA 3HFZB 3L7ZC 3PF5A 4JI0L 3GTLH 4DPGA 5C3EH 3T1HQ 3ICEA 1KXLA 1S3OA 2AWOA 3I4NG 2MFIA 4POFA 4MZ9A 5GADC 2IX0A 3HKZE 1TXYA 4QL5A 4K0KL 3EIVA 4X66Q 1GO3E 5C44G 2LSSA 3SGIA 4JC0A 3CMEA 2VY3A 1WCMH 2Q2IA 4A3EH 1IBMQ 4LWCA 4R4IA 3J80i 4A3BG 4A3IH 3J80c 1B8AA 1NBWA 1N36L 5IP7H 1P8LA 4JV5L 1V43A 1YHAA 4PZ8A 4TVAB 5M3MG 3CXCA 5LMUQ 5IYBH 1A8VA 3S1RH 1PH2A 4NXMQ 3I4MH 3W1BA 4DNIA 1A62A 2NZHA 1QZHA 1RL2A 1YHQA 4A3DG 5K36G 1EQRA 1KC8C 4OO1G 1YBYA 4OX9Q 2JE6I 2R6GA 1EQQA 4TQUS 5C0XG 4C2MH 1VQGA 1IL2A 3I56A 3TREA 2F3IA 2Q2TA 5M3FH 2IX1A 2MO0A 4DR6Q 2CWPA 4R4QA 2K5HA 3GTOH 4B3RQ 3A0JA 3PGZA 4LF6Q 1JT8A 3T1YL 4Y7NH 3TS0A 2Q2UA 1HR0L 1XPUA 5GAHC 1WJJA 2WB1G 1HNWQ 1IZ6A 4DV1Q 2MQHA 3PUZA 3CCRA 1Q1BA 2AWNA 4YCWA 3PIOA 4JBJA 1EUJA 1I5FA 2OQ0A 4JI3Q 3S1MH 5J3BA 3PO3H 4AH6A 5C4JH 1E3PA 3MEFA 2Z6KC 1PA6A 4JI7Q 2UXBQ 4XTCS 1JE5A 1Y1VG 4YY3L 3HOXH 2MO1A 4QGUA 1UE5A 3K80C 4A3CH 1SLJA 1WOCA 2N3SA 4P73A 1G6PA 3F2BA 1VQFA 4JI0Q 2R7FA 3CCUA 4IPCA 1GVPA 1KRTA 3RLOA 3M85A 2RHSB 4BY1G 1N33L 2I5LX 4BXXH 2F4VQ 1CKMA 4DV3L 3HKZG 1HR0W 3GD7A 3CCEA 3FP9A 3GTPH 4YHHQ 1FL0A 4K0KQ 2CCZA 2LXKA 3KDFB 4IJLA 2Z6KA 2B3GA 1TWGH 1O7IA 4X6AH 4DR4L 3AFPA 2K5VA 4JV5Q 3BZKA 2PI2A 1K9MC 1MJCA 1P16A 2F52A 4A3JH 2VZAA 4BY7H 3KFUA 3J7A5 2D62A 3HOUH 1E1TA 2VS1A 3HOYG 4KI0A 3M4PA 2NVXH 2D0PA 4O0AA 1G51A 4RMFA 3FHWA 4GLXA 1IYJB 2WAQE 1PH5A 3BJUA 2PMZE 1W2BA 3RLFA 1PHJA 1CSQA 1HH2P 1QZGA 3T1YQ 3E0EA 1X3FA 4YWKA 2N78A 3S16H 2ZJRA 4IO9A 1FJGQ 4ALPA 4A3GH 4A3MH 4IFDI 4WJ4A 3S1QH 1VQMA 2UU9L 1A63A 1NE3A 3OYYA 5IYCG 1IBLL 4UY8C 2JA5G 1VQHA 1K73C 3PO2H 5C4XG 5GQOA 2A1AA 5IWAL 4A93H 1H95A 1CKNB 4YY3Q 3S14H 1EWIA 1Q7YC 4LF9Q 3K0XA 1UE6A 4YWMA 2UUCQ 2ALYB 2RHQB 3GTMH 3E9IA 4DR7L 4AIMA 2Y0SE 1VQ4A 4JI8L 1SMXA 1N33Q 4AQYL 4DV3Q 4DK3C 1XNQL 4DV7L 5JJKA 1XTDA 2OWOA 1ASZA 4B3SL 3RN5A 3OTOL 2VQEL 5GAGC 2ZTDA 4IPDA 4UP7A 3STBD 1L1OB 4P72A 4DUYQ 3G48A 4DR4Q 4KHPL 3M4QA 1YEZA 3RR5A 4L5QA 2ATWA 2NN6G 2CFMA 4LFCL 1B7YB 2PQAA 4GOPB 1NTGA 1I94L 1JMCA 4AYBE 3PCOB 4DV2L 2E2IH 2B63H 4BBSG 4A3FG 3CQZH 3RZOH 1Z9FA 4GNXB 3U58A 1YI2A 3CD6A 5IY0A 5IYDH 2WAQG 3HKSA 3I2ZA 4DKAC 4KLKA 4A3LH 1MIUA 4JI4L 1LYLA 1K3RA 1YHBA 3D0FA 4GN5A 3J81j 2HHHQ 3WWVA 1WFQA 3F2CA 1C9OA 1D8LA 4JBWA 4LNQA 4UP8A 1VQJA 2KBNA 5IP9G 2R7DA 1Q81C 2R93G 1SFOH 1YJNA 1UE7A 3HOWH 4R1JA 2BH2A 3S15H 3S24A 1BBWA 2UXCQ 1X56A 1CKOA 3H0GG 3ULLA 1HNZL 4JI2L 3FKIG 2UU9Q 2LXJA 2PNHA 4P71A 3GDEA 4MNOA 1IBLQ 3TQYA 1XMQL 2R92H 3PF4A 1OXSC 1T9HA 2JQOA 3AYHB 3PSIA 4L5RC 2I5MX 1U5KA 3K8AA 4ME3A 4QIWE 3G71A 2QA4A 2HT1A 2GVBA 1XJVA 5M5WH 1FVIA 5FLMH 2JA6H 1TWHH 2K52A 3JC66 4UPAA 4DR7Q 2Y0SG 5C3EG 1PFSA 4DK6C 3ERSX 3KLWA 3RNUA 4JI8Q 5GAEC 1TWAH 2ZTCA 3U4VA 4AQYQ 3AFQA 1XNQQ 4DV7Q 1IBKL 1YNXA 4JCVE 4IOCA 1VQ6A 4DAYB 4B3SQ 3OTOQ 2VQEQ 1Q46A 1WCMG 2RCNA 5FLXc 4A3EG 2JA8H 1W3SA 1AH9A 3ER0A 4A3IG 4KHPQ 1VQBA 5IP7G 5JJLA 2ES2A 1YJ9A 1PYBA 2HIVA 3KOJA 5IYBG 4DV4L 4AYBG 1N8RC 1VQ8A 4LFCQ 3I4MG 1PV4A 1KL9A 1N32L 4DV2Q 4JI5L 4YCUA 5AJ3Q 4BBRH 3CC7A 1MKHA 1Z47A 2A19A 1J6QA 4DV0L 2H5XA 3D31A 1ASYA 1Y14B 1PYSB 1JJCB 1NMGA 4NB3A 2XTIA 4JI4Q 4POGA 4LF4L 1L2FA 5IT9c 3K7UC 4GN3B 1HZCA 3U50C 1XMOL 1DGSA 4LUOA 2ZTEA 2FXQA 3CPFA 1OXUA 3HOZG 1N36Q 4DR1L 1XPRA 5M5YH 4X62L 1U0LA 2I5HA 1OTCA 3H3VI 1K83H 4JOIC 1S72A 1PH1A 2IT1A 2K14A 1X3EA 2KCTA 4FDBA 2ZM6L 1HNZQ 2BH8A 1JB7A 4QJFA 2YTVA 1E7ZA 1LUZA 4YCVA 2CWAA 1XMQQ 4IFDJ 4OO1I 1BBUA 4JI6L 5C0XI 2OTJA 1X55A 3HOXG 4J15A 2UUAL 4B3ML 1L1OC 1LM0A 2GVAA 4A75A 4A3CG 3GTGH 1Q8KA 3EN2A 3ZJYC 4HJAA 1VQOA 1KQSA 2VUMH 4A3KH 1PH3A 4JI1L 4HIKA 4HJ5A 1S40A 2AHOB 1PH7A 1M1KC 4GOPC 2R7ZH 4BXXG 1C0AA 3EBEA 1Q82C 3HOVH 1Q12A 4IPHA 1IBKQ 3CP0A 1HR0Q 2KCMA 4GNXC 1V1QA 1KD1C 3L2PA 2JEBI 3ULJA 4OWWB 3BZCA 1PH4A 3DM3A 3T1HL 4DUZL 1KRSA 1VQ5A 1YJWA 2YTYA 2CQOA 2Z0SA 4BA2I 3KF6A 3E9HA 2KHJA 3IRBA 4LF8L 2EXDA 3W5OA 4BY7G 4X64L 5BR8L 4X66L 2VQFL 1N32Q 4JI5Q 3HOUG 4GOPA 1Y1WH 1I6HH 1A0IA 4HIDA 5FJ8H 2C35B 2JA7H 1BVSA 3TS2A 3K81C 4GNXA 4LFBL 1YIJA 2E5LL 4LUVA 5ELNA 4LFAL 2JA6G 1XMOQ 1KHIA 2IHEA 2K5NA 4DAMA 3DLLA 1EFWA 2NVQH 1WYDA 3CW2C 3GTKH 2YYZA 4GN4B 4OXPA 4XIGS 4DR1Q 3I4OA 4X62Q 3I4NH 4A3GG 4A3MG 1SROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1O A;  4DR6 L;  3M3Y H;  4QQB X;  3CCM A;  1QVG A;  3RZD H;  3MXN B;  2GN5 A;  5C44 H;  1HNX L;  1N34 L;  4YWL A;  3I7F A;  4B3R L;  2YTX A;  1BKB A;  3PO2 G;  2ID0 A;  3CCJ A;  4GLV B;  4A93 G;  5H1S E;  4GKK L;  2UUB L;  4A3B H;  2UUA Q;  4GS3 A;  2R93 H;  4L5T A;  1PH6 A;  4B3M Q;  2WP8 J;  3KF8 B;  1B70 B;  4HJ8 A;  1PVO A;  1QVF A;  3H3V H;  1HJP A;  4NXN L;  3UDF A;  5M3M H;  1PH8 A;  2JJQ A;  4JI1 Q;  1OXV A;  4BA1 I;  4A4I A;  1K8G A;  1QUQ B;  4DV6 L;  4A3D H;  3PV0 A;  4PZ7 A;  3J81 i;  1G29 1;  1D7Q A;  3J81 c;  3A5U A;  4R4O A;  2RF4 A;  1X9N A;  1EIY B;  4R4T A;  3CCL A;  2JEA I;  3KJP A;  2N8N A;  1VQA A;  3UDX A;  4DUZ Q;  4JYA L;  1J5E L;  3TEH B;  2F4V L;  5JEA J;  5IWA Q;  3A5Z B;  4APV A;  5M5X H;  3JAM i;  4LF8 Q;  3TRZ A;  4YHH L;  5BR8 Q;  4X64 Q;  3JAM c;  2VQF Q;  2B63 G;  1VQC A;  1SE8 A;  2OCE A;  1MJE A;  2V1C C;  5LMN L;  5IYD G;  4DR3 L;  1UE1 A;  4A76 A;  4LFB Q;  2PQA B;  4A3L G;  1NMF A;  1R9T H;  2E5L Q;  1XPO A;  4R4C A;  1Y1V H;  4LFA Q;  4RG1 A;  3CAM A;  3M9B A;  4PMW A;  1X65 A;  3RN2 A;  3KDF A;  4DR5 L;  2D0O A;  1C7Y A;  1CUK A;  4C3I H;  2AKW B;  2EIF A;  3L0O A;  4BY1 H;  3HOW G;  2NN6 I;  1X54 A;  4OWX B;  1I94 Q;  1EIF A;  4LF5 L;  1HNX Q;  3S2H H;  1N34 Q;  2XGT A;  2R92 G;  1LTL A;  2N49 A;  5LMN W;  2ASB A;  2OQK A;  1XNR L;  3HOZ H;  2UUB Q;  3CMA A;  3I55 A;  4GKK Q;  1WI5 A;  2IHF A;  2K4K A;  3F2D A;  5M3F G;  3U4Z A;  3Q8D A;  5FLM G;  4B3T L;  1X3G A;  1YZ6 A;  4O2D A;  4NXN Q;  1VCI A;  5C0X J;  1FJG L;  2L15 A;  3W1G A;  4IFD G;  1HZB A;  2BA0 A;  4GKJ L;  3GTJ H;  3G6E A;  4DR2 L;  1CSP A;  1VQE A;  5DLQ E;  1Q86 C;  5JJI A;  4P75 A;  4C3H H;  3HOY H;  2CKZ B;  1VS0 A;  4DV6 Q;  3S17 H;  3PIP A;  1VQL A;  1OXX K;  4LF7 L;  4JBK A;  2NVT H;  3PUX A;  4OWT B;  3UE1 A;  4WJ3 M;  4LF9 L;  2HQL A;  2UUC L;  2JA8 G;  1K0R A;  2K50 A;  1GKH A;  4PG3 A;  4JI2 Q;  4QY7 A;  2ZJP A;  2JA9 A;  1EOV A;  2PI2 E;  1KIX A;  3PO3 G;  3S2D H;  4MTN A;  1HZA A;  4JYA Q;  1J5E Q;  2K75 A;  2WFW A;  3PUY A;  4X65 L;  1Q1E A;  3NBH B;  1EYG A;  2KHI A;  3AQQ A;  3F8T A;  3M7N A;  2OTL A;  1HZ9 A;  1FGU A;  2JK8 A;  1SRU A;  3LGJ A;  4BBR G;  2Q2H A;  2E2H H;  1CKN A;  2VNU D;  4KHZ A;  2AMC B;  5HGQ A;  3VDY A;  5LMN Q;  2UXD L;  4DR3 Q;  4DUY L;  5IYC H;  4HIO A;  1NY4 A;  4JOI A;  2JA5 H;  5C4X H;  2BA1 A;  2YU9 H;  1TWC H;  5HY6 A;  1VQP A;  2KEN A;  5IE8 A;  4DV5 L;  3UDG A;  4H02 A;  3K7A H;  4IJH A;  3RLN A;  1JJ2 A;  1VQN A;  4EQ5 A;  1AE2 A;  2NZO A;  1X6O A;  4DR5 Q;  4IOA A;  1V9P A;  3KYH C;  3A74 A;  1L1O A;  3NEM A;  1GD7 A;  1UWV A;  4A3J G;  1K8A C;  3CC4 A;  4DV4 Q;  1VQK A;  1OXT A;  5EAY A;  2I0Q A;  3F1Z A;  2NVY H;  1E24 A;  3GTQ H;  1N9W A;  4LF5 Q;  2HHH L;  2E8G A;  2EQS A;  4JG2 A;  4P74 A;  3G4S A;  4DV0 Q;  1PH9 A;  1IBM L;  2A8V A;  3BU2 A;  1XNR Q;  2IY5 B;  4Y52 H;  1KAW A;  1VQ7 A;  4JBM A;  3CCS A;  2DGY A;  2YV5 A;  4B3T Q;  4HIM A;  4NPS A;  5LMU L;  4LF4 Q;  4NXM L;  2VUM G;  4LUZ A;  4GKJ Q;  4A3K G;  2UXC L;  1I3Q H;  4UP9 A;  3UDI A;  3CF5 A;  4DR2 Q;  3STB C;  2R7Z G;  4BBS H;  4OON A;  4A3F H;  2ZJQ A;  2QGQ A;  4C3J H;  4EX5 A;  1UEB A;  3HOV G;  4OX9 L;  3OW2 A;  4LF7 Q;  2E2J H;  2DUD A;  3H15 A;  1QUQ A;  3GO5 A;  3NEL A;  2ZM6 Q;  1TWF H;  1YIT A;  1RIP A;  3M4O H;  1QVC A;  3B6Y A;  1IXR A;  4HJ7 A;  3ULP A;  3CPW A;  1VQI A;  4PZ6 A;  2MNA A;  1VQ9 A;  4JI6 Q;  4LF6 L;  1SN8 A;  1YVC A;  3PUV A;  4LW1 A;  1L0W A;  5IP9 H;  4X65 Q;  3J7Z C;  3CCQ A;  3CCV A;  1M90 C;  3AEV A;  2HIX A;  1HNW L;  4L5S A;  2WB1 E;  4DV1 L;  2VL6 A;  3PUW A;  2VW9 A;  1Y1W G;  1E22 A;  1SR3 A;  1I50 H;  3H0G H;  5FJ8 G;  1NJI C;  2QEX A;  3FKI H;  4IPG A;  4JI3 L;  3UE0 A;  5JEA G;  2JA7 G;  2UXD Q;  1JJG A;  3KJO A;  5E7N A;  3KF6 B;  5GRO A;  1VQD A;  4JI7 L;  3NEN A;  2UXB L;  1AE3 A;  1GM5 A;  4HJ9 A;  2B29 A;  4DV5 Q;  4GLA C;  3S1N H;  5AJ3 L;  3CC2 A;  5ELO A;  3HFZ B;  3L7Z C;  3PF5 A;  4JI0 L;  3GTL H;  4DPG A;  5C3E H;  3T1H Q;  3ICE A;  1KXL A;  1S3O A;  2AWO A;  3I4N G;  2MFI A;  4POF A;  4MZ9 A;  5GAD C;  2IX0 A;  3HKZ E;  1TXY A;  4QL5 A;  4K0K L;  3EIV A;  4X66 Q;  1GO3 E;  5C44 G;  2LSS A;  3SGI A;  4JC0 A;  3CME A;  2VY3 A;  1WCM H;  2Q2I A;  4A3E H;  1IBM Q;  4LWC A;  4R4I A;  3J80 i;  4A3B G;  4A3I H;  3J80 c;  1B8A A;  1NBW A;  1N36 L;  5IP7 H;  1P8L A;  4JV5 L;  1V43 A;  1YHA A;  4PZ8 A;  4TVA B;  5M3M G;  3CXC A;  5LMU Q;  5IYB H;  1A8V A;  3S1R H;  1PH2 A;  4NXM Q;  3I4M H;  3W1B A;  4DNI A;  1A62 A;  2NZH A;  1QZH A;  1RL2 A;  1YHQ A;  4A3D G;  5K36 G;  1EQR A;  1KC8 C;  4OO1 G;  1YBY A;  4OX9 Q;  2JE6 I;  2R6G A;  1EQQ A;  4TQU S;  5C0X G;  4C2M H;  1VQG A;  1IL2 A;  3I56 A;  3TRE A;  2F3I A;  2Q2T A;  5M3F H;  2IX1 A;  2MO0 A;  4DR6 Q;  2CWP A;  4R4Q A;  2K5H A;  3GTO H;  4B3R Q;  3A0J A;  3PGZ A;  4LF6 Q;  1JT8 A;  3T1Y L;  4Y7N H;  3TS0 A;  2Q2U A;  1HR0 L;  1XPU A;  5GAH C;  1WJJ A;  2WB1 G;  1HNW Q;  1IZ6 A;  4DV1 Q;  2MQH A;  3PUZ A;  3CCR A;  1Q1B A;  2AWN A;  4YCW A;  3PIO A;  4JBJ A;  1EUJ A;  1I5F A;  2OQ0 A;  4JI3 Q;  3S1M H;  5J3B A;  3PO3 H;  4AH6 A;  5C4J H;  1E3P A;  3MEF A;  2Z6K C;  1PA6 A;  4JI7 Q;  2UXB Q;  4XTC S;  1JE5 A;  1Y1V G;  4YY3 L;  3HOX H;  2MO1 A;  4QGU A;  1UE5 A;  3K80 C;  4A3C H;  1SLJ A;  1WOC A;  2N3S A;  4P73 A;  1G6P A;  3F2B A;  1VQF A;  4JI0 Q;  2R7F A;  3CCU A;  4IPC A;  1GVP A;  1KRT A;  3RLO A;  3M85 A;  2RHS B;  4BY1 G;  1N33 L;  2I5L X;  4BXX H;  2F4V Q;  1CKM A;  4DV3 L;  3HKZ G;  1HR0 W;  3GD7 A;  3CCE A;  3FP9 A;  3GTP H;  4YHH Q;  1FL0 A;  4K0K Q;  2CCZ A;  2LXK A;  3KDF B;  4IJL A;  2Z6K A;  2B3G A;  1TWG H;  1O7I A;  4X6A H;  4DR4 L;  3AFP A;  2K5V A;  4JV5 Q;  3BZK A;  2PI2 A;  1K9M C;  1MJC A;  1P16 A;  2F52 A;  4A3J H;  2VZA A;  4BY7 H;  3KFU A;  3J7A 5;  2D62 A;  3HOU H;  1E1T A;  2VS1 A;  3HOY G;  4KI0 A;  3M4P A;  2NVX H;  2D0P A;  4O0A A;  1G51 A;  4RMF A;  3FHW A;  4GLX A;  1IYJ B;  2WAQ E;  1PH5 A;  3BJU A;  2PMZ E;  1W2B A;  3RLF A;  1PHJ A;  1CSQ A;  1HH2 P;  1QZG A;  3T1Y Q;  3E0E A;  1X3F A;  4YWK A;  2N78 A;  3S16 H;  2ZJR A;  4IO9 A;  1FJG Q;  4ALP A;  4A3G H;  4A3M H;  4IFD I;  4WJ4 A;  3S1Q H;  1VQM A;  2UU9 L;  1A63 A;  1NE3 A;  3OYY A;  5IYC G;  1IBL L;  4UY8 C;  2JA5 G;  1VQH A;  1K73 C;  3PO2 H;  5C4X G;  5GQO A;  2A1A A;  5IWA L;  4A93 H;  1H95 A;  1CKN B;  4YY3 Q;  3S14 H;  1EWI A;  1Q7Y C;  4LF9 Q;  3K0X A;  1UE6 A;  4YWM A;  2UUC Q;  2ALY B;  2RHQ B;  3GTM H;  3E9I A;  4DR7 L;  4AIM A;  2Y0S E;  1VQ4 A;  4JI8 L;  1SMX A;  1N33 Q;  4AQY L;  4DV3 Q;  4DK3 C;  1XNQ L;  4DV7 L;  5JJK A;  1XTD A;  2OWO A;  1ASZ A;  4B3S L;  3RN5 A;  3OTO L;  2VQE L;  5GAG C;  2ZTD A;  4IPD A;  4UP7 A;  3STB D;  1L1O B;  4P72 A;  4DUY Q;  3G48 A;  4DR4 Q;  4KHP L;  3M4Q A;  1YEZ A;  3RR5 A;  4L5Q A;  2ATW A;  2NN6 G;  2CFM A;  4LFC L;  1B7Y B;  2PQA A;  4GOP B;  1NTG A;  1I94 L;  1JMC A;  4AYB E;  3PCO B;  4DV2 L;  2E2I H;  2B63 H;  4BBS G;  4A3F G;  3CQZ H;  3RZO H;  1Z9F A;  4GNX B;  3U58 A;  1YI2 A;  3CD6 A;  5IY0 A;  5IYD H;  2WAQ G;  3HKS A;  3I2Z A;  4DKA C;  4KLK A;  4A3L H;  1MIU A;  4JI4 L;  1LYL A;  1K3R A;  1YHB A;  3D0F A;  4GN5 A;  3J81 j;  2HHH Q;  3WWV A;  1WFQ A;  3F2C A;  1C9O A;  1D8L A;  4JBW A;  4LNQ A;  4UP8 A;  1VQJ A;  2KBN A;  5IP9 G;  2R7D A;  1Q81 C;  2R93 G;  1SFO H;  1YJN A;  1UE7 A;  3HOW H;  4R1J A;  2BH2 A;  3S15 H;  3S24 A;  1BBW A;  2UXC Q;  1X56 A;  1CKO A;  3H0G G;  3ULL A;  1HNZ L;  4JI2 L;  3FKI G;  2UU9 Q;  2LXJ A;  2PNH A;  4P71 A;  3GDE A;  4MNO A;  1IBL Q;  3TQY A;  1XMQ L;  2R92 H;  3PF4 A;  1OXS C;  1T9H A;  2JQO A;  3AYH B;  3PSI A;  4L5R C;  2I5M X;  1U5K A;  3K8A A;  4ME3 A;  4QIW E;  3G71 A;  2QA4 A;  2HT1 A;  2GVB A;  1XJV A;  5M5W H;  1FVI A;  5FLM H;  2JA6 H;  1TWH H;  2K52 A;  3JC6 6;  4UPA A;  4DR7 Q;  2Y0S G;  5C3E G;  1PFS A;  4DK6 C;  3ERS X;  3KLW A;  3RNU A;  4JI8 Q;  5GAE C;  1TWA H;  2ZTC A;  3U4V A;  4AQY Q;  3AFQ A;  1XNQ Q;  4DV7 Q;  1IBK L;  1YNX A;  4JCV E;  4IOC A;  1VQ6 A;  4DAY B;  4B3S Q;  3OTO Q;  2VQE Q;  1Q46 A;  1WCM G;  2RCN A;  5FLX c;  4A3E G;  2JA8 H;  1W3S A;  1AH9 A;  3ER0 A;  4A3I G;  4KHP Q;  1VQB A;  5IP7 G;  5JJL A;  2ES2 A;  1YJ9 A;  1PYB A;  2HIV A;  3KOJ A;  5IYB G;  4DV4 L;  4AYB G;  1N8R C;  1VQ8 A;  4LFC Q;  3I4M G;  1PV4 A;  1KL9 A;  1N32 L;  4DV2 Q;  4JI5 L;  4YCU A;  5AJ3 Q;  4BBR H;  3CC7 A;  1MKH A;  1Z47 A;  2A19 A;  1J6Q A;  4DV0 L;  2H5X A;  3D31 A;  1ASY A;  1Y14 B;  1PYS B;  1JJC B;  1NMG A;  4NB3 A;  2XTI A;  4JI4 Q;  4POG A;  4LF4 L;  1L2F A;  5IT9 c;  3K7U C;  4GN3 B;  1HZC A;  3U50 C;  1XMO L;  1DGS A;  4LUO A;  2ZTE A;  2FXQ A;  3CPF A;  1OXU A;  3HOZ G;  1N36 Q;  4DR1 L;  1XPR A;  5M5Y H;  4X62 L;  1U0L A;  2I5H A;  1OTC A;  3H3V I;  1K83 H;  4JOI C;  1S72 A;  1PH1 A;  2IT1 A;  2K14 A;  1X3E A;  2KCT A;  4FDB A;  2ZM6 L;  1HNZ Q;  2BH8 A;  1JB7 A;  4QJF A;  2YTV A;  1E7Z A;  1LUZ A;  4YCV A;  2CWA A;  1XMQ Q;  4IFD J;  4OO1 I;  1BBU A;  4JI6 L;  5C0X I;  2OTJ A;  1X55 A;  3HOX G;  4J15 A;  2UUA L;  4B3M L;  1L1O C;  1LM0 A;  2GVA A;  4A75 A;  4A3C G;  3GTG H;  1Q8K A;  3EN2 A;  3ZJY C;  4HJA A;  1VQO A;  1KQS A;  2VUM H;  4A3K H;  1PH3 A;  4JI1 L;  4HIK A;  4HJ5 A;  1S40 A;  2AHO B;  1PH7 A;  1M1K C;  4GOP C;  2R7Z H;  4BXX G;  1C0A A;  3EBE A;  1Q82 C;  3HOV H;  1Q12 A;  4IPH A;  1IBK Q;  3CP0 A;  1HR0 Q;  2KCM A;  4GNX C;  1V1Q A;  1KD1 C;  3L2P A;  2JEB I;  3ULJ A;  4OWW B;  3BZC A;  1PH4 A;  3DM3 A;  3T1H L;  4DUZ L;  1KRS A;  1VQ5 A;  1YJW A;  2YTY A;  2CQO A;  2Z0S A;  4BA2 I;  3KF6 A;  3E9H A;  2KHJ A;  3IRB A;  4LF8 L;  2EXD A;  3W5O A;  4BY7 G;  4X64 L;  5BR8 L;  4X66 L;  2VQF L;  1N32 Q;  4JI5 Q;  3HOU G;  4GOP A;  1Y1W H;  1I6H H;  1A0I A;  4HID A;  5FJ8 H;  2C35 B;  2JA7 H;  1BVS A;  3TS2 A;  3K81 C;  4GNX A;  4LFB L;  1YIJ A;  2E5L L;  4LUV A;  5ELN A;  4LFA L;  2JA6 G;  1XMO Q;  1KHI A;  2IHE A;  2K5N A;  4DAM A;  3DLL A;  1EFW A;  2NVQ H;  1WYD A;  3CW2 C;  3GTK H;  2YYZ A;  4GN4 B;  4OXP A;  4XIG S;  4DR1 Q;  3I4O A;  4X62 Q;  3I4N H;  4A3G G;  4A3M G;  1SRO A; 
#chains in the Genus database with same CATH topology
 4DR6 L;  2DY7 A;  2CW0 C;  5CV4 A;  2YTX A;  4L6T B;  2ID0 A;  4IUR A;  4GKK L;  2UUB L;  4GS3 A;  4B3M Q;  1QVF A;  3FPP A;  1PLF A;  4NXN L;  1PH8 A;  1NSN S;  3C46 A;  2JJQ A;  4RGN A;  1OXV A;  4BA1 I;  4K8J A;  1PMR A;  3RZO B;  3SK5 A;  4A3D H;  4OO1 H;  4R8N A;  3J81 i;  1BCP B;  3V05 A;  3GV6 A;  2QEJ C;  1EIY B;  1A6X A;  1RJT A;  5CBE E;  2N8N A;  1VQA A;  4ZKC B;  2J7Z A;  5IWA Q;  2F1M A;  5EPJ A;  5FO9 B;  4YHH L;  2B63 G;  1SFO B;  3GQB A;  3D4D A;  2OCE A;  3QWN A;  1UE1 A;  3M7G A;  4LFB Q;  2PQA B;  2R92 B;  1NMF A;  1H9K A;  1SAP A;  1Y1V H;  4WFN 3;  3CAM A;  1BR9 A;  1STH A;  4Q0F A;  1EYD A;  2G9D A;  3RN2 A;  3KDF A;  5I9O A;  1C7Y A;  1HFN A;  4BY1 H;  3L0O A;  2KVM A;  3AMU A;  1X54 A;  4H44 C;  1I94 Q;  1PRT C;  1EIF A;  3DWQ A;  4JK1 C;  3ZYY X;  2JA8 B;  1FD7 D;  3CMA A;  3I55 A;  3F2D A;  2K4K A;  2DNE A;  3U4Z A;  1X3G A;  5KYL A;  5ELF A;  4IUQ A;  2BA0 A;  2GA4 B;  1F2Z A;  1Q86 C;  4BBR B;  1PYW D;  1VS0 A;  4DV6 Q;  1RF2 D;  2D9U A;  3PIP A;  2EDG A;  2XWB B;  4KD4 A;  1K0R A;  4JI2 Q;  3U58 A;  2ZJP A;  2JA9 A;  1EOV A;  1HZA A;  1G6Z A;  4WJW A;  4JYA Q;  2K75 A;  3A7L A;  1R4Q B;  3FVQ A;  2JK8 A;  3JAM E;  1KTK A;  5LMN Q;  4CDE C;  4DR3 Q;  4DXG A;  4HIO A;  5HY6 A;  2B8G A;  2RCF A;  4GZY C;  4H02 A;  4IJH A;  1VQN A;  1ESF A;  3EJI A;  3GTG B;  1PFM A;  1CZW A;  1B50 A;  1B4O A;  1L1O A;  2R7Z B;  1UWV A;  5EAY A;  3F1Z A;  2HCC A;  5CMD A;  1E24 A;  1AW7 A;  1N9W A;  5E1F A;  2E8G A;  5DEH A;  4K14 A;  2F0E A;  1XNR Q;  4Y52 H;  1JC7 A;  1KAW A;  3TBI B;  4OIK A;  1A3V A;  2YV5 A;  2VUM G;  2NN6 H;  2UXC L;  2F0V A;  2L0C A;  3UDI A;  3STB C;  4A3F H;  1G91 A;  1STA A;  5IGB A;  1W6K A;  2ZM6 Q;  1TWF H;  3T16 A;  3M4O H;  3B6Y A;  1IXR A;  2A74 C;  2PQE A;  3CPW A;  1VQI A;  2MNA A;  1SN8 A;  1YVC A;  4LW1 A;  4XXE A;  4X65 Q;  3GTK B;  3AEV A;  1JOR A;  1NJI C;  3PUW A;  1E22 A;  3BYY B;  3H0G H;  5FJ8 G;  2D5D A;  2QEX A;  1E2W A;  1F9P A;  3NEN A;  5J1Z A;  2B29 A;  4DV5 Q;  2ZXP A;  5IGG A;  3S1N H;  2CW0 D;  3CC2 A;  2K7V A;  3PF5 A;  1Q90 A;  4JI0 L;  5C3E H;  1KXL A;  3OW7 A;  1S3O A;  3E6Z X;  2MFI A;  2BCO A;  3EIV A;  4X66 Q;  1KLG D;  2XNA C;  3BG3 A;  3CME A;  2VY3 A;  3LNN A;  4CJ1 B;  1IBM Q;  3J80 i;  1N36 L;  5LMU Q;  3ND9 A;  4NXM Q;  1DZ1 A;  4RCO A;  1A8V A;  3I4M H;  3W1B A;  1A62 A;  2NZH A;  1SNP A;  5M5X B;  4NW2 A;  1YHQ A;  1AZP A;  4ZQ3 A;  5K36 G;  5EKL A;  4RGO S;  2R6G A;  2A68 D;  5C0X G;  3R2I A;  1IL2 A;  2F3I A;  2IX1 A;  1UUP A;  2MO0 A;  2EY2 A;  4LF6 Q;  2L11 A;  1JOK A;  2O5I C;  4Y7N H;  1IZ6 A;  3P75 A;  3SK8 A;  4JBJ A;  1DOK A;  1PA6 A;  4RCN A;  4JI7 Q;  2UXB Q;  4XTC S;  1JE5 A;  3NXW A;  3ERO A;  4A3C H;  3F2B A;  3CCU A;  3RLO A;  4BXX H;  4KK7 A;  1CKM A;  4DV3 L;  3HKZ G;  3HOY B;  1EZ8 A;  3FP9 A;  3UI2 A;  3CCE A;  4K0K Q;  4G7H C;  4G4K A;  3PMF A;  2Z6K A;  2B3G A;  4QF4 A;  2K5V A;  3BZK A;  5ELB A;  5EGT A;  3KFU A;  4HR7 B;  4KI0 A;  1D1K A;  3NTI A;  3SK4 A;  1PXU A;  3HGB A;  4MIU A;  4RAU C;  3BJU A;  2PMZ E;  1TWC B;  5JPN C;  1JR0 D;  1MSH A;  3K7A B;  1PHJ A;  3MXP A;  3MXN A;  1X32 A;  2ENB A;  3D3R A;  1LTB D;  1X3F A;  3H3V C;  2SNM A;  3U9O A;  2N78 A;  2EYL A;  4IO9 A;  4A3G H;  4IFD I;  4JVZ A;  1A63 A;  2QCP X;  3OYY A;  5FLX E;  2JA5 G;  1VQH A;  2RQX A;  4A93 H;  1H95 A;  5G3L F;  1EWI A;  2ALY B;  3MAQ A;  4AIM A;  5E3F A;  4JPB W;  1VQ4 A;  1VF5 C;  4DK3 C;  4DV7 L;  3SVM A;  4RGT A;  2EZV A;  1XTD A;  2OWO A;  1F2M A;  3RN5 A;  2PMZ B;  4IPD A;  3Q24 A;  3STB D;  4DUY Q;  1IYU A;  1SJE D;  3BDO A;  3OIP A;  1PTO F;  4U68 A;  3RR5 A;  3NPP A;  5CC4 A;  4XQJ A;  1JMC A;  4AYB E;  2N88 A;  4DV2 L;  4CJ0 B;  3F2U A;  3RZO H;  2B2T C;  1Z9F A;  1ONL A;  2WAQ G;  3HKS A;  1YNN D;  3I2Z A;  2SDF A;  4KLK A;  4UHV A;  1MIU A;  1QOH A;  1WFQ A;  4XYQ A;  5J39 A;  3OWE B;  5EPK A;  2I07 B;  1SFO H;  1XXG A;  3I8Z A;  4ZUJ A;  1HNZ L;  4P71 A;  2R92 H;  1OXS C;  1WCM B;  2JQO A;  3K5O A;  1ET6 A;  1O7Z A;  1U5K A;  2EYO A;  3G71 A;  4A3I B;  2F0S A;  1R4P B;  4UPA A;  4AYB B;  4ABN A;  4DK6 C;  1SYC A;  3ERS X;  3KLW A;  5ISR A;  4JI8 Q;  3RNU A;  2ZTC A;  1BNZ A;  4EGV A;  3LWE A;  1XNQ Q;  3TZD A;  1M8A A;  3NK9 A;  4IOC A;  5EBC A;  4DAY B;  1STN A;  4C2M B;  1Q46 A;  4TKO B;  4A3E G;  2JA8 H;  4BWG B;  2WAC A;  5FK9 C;  5IP7 G;  5JJL A;  4DNT B;  1PYB A;  2WII B;  3KOJ A;  5IYB G;  4DV4 L;  1N8R C;  4LFC Q;  1PV4 A;  1H9J A;  4BBR H;  1MKH A;  5A2Q E;  2EY1 A;  1Y14 B;  4CDD C;  2XRS D;  1NMG A;  3HRZ C;  3KUP A;  1UAP A;  2SEB D;  2BE5 C;  1E2V A;  3K57 A;  4IAL A;  1DGS A;  5CBA E;  3KBX A;  3NP8 A;  2F0P A;  2FXQ A;  1LTR D;  5I6W A;  1XPR A;  3H3V I;  3NBI A;  2NUC A;  1S72 A;  1I4G A;  1PH1 A;  3QR8 A;  1F9Q A;  5C4H A;  2E74 C;  1HQM C;  4K5V A;  5IT9 L;  1GHK A;  2H1E A;  4HED A;  3HOX G;  2UUA L;  2KOL A;  1L1O C;  1ILP A;  5M9O A;  1SE2 A;  3GTG H;  1Q8K A;  1VQO A;  1PH3 A;  4HIK A;  1F2L A;  4GOP C;  2R7Z H;  4BY7 B;  2DNC A;  3EBE A;  4K6D A;  1Q82 C;  4EQP A;  1IBK Q;  2C5C A;  4RGM A;  2KED A;  4DU9 A;  4GNX C;  1CZG A;  2JEB I;  4QUF A;  4B9X A;  2OT2 A;  4KKU A;  2E75 C;  2PW5 A;  4RHR A;  4DUZ L;  4A3K B;  1B3Q A;  4F7X A;  1CTM A;  4LF8 L;  3D6W A;  4X64 L;  5BR8 L;  2VQF L;  3S16 B;  3HOU G;  5FOB B;  1O7L A;  3VYR A;  4HID A;  2LY7 A;  3TS2 A;  4C56 C;  5I2X A;  1GUS A;  3SK6 A;  2CH4 W;  2LMC B;  2PO4 A;  4LFA L;  1KHI A;  3S14 B;  2VB3 X;  3CW2 C;  3GTK H;  3T53 B;  4IUT A;  5EBD A;  4A3M G;  4QB4 A;  4QQB X;  1QVG A;  1HNX L;  4B3R L;  3PO2 G;  3G7L A;  3CCJ A;  4GLV B;  3TME A;  5H1S E;  4DNR B;  3BYT B;  4L5T A;  1ZYR D;  1B70 B;  2BOS A;  1J9O A;  4DK1 A;  1PVO A;  2F0D A;  4M8A A;  2Z4I A;  1MBY A;  5C5L A;  2B63 B;  3IAY A;  4A4I A;  1SNQ A;  4XYO A;  1RTN A;  1D7Q A;  3N52 A;  1D5X C;  1LLR D;  1LTS D;  2KUM A;  2PPB C;  1BCP F;  2DJF C;  4R4T A;  4DAY A;  3CCL A;  5L37 A;  3KJP A;  3R93 A;  4IUV A;  4EQN A;  3MXU A;  3IL8 A;  3TSS A;  1RD9 D;  2H4O A;  3L9A X;  1HUN A;  5M5X H;  3J7A F;  3TRZ A;  2HUG A;  3JAM c;  5DM7 3;  3H94 A;  4KHV A;  1Q8I A;  2V1C C;  2K5W A;  4A3L G;  2E5L Q;  4R4C A;  2K1B A;  1EWH A;  3J7A V;  4RG1 A;  3HG9 A;  2XN9 C;  5C4Z A;  4QCL A;  3M9B A;  4PMW A;  5M5W B;  1X65 A;  4DR5 L;  2D0O A;  4C3I H;  2EIF A;  1ROD A;  1EZ6 A;  4F88 A;  3T13 A;  5CV5 A;  1F77 A;  1SSO A;  1UEA B;  2D2C C;  2N49 A;  5LMN W;  1QJO A;  4GKK Q;  2UUB Q;  1B53 A;  5FLM G;  2F0K A;  4IUP A;  5C0X J;  4NXN Q;  3W1G A;  4IFD G;  3G6E A;  3W3A A;  3RD4 A;  5DLQ E;  4N9T A;  5JJI A;  4P75 A;  3HOY H;  1DXM A;  1HTP A;  2MPM A;  2RKS A;  4LF7 L;  3PUX A;  4OWT B;  5LHY 1;  3OOC A;  3J81 E;  2EYH A;  2RDH A;  1KIX A;  5KNB A;  3I90 A;  1PZK D;  2K32 A;  2WFW A;  1AP0 A;  1Q1E A;  2KHS A;  3F8T A;  5CV7 A;  3MXG A;  1HZ9 A;  1SRU A;  2BE5 D;  2VNU D;  3ERQ A;  2AMC B;  1A2U A;  2OF1 A;  2UXD L;  3SDZ A;  3C3L A;  4RKB A;  4JW0 A;  1RDP D;  5C4X H;  1TWC H;  4K5W A;  3K7A H;  2L5T A;  1EY5 A;  4CKB A;  2VUM B;  1AEX A;  4IOA A;  3KYH C;  1B1Z A;  1GD7 A;  4K2K A;  1OXT A;  2I0Q A;  2EVB A;  2HHH L;  4JG2 A;  3ND8 A;  4P74 A;  3SEB A;  4DV0 Q;  3BU2 A;  1LT5 D;  1VQ7 A;  2IWH A;  1C48 A;  3CCS A;  4HIM A;  4LF4 Q;  4LUZ A;  1BQQ T;  4A3K G;  1HFG A;  4OON A;  2ZJQ A;  1SYE A;  2QGQ A;  4NKL A;  1B3A A;  3HOV G;  1Z6H A;  4DXF A;  1NNX A;  3GO5 A;  2WKC A;  1QVC A;  4N9P A;  2OXP A;  2P5Z X;  3VYU A;  4FF2 A;  4FYD A;  3IFD A;  4JI6 Q;  5IP9 H;  1M90 C;  2VL6 A;  1Y1W G;  2JA7 G;  4IPG A;  4JI3 L;  5JEA G;  3RZD B;  2ICE C;  5C5M A;  3KF6 B;  2Q8I B;  2FFK B;  5IGC A;  5AJ3 L;  1X3Q A;  3K6O A;  3M4Y A;  4P2C B;  3T1H Q;  3KLS A;  3I4N G;  2K04 A;  2A68 C;  4POF A;  5KNC A;  1QIL A;  5KND A;  2IX0 A;  3HKZ E;  4QL5 A;  5C44 G;  3SGI A;  4JC0 A;  1WCM H;  4A3B G;  4A3I H;  2M2L A;  1DYQ A;  1ML0 D;  1Q3L A;  3MA2 B;  1C8C A;  1P8L A;  4JV5 L;  1V43 A;  4QUC A;  4L63 B;  4PZ8 A;  5M3M G;  3CXC A;  1PH2 A;  3OPO A;  4H13 C;  4DNI A;  2FMC A;  4CDC C;  3JAM L;  1KC8 C;  1YBY A;  1KAA A;  4TQU S;  2R61 A;  4C2M H;  4DK0 A;  3TRE A;  1SE4 A;  2F0L A;  2Q2T A;  5EQ0 A;  3RUZ A;  1R9T B;  4R4Q A;  2K5H A;  2HD3 A;  3S1R B;  4RKL A;  1HRJ A;  3PGZ A;  4ID6 A;  4ZKB B;  3T1Y L;  3TS0 A;  1CFM A;  2QKI C;  5GAH C;  1GUW A;  2WB1 G;  3FMC A;  2AWN A;  4YCW A;  3HKZ B;  1TY2 A;  1EUJ A;  1I5F A;  1ET9 A;  4KJN A;  3MEF A;  3VR5 A;  4FO2 A;  5JOB A;  4YY3 L;  1UE5 A;  3K80 C;  4UAI A;  1SLJ A;  3NQI A;  4JI0 Q;  2F03 A;  2RHS B;  2F4V Q;  3DUZ A;  3H09 A;  1HR0 W;  3GD7 A;  3PQI A;  3S17 B;  1KAB A;  2NVT B;  2LXK A;  3VR2 A;  4IJL A;  1TWG H;  4KTA A;  1O7I A;  1LT3 D;  3AFP A;  2DN8 A;  1TS3 A;  2LFN A;  3J80 E;  4FF4 A;  1P16 A;  2F52 A;  2AUK A;  5ELC A;  4BY7 H;  3D8G A;  2E2H B;  4G7Z C;  2VS1 A;  5T1I A;  1GUG A;  4C3H G;  3OMG A;  1G51 A;  4I7Z C;  1TR5 A;  2WAQ E;  2JSO A;  1I6V C;  2JA5 B;  1TKW B;  4IUN A;  3P7J A;  1CSQ A;  1STE A;  5CR3 A;  3FDT A;  3A8K E;  3EVQ A;  4I7A A;  3E0E A;  1PRT F;  1GXD C;  3S16 H;  2ZJR A;  1FJG Q;  1BUV T;  4ALP A;  3KK7 A;  1PDQ A;  2NVY B;  3GTQ B;  1FYC A;  3WOF A;  5IYC G;  1GJX A;  1J8I A;  1QCB D;  1S5C D;  5HUR A;  5GQO A;  5IWA L;  1CKN B;  3S14 H;  4LF9 Q;  3CRL C;  4YWM A;  2UUC Q;  1K3B C;  1PTO H;  1S5B D;  3E9I A;  4DR7 L;  1NR4 A;  1I3Q B;  5IOC A;  1YNN C;  1JB3 A;  4AQY L;  4DV3 Q;  2EJG C;  4ZLT F;  3NHH A;  5JJK A;  2E2J B;  2WAQ B;  3OTO L;  2VQE L;  5GAG C;  4KY5 A;  3I70 A;  2WKD A;  2V4D A;  3X3N A;  4N8X 1;  2L12 A;  3M4Q A;  1NUC A;  1YEZ A;  2RDG A;  2WIN B;  2CFM A;  2PQA A;  4L8J A;  1I94 L;  2B63 H;  4BBS G;  4C3J G;  4XT3 B;  1I50 B;  1JCK B;  1EY6 A;  1WTO A;  4DKA C;  1BXT A;  4X3U A;  1EY9 A;  1LYL A;  3J81 j;  1S5D D;  3WWV A;  5JAV A;  1C9O A;  4HN7 A;  4JBW A;  4LNQ A;  1QWY A;  2KBN A;  3GTL B;  2R7D A;  1YJN A;  1UE7 A;  4R1J A;  2BH2 A;  3EQL C;  2E76 C;  1X56 A;  3ULL A;  1I4H A;  3DMU A;  4JI2 L;  1LT6 D;  3BZD B;  3FKI G;  1U4P A;  2LXJ A;  1D6E C;  1XMQ L;  5CV8 A;  1CT1 D;  4A3E B;  4L5R C;  5CV9 A;  4QIW E;  5JVG 3;  2GVB A;  3DWA A;  1XJV A;  5M5W H;  2MUY A;  2K52 A;  2RA4 A;  4HSP A;  3NWT A;  2NTT A;  2Z4H A;  3AFQ A;  3SHL A;  4DV7 Q;  5I4D A;  1YNX A;  3HS0 C;  4XT1 B;  5M3F B;  3EA6 A;  1H9S B;  1AH9 A;  3ER0 A;  5DAU A;  1EU3 A;  1EWC A;  1D2B A;  1VQ8 A;  1KL9 A;  4DV2 Q;  3CC7 A;  1Z47 A;  2A19 A;  3S1M B;  3D31 A;  5FLX L;  1CHQ D;  4ZRZ A;  5C4J B;  4NB3 A;  1TU2 B;  5C3W A;  2XTI A;  4O42 A;  1JQY D;  4POG A;  4QIW B;  5IT9 c;  2B2W A;  1HZC A;  3HOX B;  1D1I A;  3OMC A;  2Z8L A;  3VYT A;  3CPF A;  3QIA A;  4G57 A;  4DR1 L;  4X62 L;  2I5H A;  4F87 A;  2K01 A;  2ZM6 L;  2G5D A;  4HTH A;  1HNZ Q;  1ZKO A;  1E7Z A;  1ENF A;  3NE5 B;  4RHS A;  2QDB A;  4DFA A;  4IFD J;  1M4V A;  2IL8 A;  4ULL A;  4OO1 I;  1X55 A;  3VA7 A;  5F2D A;  4FXK C;  4LAA A;  2GVA A;  4HMI A;  1RCV D;  2NTS A;  2VUM H;  1LTG D;  3A54 A;  4JI1 L;  4HJ5 A;  1PH7 A;  2AHO B;  1PRT B;  3HOU B;  5EKI A;  4FXD A;  4IPH A;  1HR0 Q;  2NVX B;  2EYM A;  1NR2 A;  2KCM A;  2G9H D;  5IGF A;  1JWU D;  3L2P A;  4PQX A;  3BZC A;  1PH4 A;  4OL7 A;  3DM3 A;  1VQ5 A;  1XWE A;  2CQO A;  2B2Y C;  3IRB A;  1VMP A;  5EPL A;  4X66 L;  1T5X D;  4A3M B;  5FJ8 H;  1CK1 A;  1DD2 A;  1ZYR C;  4PMC A;  3PO2 B;  2IHE A;  3W2D A;  1EFW A;  4FP5 D;  1QNU A;  5E4X A;  3GTM B;  4XIG S;  4X3S A;  1TQO A;  3VR3 A;  1E1O A;  1EYC A;  3RZD H;  1ICW A;  1N34 L;  4YWL A;  3I7F A;  2A69 D;  1BKB A;  5C6A A;  2PZU A;  4QMG A;  3PIO 3;  3A55 A;  2UUA Q;  1PH6 A;  3KF8 B;  1IW7 C;  4C1N K;  3UDF A;  2KEC A;  3MVV A;  2E2I B;  2KJX A;  2DY8 A;  3CQZ B;  1K8G A;  1QUQ B;  1V8Q A;  5K36 H;  5A2Q L;  4PZ7 A;  5C0X H;  3H91 A;  3J81 c;  4NP5 A;  3A5U A;  2RF4 A;  1X9N A;  3VYS A;  2C9O A;  4DUZ Q;  4KY7 A;  1LAB A;  1J5E L;  4J8Q A;  5JEA J;  4APV A;  4FF1 A;  1TS2 A;  4KN4 C;  4LF8 Q;  5BR8 Q;  2DJG C;  5I2Y A;  4X64 Q;  2KCC A;  2VQF Q;  1VQC A;  3S15 B;  1SE8 A;  2FIN B;  3U9S A;  2PCF B;  5IYD G;  4A76 A;  5DNF A;  1R9T H;  5FKA C;  3MFY A;  1XPO A;  4LFA Q;  3FRP B;  5A35 A;  4XDX A;  5C3X A;  4HMJ A;  1PFB A;  2I46 A;  3HOW G;  2NN6 I;  1TWA B;  4H7B A;  4LF5 L;  1HNX Q;  5EJW A;  1JOO A;  1LTL A;  1QNK A;  2OQK A;  2IHF A;  5M3F G;  2JA6 G;  3Q8D A;  4B3T L;  5IOD A;  1YZ6 A;  4O2D A;  4GKJ L;  1O80 A;  2L15 A;  4F8M A;  1HZB A;  3Q22 A;  4DR2 L;  1VQE A;  4RH6 A;  2SNS A;  3S17 H;  1OXX K;  1DJR D;  2NVT H;  2F0O A;  3OHX C;  2HQL A;  1G6P A;  1NCV A;  2K50 A;  5ELD A;  4QY7 A;  4WOR A;  1HTL D;  4MTN A;  1XTC D;  2QF7 A;  3M7N A;  2OTL A;  1FGU A;  3LGJ A;  2E2H H;  1KDA A;  5G3L D;  4KHZ A;  1BOS A;  2F0W A;  2A6E C;  1JWS D;  4DUY L;  3CU7 A;  3KLR A;  2JA5 H;  1F2Y A;  2BA1 A;  2K5D A;  1VQP A;  2KEN A;  4HCS A;  1W6J A;  2X6G A;  4K6L A;  2Q8T A;  1SDF A;  3QOL A;  1PZJ D;  4DR5 Q;  1ZEQ X;  2XWJ B;  1FNV A;  3A74 A;  3NEM A;  1STG A;  1VQK A;  4WRD A;  3HOV B;  1PTO D;  4ZK9 B;  2NVY H;  3E3X A;  3GTQ H;  1B2T A;  1PH9 A;  1BCP C;  4OEM B;  4KN7 C;  2IY5 B;  2F0U A;  3I72 A;  4JBM A;  2DGY A;  4NPS A;  1CHP D;  1ZXT A;  1I3Q H;  3KF8 A;  4UP9 A;  1DON A;  1S5F D;  4EX5 A;  3A56 A;  1Y1W B;  1H9R A;  4OX9 L;  3OW2 A;  2JA7 B;  4ZCK A;  2E2J H;  4LF7 Q;  2DUD A;  1IYV A;  1QUQ A;  3NEL A;  1SNO A;  4M1U B;  3VA5 A;  1YIT A;  2JXM B;  4HJ7 A;  3ULP A;  4PZ6 A;  1VQ9 A;  2NVQ B;  3D4R A;  1U9R A;  1II3 A;  1IKM A;  3CCV A;  1HNW L;  2HIX A;  3L3O C;  2WB1 E;  4DV1 L;  3I4N B;  1SR3 A;  1I50 H;  3M3Y B;  3UE0 A;  2UXD Q;  1JJG A;  1Y8P B;  2F0N A;  5E7N A;  5C44 B;  5GRO A;  1SBB B;  4Q5V A;  1KDB A;  1VQD A;  1GM5 A;  4CBV A;  2LKV A;  4A3B B;  2R93 B;  2AQ2 B;  5ELO A;  3GTL H;  3L7Z C;  5M3M B;  1BF4 A;  4DPG A;  2RBM A;  2AWO A;  3DWP A;  4EQO A;  1TXY A;  1IW7 D;  2K6A A;  2Q2I A;  4K8I A;  3CRK C;  3J81 L;  4A3E H;  2XVS A;  1Y69 U;  1V1P B;  3J80 c;  5IP7 H;  2K5Q A;  1YHA A;  3BVZ A;  4TVA B;  5IYB H;  5E4W C;  3K0Y A;  2WB1 B;  1QZH A;  1RL2 A;  4FVM A;  4A3D G;  1EQR A;  4OO1 G;  2CQA A;  1VQG A;  2QW7 A;  3I56 A;  5M3F H;  4DR6 Q;  2CWP A;  1F9R A;  5CYU A;  3A0J A;  2PW7 A;  4B9W A;  3NTH A;  2EYF A;  3DHQ A;  2MQH A;  3TP6 A;  3PUZ A;  3CCR A;  3TDQ A;  1Q1B A;  4DAP A;  3S1M H;  4JI3 Q;  2B2W C;  4CJ2 C;  4AH6 A;  3S2H B;  5C4J H;  2Z6K C;  1DOM A;  3QO2 A;  1XX8 A;  1Y1V G;  3HOX H;  3HOZ B;  4QGU A;  1KNA A;  2EY6 A;  2XRQ D;  4P73 A;  1VQF A;  2B39 A;  1TVX A;  1K28 A;  3N6R A;  4BY1 G;  3GTJ B;  1N33 L;  2B2U A;  4C3H B;  4YHH Q;  1FL0 A;  1DCZ A;  3KDF B;  1CQF A;  2A73 B;  3MWY W;  1EU4 A;  4X6A H;  4DR4 L;  3T56 B;  3S2D B;  4JV5 Q;  3I91 A;  1MJC A;  5JVH 3;  1K9M C;  5D14 A;  4IQZ A;  2D62 A;  3HOU H;  5KGU A;  5K5P A;  3M4P A;  2NVX H;  1EEI D;  1WTV A;  4RMF A;  3FHW A;  1PH5 A;  3HEJ A;  2RSO A;  1W2B A;  2YU9 B;  1K8O A;  4ZYS A;  2A6E D;  1HH2 P;  1SYG A;  3T1Y Q;  1WTX A;  4YWK A;  1EY4 A;  3H6M A;  1I4R A;  4A3M H;  1EL0 A;  1VQM A;  2UU9 L;  1NE3 A;  1IBL L;  5IGE A;  1WTW A;  4UY8 C;  3E0J A;  1K73 C;  3PO2 H;  2A1A A;  1SND A;  4YY3 Q;  3K0X A;  2RHQ B;  3GTM H;  5EKK A;  1BCP D;  2L9H A;  1SMX A;  4BBS B;  4C3J B;  1KDC A;  4KJO A;  2IPK D;  1E2Z A;  4B3S L;  3BS1 A;  1PZI D;  2BDN A;  2ZTD A;  4UP7 A;  5CGK A;  1L1O B;  3G48 A;  4KHP L;  3IKJ A;  4KV6 A;  3NTK A;  4CKE A;  1EIG A;  4L5Q A;  1CA6 A;  2NN6 G;  1SMY D;  4GOP B;  1NTG A;  2E2I H;  4A3F G;  3CQZ H;  2M00 A;  3TZU A;  4GNX B;  3CD6 A;  1YI2 A;  3FKI B;  5IY0 A;  4TSS A;  1IKL A;  3Q23 A;  4A3L H;  4JI4 L;  3PIP 3;  1YHB A;  5BN3 A;  2MGS A;  1SYF A;  1D5M C;  1I4P A;  5KYI A;  1D8L A;  4B08 A;  3DM1 A;  1Q81 C;  2R93 G;  2HQE A;  3S15 H;  3S24 A;  1BBW A;  3WDN A;  4UDU C;  3H0G G;  4FF3 A;  2UXC Q;  1O7Y A;  2B2T A;  3QB3 A;  2PNH A;  3GDE A;  4MNO A;  3TQY A;  3PF4 A;  1T9H A;  3AYH B;  3C1F A;  4X3K A;  3PSI A;  2I5M X;  1JWM D;  3K8A A;  2HT1 A;  1CM9 A;  3J80 L;  5FLM H;  2HCI A;  5TSS A;  4DR7 Q;  1STB A;  1TII D;  2Y0S G;  2K33 A;  5C3E G;  4IFD H;  1WD1 A;  3I3C A;  5GAE C;  1TWA H;  1Z7T A;  1FR3 A;  3U4V A;  4AQY Q;  1O78 A;  1VQ6 A;  3NWS A;  4OIJ A;  3OTO Q;  2VQE Q;  1C4Q A;  5FLX c;  4DN4 M;  1W3S A;  3GTO B;  2ES2 A;  3OSO A;  1YJ9 A;  1EQV A;  1XYI A;  3I4M G;  1B9N A;  1N32 L;  4JI5 L;  4YCU A;  5J22 A;  1J6Q A;  2HDL A;  4DV0 L;  1SE3 A;  4OHJ A;  3K5M A;  2MP1 A;  2F3V A;  3SE0 A;  3PO3 B;  1JJC B;  1MSG A;  4LF4 L;  1ICF B;  4GN3 B;  1XMO L;  2ZXR A;  4LUO A;  5KIX A;  1YNJ D;  1OXU A;  3HOZ G;  1UNS A;  1N36 Q;  3P20 A;  1GUO A;  2IT1 A;  5HGT A;  2KCT A;  4FDB A;  3GTP B;  2BH8 A;  4QJF A;  2F0T A;  3AU7 A;  4ZUI A;  3K59 A;  4IN3 A;  1XMQ Q;  2ICI A;  2JN4 A;  1BBU A;  3QOJ A;  4JI6 L;  1AFP A;  1S5E D;  4OEL B;  4J15 A;  3BDL A;  4B3M L;  1LM0 A;  5FO8 B;  1HA5 A;  4A3C G;  3ZJY C;  4HJA A;  1KQS A;  4A3K H;  4A3J B;  1S40 A;  1RTO A;  2EYJ A;  4BXX G;  1C0A A;  3HOV H;  4ILW A;  4Z9C B;  3A7A B;  3AB9 A;  3R8B A;  4OWW B;  4U67 3;  2K05 A;  3T1H L;  1KRS A;  1DM0 B;  5D3I B;  2F3W A;  3KF6 A;  4CKC A;  2KHJ A;  2XSC A;  4GOP A;  1Y1W H;  4RA8 A;  1VMC A;  2A69 C;  1GHJ A;  3S1Q B;  2JA7 H;  3K5N A;  5JEA H;  4R9W A;  1BVS A;  4MHE A;  4GNX A;  4LFB L;  2EE1 A;  3GP7 A;  3FEW X;  1ENA A;  3TP8 A;  3DLL A;  2NVQ H;  4DR1 Q;  4X62 Q;  3I4N H;  5LL6 S;  4A3G G;  1SRO A;  2NYZ D;  3M3Y H;  3R3O A;  3CCM A;  3MXN B;  2GN5 A;  5C44 H;  2QDL A;  4A93 G;  3MFG A;  4A3B H;  2R93 H;  2WP8 J;  4HJ8 A;  3H3V H;  1HJP A;  5M3M H;  4KMU C;  4JI1 Q;  1I4X A;  4E6I A;  2B2V A;  2CVR A;  5KEE A;  4DV6 L;  3PV0 A;  1G29 1;  1EQT A;  4R4O A;  4N8F A;  2JEA I;  4CGY B;  1MGS A;  3UDX A;  5CV6 A;  3O13 A;  5I6Y A;  4JYA L;  3TEH B;  2F4V L;  3A5Z B;  1EFI D;  3JAM i;  3MC0 B;  2O5J C;  1EYA A;  3HOW B;  1MJE A;  2O2L D;  2PYK A;  3QJY A;  1A3T A;  5LMN L;  1BBX C;  4DR3 L;  1KNE A;  2J4X A;  3K5L A;  2FHT A;  1EEF D;  1V1O A;  2JA6 B;  1TWH B;  1VDZ A;  1CUK A;  4PV1 C;  2AKW B;  1CI3 M;  2RDF A;  2AUJ D;  2TSS A;  4OWX B;  1AN8 A;  1L0X B;  1H9M A;  1HA6 A;  3S2H H;  4BS9 A;  1N34 Q;  2XGT A;  2R92 G;  3Q6S A;  2ASB A;  1OO9 B;  1XNR L;  3HOZ H;  1STY A;  1WI5 A;  3SR1 A;  4C3I B;  4YIJ A;  1FJG L;  2B2U C;  1VCI A;  4KD3 A;  3GTJ H;  3J7Y W;  1CSP A;  1E0B A;  4C3H H;  2CKZ B;  4CDF C;  1Y8O B;  3C1E A;  1VQL A;  1MHW C;  4JBK A;  3UE1 A;  4WJ3 M;  4LF9 L;  2N55 A;  1PRT D;  2UUC L;  2JA8 G;  1GKH A;  4PG3 A;  5D65 A;  2PI2 E;  3WOE A;  1LV9 A;  4C1N I;  3PO3 G;  3S2D H;  1J5E Q;  3PUY A;  4X65 L;  1HCZ A;  1EYG A;  3NBH B;  2KHI A;  3AQQ A;  4PMB A;  4LMQ D;  1PTO C;  2AQ3 B;  5M5Y B;  4LJZ C;  4BBR G;  1K83 B;  2Q2H A;  1CKN A;  5IGD A;  2AQ1 B;  2F0H A;  5HGQ A;  3VDY A;  3X3M A;  2F4I A;  5IYC H;  1NY4 A;  4JOI A;  2YU9 H;  3DEP A;  4H0L C;  5I9P A;  5IE8 A;  1BO0 A;  4DV5 L;  3UDG A;  1HHV A;  1RKN A;  1JJ2 A;  4EQ5 A;  1AE2 A;  2NZO A;  1X6O A;  2Z1C A;  2FJ2 A;  2EXZ A;  1WTR A;  3D4W A;  1V9P A;  3ITP A;  3VR6 A;  4A3J G;  1K8A C;  3CC4 A;  4DV4 Q;  5C4X B;  1EY7 A;  4LF5 Q;  1X3P A;  3G6J B;  2L55 A;  2EQS A;  2A8V A;  3G4S A;  2EOT A;  1IBM L;  2X6L A;  3HP3 A;  1KLU D;  3NSW A;  4B3T Q;  1ILQ A;  5LMU L;  4NXM L;  4GKJ Q;  1HQR D;  3CF5 A;  4DR2 Q;  2R7Z G;  4BBS H;  2F0G A;  1T5E A;  3Q0A A;  4C3J H;  1UEB A;  1I6H B;  3H15 A;  3SXH A;  4ODG A;  3MHB A;  1U4L A;  2SOB A;  1F9S A;  1ENC A;  1RIP A;  2QIL A;  1A15 A;  3NQT A;  4KY6 A;  3OWF A;  4LF6 L;  4NDX A;  3PUV A;  1L0W A;  3J7Z C;  2A6H C;  3CCQ A;  4MTK A;  4L5S A;  2VW9 A;  3T51 B;  3S9W A;  4K5X A;  3FKI H;  1SXT A;  1JOQ A;  3KJO A;  2EYP A;  4JI7 L;  2UXB L;  3FPU B;  1AE3 A;  3IFT A;  4J1M A;  4HJ9 A;  2M9V A;  4J6H A;  2X69 A;  1HXY D;  4GLA C;  2CH4 A;  1LTT D;  2HDM A;  2B8F A;  3HFZ B;  3ICE A;  4NMZ A;  2L4N A;  4I65 A;  1H9S A;  1IL8 A;  2RVL A;  4MZ9 A;  1JIC A;  5GAD C;  1RHP A;  4A3D B;  1LTA D;  4K0K L;  3EFX D;  1LT4 D;  1GO3 E;  2LSS A;  2WV6 D;  4R8I A;  4HCE A;  4LWC A;  4R4I A;  1B8A A;  1NBW A;  3VR4 A;  3S1R H;  1TS5 A;  3MEH A;  4KKT A;  4OX9 Q;  2JE6 I;  2Q8R E;  1EQQ A;  5JJZ A;  3KLS X;  3CHB D;  4V19 0;  2EPB A;  4PNY A;  2VXW A;  1LAC A;  1Y1V B;  3GTO H;  4B3R Q;  4IZ8 A;  3RMH A;  1JT8 A;  4MN3 A;  2Q2U A;  1HR0 L;  1XPU A;  3D6C A;  1MI2 A;  1WJJ A;  2CHB D;  1HNW Q;  4BY1 B;  4DV1 Q;  3NBH A;  2BDO A;  3PIO A;  1AZQ A;  2OQ0 A;  5J3B A;  3PO3 H;  5ELE A;  1E3P A;  2NWG A;  2FMM A;  5D3D A;  4XQQ A;  2XIW A;  4X3T A;  2MO1 A;  4KKS A;  1WOC A;  1HPC A;  2L1B A;  2N3S A;  1L0Y B;  1QE6 A;  2R7F A;  5COY A;  4IPC A;  1GVP A;  3BVG A;  1CQV A;  1KRT A;  4C3I G;  2MHV A;  3M85 A;  2I5L X;  1B9M A;  3GTP H;  1WD0 A;  3DXJ C;  2CCZ A;  2ZXO A;  2PZW A;  3BDC A;  1LTI D;  4FXG C;  2PI2 A;  1FGB D;  4A3J H;  2VZA A;  4HSV A;  2R3Z A;  3J7A 5;  4G7O C;  1E1T A;  3HOY G;  1G2S A;  4DAV A;  3CKI B;  2D0P A;  4O0A A;  3NUC A;  1TWG B;  3LWU A;  4GLX A;  1IYJ B;  2F0I A;  1GOZ A;  2KQ3 A;  4OGQ C;  3RLF A;  3MTS A;  1QZG A;  1I4Q A;  2MJ8 A;  4WJ4 A;  3A8I E;  3C2P A;  3S1Q H;  1SNC A;  4LK1 C;  5T1G A;  1EY0 A;  5C4X G;  3HZX A;  5DM6 3;  1SMY C;  1EY8 A;  1SYB A;  1Q7Y C;  1UE6 A;  1G8Z D;  2EJM A;  4CHT B;  3TP5 A;  2Y0S E;  1SNM A;  3V2T A;  4XQN A;  4JI8 L;  1N33 Q;  4FNF A;  4V0B A;  2J0T D;  5AFW A;  4A3F B;  1GUT A;  3I73 A;  2Z9H A;  2K28 A;  3K58 A;  1XNQ L;  1VF7 A;  4S3S A;  2E2D C;  1ASZ A;  5IT9 E;  1U4M A;  1SJH D;  1TWF B;  3OIQ A;  1PTO B;  4P72 A;  4DR4 Q;  3M4O B;  2B2V C;  3TP7 A;  1HUM A;  4TRD A;  1QG7 A;  2ATW A;  4LFC L;  1B7Y B;  1S4Z A;  2RSN A;  4K2L A;  1MD2 D;  1TT2 A;  3PCO B;  3KBG A;  1G2T A;  2F0Q A;  3H0G B;  1WTQ A;  1ESR A;  5IYD H;  3ONA B;  3R2T A;  2A6H D;  3V96 A;  1K3R A;  2F0F A;  3D0F A;  4GN5 A;  2HHH Q;  3URY A;  3F2C A;  3S1N B;  4UP8 A;  1VQJ A;  5IP9 G;  1D5Z C;  2Y0S B;  5C3E B;  2F0J A;  3HOW H;  1K0S A;  2NB0 A;  1CKO A;  2LS0 1;  2UU9 Q;  1IBL Q;  1FNU A;  1TY0 A;  3DEO A;  2NZ1 D;  1LO5 D;  2QA4 A;  4ME3 A;  3BVM A;  2IW3 A;  1FVI A;  1NAP A;  2JA6 H;  2Z6B A;  1TWH H;  3JC6 6;  4ME5 A;  1PFS A;  3I4M B;  1GUN A;  5BN4 A;  1IBK L;  2ZT9 C;  4JCV E;  3LX0 A;  4B3S Q;  1FNW A;  1PFN A;  1WCM G;  2RCN A;  4EVO A;  1YNJ C;  4A3I G;  4KHP Q;  1VQB A;  1B44 D;  2EY5 A;  2HIV A;  3GV3 A;  4AYB G;  4Y7N B;  2F0M A;  5AJ3 Q;  1IHZ A;  1CA5 A;  2H5X A;  3T4A C;  3MZ5 A;  1ASY A;  2VB2 X;  1PYS B;  4JI4 Q;  3I4L A;  2JYO A;  2PNR C;  1L2F A;  1K8M A;  3K7U C;  3U50 C;  4O1N A;  2ZTE A;  5NUC A;  1EIH A;  1TS4 A;  2JP1 A;  2IJ0 A;  4DF7 A;  1OTC A;  5M5Y H;  1U0L A;  1K83 H;  2KA7 A;  4JOI C;  2K03 A;  2K14 A;  1X3E A;  1JB7 A;  2YTV A;  1LUZ A;  4YCV A;  5COR A;  1SYD A;  2CWA A;  1WVL A;  1A3U A;  5C0X I;  2NBF A;  2OTJ A;  2KEE A;  2EJF C;  1JE4 A;  4DA2 A;  4A75 A;  3EN2 A;  3TN2 A;  5BN5 A;  1Y8N B;  1M1K C;  4DGZ A;  5LL6 X;  1U4R A;  4ZAI A;  1Q12 A;  3CP0 A;  4RWS C;  1BDO A;  5JPM C;  1V1Q A;  2OEO A;  1WTP A;  1KD1 C;  3ULJ A;  3E5S A;  4IUU A;  1YJW A;  2YTY A;  5IIF A;  1A2T A;  2IX3 A;  2Z0S A;  4BA2 I;  3E9H A;  1QB5 D;  2EXD A;  3W5O A;  2O4X A;  4BY7 G;  5FO7 B;  1N32 Q;  2TMP A;  4RFB A;  4JI5 Q;  4A3G B;  1I6H H;  1A0I A;  2C35 B;  1WTH A;  2PZT A;  1EOT A;  3K81 C;  4HAE A;  2A5H A;  1YIJ A;  2E5L L;  4LUV A;  5ELN A;  1SEB D;  4A93 B;  1XMO Q;  1DOL A;  2K5N A;  4DAM A;  2KCN A;  1WYD A;  2B2Y A;  2YYZ A;  3A8J E;  3P1H A;  4GN4 B;  4OXP A;  5KRU A;  3I4O A;  3QG1 A;  1V1P A;  3RLN A; 
#chains in the Genus database with same CATH homology
 1E1O A;  4DR6 L;  3M3Y H;  4QQB X;  3CCM A;  1QVG A;  3RZD H;  3MXN B;  2GN5 A;  5C44 H;  1HNX L;  1N34 L;  4YWL A;  3I7F A;  4B3R L;  2YTX A;  1BKB A;  3PO2 G;  2ID0 A;  3CCJ A;  4GLV B;  4A93 G;  5H1S E;  4GKK L;  2UUB L;  4A3B H;  2UUA Q;  4GS3 A;  2R93 H;  4L5T A;  1PH6 A;  4B3M Q;  2WP8 J;  3KF8 B;  1B70 B;  4HJ8 A;  1PVO A;  1QVF A;  3H3V H;  1HJP A;  4NXN L;  3UDF A;  5M3M H;  1PH8 A;  2JJQ A;  4JI1 Q;  1OXV A;  4BA1 I;  4A4I A;  1K8G A;  1QUQ B;  4DV6 L;  4A3D H;  3PV0 A;  4PZ7 A;  3J81 i;  1G29 1;  1D7Q A;  3J81 c;  3A5U A;  4R4O A;  2RF4 A;  1X9N A;  1EIY B;  4R4T A;  3CCL A;  2JEA I;  3KJP A;  2N8N A;  1VQA A;  3UDX A;  4DUZ Q;  4JYA L;  1J5E L;  3TEH B;  2F4V L;  5JEA J;  5IWA Q;  3A5Z B;  4APV A;  5M5X H;  3JAM i;  4LF8 Q;  3TRZ A;  4YHH L;  5BR8 Q;  4X64 Q;  3JAM c;  2VQF Q;  2B63 G;  1VQC A;  1SE8 A;  2OCE A;  1MJE A;  2V1C C;  5LMN L;  5IYD G;  4DR3 L;  1UE1 A;  4A76 A;  4LFB Q;  2PQA B;  4A3L G;  1NMF A;  1R9T H;  2E5L Q;  1XPO A;  4R4C A;  1Y1V H;  4LFA Q;  4RG1 A;  3CAM A;  3M9B A;  4PMW A;  1X65 A;  3RN2 A;  3KDF A;  4DR5 L;  2D0O A;  1C7Y A;  1CUK A;  4C3I H;  2AKW B;  2EIF A;  3L0O A;  4BY1 H;  3HOW G;  2NN6 I;  1X54 A;  4OWX B;  1I94 Q;  1EIF A;  4LF5 L;  1HNX Q;  3S2H H;  1N34 Q;  2XGT A;  2R92 G;  1LTL A;  2N49 A;  5LMN W;  2ASB A;  2OQK A;  1XNR L;  3HOZ H;  2UUB Q;  3CMA A;  3I55 A;  4GKK Q;  1WI5 A;  2IHF A;  2K4K A;  3F2D A;  5M3F G;  3U4Z A;  3Q8D A;  5FLM G;  4B3T L;  1X3G A;  1YZ6 A;  4O2D A;  4NXN Q;  1VCI A;  5C0X J;  1FJG L;  2L15 A;  3W1G A;  4IFD G;  1HZB A;  2BA0 A;  4GKJ L;  3GTJ H;  3G6E A;  4DR2 L;  1CSP A;  1VQE A;  5DLQ E;  1Q86 C;  5JJI A;  4P75 A;  4C3H H;  3HOY H;  2CKZ B;  1VS0 A;  4DV6 Q;  3S17 H;  3PIP A;  1VQL A;  1OXX K;  4LF7 L;  4JBK A;  2NVT H;  3PUX A;  4OWT B;  3UE1 A;  4WJ3 M;  4LF9 L;  2HQL A;  2UUC L;  2JA8 G;  1K0R A;  2K50 A;  1GKH A;  4PG3 A;  4JI2 Q;  4QY7 A;  2ZJP A;  2JA9 A;  1EOV A;  2PI2 E;  1KIX A;  3PO3 G;  3S2D H;  4MTN A;  1HZA A;  4JYA Q;  1J5E Q;  2K75 A;  2WFW A;  3PUY A;  4X65 L;  1Q1E A;  3NBH B;  1EYG A;  2KHI A;  3AQQ A;  3F8T A;  3M7N A;  2OTL A;  1HZ9 A;  1FGU A;  2JK8 A;  1SRU A;  3LGJ A;  4BBR G;  2Q2H A;  2E2H H;  1CKN A;  2VNU D;  4KHZ A;  2AMC B;  5HGQ A;  3VDY A;  5LMN Q;  2UXD L;  4DR3 Q;  4DUY L;  5IYC H;  4HIO A;  1NY4 A;  4JOI A;  2JA5 H;  5C4X H;  2BA1 A;  2YU9 H;  1TWC H;  5HY6 A;  1VQP A;  2KEN A;  5IE8 A;  4DV5 L;  3UDG A;  4H02 A;  3K7A H;  4IJH A;  3RLN A;  1JJ2 A;  1VQN A;  4EQ5 A;  1AE2 A;  2NZO A;  1X6O A;  4DR5 Q;  4IOA A;  1V9P A;  3KYH C;  3A74 A;  1L1O A;  3NEM A;  1GD7 A;  1UWV A;  4A3J G;  1K8A C;  3CC4 A;  4DV4 Q;  1VQK A;  1OXT A;  5EAY A;  2I0Q A;  3F1Z A;  2NVY H;  1E24 A;  3GTQ H;  1N9W A;  4LF5 Q;  2HHH L;  2E8G A;  2EQS A;  4JG2 A;  4P74 A;  3G4S A;  4DV0 Q;  1PH9 A;  1IBM L;  2A8V A;  3BU2 A;  1XNR Q;  2IY5 B;  4Y52 H;  1KAW A;  1VQ7 A;  4JBM A;  3CCS A;  2DGY A;  2YV5 A;  4B3T Q;  4HIM A;  4NPS A;  5LMU L;  4LF4 Q;  4NXM L;  2VUM G;  4LUZ A;  4GKJ Q;  4A3K G;  2UXC L;  1I3Q H;  4UP9 A;  3UDI A;  3CF5 A;  4DR2 Q;  3STB C;  2R7Z G;  4BBS H;  4OON A;  4A3F H;  2ZJQ A;  2QGQ A;  4C3J H;  4EX5 A;  1UEB A;  3HOV G;  4OX9 L;  3OW2 A;  4LF7 Q;  2E2J H;  2DUD A;  3H15 A;  1QUQ A;  3GO5 A;  3NEL A;  2ZM6 Q;  1TWF H;  1YIT A;  1RIP A;  3M4O H;  1QVC A;  3B6Y A;  1IXR A;  4HJ7 A;  3ULP A;  3CPW A;  1VQI A;  4PZ6 A;  2MNA A;  1VQ9 A;  4JI6 Q;  4LF6 L;  1SN8 A;  1YVC A;  3PUV A;  4LW1 A;  1L0W A;  5IP9 H;  4X65 Q;  3J7Z C;  3CCQ A;  3CCV A;  1M90 C;  3AEV A;  2HIX A;  1HNW L;  4L5S A;  2WB1 E;  4DV1 L;  2VL6 A;  3PUW A;  2VW9 A;  1Y1W G;  1E22 A;  1SR3 A;  1I50 H;  3H0G H;  5FJ8 G;  1NJI C;  2QEX A;  3FKI H;  4IPG A;  4JI3 L;  3UE0 A;  5JEA G;  2JA7 G;  2UXD Q;  1JJG A;  3KJO A;  5E7N A;  3KF6 B;  5GRO A;  1VQD A;  4JI7 L;  3NEN A;  2UXB L;  1AE3 A;  1GM5 A;  4HJ9 A;  2B29 A;  4DV5 Q;  4GLA C;  3S1N H;  5AJ3 L;  3CC2 A;  5ELO A;  3HFZ B;  3L7Z C;  3PF5 A;  4JI0 L;  3GTL H;  4DPG A;  5C3E H;  3T1H Q;  3ICE A;  1KXL A;  1S3O A;  2AWO A;  3I4N G;  2MFI A;  4POF A;  4MZ9 A;  5GAD C;  2IX0 A;  3HKZ E;  1TXY A;  4QL5 A;  4K0K L;  3EIV A;  4X66 Q;  1GO3 E;  5C44 G;  2LSS A;  3SGI A;  4JC0 A;  3CME A;  2VY3 A;  1WCM H;  2Q2I A;  4A3E H;  1IBM Q;  4LWC A;  4R4I A;  3J80 i;  4A3B G;  4A3I H;  3J80 c;  1B8A A;  1NBW A;  1N36 L;  5IP7 H;  1P8L A;  4JV5 L;  1V43 A;  1YHA A;  4PZ8 A;  4TVA B;  5M3M G;  3CXC A;  5LMU Q;  5IYB H;  1A8V A;  3S1R H;  1PH2 A;  4NXM Q;  3I4M H;  3W1B A;  4DNI A;  1A62 A;  2NZH A;  1QZH A;  1RL2 A;  1YHQ A;  4A3D G;  5K36 G;  1EQR A;  1KC8 C;  4OO1 G;  1YBY A;  4OX9 Q;  2JE6 I;  2R6G A;  1EQQ A;  4TQU S;  5C0X G;  4C2M H;  1VQG A;  1IL2 A;  3I56 A;  3TRE A;  2F3I A;  2Q2T A;  5M3F H;  2IX1 A;  2MO0 A;  4DR6 Q;  2CWP A;  4R4Q A;  2K5H A;  3GTO H;  4B3R Q;  3A0J A;  3PGZ A;  4LF6 Q;  1JT8 A;  3T1Y L;  4Y7N H;  3TS0 A;  2Q2U A;  1HR0 L;  1XPU A;  5GAH C;  1WJJ A;  2WB1 G;  1HNW Q;  1IZ6 A;  4DV1 Q;  2MQH A;  3PUZ A;  3CCR A;  1Q1B A;  2AWN A;  4YCW A;  3PIO A;  4JBJ A;  1EUJ A;  1I5F A;  2OQ0 A;  4JI3 Q;  3S1M H;  5J3B A;  3PO3 H;  4AH6 A;  5C4J H;  1E3P A;  3MEF A;  2Z6K C;  1PA6 A;  4JI7 Q;  2UXB Q;  4XTC S;  1JE5 A;  1Y1V G;  4YY3 L;  3HOX H;  2MO1 A;  4QGU A;  1UE5 A;  3K80 C;  4A3C H;  1SLJ A;  1WOC A;  2N3S A;  4P73 A;  1G6P A;  3F2B A;  1VQF A;  4JI0 Q;  2R7F A;  3CCU A;  4IPC A;  1GVP A;  1KRT A;  3RLO A;  3M85 A;  2RHS B;  4BY1 G;  1N33 L;  2I5L X;  4BXX H;  2F4V Q;  1CKM A;  4DV3 L;  3HKZ G;  1HR0 W;  3GD7 A;  3CCE A;  3FP9 A;  3GTP H;  4YHH Q;  1FL0 A;  4K0K Q;  2CCZ A;  2LXK A;  3KDF B;  4IJL A;  2Z6K A;  2B3G A;  1TWG H;  1O7I A;  4X6A H;  4DR4 L;  3AFP A;  2K5V A;  4JV5 Q;  3BZK A;  2PI2 A;  1K9M C;  1MJC A;  1P16 A;  2F52 A;  4A3J H;  2VZA A;  4BY7 H;  3KFU A;  3J7A 5;  2D62 A;  3HOU H;  1E1T A;  2VS1 A;  3HOY G;  4KI0 A;  3M4P A;  2NVX H;  2D0P A;  4O0A A;  1G51 A;  4RMF A;  3FHW A;  4GLX A;  1IYJ B;  2WAQ E;  1PH5 A;  3BJU A;  2PMZ E;  1W2B A;  3RLF A;  1PHJ A;  1CSQ A;  1HH2 P;  1QZG A;  3T1Y Q;  3E0E A;  1X3F A;  4YWK A;  2N78 A;  3S16 H;  2ZJR A;  4IO9 A;  1FJG Q;  4ALP A;  4A3G H;  4A3M H;  4IFD I;  4WJ4 A;  3S1Q H;  1VQM A;  2UU9 L;  1A63 A;  1NE3 A;  3OYY A;  5IYC G;  1IBL L;  4UY8 C;  2JA5 G;  1VQH A;  1K73 C;  3PO2 H;  5C4X G;  5GQO A;  2A1A A;  5IWA L;  4A93 H;  1H95 A;  1CKN B;  4YY3 Q;  3S14 H;  1EWI A;  1Q7Y C;  4LF9 Q;  3K0X A;  1UE6 A;  4YWM A;  2UUC Q;  2ALY B;  2RHQ B;  3GTM H;  3E9I A;  4DR7 L;  4AIM A;  2Y0S E;  1VQ4 A;  4JI8 L;  1SMX A;  1N33 Q;  4AQY L;  4DV3 Q;  4DK3 C;  1XNQ L;  4DV7 L;  5JJK A;  1XTD A;  2OWO A;  1ASZ A;  4B3S L;  3RN5 A;  3OTO L;  2VQE L;  5GAG C;  2ZTD A;  4IPD A;  4UP7 A;  3STB D;  1L1O B;  4P72 A;  4DUY Q;  3G48 A;  4DR4 Q;  4KHP L;  3M4Q A;  1YEZ A;  3RR5 A;  4L5Q A;  2ATW A;  2NN6 G;  2CFM A;  4LFC L;  1B7Y B;  2PQA A;  4GOP B;  1NTG A;  1I94 L;  1JMC A;  4AYB E;  3PCO B;  4DV2 L;  2E2I H;  2B63 H;  4BBS G;  4A3F G;  3CQZ H;  3RZO H;  1Z9F A;  4GNX B;  3U58 A;  1YI2 A;  3CD6 A;  5IY0 A;  5IYD H;  2WAQ G;  3HKS A;  3I2Z A;  4DKA C;  4KLK A;  4A3L H;  1MIU A;  4JI4 L;  1LYL A;  1K3R A;  1YHB A;  3D0F A;  4GN5 A;  3J81 j;  2HHH Q;  3WWV A;  1WFQ A;  3F2C A;  1C9O A;  1D8L A;  4JBW A;  4LNQ A;  4UP8 A;  1VQJ A;  2KBN A;  5IP9 G;  2R7D A;  1Q81 C;  2R93 G;  1SFO H;  1YJN A;  1UE7 A;  3HOW H;  4R1J A;  2BH2 A;  3S15 H;  3S24 A;  1BBW A;  2UXC Q;  1X56 A;  1CKO A;  3H0G G;  3ULL A;  1HNZ L;  4JI2 L;  3FKI G;  2UU9 Q;  2LXJ A;  2PNH A;  4P71 A;  3GDE A;  4MNO A;  1IBL Q;  3TQY A;  1XMQ L;  2R92 H;  3PF4 A;  1OXS C;  1T9H A;  2JQO A;  3AYH B;  3PSI A;  4L5R C;  2I5M X;  1U5K A;  3K8A A;  4ME3 A;  4QIW E;  3G71 A;  2QA4 A;  2HT1 A;  2GVB A;  1XJV A;  5M5W H;  1FVI A;  5FLM H;  2JA6 H;  1TWH H;  2K52 A;  3JC6 6;  4UPA A;  4DR7 Q;  2Y0S G;  5C3E G;  1PFS A;  4DK6 C;  3ERS X;  3KLW A;  3RNU A;  4JI8 Q;  5GAE C;  1TWA H;  2ZTC A;  3U4V A;  4AQY Q;  3AFQ A;  1XNQ Q;  4DV7 Q;  1IBK L;  1YNX A;  4JCV E;  4IOC A;  1VQ6 A;  4DAY B;  4B3S Q;  3OTO Q;  2VQE Q;  1Q46 A;  1WCM G;  2RCN A;  5FLX c;  4A3E G;  2JA8 H;  1W3S A;  1AH9 A;  3ER0 A;  4A3I G;  4KHP Q;  1VQB A;  5IP7 G;  5JJL A;  2ES2 A;  1YJ9 A;  1PYB A;  2HIV A;  3KOJ A;  5IYB G;  4DV4 L;  4AYB G;  1N8R C;  1VQ8 A;  4LFC Q;  3I4M G;  1PV4 A;  1KL9 A;  1N32 L;  4DV2 Q;  4JI5 L;  4YCU A;  5AJ3 Q;  4BBR H;  3CC7 A;  1MKH A;  1Z47 A;  2A19 A;  1J6Q A;  4DV0 L;  2H5X A;  3D31 A;  1ASY A;  1Y14 B;  1PYS B;  1JJC B;  1NMG A;  4NB3 A;  2XTI A;  4JI4 Q;  4POG A;  4LF4 L;  1L2F A;  5IT9 c;  3K7U C;  4GN3 B;  1HZC A;  3U50 C;  1XMO L;  1DGS A;  4LUO A;  2ZTE A;  2FXQ A;  3CPF A;  1OXU A;  3HOZ G;  1N36 Q;  4DR1 L;  1XPR A;  5M5Y H;  4X62 L;  1U0L A;  2I5H A;  1OTC A;  3H3V I;  1K83 H;  4JOI C;  1S72 A;  1PH1 A;  2IT1 A;  2K14 A;  1X3E A;  2KCT A;  4FDB A;  2ZM6 L;  1HNZ Q;  2BH8 A;  1JB7 A;  4QJF A;  2YTV A;  1E7Z A;  1LUZ A;  4YCV A;  2CWA A;  1XMQ Q;  4IFD J;  4OO1 I;  1BBU A;  4JI6 L;  5C0X I;  2OTJ A;  1X55 A;  3HOX G;  4J15 A;  2UUA L;  4B3M L;  1L1O C;  1LM0 A;  2GVA A;  4A75 A;  4A3C G;  3GTG H;  1Q8K A;  3EN2 A;  3ZJY C;  4HJA A;  1VQO A;  1KQS A;  2VUM H;  4A3K H;  1PH3 A;  4JI1 L;  4HIK A;  4HJ5 A;  1S40 A;  2AHO B;  1PH7 A;  1M1K C;  4GOP C;  2R7Z H;  4BXX G;  1C0A A;  3EBE A;  1Q82 C;  3HOV H;  1Q12 A;  4IPH A;  1IBK Q;  3CP0 A;  1HR0 Q;  2KCM A;  4GNX C;  1V1Q A;  1KD1 C;  3L2P A;  2JEB I;  3ULJ A;  4OWW B;  3BZC A;  1PH4 A;  3DM3 A;  3T1H L;  4DUZ L;  1KRS A;  1VQ5 A;  1YJW A;  2YTY A;  2CQO A;  2Z0S A;  4BA2 I;  3KF6 A;  3E9H A;  2KHJ A;  3IRB A;  4LF8 L;  2EXD A;  3W5O A;  4BY7 G;  4X64 L;  5BR8 L;  4X66 L;  2VQF L;  1N32 Q;  4JI5 Q;  3HOU G;  4GOP A;  1Y1W H;  1I6H H;  1A0I A;  4HID A;  5FJ8 H;  2C35 B;  2JA7 H;  1BVS A;  3TS2 A;  3K81 C;  4GNX A;  4LFB L;  1YIJ A;  2E5L L;  4LUV A;  5ELN A;  4LFA L;  2JA6 G;  1XMO Q;  1KHI A;  2IHE A;  2K5N A;  4DAM A;  3DLL A;  1EFW A;  2NVQ H;  1WYD A;  3CW2 C;  3GTK H;  2YYZ A;  4GN4 B;  4OXP A;  4XIG S;  4DR1 Q;  3I4O A;  4X62 Q;  3I4N H;  4A3G G;  4A3M G;  1SRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...