1QVCA

Crystal structure analysis of single stranded dna binding protein (ssb) from e.coli
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
145
Chain Sequence
b'ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of functional loops and the C-terminal segment of a single-stranded DNA binding protein elucidated by X-Ray structure analysis.
pubmed rcsb
molecule keywords SINGLE STRANDED DNA BINDING PROTEIN MONOMER
source organism Escherichia coli
molecule tags Dna binding protein
total genus 15
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1999-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1qvcA00
1V1QA 1XTDA 4PZ6A 1JJGA 4IFDG 2JJQA 3HOZH 1WI5A 3A0JA 4DV4Q 1VQAA 1TWAH 1VQ9A 2MO1A 4OX9L 4JOIC 1LM0A 3K80C 3F1ZA 4NXMQ 3I4OA 2VUMH 3U58A 1PH9A 1IBKL 2JA5H 1CKOA 2PQAB 1GD7A 1N34Q 4HJ7A 2MQHA 2N49A 1PH1A 2Q2UA 4JYAQ 1I94L 1HNZQ 2F3IA 4APVA 4YWKA 5M3MH 5DLQE 3SGIA 2YTVA 4JBKA 3KF8B 4JC0A 3I4NG 3CF5A 4QGUA 4DV1Q 3ICEA 2ZJPA 4DV2Q 1QVCA 4BXXH 1JE5A 4QIWE 2I5MX 2QA4A 1C7YA 4HJ5A 4FDBA 5JEAJ 4LUVA 4P74A 4YWLA 3GTKH 4A3DG 4DV3Q 1VQ4A 1AE3A 1TWHH 1X9NA 4DR3L 4DR2Q 3GO5A 4WJ4A 4DR5Q 1PH4A 1YHBA 1VQIA 3CCSA 1I6HH 2ATWA 3T1HL 2UXDQ 5BR8L 3UE0A 5C0XJ 1YJWA 1E1OA 1YNXA 3EIVA 4IOCA 4A3LH 1HNWQ 4L5TA 1XPRA 3I4MG 4LF9L 2K5HA 4UP7A 4JI4L 2MNAA 1HZCA 3KF6A 1RL2A 2C35B 4DR7L 2E2HH 3G4SA 5C4JH 2R7DA 3CC2A 2JE6I 2MO0A 2CWAA 1Q81C 4POFA 1K9MC 1VQKA 3CQZH 3OYYA 4X66L 3GTPH 2VW9A 3CP0A 3AFPA 2NZOA 4IO9A 4Y7NH 1FL0A 1OXTA 5H1SE 4KI0A 4DUZQ 1C0AA 2R6GA 1S40A 2PNHA 2XTIA 3A74A 4OWTB 1L1OA 2AWOA 3HOWH 1KRSA 4JI6L 2KHJA 2YU9H 2A19A 1O7IA 1Z47A 4A3KG 4QJFA 4A3JH 1XMQQ 2R92H 2ALYB 1BBWA 1SROA 2HT1A 4A3GG 1VQ5A 1I3QH 1EOVA 5AJ3L 3UE1A 2JEAI 3STBC 1NBWA 1YHAA 1C9OA 3HOZG 4DPGA 2WB1E 3G71A 1XNQL 4YHHL 1SN8A 2PQAA 3AQQA 4POGA 4BY1H 4OWXB 3PIOA 3MXNB 4GOPC 1N33Q 4BBRH 3PUZA 2CWPA 2YYZA 2UUBQ 2AKWB 2DUDA 1PH6A 4BXXG 4NXNQ 2JQOA 1Q1EA 4R4CA 1IBML 1EYGA 4HIMA 2AHOB 1PH8A 2UUAL 2B29A 4MZ9A 3F2CA 4AQYQ 2E2JH 4JI7L 1FJGL 4DR6Q 2VNUD 2Q2IA 2QGQA 5C4XH 4DV6L 1E1TA 1EFWA 2F4VQ 3B6YA 4JI1L 4A3CH 4DUYL 3ER0A 3S24A 1YVCA 1JJ2A 2ZJQA 3K7UC 4GKKL 3TQYA 4JI3L 3KLWA 2R7FA 4JI0Q 4YCVA 2E5LQ 3KDFB 2JA7H 4LF6Q 1SR3A 4AH6A 2IT1A 4ALPA 4L5SA 2F52A 5LMNQ 1MKHA 4XTCS 1EQQA 4NXML 1QVFA 1XNRQ 4P75A 3CPWA 2R7ZH 2KCTA 3KYHC 4LF8L 1K83H 3M4OH 3OTOL 1L1OC 3AYHB 4DV0Q 1HR0W 3PO2H 4HIDA 1HNZL 4IFDJ 2DGYA 4EQ5A 4A3BH 3K7AH 3HOVH 2VQEL 4DV1L 1LYLA 3NELA 2GVBA 4DV2L 2JA6G 1UE5A 1K0RA 4KLKA 1KRTA 1K8GA 2UXBL 1VQEA 1V43A 3HOWG 5GAEC 4JI5L 5C44H 4DAMA 4DR2L 4LF5L 4OO1G 3TS0A 3S1NH 4DK6C 2BH2A 4TQUS 4JI8L 4DR1L 2PI2A 4GLXA 1IBLQ 2PMZE 3F2BA 2UXDL 2WAQG 3I7FA 5FLXc 1N32Q 2UUCQ 4HJ9A 3FP9A 1Q8KA 3J80c 2RF4A 1KXLA 4DNIA 2NVXH 2Z0SA 4LFBL 1WJJA 1W2BA 4PMWA 1MJEA 1UEBA 2NVTH 1I50H 5M5YH 1K8AC 4H02A 4HJ8A 4A3EH 5J3BA 3H15A 5IT9c 1U5KA 3S14H 3U50C 4X64Q 1N36L 3GDEA 4RG1A 3M4QA 4GKJL 1KQSA 3HOUG 1SMXA 2GVAA 1YZ6A 4RMFA 4B3SL 1KD1C 5M3FG 1QUQB 5C3EG 4DAYB 3GTGH 5EAYA 4JI2Q 2ASBA 2IHEA 2HQLA 1GO3E 1M90C 4UP9A 1Y1VH 3T1YQ 5JJIA 1A0IA 4DUZL 1BKBA 5IP7H 1J5EQ 4KHPL 5IP9H 3KFUA 1VQCA 1GM5A 2BH8A 3TREA 1VQMA 5C4XG 1Q82C 4DR4L 2CFMA 1XMQL 1X3FA 4B3RQ 1G6PA 1KL9A 1CUKA 5C0XI 3HOXH 1PYBA 3HFZB 5IYCG 3IRBA 4A3MH 5GROA 2OTJA 3W5OA 5FLMG 2NVQH 2VQFQ 4YY3Q 2ZM6L 3HOYH 3PUXA 4QY7A 1WCMG 1EWIA 2YTXA 4P72A 4DV7L 3CCLA 1DGSA 1XMOL 2N78A 4GS3A 1EIFA 4IOAA 4B3TQ 2B63G 3I2ZA 2UU9Q 4IJHA 4A3BG 3H0GG 3CCUA 4A3IH 2UUBL 4A93G 1YI2A 3PUWA 2K50A 4LF4L 4NXNL 3NBHB 1TXYA 5IWAL 5JJLA 3HKSA 5M5XH 3CD6A 4DV5L 1UE1A 1X54A 1PV4A 4GNXA 1K3RA 2CCZA 4DR6L 4X62L 1HZBA 3K0XA 4QL5A 1HNXL 1KHIA 1VQJA 2RHQB 4LUZA 1HJPA 2IHFA 3S1MH 4BBSG 1OXUA 3PO3H 2K14A 1VQ8A 4B3MQ 1AE2A 3ZJYC 4PG3A 3LGJA 4JI0L 1PH2A 2JA8G 3K8AA 4LF6L 2D0OA 4GN5A 4LFAL 1CKMA 1JMCA 1WOCA 5LMUQ 2NN6I 4JV5Q 1YBYA 1GVPA 1D7QA 2QEXA 5K36G 4JBWA 1HR0L 2VS1A 3G48A 1S3OA 5ELOA 4OX9Q 3BU2A 2IX1A 2N3SA 4YCUA 1IBKQ 2VUMG 2JA5G 2KHIA 1XJVA 1J6QA 4A3FH 4KHZA 5M5WH 5GAGC 1FVIA 1Q7YC 5IP7G 5IYDH 4XIGS 5IP9G 5M3MG 1G51A 4R1JA 3FHWA 3PGZA 4HIOA 2Z6KA 3CCMA 3S2DH 3AEVA 2JA9A 3J7ZC 3RZOH 1L0WA 3FKIH 5ELNA 1QVGA 2Q2TA 3S15H 1P16A 2HIXA 4DR3Q 1HH2P 2GN5A 2YV5A 1U0LA 1YIJA 4C3HH 2HIVA 1Q12A 2R93H 4K0KL 4C2MH 3DM3A 1YJNA 1OXXK 3KOJA 5BR8Q 4BA1I 1PHJA 2I0QA 2OTLA 1AH9A 4X65Q 3ERSX 1NTGA 4YWMA 3I56A 4A3LG 2LXJA 1B8AA 3TS2A 4DV4L 1Y14B 2K75A 5GAHC 4O0AA 4GNXC 4LF9Q 3S16H 4NB3A 5LMNW 4JI4Q 2WAQE 2Q2HA 3PV0A 3J81j 1IL2A 3J7A5 3GTOH 3STBD 2YTYA 4JI2L 1X3EA 4UP8A 4LUOA 4UPAA 1N34L 3CC4A 3S2HH 4X66Q 4JYAL 1VQPA 2L15A 1K73C 3I4NH 4R4IA 4C3JH 3L2PA 3CMAA 1VQNA 5E7NA 1T9HA 4P71A 5FJ8H 1TWCH 4HJAA 4B3RL 1PH3A 2OCEA 2V1CC 4A3DH 2K5VA 4DV3L 3E0EA 4JI6Q 3GTMH 1N9WA 4GOPB 4DR5L 1NJIC 2MFIA 2CKZB 4A3JG 2R92G 1TWFH 2IX0A 3UDIA 3RN5A 3VDYA 3CW2C 1UE6A 4GLVB 4X6AH 5IE8A 1TWGH 4MTNA 5AJ3Q 4UY8C 4OONA 3PUYA 1HNWL 4GLAC 4JCVE 4L5QA 3GTQH 3H3VH 2ID0A 4PZ7A 5GADC 1N8RC 1PFSA 2UU9L 2K4KA 4L5RC 3H3VI 3D0FA 2Z6KC 3ULLA 2UXCQ 3RNUA 4OXPA 2D0PA 1R9TH 4HIKA 4GN4B 3BZKA 3CXCA 3CC7A 1IYJB 1PA6A 2VZAA 4BY7H 3UDFA 3KJOA 3PF4A 3CPFA 2Y0SG 3A5ZB 5IYDG 4BY1G 3J81c 5IYBH 2WFWA 4BBRG 2K5NA 1JB7A 1VQBA 3RR5A 3K81C 3NENA 3J81i 1BBUA 1VQOA 1VCIA 2UUAQ 1L1OB 1E22A 1OXVA 1V9PA 4JI7Q 2EIFA 2RCNA 3CCRA 4DV6Q 2ZTDA 5IY0A 3M3YH 2K52A 4IPCA 4JI1Q 3Q8DA 4LNQA 4WJ3M 2D62A 3D31A 1PH7A 4LFCQ 4O2DA 1SFOH 4A3CG 1MIUA 1YHQA 1E24A 4IJLA 4GKKQ 5LMUL 1D8LA 4ME3A 4JI3Q 3E9HA 3I55A 4A76A 1S72A 3S1QH 2IY5B 3KDFA 2JA7G 4P73A 4JBJA 3RN2A 3EBEA 1I5FA 4LF8Q 2R7ZG 2B3GA 3OTOQ 1WYDA 3MEFA 1YEZA 3GTJH 1HZ9A 3PO2G 1SE8A 2XGTA 4PZ8A 2JEBI 4C3IH 1PYSB 1N33L 3U4VA 1H95A 2VQEQ 3HOVG 3ULJA 2NZHA 5FJ8G 3PF5A 4DK3C 3RLNA 1BVSA 4LF7Q 1B7YB 2PI2E 1CKNB 3G6EA 2OQ0A 2OWOA 3GTLH 3CMEA 2UXBQ 1RIPA 1G291 1X3GA 4AQYL 4JI5Q 4LF5Q 2AWNA 5C44G 4GOPA 3OW2A 3TRZA 2F4VL 4JI8Q 3A5UA 3CCEA 4DR1Q 1XPUA 4Y52H 1VQGA 3GD7A 2NVYH 1KAWA 4A75A 1B70B 4MNOA 4X65L 2E5LL 3PUVA 4LFBQ 2HHHQ 5LMNL 1XNRL 4JBMA 3S17H 1LUZA 3W1GA 4A3EG 4BY7G 1N36Q 1VS0A 4DV0L 4BA2I 4GKJQ 2WP8J 1EQRA 3M85A 1OXSC 4B3SQ 2KCMA 3CCQA 1JJCB 3S1RH 5IYBG 1QUQA 3NEMA 1EUJA 2VL6A 1Y1WH 4LW1A 5JEAG 2JA6H 1LTLA 3PSIA 3TEHB 1Y1VG 2N8NA 3EN2A 3UDGA 1VQFA 1X6OA 1I94Q 1CSPA 4KHPQ 1HZAA 1P8LA 3AFQA 3HKZE 1Q86C 2ES2A 4IPGA 4LWCA 4DR4Q 3DLLA 3F2DA 4OO1I 1NE3A 5C0XG 1IBLL 4R4QA 3M7NA 3HOXG 1N32L 1KC8C 2UUCL 2OQKA 3JC66 1WFQA 1XPOA 4A3MG 1Q46A 2FXQA 2I5HA 2ZJRA 4JV5L 2ZM6Q 3M4PA 4DKAC 1VQ7A 1VQ6A 2EQSA 3T1HQ 2UXCL 3HOYG 1IZ6A 4DV7Q 2ZTCA 4GN3B 1A63A 3W1BA 1XMOQ 1MJCA 2I5LX 1SLJA 4X64L 4IFDI 3E9IA 4R4TA 1SRUA 3BZCA 3L7ZC 4R4OA 3M9BA 3HOUH 1X65A 5M3FH 5C3EH 3HKZG 4DR7Q 4LF4Q 2JK8A 4A3IG 1QZHA 5IWAQ 3T1YL 4YCWA 1CKNA 1J5EL 1IXRA 1UWVA 4DV5Q 1PH5A 3U4ZA 2LXKA 1OTCA 1Z9FA 4X62Q 4JG2A 3F8TA 4JOIA 3BJUA 1YJ9A 1HNXQ 2E2IH 4J15A 2E8GA 1PVOA 1YITA 3WWVA 2H5XA 1NMFA 4NPSA 4LFCL 1A8VA 1NMGA 1VQDA 2WB1G 2Y0SE 5IYCH 3RLOA 3UDXA 3PO3G 1JT8A 1QZGA 1A62A 1E3PA 5FLMH 1X55A 2VQFL 3RLFA 4AIMA 4LFAQ 4AYBE 2A1AA 4YY3L 1WCMH 2NN6G 2LSSA 2KENA 3PIPA 5GQOA 4TVAB 1GKHA 1HR0Q 2CQOA 3KJPA 5HY6A 2B63H 3I4MH 1ASYA 4B3TL 1E7ZA 3CAMA 3RZDH 1NY4A 1XNQQ 4YHHQ 3H0GH 3KF6B 1ASZA 4A93H 2A8VA 3JAMc 1KIXA 1Y1WG 1FGUA 2EXDA 1VQLA 4A3FG 3CCJA 4LF7L 1W3SA 4GNXB 3JAMi 4A4IA 4QQBX 1L2FA 1Q1BA 2BA1A 4EX5A 1EIYB 4OWWB 4BBSH 1VQHA 3ULPA 4AYBG 1IBMQ 2BA0A 3FKIG 3CCVA 4B3ML 5HGQA 2VY3A 4A3KH 1FJGQ 4IPDA 4IPHA 2JA8H 2RHSB 4A3GH 1X56A 2KBNA 2HHHL 4K0KQ 4DUYQ 1M1KC 2R93G 3L0OA 1UE7A 3J80i 1CSQA 5JJKA 2AMCB 3PCOB 2ZTEA
chains in the Genus database with same CATH superfamily
5A35A 1FNVA 5K36H 4PZ6A 5KNCA 2JJQA 4PNYA 1TWAH 2DY8A 3K80C 1SNPA 4NXMQ 3I4OA 3U58A 1PH9A 1IBKL 2JA5H 1EYCA 2PQAB 1N34Q 3NTKA 1PH1A 1HNZQ 4IUQA 3NPPA 5CV4A 3CF5A 1AZQA 3ICEA 1IW7C 1JWUD 1UUPA 3Q22A 4BXXH 1ESRA 1JE5A 2AQ3B 4QIWE 2I5MX 1C7YA 3K59A 4HJ5A 3ND8A 1VQ4A 1AE3A 1STYA 3A54A 1KNEA 3GO5A 4WJ4A 1ENAA 3CCSA 3PO2B 1I6HH 2J4XA 3OMCA 2UXDQ 4A3BB 2AUKA 1YJWA 2NWGA 1E1OA 2EYMA 5ELFA 4IOCA 1S5ED 4LF9L 1SMYD 4WFN3 2F0WA 3CC2A 1K9MC 2DJGC 1IKMA 2ZXPA 3WDNA 3CP0A 1TR5A 4K2LA 1VDZA 4Y7NH 3V2TA 1CQVA 2R6GA 3A74A 2PNHA 3K5NA 1ZEQX 2AWOA 1I50B 5M5YB 4A3KG 5D3IB 5BN3A 1AFPA 1XMQQ 3QO2A 2XRQD 1EOVA 1A15A 5AJ3L 2NB0A 2JEAI 1NBWA 5G3LD 3G71A 3PQIA 1XNQL 1SN8A 5NUCA 1QJOA 5JOBA 3T13A 3D6WA 4M1UB 5KEEA 1B2TA 4BY1H 2F0EA 3KF8A 1B4OA 3I73A 1Q1EA 4R4CA 1JWSD 3HOYB 4ZK9B 2J0TD 5TSSA 4AQYQ 2F4VQ 3QOJA 2K32A 4P2CB 1G2TA 2ZJQA 1DOMA 2R7FA 4YCVA 3KDFB 5C4JB 4ALPA 4L5SA 3HS0C 2WKDA 1EQQA 3N52A 4LF8L 3DM1A 4DN4M 1IL8A 4ZQ3A 3DUZA 3TZDA 3K7AH 2EY1A 1IHZA 2NZ1D 1LYLA 2YU9B 2GVBA 2LMCB 2WKCA 4KLKA 2XN9C 2UXBL 1CA5A 1VQEA 4RHSA 4DR2L 4LK1C 3TS0A 2EYPA 4DK6C 2OT2A 4JI8L 1IBLQ 3I7FA 1N32Q 1NSNS 3QIAA 1X3QA 4DNIA 2Z0SA 4LFBL 4OIJA 1WJJA 4PMWA 4EQNA 1MJEA 4BBRB 4H02A 1I4HA 2KA7A 4X64Q 1RDPD 2EYLA 3GDEA 3HOUG 4L63B 1S4ZA 1QG7A 1QUQB 1E0BA 2Z9HA 3GTGH 2IHEA 1GO3E 1M90C 5IP7H 3T51B 1J5EQ 1VQCA 2PZWA 5JVG3 2RDHA 4DR4L 1G6PA 1CUKA 5ELCA 1NCVA 4K5XA 1HQMC 3SK5A 4QMGA 1EWCA 2NVQH 3M4OB 2RSOA 3KLSA 3PUXA 1WCMG 1EWIA 5J39A 4DK1A 1TS4A 2F0JA 1UAPA 2F0MA 2B2YA 5C44B 4LF4L 1T5XD 2K50A 1STGA 5CBEE 5I9OA 1TWFB 5M5XH 4DV5L 1PV4A 4GNXA 1K3RA 4FXKC 4DAVA 3QB3A 4LUZA 1PLFA 2K14A 2NVTB 5CV9A 3VYSA 3HG9A 4PG3A 2JA8G 3K8AA 4LF6L 4MTKA 1B3QA 5ELEA 4KJOA 2NN6H 4QCLA 2NN6I 4IUVA 3ERQA 3J81E 5K36G 5CYUA 1LT6D 5ELOA 1S3OA 4OX9Q 2IX1A 5ELDA 4L8JA 3J7YW 4DAYA 2JA5G 3U9OA 4KHZA 5GAGC 1XWEA 3IL8A 2KECA 3VR5A 1SFOB 1F9RA 1K28A 4HIOA 2Z6KA 3X3NA 1F9QA 4OEMB 4IZ8A 1K8MA 2Q2TA 1H9SB 1QVGA 3S15H 5EGTA 1ESFA 2GN5A 2YV5A 1U0LA 4C3HH 3A8IE 4K0KL 4C2MH 1YJNA 1HFNA 4BA1I 1AH9A 4DAPA 4X65Q 3J81L 4DNRB 4G57A 1KDCA 2XRSD 1DJRD 4DV4L 4GNXC 5C3WA 5GAHC 2WAQE 2Q2HA 1X3PA 1X3EA 4UP8A 4DXFA 4X66Q 3FRPB 5I2XA 3PO3B 3I4NH 4C3JH 1VQNA 3DHQA 3P20A 5T1IA 4B3RL 4K5WA 2OCEA 2XVSA 4HCSA 5IGDA 3GTMH 4KD4A 2E2DC 3R2IA 4DR5L 2ICEC 2MFIA 3L3OC 3CW2C 4OGQC 5IGBA 4KV6A 5IE8A 1TWGH 4MTNA 1W6KA 3H3VH 2ID0A 2UU9L 2K4KA 3H3VI 2Z6KC 3RNUA 1G6ZA 1PA6A 4GN4B 3BZKA 4BY7H 1IYJB 1RTOA 3S2DB 1HA6A 3KJOA 3R2TA 2Y0SG 2A6HD 4BY1G 3J81c 2Z4HA 4QUFA 4F8MA 1FNWA 2KEDA 3K81C 3KBGA 1TY0A 2R93B 1E22A 4ABNA 3HRZC 4JI7Q 4FXGC 4JI1Q 1V8QA 1FR3A 3HOUB 3IKJA 1E24A 4GKKQ 1D8LA 1SMYC 3SK8A 4KMUC 3S1QH 2IY5B 4IUPA 3KK7A 2B3GA 2I07B 2WINB 2EYFA 4N9TA 1BNZA 4GZYC 1N33L 1GUTA 3ULJA 5KIXA 1PXUA 1BVSA 4LF7Q 4UAIA 5LL6S 3G6EA 2OQ0A 2OWOA 1PRTD 1X3GA 4JI5Q 3TP7A 4GOPA 3OW2A 1LABA 3TRZA 3SEBA 3CCEA 4DR1Q 5I2YA 3OOCA 1B70B 4MNOA 2EDGA 1W6JA 3GP7A 3EA6A 4DGZA 5CGKA 2QCPX 5LMNL 1JB3A 4JBMA 1LUZA 1HUNA 2AQ1B 3I4LA 1BUVT 4KKUA 1N36Q 1VS0A 3KLSX 3KUPA 1GXDC 3M85A 5IYBG 1LTLA 4A3GB 4DA2A 2N8NA 1VQFA 4KHPQ 2PW7A 3AU7A 3EVQA 4M8AA 2ES2A 3F2DA 1NE3A 4R4QA 4JW0A 3GQBA 3JC66 1Q46A 4JV5L 2ZM6Q 3M4PA 4DKAC 1LTBD 3K57A 3PIP3 4DV7Q 3MVVA 4C3IB 2F0LA 1SLJA 1DOLA 4R4TA 3VR6A 1K3BC 3L7ZC 4R4OA 5G3LF 4Q5VA 4MHEA 2J7ZA 2RQXA 5FO9B 1QZHA 5IWAQ 2K1BA 1IXRA 1UWVA 3J7AF 2M9VA 2NVYB 1Z9FA 1Y8OB 4NDXA 1HNXQ 1YJ9A 1NAPA 2E8GA 1YITA 1TKWB 3E6ZX 1Y8NB 1A8VA 5FO8B 2CHBD 4LMQD 3S17B 4KKTA 1A62A 5FLMH 4UDUC 2E74C 4LFAQ 2F0TA 2NN6G 1IYVA 2OEOA 3PIPA 4TVAB 1GKHA 3LWUA 3V96A 2KEEA 3KJPA 1HR0Q 4FF2A 2B63H 3RZDH 3DEOA 2D2CC 1NY4A 5FK9C 3KF6B 1Y1WG 1FGUA 4OL7A 2EXDA 3R93A 1VQLA 1RHPA 3D4WA 5D65A 3TP8A 3CCJA 4GNXB 4A4IA 1PYWD 1K0SA 4AYBG 2BA0A 4A3KH 1SYFA 5I4DA 1C48A 1RKNA 4C3HG 4CJ1B 1EIGA 3J80i 2KOLA 5ELNA 5M3FB 3PCOB 3K58A 4I7AA 3N6RA 1ILPA 1GUSA 2VUMH 3H3VC 2F0OA 1CKOA 5C4HA 4HJ7A 2HUGA 2N49A 1I94L 1I4RA 2F3IA 4YWKA 2G9DA 3SGIA 3I4NG 4C3JG 4QGUA 4DV1Q 2ZJPA 2R61A 4HN7A 1FGBD 1CFMA 2L55A 4P74A 4DV3Q 1TWHH 3NUCA 3SHLA 4PV1C 2OXPA 3FPPA 1YHBA 1VQIA 1PFNA 3T1HL 2PW5A 3K7AB 3BZDB 3H0GB 3EIVA 4A3LH 1HNWQ 1WTXA 4UP7A 1SSOA 2HQEA 2BE5D 2C35B 3A7LA 2E2HH 3G4SA 3VYUA 3PIO3 1VQKA 4BBSB 2JXMB 3AFPA 2BCOA 3NHHA 3MFGA 3J80E 1HFGA 4DUZQ 2F0SA 1L1OA 1XYIA 1KRSA 1MSGA 4JI6L 1CZWA 1O7IA 2XWJB 4QJFA 3SE0A 3K5MA 1V1PA 1JOOA 3DWQA 2TMPA 3IAYA 1HHVA 5CORA 5M3MB 4YHHL 3BDCA 3AQQA 4POGA 1CTMA 2XWBB 3GTKB 3PIOA 2CWPA 2DUDA 2JQOA 1IBML 2UUAL 4MZ9A 2E2JH 5KRUA 3B6YA 5ELBA 2Z1CA 1TIID 3MXGA 1YVCA 1JJ2A 4K6DA 3A7AB 3K7UC 3TQYA 1DOKA 4JI3L 1GJXA 1I4QA 2JA7H 1SR3A 4AH6A 1MHWC 2IT1A 1PZJD 1MKHA 1XNRQ 4NXML 2HD3A 2BDNA 2A6HC 2R7ZH 1K83H 1STEA 3OTOL 1L1OC 1HR0W 4HIDA 1HNZL 2PO4A 1ZYRD 4A3JB 4KK7A 3E5SA 4ZCKA 1K8GA 2QEJC 4K6LA 1BBXC 1WTOA 4F87A 3S1NH 2BH2A 5J1ZA 1D6EC 2PI2A 4K5VA 3F2BA 2UXDL 3A8JE 2UUCQ 3FP9A 1Q8KA 3J80c 2RF4A 2IL8A 1KXLA 1SE2A 3K5LA 2EY6A 1TT2A 1SYDA 4A3EH 5J22A 3S14H 4WJWA 5KGUA 1NR2A 4ZKBB 3S15B 4RMFA 4B3SL 5EBDA 1YNNC 4KN4C 3IFDA 1SEBD 5CC4A 4XYOA 4JI2Q 1PRTC 1Y1VH 5C6AA 5KNDA 1A0IA 3T1YQ 1BKBA 2EYHA 5FO7B 4C2MB 1D5ZC 1ICFB 4FYDA 1VQMA 5C4XG 1XMQL 1BOSA 1MD2D 1KL9A 2DJFC 1DYQA 2EOTA 3HOXH 4QB4A 1HXYD 3IRBA 2OTJA 4HEDA 2KQ3A 3W5OA 2B2WA 5FLMG 4YY3Q 2F0HA 4WRDA 4QY7A 4P72A 1DXMA 3CCLA 1KLUD 1DGSA 1XMOL 4ZRZA 1HRJA 1EIFA 4EQPA 4IOAA 1RODA 2B63G 2I46A 3FPUB 1RCVD 1Z6HA 3PUWA 2CH4A 5IIFA 1TXYA 1KDAA 3CD6A 3TP5A 4QF4A 2N88A 1TWGB 1DCZA 2WV6D 4X62L 3K0XA 5F2DA 1VQJA 4XQNA 2RHQB 1EY6A 5EPKA 1HJPA 2NVXB 3BVGA 1PRTF 3LGJA 2BOSA 4TSSA 3R8BA 4BY7B 1XTCD 5KYIA 3WOEA 2A5HA 2F4IA 3RD4A 1BCPD 1WOCA 1SYEA 5LMUQ 1GVPA 1LTAD 1SXTA 1IBKQ 3LWEA 1O80A 2PPBC 2VUMG 2KHIA 1UEAB 2L0CA 1JQYD 1STAA 2VB3X 2B2WC 1SAPA 2RKSA 1G51A 5BN5A 4R1JA 3FHWA 1JCKB 5JAVA 4A3MB 3CCMA 1L0YB 4XQQA 4JPBW 5AFWA 3PMFA 3SVMA 2HIVA 4KY6A 1A6XA 4FVMA 4ZAIA 2I0QA 1NTGA 3I56A 4A3IB 4A3LG 1F2MA 2K75A 4O0AA 3SR1A 4LF9Q 2RCFA 2P5ZX 1IL2A 1BR9A 3GTOH 3FDTA 2KVMA 1HA5A 3S2HH 3NBHA 2HCIA 4JYAL 1VQPA 2WB1B 1K73C 1PFMA 1CK1A 5E7NA 2BDOA 4P71A 1EEID 1PH3A 5CR3A 1HTPA 1TY2A 2B2VA 4A3DH 2K5VA 2LY7A 3E0EA 4DK0A 1N9WA 1NJIC 4BWGB 3OIPA 1HTLD 3VDYA 4GLVB 4BS9A 5AJ3Q 4OONA 3PUYA 3MXUA 4GLAC 4JCVE 4L5QA 4A3FB 3FVQA 5M5WB 3NXWA 2UXCQ 3D0FA 3ULLA 1I4GA 2B2UA 1ENFA 3UDFA 3PF4A 3L9AX 3CPFA 1CI3M 3RZOB 3FKIB 4G7ZC 3MXNA 5IYBH 3TMEA 2WFWA 4I65A 2K5NA 4IUNA 3BS1A 4H13C 1FYCA 4IUUA 2PYKA 3J81i 1L1OB 1F9SA 1V9PA 2EIFA 2RCNA 2ZTDA 5D3DA 3M3YH 1V1PB 2D62A 4LFCQ 3S16B 1MIUA 1SDFA 4ME3A 1AN8A 1S72A 2BE5C 4HCEA 4B9XA 2PMZB 1GUNA 2JA7G 1Q8IA 3A56A 4LF8Q 2CH4W 2R7ZG 1LLRD 1YEZA 1HZ9A 2N55A 1SE8A 2K5DA 3CKIB 3D3RA 2NZHA 4DK3C 3RLNA 1B7YB 1CKNB 2IX3A 2UXBQ 3CMEA 1B1ZA 4RCNA 3K5OA 3NSWA 4JI8Q 3A5UA 3GTQB 1LTGD 1VQGA 2QKIC 1PRTB 2LS01 1KAWA 2B2UC 4X65L 3GV6A 1OO9B 2E5LL 1I4PA 4FNFA 3PUVA 2QW7A 1PZKD 4LFBQ 2HHHQ 2DNCA 2F0VA 4V190 3W1GA 4A3EG 1R4QB 5M9OA 4DV0L 2WP8J 1EQRA 4CGYB 1OXSC 4RAUC 3SXHA 3CCQA 3S1RH 4A3KB 3NEMA 1Y1WH 2JA6H 3PSIA 3UDGA 1Y1VG 3EN2A 1L0XB 1CSPA 2B8GA 5K5PA 4OO1H 4IPGA 4DR4Q 4OO1I 3DLLA 1QILA 2EYJA 1SJED 3BVZA 3HOXG 3HEJA 1LTRD 2QDBA 1AP0A 1II3A 2FXQA 4EGVA 2A68D 2B2YC 5JPMC 4J8QA 2ZTCA 1MJCA 1SRUA 3BZCA 3GTLB 1Z7TA 1X65A 3HKZG 4DR7Q 1G2SA 5CV6A 4LF4Q 1PZID 4LJZC 4C1NK 4ZLTF 1F2YA 4DV5Q 1RF2D 1IKLA 4JOIA 1EYAA 3WWVA 1LTSD 1U4PA 1NMGA 1VQDA 3RLOA 3UDXA 1WTRA 1EU4A 1QZGA 2E2HB 1X55A 2VQFL 4AYBE 2CW0D 2LSSA 2KENA 4KD3A 5GQOA 4V0BA 1ASYA 4B3TL 1E7ZA 2EXZA 4A93H 4ZUJA 2K05A 1JWMD 3MTSA 4NMZA 3TSSA 4CBVA 4LF7L 4ODGA 4RGMA 1EZ6A 3KBXA 1VQHA 3D6CA 4B3ML 3CCVA 5HGQA 5JPNC 2VY3A 1FJGQ 1SYGA 3ITPA 4OHJA 4XQJA 4F88A 2RHSB 1SNOA 4K0KQ 2KBNA 5C5LA 2NUCA 4NW2A 4DUYQ 5JJKA 4HMIA 1X9NA 2ZTEA 4S3SA 1EZ8A 4WORA 1JJGA 1WI5A 4DV4Q 1VQ9A 1VQAA 2MO1A 4JOIC 1Y69U 1LM0A 3F1ZA 5EJWA 2E2IB 1GD7A 2F0KA 1VF5C 2MQHA 2Q2UA 2RDGA 1STNA 3ZYYX 3KF8B 3Q6SA 1RTNA 4FXDA 4DV2Q 2QA4A 3O13A 4FDBA 4YWLA 1WCMB 4A3DG 2XNAC 4DR3L 2R7ZB 2SDFA 4DR5Q 1PH4A 1K83B 1M8AA 1YNJD 5BR8L 2K5WA 5C0XJ 1D1KA 2NTSA 4L5TA 1XPRA 5JJZA 3I4MG 1G91A 2K5HA 4JI4L 2MNAA 1HZCA 1JICA 2Z8LA 3S1NB 5C4JH 2R7DA 3S1MH 2JE6I 2CWAA 1Q81C 4POFA 3GTPH 1EIHA 1O7YA 2VW9A 4MN3A 4H7BA 1SJHD 2JA8B 1OXTA 4IN3A 2XTIA 1XX8A 1IW7D 3E0JA 1B3AA 1A2UA 1BO0A 2YU9H 2A19A 3I72A 4A3EB 4IALA 3S14B 2ALYB 1BBWA 1SROA 5IT9E 1TWAB 1VQ5A 4TKOB 1ET6A 4H44C 2JA5B 1D5XC 3UE1A 1B9MA 3HOZG 3OSOA 1YHAA 1C9OA 2WB1E 2LFNA 1BCPF 2PQAA 4KTAA 4OWXB 3MXNB 4GOPC 3EQLC 1N33Q 4BBRH 3PUZA 1LACA 2UUBQ 1CZGA 1PH6A 4NXNQ 3MFYA 3V05A 1I6HB 2FJ2A 1EYGA 4HIMA 2AHOB 1PH8A 3A55A 4DR6Q 2VNUD 2Q2IA 1T5EA 2QGQA 5C4XH 4DV6L 1A3UA 1SNMA 1EFWA 1B44D 5IT9L 4A3CH 3HKZB 2KHSA 1TS2A 4JI0Q 5CV7A 1SE3A 2F52A 5LMNQ 4LAAA 1HUMA 3CPWA 1TU2B 3KYHC 3M4OH 4Y7NB 3AYHB 4IFDJ 4EQ5A 3HOVH 2VQEL 4DV1L 2JA6G 1K0RA 3TDQA 1VMPA 3RMHA 4C56C 5EQ0A 1V43A 3HOWG 5GAEC 3SK4A 5C44H 4LF5L 1KTKA 4OO1G 4J1MA 3HP3A 4TQUS 2TSSA 1X32A 2A73B 3CRKC 5A2QE 2PMZE 2WAQG 4HJ9A 1JOQA 4XYQA 2Y0SB 1W2BA 4BY1B 1UEBA 2NVTH 1K8AC 3K0YA 4HJ8A 5J3BA 5IT9c 1TS3A 4RG1A 4GKJL 2WIIB 3MAQA 1Y8PB 4JVZA 1O7ZA 1STHA 4DAYB 5EAYA 2HQLA 5JJIA 4UP9A 3URYA 4DUZL 2Q8RE 3KFUA 1GM5A 1U4RA 2BH8A 1ILQA 4KJNA 2CFMA 5A2QL 5C0XH 5DAUA 5C0XI 1PYBA 3HFZB 3NWSA 1RD9D 2RA4A 3S2HB 2YTXA 4J6HA 1E2WA 3NK9A 1QCBD 2MPMA 4A3BG 3CCUA 4A93G 4CKBA 1QOHA 1WTWA 2ZXRA 5HGTA 1UE1A 1X54A 2QILA 2CCZA 1GHJA 1HZBA 2K03A 4RGTA 1KHIA 2DN8A 2L5TA 2IHFA 3PO3H 1E2ZA 5I6YA 4RKLA 2A68C 4R8IA 1AE2A 3ZJYC 3FEWX 1PH2A 2D0OA 5KYLA 2K5QA 1CKMA 2NYZD 1JC7A 2RBMA 2D9UA 1SNDA 3HZXA 3GTGB 1YBYA 3TN2A 4FF4A 2MJ8A 4JBWA 3T4AC 2VS1A 3BU2A 5E1FA 2N3SA 4YCUA 4Z9CB 2Q8IB 1Q7YC 3R3OA 4B9WA 1JOKA 5LHY1 4XIGS 5IP9G 1EY5A 4CJ0B 3S2DH 2JA9A 2NVQB 3J7ZC 1JR0D 1L0WA 3KLRA 2KJXA 4X3SA 1CT1D 2KCNA 3CU7A 2L4NA 2RVLA 2VB2X 4CHTB 1YIJA 1Q12A 2R93H 1DD2A 3DM3A 1OXXK 2OTLA 2F1MA 5EKKA 1O78A 3ERSX 4YWMA 4IFDH 2LXJA 1KABA 1PFBA 3TS2A 2WACA 4PMCA 1E2VA 1EY9A 1BDOA 5LMNW 5M5XB 3J7A5 4HSPA 5COYA 5DM63 3STBD 4JI2L 4UPAA 2KCCA 1N34L 4QUCA 5BN4A 3CC4A 2DNEA 2IWHA 2NBFA 4F7XA 3C3LA 1GUOA 3L2PA 3CMAA 1TWCH 2K01A 3E3XA 2V1CC 4JI6Q 4GOPB 3X3MA 2RDFA 2F0QA 2IX0A 1MBYA 1UE6A 3S1RB 4X3TA 1Y1WB 2JA6B 5GADC 1N8RC 4L5RC 1PFSA 5IODA 2MUYA 1AZPA 1R9TH 4CKCA 4HIKA 4RHRA 3CC7A 3CXCA 2VZAA 4AYBB 4ZKCB 5IYDG 3F2UA 4RA8A 4BBRG 1JB7A 3TBIB 3RR5A 4C3HB 1EOTA 3NENA 5C3XA 5LL6X 1BBUA 2UUAQ 4XXEA 1OXVA 1YNJC 1WTQA 3I70A 4DU9A 4IPCA 3Q8DA 2K6AA 3D31A 3VA7A 2F0DA 4O2DA 4A3CG 1M4VA 4IJLA 1YHQA 5LMUL 4JI3Q 4Q0FA 2K04A 3I55A 4A76A 2A6ED 2AUJD 1LO5D 2FHTA 4DNTB 3EBEA 3I4NB 4C3JB 1PMRA 4XDXA 2EJGC 4XT1B 3OTOQ 1WYDA 3GTJH 5E4XA 4G7HC 3OIQA 2JEBI 4C3IH 2F0PA 3U4VA 3GTMB 3HOVG 2EPBA 1ENCA 2IPKD 4CDEC 5FJ8G 3WOFA 2IJ0A 3PF5A 1K8OA 2M00A 3DXJC 1G291 4AQYL 3MZ5A 2V4DA 5C44G 5FKAC 2F4VL 1XPUA 2B39A 4FF3A 2L11A 3BG3A 2NVYH 1KLGD 1F2LA 5C4ZA 4A93B 4NP5A 4NKLA 3C1FA 1HPCA 4ILWA 3JAME 1STBA 4R9WA 1EWHA 2PQEA 2FMMA 3S17H 1KDBA 1SYBA 5DEHA 4ID6A 1WVLA 3S9WA 4B3SQ 1JJCB 4ZUIA 3AMUA 3NTIA 4LW1A 1ZXTA 3DMUA 3TEHB 1X6OA 4PMBA 3AFQA 1TS5A 3HKZE 2K28A 4PQXA 1TQOA 3S1QB 5CV8A 5C0XG 1IBLL 4IURA 3M7NA 1N32L 1XPOA 4TRDA 1DZ1A 3JAML 2I5HA 2ZJRA 1VQ7A 3H6MA 2UXCL 1IZ6A 4RH6A 4GN3B 1H9JA 1H9MA 1XMOQ 4L6TB 2C5CA 3EROA 4X64L 3D8GA 4FF1A 3E9IA 3QOLA 5DM73 5M3FH 5C3EH 2JK8A 2F0FA 1AEXA 3QR8A 2JP1A 5L37A 2B2TA 1H9KA 2EY2A 1PH5A 1J5EL 1PTOD 3U4ZA 4CDDC 4X62Q 4JG2A 3F8TA 3BJUA 1B9NA 3SDZA 4LFCL 2Y0SE 4X3UA 1JT8A 3PO3G 5IYCH 4HMJA 1E3PA 3S1MB 2OF1A 3RLFA 3GTPB 1ONLA 1R4PB 2JN4A 1LT4D 2CQOA 3I4MH 1RJTA 2PCFB 1XNQQ 1EY0A 3H0GH 1ASZA 3JAMc 2EVBA 2DY7A 3SK6A 3EJIA 1EL0A 3VR4A 1HQRD 4G7OC 3Q0AA 1F9PA 4ZYSA 1A3VA 1L2FA 1MI2A 3T16A 2BA1A 4BBSH 1A3TA 2F0NA 3Q23A 3ULPA 2CVRA 3QG1A 2XSCA 1SBBB 4IPDA 2ZXOA 2HHHL 2R93G 1M1KC 3L0OA 1UE7A 1CSQA 2AMCB 4HTHA 4U673 2X6LA 1V1QA 1XTDA 1U4MA 2B2TC 3HOZH 4IFDG 3A0JA 1B50A 4OX9L 1J8IA 3ONAB 5C4XB 1SNQA 1TVXA 2B2VC 2NTTA 4RGNA 4JYAQ 5I6WA 4APVA 1O7LA 5DLQE 5M3MH 2YTVA 4JBKA 4JC0A 1S5BD 1F77A 1QVCA 1BQQT 4XT3B 1WTHA 5JEAJ 4LUVA 3GTKH 2H4OA 1WD0A 2B8FA 2HCCA 2E75C 4DR2Q 1H9RA 2ATWA 4FP5D 1WTVA 2B63B 3RZDB 3NP8A 3UE0A 3HOVB 3BDLA 1S5DD 1YNXA 2H1EA 3OWFA 3NWTA 3LX0A 1PTOH 1CA6A 1G8ZD 3KF6A 1MGSA 1RL2A 2EJMA 4DR7L 5DNFA 2MO0A 1CM9A 3CQZH 3OYYA 5D14A 4X66L 2CQAA 4KY7A 3EFXD 2NZOA 2Q8TA 1FD7D 5FLXE 4IO9A 1FL0A 5H1SE 2O4XA 4KI0A 1C0AA 3RUZA 1S40A 4OWTB 1AW7A 3HOWH 2KHJA 2F0GA 1Z47A 4A3JH 2R92H 1KNAA 4A3GG 2HT1A 3UI2A 2F0UA 1I3QH 2VUMB 1EFID 4K8IA 5EPJA 3STBC 4CJ2C 1U4LA 4DPGA 3Q24A 2K33A 4IUTA 3K6OA 3IFTA 1ZYRC 3I8ZA 3D4RA 5FLXL 4RCOA 4C3IG 1TWHB 3MWYW 2YYZA 4KKSA 2AKWB 3DEPA 4BXXG 4H0LC 3FMCA 2B29A 3F2CA 4JI7L 1FJGL 2F3VA 1E1TA 4JI1L 4OIKA 4DUYL 3ER0A 3M4YA 3S24A 1KAAA 3C2PA 1QE6A 2EY5A 3P1HA 4GKKL 3KLWA 3MEHA 2ICIA 2E5LQ 4LF6Q 1PDQA 4XTCS 1QVFA 4HAEA 4IQZA 2FMCA 4P75A 2PZUA 2KCTA 5JVH3 1CHPD 4DV0Q 3PO2H 2DGYA 4A3BH 2PZTA 3OWEB 1SNCA 2Z4IA 3NELA 4K2KA 1F2ZA 4DV2L 2QF7A 1UE5A 3C1EA 3J7AV 3VA5A 1KRTA 1FNUA 5E3FA 4JI5L 4DAMA 3H94A 3DWPA 2K7VA 4HR7B 3T53B 4DR1L 5ISRA 4GLXA 1LV9A 2A6EC 2GA4B 5FLXc 1UNSA 2L12A 1I6VC 2NVXH 1Q90A 4MIUA 2SNMA 5I9PA 2A69D 1I50H 5M5YH 3MXPA 2PNRC 3H15A 1U5KA 3U50C 1N36L 1JORA 4N8FA 3M4QA 4E6IA 1KQSA 1SMXA 2GVAA 1YZ6A 5EBCA 5HURA 3QJYA 5M3FG 1KD1C 2E2JB 5C3EG 2RSNA 3MA2B 5JEAH 2ENBA 2ASBA 5CMDA 4KHPL 5IP9H 1GHKA 5IOCA 3P7JA 3TREA 3CHBD 1C8CA 1Q82C 1X3FA 2JA7B 2X6GA 4B3RQ 2O5IC 1ZKOA 5IYCG 4N9PA 5GROA 4A3MH 3VYTA 3HGBA 1BCPC 2VQFQ 3TZUA 2ZM6L 3HOYH 4ME5A 4HSVA 3OMGA 4DV7L 4RWSC 4I7ZC 2N78A 1NUCA 1TWCB 4GS3A 4RKBA 1CHQD 5EKIA 4B3TQ 3I2ZA 4YIJA 4KHVA 5IGCA 4IJHA 2UU9Q 3H0GG 3NBIA 4A3IH 2UUBL 1YI2A 2MHVA 1IYUA 1GOZA 2QDLA 4NXNL 3NBHB 5IWAL 5JJLA 1YNND 3HKSA 3H09A 4O42A 4DF7A 4DR6L 1A2TA 1HNXL 4QL5A 4C1NI 3OPOA 1V1OA 4BBSG 1OXUA 1VQ8A 4B3MQ 2XIWA 4JK1C 5T1GA 1R9TB 4K8JA 1XXGA 4JI0L 4QIWB 4GN5A 4LFAL 2SEBD 5EKLA 1JMCA 3D4DA 1S5FD 1D7QA 2QEXA 1HR0L 1Y1VB 3G48A 2HDMA 2L1BA 4K14A 3M7GA 1LT3D 4FO2A 1C4QA 1GUWA 1PTOC 2EJFC 1J6QA 1XJVA 4A3FH 5M5WH 1FVIA 5IP7G 5IYDH 3HOXB 5M3MG 3PGZA 2E76C 2C9OA 3ND9A 1MSHA 3AEVA 1EU3A 3RZOH 3FKIH 1P16A 2HIXA 4DR3Q 1HH2P 3GTJB 3DWAA 1PHJA 5BR8Q 3KOJA 5KNBA 3QWNA 3A8KE 1B8AA 4KN7C 1Y14B 3S16H 4NB3A 4JI4Q 3PV0A 3J81j 3W2DA 2YTYA 4UHVA 3MC0B 4LUOA 2EE1A 2R3ZA 2L15A 4R4IA 3TP6A 1JE4A 1T9HA 5FJ8H 3NE5B 1QNUA 4HJAA 2VXWA 3AB9A 2EZVA 4DV3L 1PTOF 3U9SA 1EY8A 2SOBA 2CKZB 4A3JG 2R92G 1TWFH 3UDIA 3RN5A 1VF7A 4X6AH 1QB5D 4UY8C 4EVOA 1HNWL 3GTQH 3LNNA 4PZ7A 4JV5Q 3BYTB 4OXPA 1DM0B 3NQIA 2D0PA 2ZT9C 5E4WC 5FOBB 1ML0D 1VMCA 2M2LA 3A5ZB 2AQ2B 3OW7A 1VQBA 1VQOA 1VCIA 1SYCA 4X3KA 3CCRA 4DV6Q 5IY0A 3H91A 2K52A 3CRLC 4LNQA 4WJ3M 1PH7A 1SFOH 1Q3LA 5CBAE 5C3EB 3GTOB 3E9HA 3KDFA 4P73A 1HCZA 2FINB 1BXTA 4JBJA 3RN2A 1I5FA 3VR3A 2F0IA 1DONA 3MEFA 3PO2G 2XGTA 4A3DB 4PZ8A 1PYSB 1H95A 2VQEQ 1LT5D 5C5MA 4O1NA 3MHBA 4U68A 3W3AA 2PI2E 3GTLH 1NR4A 4ULLA 1RIPA 4LF5Q 2AWNA 4RGOS 3I91A 1WTPA 4Y52H 3I4MB 3GD7A 4A75A 3I90A 2SNSA 3G6JB 2F03A 2G9HD 1XNRL 2IW3A 4BY7G 2HDLA 4EQOA 4BA2I 5IGFA 4GKJQ 4G4KA 1BCPB 1GUGA 1QNKA 2F3WA 3P75A 3BDOA 1EYDA 2KCMA 3BYYB 1QUQA 1EUJA 2VL6A 5JEAG 3M3YB 4R8NA 4DXGA 1BF4A 3GV3A 1I94Q 1HZAA 1P8LA 2MGSA 4CKEA 2KUMA 1Q86C 1J9OA 4LWCA 3HOZB 2MP1A 2EYOA 1KC8C 3NQTA 2UUCL 2OQKA 1WFQA 4A3MG 5EPLA 2CW0C 1VQ6A 2EQSA 3T1HQ 3HOYG 1NNXA 1A63A 3W1BA 1D1IA 4N8X1 2I5LX 1U9RA 4IFDI 2JSOA 3HOUH 1EQTA 4CDFC 3OHXC 1I4XA 3M9BA 2FFKB 4A3IG 3J80L 3T1YL 4YCWA 1CQFA 1CKNA 2O5JC 1OTCA 2LXKA 5IGEA 3C46A 2E2IH 1EY7A 4J15A 3BVMA 1PVOA 2H5XA 1NMFA 1PTOB 1SE4A 4NPSA 2WB1G 3VYRA 2D5DA 4CDCC 3G7LA 1QWYA 2O2LD 1D2BA 2A69C 4AIMA 4YY3L 2A1AA 2G5DA 1WCMH 3CQZB 3I3CA 2A74C 4OELB 3NTHA 4DFAA 5HY6A 5CV5A 1WD1A 3CAMA 1LTID 4YHHQ 3HOWB 3VR2A 1S5CD 4B08A 5IGGA 2A8VA 1KIXA 1B53A 2R92B 1EY4A 1EQVA 4A3FG 1W3SA 2WAQB 3JAMi 2LKVA 1ICWA 2L9HA 1I3QB 4QQBX 1Q1BA 2JYOA 4EX5A 1EIYB 4OWWB 1EEFD 1IBMQ 2X69A 1H9SA 3FKIG 3T56B 1LTTD 4IPHA 2JA8H 4RFBA 4A3GH 1X56A 4KY5A 1D5MC 1ET9A 2Z6BA
chains in the Genus database with same CATH topology
1V1QA 1XTDA 4PZ6A 1JJGA 4IFDG 2JJQA 3HOZH 1WI5A 3A0JA 4DV4Q 1VQAA 1TWAH 1VQ9A 2MO1A 4OX9L 4JOIC 1LM0A 3K80C 3F1ZA 4NXMQ 3I4OA 2VUMH 3U58A 1PH9A 1IBKL 2JA5H 1CKOA 2PQAB 1GD7A 1N34Q 4HJ7A 2MQHA 2N49A 1PH1A 2Q2UA 4JYAQ 1I94L 1HNZQ 2F3IA 4APVA 4YWKA 5M3MH 5DLQE 3SGIA 2YTVA 4JBKA 3KF8B 4JC0A 3I4NG 3CF5A 4QGUA 4DV1Q 3ICEA 2ZJPA 4DV2Q 1QVCA 4BXXH 1JE5A 4QIWE 2I5MX 2QA4A 1C7YA 4HJ5A 4FDBA 5JEAJ 4LUVA 4P74A 4YWLA 3GTKH 4A3DG 4DV3Q 1VQ4A 1AE3A 1TWHH 1X9NA 4DR3L 4DR2Q 3GO5A 4WJ4A 4DR5Q 1PH4A 1YHBA 1VQIA 3CCSA 1I6HH 2ATWA 3T1HL 2UXDQ 5BR8L 3UE0A 5C0XJ 1YJWA 1E1OA 1YNXA 3EIVA 4IOCA 4A3LH 1HNWQ 4L5TA 1XPRA 3I4MG 4LF9L 2K5HA 4UP7A 4JI4L 2MNAA 1HZCA 3KF6A 1RL2A 2C35B 4DR7L 2E2HH 3G4SA 5C4JH 2R7DA 3CC2A 2JE6I 2MO0A 2CWAA 1Q81C 4POFA 1K9MC 1VQKA 3CQZH 3OYYA 4X66L 3GTPH 2VW9A 3CP0A 3AFPA 2NZOA 4IO9A 4Y7NH 1FL0A 1OXTA 5H1SE 4KI0A 4DUZQ 1C0AA 2R6GA 1S40A 2PNHA 2XTIA 3A74A 4OWTB 1L1OA 2AWOA 3HOWH 1KRSA 4JI6L 2KHJA 2YU9H 2A19A 1O7IA 1Z47A 4A3KG 4QJFA 4A3JH 1XMQQ 2R92H 2ALYB 1BBWA 1SROA 2HT1A 4A3GG 1VQ5A 1I3QH 1EOVA 5AJ3L 3UE1A 2JEAI 3STBC 1NBWA 1YHAA 1C9OA 3HOZG 4DPGA 2WB1E 3G71A 1XNQL 4YHHL 1SN8A 2PQAA 3AQQA 4POGA 4BY1H 4OWXB 3PIOA 3MXNB 4GOPC 1N33Q 4BBRH 3PUZA 2CWPA 2YYZA 2UUBQ 2AKWB 2DUDA 1PH6A 4BXXG 4NXNQ 2JQOA 1Q1EA 4R4CA 1IBML 1EYGA 4HIMA 2AHOB 1PH8A 2UUAL 2B29A 4MZ9A 3F2CA 4AQYQ 2E2JH 4JI7L 1FJGL 4DR6Q 2VNUD 2Q2IA 2QGQA 5C4XH 4DV6L 1E1TA 1EFWA 2F4VQ 3B6YA 4JI1L 4A3CH 4DUYL 3ER0A 3S24A 1YVCA 1JJ2A 2ZJQA 3K7UC 4GKKL 3TQYA 4JI3L 3KLWA 2R7FA 4JI0Q 4YCVA 2E5LQ 3KDFB 2JA7H 4LF6Q 1SR3A 4AH6A 2IT1A 4ALPA 4L5SA 2F52A 5LMNQ 1MKHA 4XTCS 1EQQA 4NXML 1QVFA 1XNRQ 4P75A 3CPWA 2R7ZH 2KCTA 3KYHC 4LF8L 1K83H 3M4OH 3OTOL 1L1OC 3AYHB 4DV0Q 1HR0W 3PO2H 4HIDA 1HNZL 4IFDJ 2DGYA 4EQ5A 4A3BH 3K7AH 3HOVH 2VQEL 4DV1L 1LYLA 3NELA 2GVBA 4DV2L 2JA6G 1UE5A 1K0RA 4KLKA 1KRTA 1K8GA 2UXBL 1VQEA 1V43A 3HOWG 5GAEC 4JI5L 5C44H 4DAMA 4DR2L 4LF5L 4OO1G 3TS0A 3S1NH 4DK6C 2BH2A 4TQUS 4JI8L 4DR1L 2PI2A 4GLXA 1IBLQ 2PMZE 3F2BA 2UXDL 2WAQG 3I7FA 5FLXc 1N32Q 2UUCQ 4HJ9A 3FP9A 1Q8KA 3J80c 2RF4A 1KXLA 4DNIA 2NVXH 2Z0SA 4LFBL 1WJJA 1W2BA 4PMWA 1MJEA 1UEBA 2NVTH 1I50H 5M5YH 1K8AC 4H02A 4HJ8A 4A3EH 5J3BA 3H15A 5IT9c 1U5KA 3S14H 3U50C 4X64Q 1N36L 3GDEA 4RG1A 3M4QA 4GKJL 1KQSA 3HOUG 1SMXA 2GVAA 1YZ6A 4RMFA 4B3SL 1KD1C 5M3FG 1QUQB 5C3EG 4DAYB 3GTGH 5EAYA 4JI2Q 2ASBA 2IHEA 2HQLA 1GO3E 1M90C 4UP9A 1Y1VH 3T1YQ 5JJIA 1A0IA 4DUZL 1BKBA 5IP7H 1J5EQ 4KHPL 5IP9H 3KFUA 1VQCA 1GM5A 2BH8A 3TREA 1VQMA 5C4XG 1Q82C 4DR4L 2CFMA 1XMQL 1X3FA 4B3RQ 1G6PA 1KL9A 1CUKA 5C0XI 3HOXH 1PYBA 3HFZB 5IYCG 3IRBA 4A3MH 5GROA 2OTJA 3W5OA 5FLMG 2NVQH 2VQFQ 4YY3Q 2ZM6L 3HOYH 3PUXA 4QY7A 1WCMG 1EWIA 2YTXA 4P72A 4DV7L 3CCLA 1DGSA 1XMOL 2N78A 4GS3A 1EIFA 4IOAA 4B3TQ 2B63G 3I2ZA 2UU9Q 4IJHA 4A3BG 3H0GG 3CCUA 4A3IH 2UUBL 4A93G 1YI2A 3PUWA 2K50A 4LF4L 4NXNL 3NBHB 1TXYA 5IWAL 5JJLA 3HKSA 5M5XH 3CD6A 4DV5L 1UE1A 1X54A 1PV4A 4GNXA 1K3RA 2CCZA 4DR6L 4X62L 1HZBA 3K0XA 4QL5A 1HNXL 1KHIA 1VQJA 2RHQB 4LUZA 1HJPA 2IHFA 3S1MH 4BBSG 1OXUA 3PO3H 2K14A 1VQ8A 4B3MQ 1AE2A 3ZJYC 4PG3A 3LGJA 4JI0L 1PH2A 2JA8G 3K8AA 4LF6L 2D0OA 4GN5A 4LFAL 1CKMA 1JMCA 1WOCA 5LMUQ 2NN6I 4JV5Q 1YBYA 1GVPA 1D7QA 2QEXA 5K36G 4JBWA 1HR0L 2VS1A 3G48A 1S3OA 5ELOA 4OX9Q 3BU2A 2IX1A 2N3SA 4YCUA 1IBKQ 2VUMG 2JA5G 2KHIA 1XJVA 1J6QA 4A3FH 4KHZA 5M5WH 5GAGC 1FVIA 1Q7YC 5IP7G 5IYDH 4XIGS 5IP9G 5M3MG 1G51A 4R1JA 3FHWA 3PGZA 4HIOA 2Z6KA 3CCMA 3S2DH 3AEVA 2JA9A 3J7ZC 3RZOH 1L0WA 3FKIH 5ELNA 1QVGA 2Q2TA 3S15H 1P16A 2HIXA 4DR3Q 1HH2P 2GN5A 2YV5A 1U0LA 1YIJA 4C3HH 2HIVA 1Q12A 2R93H 4K0KL 4C2MH 3DM3A 1YJNA 1OXXK 3KOJA 5BR8Q 4BA1I 1PHJA 2I0QA 2OTLA 1AH9A 4X65Q 3ERSX 1NTGA 4YWMA 3I56A 4A3LG 2LXJA 1B8AA 3TS2A 4DV4L 1Y14B 2K75A 5GAHC 4O0AA 4GNXC 4LF9Q 3S16H 4NB3A 5LMNW 4JI4Q 2WAQE 2Q2HA 3PV0A 3J81j 1IL2A 3J7A5 3GTOH 3STBD 2YTYA 4JI2L 1X3EA 4UP8A 4LUOA 4UPAA 1N34L 3CC4A 3S2HH 4X66Q 4JYAL 1VQPA 2L15A 1K73C 3I4NH 4R4IA 4C3JH 3L2PA 3CMAA 1VQNA 5E7NA 1T9HA 4P71A 5FJ8H 1TWCH 4HJAA 4B3RL 1PH3A 2OCEA 2V1CC 4A3DH 2K5VA 4DV3L 3E0EA 4JI6Q 3GTMH 1N9WA 4GOPB 4DR5L 1NJIC 2MFIA 2CKZB 4A3JG 2R92G 1TWFH 2IX0A 3UDIA 3RN5A 3VDYA 3CW2C 1UE6A 4GLVB 4X6AH 5IE8A 1TWGH 4MTNA 5AJ3Q 4UY8C 4OONA 3PUYA 1HNWL 4GLAC 4JCVE 4L5QA 3GTQH 3H3VH 2ID0A 4PZ7A 5GADC 1N8RC 1PFSA 2UU9L 2K4KA 4L5RC 3H3VI 3D0FA 2Z6KC 3ULLA 2UXCQ 3RNUA 4OXPA 2D0PA 1R9TH 4HIKA 4GN4B 3BZKA 3CXCA 3CC7A 1IYJB 1PA6A 2VZAA 4BY7H 3UDFA 3KJOA 3PF4A 3CPFA 2Y0SG 3A5ZB 5IYDG 4BY1G 3J81c 5IYBH 2WFWA 4BBRG 2K5NA 1JB7A 1VQBA 3RR5A 3K81C 3NENA 3J81i 1BBUA 1VQOA 1VCIA 2UUAQ 1L1OB 1E22A 1OXVA 1V9PA 4JI7Q 2EIFA 2RCNA 3CCRA 4DV6Q 2ZTDA 5IY0A 3M3YH 2K52A 4IPCA 4JI1Q 3Q8DA 4LNQA 4WJ3M 2D62A 3D31A 1PH7A 4LFCQ 4O2DA 1SFOH 4A3CG 1MIUA 1YHQA 1E24A 4IJLA 4GKKQ 5LMUL 1D8LA 4ME3A 4JI3Q 3E9HA 3I55A 4A76A 1S72A 3S1QH 2IY5B 3KDFA 2JA7G 4P73A 4JBJA 3RN2A 3EBEA 1I5FA 4LF8Q 2R7ZG 2B3GA 3OTOQ 1WYDA 3MEFA 1YEZA 3GTJH 1HZ9A 3PO2G 1SE8A 2XGTA 4PZ8A 2JEBI 4C3IH 1PYSB 1N33L 3U4VA 1H95A 2VQEQ 3HOVG 3ULJA 2NZHA 5FJ8G 3PF5A 4DK3C 3RLNA 1BVSA 4LF7Q 1B7YB 2PI2E 1CKNB 3G6EA 2OQ0A 2OWOA 3GTLH 3CMEA 2UXBQ 1RIPA 1G291 1X3GA 4AQYL 4JI5Q 4LF5Q 2AWNA 5C44G 4GOPA 3OW2A 3TRZA 2F4VL 4JI8Q 3A5UA 3CCEA 4DR1Q 1XPUA 4Y52H 1VQGA 3GD7A 2NVYH 1KAWA 4A75A 1B70B 4MNOA 4X65L 2E5LL 3PUVA 4LFBQ 2HHHQ 5LMNL 1XNRL 4JBMA 3S17H 1LUZA 3W1GA 4A3EG 4BY7G 1N36Q 1VS0A 4DV0L 4BA2I 4GKJQ 2WP8J 1EQRA 3M85A 1OXSC 4B3SQ 2KCMA 3CCQA 1JJCB 3S1RH 5IYBG 1QUQA 3NEMA 1EUJA 2VL6A 1Y1WH 4LW1A 5JEAG 2JA6H 1LTLA 3PSIA 3TEHB 1Y1VG 2N8NA 3EN2A 3UDGA 1VQFA 1X6OA 1I94Q 1CSPA 4KHPQ 1HZAA 1P8LA 3AFQA 3HKZE 1Q86C 2ES2A 4IPGA 4LWCA 4DR4Q 3DLLA 3F2DA 4OO1I 1NE3A 5C0XG 1IBLL 4R4QA 3M7NA 3HOXG 1N32L 1KC8C 2UUCL 2OQKA 3JC66 1WFQA 1XPOA 4A3MG 1Q46A 2FXQA 2I5HA 2ZJRA 4JV5L 2ZM6Q 3M4PA 4DKAC 1VQ7A 1VQ6A 2EQSA 3T1HQ 2UXCL 3HOYG 1IZ6A 4DV7Q 2ZTCA 4GN3B 1A63A 3W1BA 1XMOQ 1MJCA 2I5LX 1SLJA 4X64L 4IFDI 3E9IA 4R4TA 1SRUA 3BZCA 3L7ZC 4R4OA 3M9BA 3HOUH 1X65A 5M3FH 5C3EH 3HKZG 4DR7Q 4LF4Q 2JK8A 4A3IG 1QZHA 5IWAQ 3T1YL 4YCWA 1CKNA 1J5EL 1IXRA 1UWVA 4DV5Q 1PH5A 3U4ZA 2LXKA 1OTCA 1Z9FA 4X62Q 4JG2A 3F8TA 4JOIA 3BJUA 1YJ9A 1HNXQ 2E2IH 4J15A 2E8GA 1PVOA 1YITA 3WWVA 2H5XA 1NMFA 4NPSA 4LFCL 1A8VA 1NMGA 1VQDA 2WB1G 2Y0SE 5IYCH 3RLOA 3UDXA 3PO3G 1JT8A 1QZGA 1A62A 1E3PA 5FLMH 1X55A 2VQFL 3RLFA 4AIMA 4LFAQ 4AYBE 2A1AA 4YY3L 1WCMH 2NN6G 2LSSA 2KENA 3PIPA 5GQOA 4TVAB 1GKHA 1HR0Q 2CQOA 3KJPA 5HY6A 2B63H 3I4MH 1ASYA 4B3TL 1E7ZA 3CAMA 3RZDH 1NY4A 1XNQQ 4YHHQ 3H0GH 3KF6B 1ASZA 4A93H 2A8VA 3JAMc 1KIXA 1Y1WG 1FGUA 2EXDA 1VQLA 4A3FG 3CCJA 4LF7L 1W3SA 4GNXB 3JAMi 4A4IA 4QQBX 1L2FA 1Q1BA 2BA1A 4EX5A 1EIYB 4OWWB 4BBSH 1VQHA 3ULPA 4AYBG 1IBMQ 2BA0A 3FKIG 3CCVA 4B3ML 5HGQA 2VY3A 4A3KH 1FJGQ 4IPDA 4IPHA 2JA8H 2RHSB 4A3GH 1X56A 2KBNA 2HHHL 4K0KQ 4DUYQ 1M1KC 2R93G 3L0OA 1UE7A 3J80i 1CSQA 5JJKA 2AMCB 3PCOB 2ZTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1Q A;  1XTD A;  4PZ6 A;  1JJG A;  4IFD G;  2JJQ A;  3HOZ H;  1WI5 A;  3A0J A;  4DV4 Q;  1VQA A;  1TWA H;  1VQ9 A;  2MO1 A;  4OX9 L;  4JOI C;  1LM0 A;  3K80 C;  3F1Z A;  4NXM Q;  3I4O A;  2VUM H;  3U58 A;  1PH9 A;  1IBK L;  2JA5 H;  1CKO A;  2PQA B;  1GD7 A;  1N34 Q;  4HJ7 A;  2MQH A;  2N49 A;  1PH1 A;  2Q2U A;  4JYA Q;  1I94 L;  1HNZ Q;  2F3I A;  4APV A;  4YWK A;  5M3M H;  5DLQ E;  3SGI A;  2YTV A;  4JBK A;  3KF8 B;  4JC0 A;  3I4N G;  3CF5 A;  4QGU A;  4DV1 Q;  3ICE A;  2ZJP A;  4DV2 Q;  1QVC A;  4BXX H;  1JE5 A;  4QIW E;  2I5M X;  2QA4 A;  1C7Y A;  4HJ5 A;  4FDB A;  5JEA J;  4LUV A;  4P74 A;  4YWL A;  3GTK H;  4A3D G;  4DV3 Q;  1VQ4 A;  1AE3 A;  1TWH H;  1X9N A;  4DR3 L;  4DR2 Q;  3GO5 A;  4WJ4 A;  4DR5 Q;  1PH4 A;  1YHB A;  1VQI A;  3CCS A;  1I6H H;  2ATW A;  3T1H L;  2UXD Q;  5BR8 L;  3UE0 A;  5C0X J;  1YJW A;  1E1O A;  1YNX A;  3EIV A;  4IOC A;  4A3L H;  1HNW Q;  4L5T A;  1XPR A;  3I4M G;  4LF9 L;  2K5H A;  4UP7 A;  4JI4 L;  2MNA A;  1HZC A;  3KF6 A;  1RL2 A;  2C35 B;  4DR7 L;  2E2H H;  3G4S A;  5C4J H;  2R7D A;  3CC2 A;  2JE6 I;  2MO0 A;  2CWA A;  1Q81 C;  4POF A;  1K9M C;  1VQK A;  3CQZ H;  3OYY A;  4X66 L;  3GTP H;  2VW9 A;  3CP0 A;  3AFP A;  2NZO A;  4IO9 A;  4Y7N H;  1FL0 A;  1OXT A;  5H1S E;  4KI0 A;  4DUZ Q;  1C0A A;  2R6G A;  1S40 A;  2PNH A;  2XTI A;  3A74 A;  4OWT B;  1L1O A;  2AWO A;  3HOW H;  1KRS A;  4JI6 L;  2KHJ A;  2YU9 H;  2A19 A;  1O7I A;  1Z47 A;  4A3K G;  4QJF A;  4A3J H;  1XMQ Q;  2R92 H;  2ALY B;  1BBW A;  1SRO A;  2HT1 A;  4A3G G;  1VQ5 A;  1I3Q H;  1EOV A;  5AJ3 L;  3UE1 A;  2JEA I;  3STB C;  1NBW A;  1YHA A;  1C9O A;  3HOZ G;  4DPG A;  2WB1 E;  3G71 A;  1XNQ L;  4YHH L;  1SN8 A;  2PQA A;  3AQQ A;  4POG A;  4BY1 H;  4OWX B;  3PIO A;  3MXN B;  4GOP C;  1N33 Q;  4BBR H;  3PUZ A;  2CWP A;  2YYZ A;  2UUB Q;  2AKW B;  2DUD A;  1PH6 A;  4BXX G;  4NXN Q;  2JQO A;  1Q1E A;  4R4C A;  1IBM L;  1EYG A;  4HIM A;  2AHO B;  1PH8 A;  2UUA L;  2B29 A;  4MZ9 A;  3F2C A;  4AQY Q;  2E2J H;  4JI7 L;  1FJG L;  4DR6 Q;  2VNU D;  2Q2I A;  2QGQ A;  5C4X H;  4DV6 L;  1E1T A;  1EFW A;  2F4V Q;  3B6Y A;  4JI1 L;  4A3C H;  4DUY L;  3ER0 A;  3S24 A;  1YVC A;  1JJ2 A;  2ZJQ A;  3K7U C;  4GKK L;  3TQY A;  4JI3 L;  3KLW A;  2R7F A;  4JI0 Q;  4YCV A;  2E5L Q;  3KDF B;  2JA7 H;  4LF6 Q;  1SR3 A;  4AH6 A;  2IT1 A;  4ALP A;  4L5S A;  2F52 A;  5LMN Q;  1MKH A;  4XTC S;  1EQQ A;  4NXM L;  1QVF A;  1XNR Q;  4P75 A;  3CPW A;  2R7Z H;  2KCT A;  3KYH C;  4LF8 L;  1K83 H;  3M4O H;  3OTO L;  1L1O C;  3AYH B;  4DV0 Q;  1HR0 W;  3PO2 H;  4HID A;  1HNZ L;  4IFD J;  2DGY A;  4EQ5 A;  4A3B H;  3K7A H;  3HOV H;  2VQE L;  4DV1 L;  1LYL A;  3NEL A;  2GVB A;  4DV2 L;  2JA6 G;  1UE5 A;  1K0R A;  4KLK A;  1KRT A;  1K8G A;  2UXB L;  1VQE A;  1V43 A;  3HOW G;  5GAE C;  4JI5 L;  5C44 H;  4DAM A;  4DR2 L;  4LF5 L;  4OO1 G;  3TS0 A;  3S1N H;  4DK6 C;  2BH2 A;  4TQU S;  4JI8 L;  4DR1 L;  2PI2 A;  4GLX A;  1IBL Q;  2PMZ E;  3F2B A;  2UXD L;  2WAQ G;  3I7F A;  5FLX c;  1N32 Q;  2UUC Q;  4HJ9 A;  3FP9 A;  1Q8K A;  3J80 c;  2RF4 A;  1KXL A;  4DNI A;  2NVX H;  2Z0S A;  4LFB L;  1WJJ A;  1W2B A;  4PMW A;  1MJE A;  1UEB A;  2NVT H;  1I50 H;  5M5Y H;  1K8A C;  4H02 A;  4HJ8 A;  4A3E H;  5J3B A;  3H15 A;  5IT9 c;  1U5K A;  3S14 H;  3U50 C;  4X64 Q;  1N36 L;  3GDE A;  4RG1 A;  3M4Q A;  4GKJ L;  1KQS A;  3HOU G;  1SMX A;  2GVA A;  1YZ6 A;  4RMF A;  4B3S L;  1KD1 C;  5M3F G;  1QUQ B;  5C3E G;  4DAY B;  3GTG H;  5EAY A;  4JI2 Q;  2ASB A;  2IHE A;  2HQL A;  1GO3 E;  1M90 C;  4UP9 A;  1Y1V H;  3T1Y Q;  5JJI A;  1A0I A;  4DUZ L;  1BKB A;  5IP7 H;  1J5E Q;  4KHP L;  5IP9 H;  3KFU A;  1VQC A;  1GM5 A;  2BH8 A;  3TRE A;  1VQM A;  5C4X G;  1Q82 C;  4DR4 L;  2CFM A;  1XMQ L;  1X3F A;  4B3R Q;  1G6P A;  1KL9 A;  1CUK A;  5C0X I;  3HOX H;  1PYB A;  3HFZ B;  5IYC G;  3IRB A;  4A3M H;  5GRO A;  2OTJ A;  3W5O A;  5FLM G;  2NVQ H;  2VQF Q;  4YY3 Q;  2ZM6 L;  3HOY H;  3PUX A;  4QY7 A;  1WCM G;  1EWI A;  2YTX A;  4P72 A;  4DV7 L;  3CCL A;  1DGS A;  1XMO L;  2N78 A;  4GS3 A;  1EIF A;  4IOA A;  4B3T Q;  2B63 G;  3I2Z A;  2UU9 Q;  4IJH A;  4A3B G;  3H0G G;  3CCU A;  4A3I H;  2UUB L;  4A93 G;  1YI2 A;  3PUW A;  2K50 A;  4LF4 L;  4NXN L;  3NBH B;  1TXY A;  5IWA L;  5JJL A;  3HKS A;  5M5X H;  3CD6 A;  4DV5 L;  1UE1 A;  1X54 A;  1PV4 A;  4GNX A;  1K3R A;  2CCZ A;  4DR6 L;  4X62 L;  1HZB A;  3K0X A;  4QL5 A;  1HNX L;  1KHI A;  1VQJ A;  2RHQ B;  4LUZ A;  1HJP A;  2IHF A;  3S1M H;  4BBS G;  1OXU A;  3PO3 H;  2K14 A;  1VQ8 A;  4B3M Q;  1AE2 A;  3ZJY C;  4PG3 A;  3LGJ A;  4JI0 L;  1PH2 A;  2JA8 G;  3K8A A;  4LF6 L;  2D0O A;  4GN5 A;  4LFA L;  1CKM A;  1JMC A;  1WOC A;  5LMU Q;  2NN6 I;  4JV5 Q;  1YBY A;  1GVP A;  1D7Q A;  2QEX A;  5K36 G;  4JBW A;  1HR0 L;  2VS1 A;  3G48 A;  1S3O A;  5ELO A;  4OX9 Q;  3BU2 A;  2IX1 A;  2N3S A;  4YCU A;  1IBK Q;  2VUM G;  2JA5 G;  2KHI A;  1XJV A;  1J6Q A;  4A3F H;  4KHZ A;  5M5W H;  5GAG C;  1FVI A;  1Q7Y C;  5IP7 G;  5IYD H;  4XIG S;  5IP9 G;  5M3M G;  1G51 A;  4R1J A;  3FHW A;  3PGZ A;  4HIO A;  2Z6K A;  3CCM A;  3S2D H;  3AEV A;  2JA9 A;  3J7Z C;  3RZO H;  1L0W A;  3FKI H;  5ELN A;  1QVG A;  2Q2T A;  3S15 H;  1P16 A;  2HIX A;  4DR3 Q;  1HH2 P;  2GN5 A;  2YV5 A;  1U0L A;  1YIJ A;  4C3H H;  2HIV A;  1Q12 A;  2R93 H;  4K0K L;  4C2M H;  3DM3 A;  1YJN A;  1OXX K;  3KOJ A;  5BR8 Q;  4BA1 I;  1PHJ A;  2I0Q A;  2OTL A;  1AH9 A;  4X65 Q;  3ERS X;  1NTG A;  4YWM A;  3I56 A;  4A3L G;  2LXJ A;  1B8A A;  3TS2 A;  4DV4 L;  1Y14 B;  2K75 A;  5GAH C;  4O0A A;  4GNX C;  4LF9 Q;  3S16 H;  4NB3 A;  5LMN W;  4JI4 Q;  2WAQ E;  2Q2H A;  3PV0 A;  3J81 j;  1IL2 A;  3J7A 5;  3GTO H;  3STB D;  2YTY A;  4JI2 L;  1X3E A;  4UP8 A;  4LUO A;  4UPA A;  1N34 L;  3CC4 A;  3S2H H;  4X66 Q;  4JYA L;  1VQP A;  2L15 A;  1K73 C;  3I4N H;  4R4I A;  4C3J H;  3L2P A;  3CMA A;  1VQN A;  5E7N A;  1T9H A;  4P71 A;  5FJ8 H;  1TWC H;  4HJA A;  4B3R L;  1PH3 A;  2OCE A;  2V1C C;  4A3D H;  2K5V A;  4DV3 L;  3E0E A;  4JI6 Q;  3GTM H;  1N9W A;  4GOP B;  4DR5 L;  1NJI C;  2MFI A;  2CKZ B;  4A3J G;  2R92 G;  1TWF H;  2IX0 A;  3UDI A;  3RN5 A;  3VDY A;  3CW2 C;  1UE6 A;  4GLV B;  4X6A H;  5IE8 A;  1TWG H;  4MTN A;  5AJ3 Q;  4UY8 C;  4OON A;  3PUY A;  1HNW L;  4GLA C;  4JCV E;  4L5Q A;  3GTQ H;  3H3V H;  2ID0 A;  4PZ7 A;  5GAD C;  1N8R C;  1PFS A;  2UU9 L;  2K4K A;  4L5R C;  3H3V I;  3D0F A;  2Z6K C;  3ULL A;  2UXC Q;  3RNU A;  4OXP A;  2D0P A;  1R9T H;  4HIK A;  4GN4 B;  3BZK A;  3CXC A;  3CC7 A;  1IYJ B;  1PA6 A;  2VZA A;  4BY7 H;  3UDF A;  3KJO A;  3PF4 A;  3CPF A;  2Y0S G;  3A5Z B;  5IYD G;  4BY1 G;  3J81 c;  5IYB H;  2WFW A;  4BBR G;  2K5N A;  1JB7 A;  1VQB A;  3RR5 A;  3K81 C;  3NEN A;  3J81 i;  1BBU A;  1VQO A;  1VCI A;  2UUA Q;  1L1O B;  1E22 A;  1OXV A;  1V9P A;  4JI7 Q;  2EIF A;  2RCN A;  3CCR A;  4DV6 Q;  2ZTD A;  5IY0 A;  3M3Y H;  2K52 A;  4IPC A;  4JI1 Q;  3Q8D A;  4LNQ A;  4WJ3 M;  2D62 A;  3D31 A;  1PH7 A;  4LFC Q;  4O2D A;  1SFO H;  4A3C G;  1MIU A;  1YHQ A;  1E24 A;  4IJL A;  4GKK Q;  5LMU L;  1D8L A;  4ME3 A;  4JI3 Q;  3E9H A;  3I55 A;  4A76 A;  1S72 A;  3S1Q H;  2IY5 B;  3KDF A;  2JA7 G;  4P73 A;  4JBJ A;  3RN2 A;  3EBE A;  1I5F A;  4LF8 Q;  2R7Z G;  2B3G A;  3OTO Q;  1WYD A;  3MEF A;  1YEZ A;  3GTJ H;  1HZ9 A;  3PO2 G;  1SE8 A;  2XGT A;  4PZ8 A;  2JEB I;  4C3I H;  1PYS B;  1N33 L;  3U4V A;  1H95 A;  2VQE Q;  3HOV G;  3ULJ A;  2NZH A;  5FJ8 G;  3PF5 A;  4DK3 C;  3RLN A;  1BVS A;  4LF7 Q;  1B7Y B;  2PI2 E;  1CKN B;  3G6E A;  2OQ0 A;  2OWO A;  3GTL H;  3CME A;  2UXB Q;  1RIP A;  1G29 1;  1X3G A;  4AQY L;  4JI5 Q;  4LF5 Q;  2AWN A;  5C44 G;  4GOP A;  3OW2 A;  3TRZ A;  2F4V L;  4JI8 Q;  3A5U A;  3CCE A;  4DR1 Q;  1XPU A;  4Y52 H;  1VQG A;  3GD7 A;  2NVY H;  1KAW A;  4A75 A;  1B70 B;  4MNO A;  4X65 L;  2E5L L;  3PUV A;  4LFB Q;  2HHH Q;  5LMN L;  1XNR L;  4JBM A;  3S17 H;  1LUZ A;  3W1G A;  4A3E G;  4BY7 G;  1N36 Q;  1VS0 A;  4DV0 L;  4BA2 I;  4GKJ Q;  2WP8 J;  1EQR A;  3M85 A;  1OXS C;  4B3S Q;  2KCM A;  3CCQ A;  1JJC B;  3S1R H;  5IYB G;  1QUQ A;  3NEM A;  1EUJ A;  2VL6 A;  1Y1W H;  4LW1 A;  5JEA G;  2JA6 H;  1LTL A;  3PSI A;  3TEH B;  1Y1V G;  2N8N A;  3EN2 A;  3UDG A;  1VQF A;  1X6O A;  1I94 Q;  1CSP A;  4KHP Q;  1HZA A;  1P8L A;  3AFQ A;  3HKZ E;  1Q86 C;  2ES2 A;  4IPG A;  4LWC A;  4DR4 Q;  3DLL A;  3F2D A;  4OO1 I;  1NE3 A;  5C0X G;  1IBL L;  4R4Q A;  3M7N A;  3HOX G;  1N32 L;  1KC8 C;  2UUC L;  2OQK A;  3JC6 6;  1WFQ A;  1XPO A;  4A3M G;  1Q46 A;  2FXQ A;  2I5H A;  2ZJR A;  4JV5 L;  2ZM6 Q;  3M4P A;  4DKA C;  1VQ7 A;  1VQ6 A;  2EQS A;  3T1H Q;  2UXC L;  3HOY G;  1IZ6 A;  4DV7 Q;  2ZTC A;  4GN3 B;  1A63 A;  3W1B A;  1XMO Q;  1MJC A;  2I5L X;  1SLJ A;  4X64 L;  4IFD I;  3E9I A;  4R4T A;  1SRU A;  3BZC A;  3L7Z C;  4R4O A;  3M9B A;  3HOU H;  1X65 A;  5M3F H;  5C3E H;  3HKZ G;  4DR7 Q;  4LF4 Q;  2JK8 A;  4A3I G;  1QZH A;  5IWA Q;  3T1Y L;  4YCW A;  1CKN A;  1J5E L;  1IXR A;  1UWV A;  4DV5 Q;  1PH5 A;  3U4Z A;  2LXK A;  1OTC A;  1Z9F A;  4X62 Q;  4JG2 A;  3F8T A;  4JOI A;  3BJU A;  1YJ9 A;  1HNX Q;  2E2I H;  4J15 A;  2E8G A;  1PVO A;  1YIT A;  3WWV A;  2H5X A;  1NMF A;  4NPS A;  4LFC L;  1A8V A;  1NMG A;  1VQD A;  2WB1 G;  2Y0S E;  5IYC H;  3RLO A;  3UDX A;  3PO3 G;  1JT8 A;  1QZG A;  1A62 A;  1E3P A;  5FLM H;  1X55 A;  2VQF L;  3RLF A;  4AIM A;  4LFA Q;  4AYB E;  2A1A A;  4YY3 L;  1WCM H;  2NN6 G;  2LSS A;  2KEN A;  3PIP A;  5GQO A;  4TVA B;  1GKH A;  1HR0 Q;  2CQO A;  3KJP A;  5HY6 A;  2B63 H;  3I4M H;  1ASY A;  4B3T L;  1E7Z A;  3CAM A;  3RZD H;  1NY4 A;  1XNQ Q;  4YHH Q;  3H0G H;  3KF6 B;  1ASZ A;  4A93 H;  2A8V A;  3JAM c;  1KIX A;  1Y1W G;  1FGU A;  2EXD A;  1VQL A;  4A3F G;  3CCJ A;  4LF7 L;  1W3S A;  4GNX B;  3JAM i;  4A4I A;  4QQB X;  1L2F A;  1Q1B A;  2BA1 A;  4EX5 A;  1EIY B;  4OWW B;  4BBS H;  1VQH A;  3ULP A;  4AYB G;  1IBM Q;  2BA0 A;  3FKI G;  3CCV A;  4B3M L;  5HGQ A;  2VY3 A;  4A3K H;  1FJG Q;  4IPD A;  4IPH A;  2JA8 H;  2RHS B;  4A3G H;  1X56 A;  2KBN A;  2HHH L;  4K0K Q;  4DUY Q;  1M1K C;  2R93 G;  3L0O A;  1UE7 A;  3J80 i;  1CSQ A;  5JJK A;  2AMC B;  3PCO B;  2ZTE A; 
#chains in the Genus database with same CATH topology
 5A35 A;  1FNV A;  5K36 H;  4PZ6 A;  5KNC A;  2JJQ A;  4PNY A;  1TWA H;  2DY8 A;  3K80 C;  1SNP A;  4NXM Q;  3I4O A;  3U58 A;  1PH9 A;  1IBK L;  2JA5 H;  1EYC A;  2PQA B;  1N34 Q;  3NTK A;  1PH1 A;  1HNZ Q;  4IUQ A;  3NPP A;  5CV4 A;  3CF5 A;  1AZQ A;  3ICE A;  1IW7 C;  1JWU D;  1UUP A;  3Q22 A;  4BXX H;  1ESR A;  1JE5 A;  2AQ3 B;  4QIW E;  2I5M X;  1C7Y A;  3K59 A;  4HJ5 A;  3ND8 A;  1VQ4 A;  1AE3 A;  1STY A;  3A54 A;  1KNE A;  3GO5 A;  4WJ4 A;  1ENA A;  3CCS A;  3PO2 B;  1I6H H;  2J4X A;  3OMC A;  2UXD Q;  4A3B B;  2AUK A;  1YJW A;  2NWG A;  1E1O A;  2EYM A;  5ELF A;  4IOC A;  1S5E D;  4LF9 L;  1SMY D;  4WFN 3;  2F0W A;  3CC2 A;  1K9M C;  2DJG C;  1IKM A;  2ZXP A;  3WDN A;  3CP0 A;  1TR5 A;  4K2L A;  1VDZ A;  4Y7N H;  3V2T A;  1CQV A;  2R6G A;  3A74 A;  2PNH A;  3K5N A;  1ZEQ X;  2AWO A;  1I50 B;  5M5Y B;  4A3K G;  5D3I B;  5BN3 A;  1AFP A;  1XMQ Q;  3QO2 A;  2XRQ D;  1EOV A;  1A15 A;  5AJ3 L;  2NB0 A;  2JEA I;  1NBW A;  5G3L D;  3G71 A;  3PQI A;  1XNQ L;  1SN8 A;  5NUC A;  1QJO A;  5JOB A;  3T13 A;  3D6W A;  4M1U B;  5KEE A;  1B2T A;  4BY1 H;  2F0E A;  3KF8 A;  1B4O A;  3I73 A;  1Q1E A;  4R4C A;  1JWS D;  3HOY B;  4ZK9 B;  2J0T D;  5TSS A;  4AQY Q;  2F4V Q;  3QOJ A;  2K32 A;  4P2C B;  1G2T A;  2ZJQ A;  1DOM A;  2R7F A;  4YCV A;  3KDF B;  5C4J B;  4ALP A;  4L5S A;  3HS0 C;  2WKD A;  1EQQ A;  3N52 A;  4LF8 L;  3DM1 A;  4DN4 M;  1IL8 A;  4ZQ3 A;  3DUZ A;  3TZD A;  3K7A H;  2EY1 A;  1IHZ A;  2NZ1 D;  1LYL A;  2YU9 B;  2GVB A;  2LMC B;  2WKC A;  4KLK A;  2XN9 C;  2UXB L;  1CA5 A;  1VQE A;  4RHS A;  4DR2 L;  4LK1 C;  3TS0 A;  2EYP A;  4DK6 C;  2OT2 A;  4JI8 L;  1IBL Q;  3I7F A;  1N32 Q;  1NSN S;  3QIA A;  1X3Q A;  4DNI A;  2Z0S A;  4LFB L;  4OIJ A;  1WJJ A;  4PMW A;  4EQN A;  1MJE A;  4BBR B;  4H02 A;  1I4H A;  2KA7 A;  4X64 Q;  1RDP D;  2EYL A;  3GDE A;  3HOU G;  4L63 B;  1S4Z A;  1QG7 A;  1QUQ B;  1E0B A;  2Z9H A;  3GTG H;  2IHE A;  1GO3 E;  1M90 C;  5IP7 H;  3T51 B;  1J5E Q;  1VQC A;  2PZW A;  5JVG 3;  2RDH A;  4DR4 L;  1G6P A;  1CUK A;  5ELC A;  1NCV A;  4K5X A;  1HQM C;  3SK5 A;  4QMG A;  1EWC A;  2NVQ H;  3M4O B;  2RSO A;  3KLS A;  3PUX A;  1WCM G;  1EWI A;  5J39 A;  4DK1 A;  1TS4 A;  2F0J A;  1UAP A;  2F0M A;  2B2Y A;  5C44 B;  4LF4 L;  1T5X D;  2K50 A;  1STG A;  5CBE E;  5I9O A;  1TWF B;  5M5X H;  4DV5 L;  1PV4 A;  4GNX A;  1K3R A;  4FXK C;  4DAV A;  3QB3 A;  4LUZ A;  1PLF A;  2K14 A;  2NVT B;  5CV9 A;  3VYS A;  3HG9 A;  4PG3 A;  2JA8 G;  3K8A A;  4LF6 L;  4MTK A;  1B3Q A;  5ELE A;  4KJO A;  2NN6 H;  4QCL A;  2NN6 I;  4IUV A;  3ERQ A;  3J81 E;  5K36 G;  5CYU A;  1LT6 D;  5ELO A;  1S3O A;  4OX9 Q;  2IX1 A;  5ELD A;  4L8J A;  3J7Y W;  4DAY A;  2JA5 G;  3U9O A;  4KHZ A;  5GAG C;  1XWE A;  3IL8 A;  2KEC A;  3VR5 A;  1SFO B;  1F9R A;  1K28 A;  4HIO A;  2Z6K A;  3X3N A;  1F9Q A;  4OEM B;  4IZ8 A;  1K8M A;  2Q2T A;  1H9S B;  1QVG A;  3S15 H;  5EGT A;  1ESF A;  2GN5 A;  2YV5 A;  1U0L A;  4C3H H;  3A8I E;  4K0K L;  4C2M H;  1YJN A;  1HFN A;  4BA1 I;  1AH9 A;  4DAP A;  4X65 Q;  3J81 L;  4DNR B;  4G57 A;  1KDC A;  2XRS D;  1DJR D;  4DV4 L;  4GNX C;  5C3W A;  5GAH C;  2WAQ E;  2Q2H A;  1X3P A;  1X3E A;  4UP8 A;  4DXF A;  4X66 Q;  3FRP B;  5I2X A;  3PO3 B;  3I4N H;  4C3J H;  1VQN A;  3DHQ A;  3P20 A;  5T1I A;  4B3R L;  4K5W A;  2OCE A;  2XVS A;  4HCS A;  5IGD A;  3GTM H;  4KD4 A;  2E2D C;  3R2I A;  4DR5 L;  2ICE C;  2MFI A;  3L3O C;  3CW2 C;  4OGQ C;  5IGB A;  4KV6 A;  5IE8 A;  1TWG H;  4MTN A;  1W6K A;  3H3V H;  2ID0 A;  2UU9 L;  2K4K A;  3H3V I;  2Z6K C;  3RNU A;  1G6Z A;  1PA6 A;  4GN4 B;  3BZK A;  4BY7 H;  1IYJ B;  1RTO A;  3S2D B;  1HA6 A;  3KJO A;  3R2T A;  2Y0S G;  2A6H D;  4BY1 G;  3J81 c;  2Z4H A;  4QUF A;  4F8M A;  1FNW A;  2KED A;  3K81 C;  3KBG A;  1TY0 A;  2R93 B;  1E22 A;  4ABN A;  3HRZ C;  4JI7 Q;  4FXG C;  4JI1 Q;  1V8Q A;  1FR3 A;  3HOU B;  3IKJ A;  1E24 A;  4GKK Q;  1D8L A;  1SMY C;  3SK8 A;  4KMU C;  3S1Q H;  2IY5 B;  4IUP A;  3KK7 A;  2B3G A;  2I07 B;  2WIN B;  2EYF A;  4N9T A;  1BNZ A;  4GZY C;  1N33 L;  1GUT A;  3ULJ A;  5KIX A;  1PXU A;  1BVS A;  4LF7 Q;  4UAI A;  5LL6 S;  3G6E A;  2OQ0 A;  2OWO A;  1PRT D;  1X3G A;  4JI5 Q;  3TP7 A;  4GOP A;  3OW2 A;  1LAB A;  3TRZ A;  3SEB A;  3CCE A;  4DR1 Q;  5I2Y A;  3OOC A;  1B70 B;  4MNO A;  2EDG A;  1W6J A;  3GP7 A;  3EA6 A;  4DGZ A;  5CGK A;  2QCP X;  5LMN L;  1JB3 A;  4JBM A;  1LUZ A;  1HUN A;  2AQ1 B;  3I4L A;  1BUV T;  4KKU A;  1N36 Q;  1VS0 A;  3KLS X;  3KUP A;  1GXD C;  3M85 A;  5IYB G;  1LTL A;  4A3G B;  4DA2 A;  2N8N A;  1VQF A;  4KHP Q;  2PW7 A;  3AU7 A;  3EVQ A;  4M8A A;  2ES2 A;  3F2D A;  1NE3 A;  4R4Q A;  4JW0 A;  3GQB A;  3JC6 6;  1Q46 A;  4JV5 L;  2ZM6 Q;  3M4P A;  4DKA C;  1LTB D;  3K57 A;  3PIP 3;  4DV7 Q;  3MVV A;  4C3I B;  2F0L A;  1SLJ A;  1DOL A;  4R4T A;  3VR6 A;  1K3B C;  3L7Z C;  4R4O A;  5G3L F;  4Q5V A;  4MHE A;  2J7Z A;  2RQX A;  5FO9 B;  1QZH A;  5IWA Q;  2K1B A;  1IXR A;  1UWV A;  3J7A F;  2M9V A;  2NVY B;  1Z9F A;  1Y8O B;  4NDX A;  1HNX Q;  1YJ9 A;  1NAP A;  2E8G A;  1YIT A;  1TKW B;  3E6Z X;  1Y8N B;  1A8V A;  5FO8 B;  2CHB D;  4LMQ D;  3S17 B;  4KKT A;  1A62 A;  5FLM H;  4UDU C;  2E74 C;  4LFA Q;  2F0T A;  2NN6 G;  1IYV A;  2OEO A;  3PIP A;  4TVA B;  1GKH A;  3LWU A;  3V96 A;  2KEE A;  3KJP A;  1HR0 Q;  4FF2 A;  2B63 H;  3RZD H;  3DEO A;  2D2C C;  1NY4 A;  5FK9 C;  3KF6 B;  1Y1W G;  1FGU A;  4OL7 A;  2EXD A;  3R93 A;  1VQL A;  1RHP A;  3D4W A;  5D65 A;  3TP8 A;  3CCJ A;  4GNX B;  4A4I A;  1PYW D;  1K0S A;  4AYB G;  2BA0 A;  4A3K H;  1SYF A;  5I4D A;  1C48 A;  1RKN A;  4C3H G;  4CJ1 B;  1EIG A;  3J80 i;  2KOL A;  5ELN A;  5M3F B;  3PCO B;  3K58 A;  4I7A A;  3N6R A;  1ILP A;  1GUS A;  2VUM H;  3H3V C;  2F0O A;  1CKO A;  5C4H A;  4HJ7 A;  2HUG A;  2N49 A;  1I94 L;  1I4R A;  2F3I A;  4YWK A;  2G9D A;  3SGI A;  3I4N G;  4C3J G;  4QGU A;  4DV1 Q;  2ZJP A;  2R61 A;  4HN7 A;  1FGB D;  1CFM A;  2L55 A;  4P74 A;  4DV3 Q;  1TWH H;  3NUC A;  3SHL A;  4PV1 C;  2OXP A;  3FPP A;  1YHB A;  1VQI A;  1PFN A;  3T1H L;  2PW5 A;  3K7A B;  3BZD B;  3H0G B;  3EIV A;  4A3L H;  1HNW Q;  1WTX A;  4UP7 A;  1SSO A;  2HQE A;  2BE5 D;  2C35 B;  3A7L A;  2E2H H;  3G4S A;  3VYU A;  3PIO 3;  1VQK A;  4BBS B;  2JXM B;  3AFP A;  2BCO A;  3NHH A;  3MFG A;  3J80 E;  1HFG A;  4DUZ Q;  2F0S A;  1L1O A;  1XYI A;  1KRS A;  1MSG A;  4JI6 L;  1CZW A;  1O7I A;  2XWJ B;  4QJF A;  3SE0 A;  3K5M A;  1V1P A;  1JOO A;  3DWQ A;  2TMP A;  3IAY A;  1HHV A;  5COR A;  5M3M B;  4YHH L;  3BDC A;  3AQQ A;  4POG A;  1CTM A;  2XWB B;  3GTK B;  3PIO A;  2CWP A;  2DUD A;  2JQO A;  1IBM L;  2UUA L;  4MZ9 A;  2E2J H;  5KRU A;  3B6Y A;  5ELB A;  2Z1C A;  1TII D;  3MXG A;  1YVC A;  1JJ2 A;  4K6D A;  3A7A B;  3K7U C;  3TQY A;  1DOK A;  4JI3 L;  1GJX A;  1I4Q A;  2JA7 H;  1SR3 A;  4AH6 A;  1MHW C;  2IT1 A;  1PZJ D;  1MKH A;  1XNR Q;  4NXM L;  2HD3 A;  2BDN A;  2A6H C;  2R7Z H;  1K83 H;  1STE A;  3OTO L;  1L1O C;  1HR0 W;  4HID A;  1HNZ L;  2PO4 A;  1ZYR D;  4A3J B;  4KK7 A;  3E5S A;  4ZCK A;  1K8G A;  2QEJ C;  4K6L A;  1BBX C;  1WTO A;  4F87 A;  3S1N H;  2BH2 A;  5J1Z A;  1D6E C;  2PI2 A;  4K5V A;  3F2B A;  2UXD L;  3A8J E;  2UUC Q;  3FP9 A;  1Q8K A;  3J80 c;  2RF4 A;  2IL8 A;  1KXL A;  1SE2 A;  3K5L A;  2EY6 A;  1TT2 A;  1SYD A;  4A3E H;  5J22 A;  3S14 H;  4WJW A;  5KGU A;  1NR2 A;  4ZKB B;  3S15 B;  4RMF A;  4B3S L;  5EBD A;  1YNN C;  4KN4 C;  3IFD A;  1SEB D;  5CC4 A;  4XYO A;  4JI2 Q;  1PRT C;  1Y1V H;  5C6A A;  5KND A;  1A0I A;  3T1Y Q;  1BKB A;  2EYH A;  5FO7 B;  4C2M B;  1D5Z C;  1ICF B;  4FYD A;  1VQM A;  5C4X G;  1XMQ L;  1BOS A;  1MD2 D;  1KL9 A;  2DJF C;  1DYQ A;  2EOT A;  3HOX H;  4QB4 A;  1HXY D;  3IRB A;  2OTJ A;  4HED A;  2KQ3 A;  3W5O A;  2B2W A;  5FLM G;  4YY3 Q;  2F0H A;  4WRD A;  4QY7 A;  4P72 A;  1DXM A;  3CCL A;  1KLU D;  1DGS A;  1XMO L;  4ZRZ A;  1HRJ A;  1EIF A;  4EQP A;  4IOA A;  1ROD A;  2B63 G;  2I46 A;  3FPU B;  1RCV D;  1Z6H A;  3PUW A;  2CH4 A;  5IIF A;  1TXY A;  1KDA A;  3CD6 A;  3TP5 A;  4QF4 A;  2N88 A;  1TWG B;  1DCZ A;  2WV6 D;  4X62 L;  3K0X A;  5F2D A;  1VQJ A;  4XQN A;  2RHQ B;  1EY6 A;  5EPK A;  1HJP A;  2NVX B;  3BVG A;  1PRT F;  3LGJ A;  2BOS A;  4TSS A;  3R8B A;  4BY7 B;  1XTC D;  5KYI A;  3WOE A;  2A5H A;  2F4I A;  3RD4 A;  1BCP D;  1WOC A;  1SYE A;  5LMU Q;  1GVP A;  1LTA D;  1SXT A;  1IBK Q;  3LWE A;  1O80 A;  2PPB C;  2VUM G;  2KHI A;  1UEA B;  2L0C A;  1JQY D;  1STA A;  2VB3 X;  2B2W C;  1SAP A;  2RKS A;  1G51 A;  5BN5 A;  4R1J A;  3FHW A;  1JCK B;  5JAV A;  4A3M B;  3CCM A;  1L0Y B;  4XQQ A;  4JPB W;  5AFW A;  3PMF A;  3SVM A;  2HIV A;  4KY6 A;  1A6X A;  4FVM A;  4ZAI A;  2I0Q A;  1NTG A;  3I56 A;  4A3I B;  4A3L G;  1F2M A;  2K75 A;  4O0A A;  3SR1 A;  4LF9 Q;  2RCF A;  2P5Z X;  1IL2 A;  1BR9 A;  3GTO H;  3FDT A;  2KVM A;  1HA5 A;  3S2H H;  3NBH A;  2HCI A;  4JYA L;  1VQP A;  2WB1 B;  1K73 C;  1PFM A;  1CK1 A;  5E7N A;  2BDO A;  4P71 A;  1EEI D;  1PH3 A;  5CR3 A;  1HTP A;  1TY2 A;  2B2V A;  4A3D H;  2K5V A;  2LY7 A;  3E0E A;  4DK0 A;  1N9W A;  1NJI C;  4BWG B;  3OIP A;  1HTL D;  3VDY A;  4GLV B;  4BS9 A;  5AJ3 Q;  4OON A;  3PUY A;  3MXU A;  4GLA C;  4JCV E;  4L5Q A;  4A3F B;  3FVQ A;  5M5W B;  3NXW A;  2UXC Q;  3D0F A;  3ULL A;  1I4G A;  2B2U A;  1ENF A;  3UDF A;  3PF4 A;  3L9A X;  3CPF A;  1CI3 M;  3RZO B;  3FKI B;  4G7Z C;  3MXN A;  5IYB H;  3TME A;  2WFW A;  4I65 A;  2K5N A;  4IUN A;  3BS1 A;  4H13 C;  1FYC A;  4IUU A;  2PYK A;  3J81 i;  1L1O B;  1F9S A;  1V9P A;  2EIF A;  2RCN A;  2ZTD A;  5D3D A;  3M3Y H;  1V1P B;  2D62 A;  4LFC Q;  3S16 B;  1MIU A;  1SDF A;  4ME3 A;  1AN8 A;  1S72 A;  2BE5 C;  4HCE A;  4B9X A;  2PMZ B;  1GUN A;  2JA7 G;  1Q8I A;  3A56 A;  4LF8 Q;  2CH4 W;  2R7Z G;  1LLR D;  1YEZ A;  1HZ9 A;  2N55 A;  1SE8 A;  2K5D A;  3CKI B;  3D3R A;  2NZH A;  4DK3 C;  3RLN A;  1B7Y B;  1CKN B;  2IX3 A;  2UXB Q;  3CME A;  1B1Z A;  4RCN A;  3K5O A;  3NSW A;  4JI8 Q;  3A5U A;  3GTQ B;  1LTG D;  1VQG A;  2QKI C;  1PRT B;  2LS0 1;  1KAW A;  2B2U C;  4X65 L;  3GV6 A;  1OO9 B;  2E5L L;  1I4P A;  4FNF A;  3PUV A;  2QW7 A;  1PZK D;  4LFB Q;  2HHH Q;  2DNC A;  2F0V A;  4V19 0;  3W1G A;  4A3E G;  1R4Q B;  5M9O A;  4DV0 L;  2WP8 J;  1EQR A;  4CGY B;  1OXS C;  4RAU C;  3SXH A;  3CCQ A;  3S1R H;  4A3K B;  3NEM A;  1Y1W H;  2JA6 H;  3PSI A;  3UDG A;  1Y1V G;  3EN2 A;  1L0X B;  1CSP A;  2B8G A;  5K5P A;  4OO1 H;  4IPG A;  4DR4 Q;  4OO1 I;  3DLL A;  1QIL A;  2EYJ A;  1SJE D;  3BVZ A;  3HOX G;  3HEJ A;  1LTR D;  2QDB A;  1AP0 A;  1II3 A;  2FXQ A;  4EGV A;  2A68 D;  2B2Y C;  5JPM C;  4J8Q A;  2ZTC A;  1MJC A;  1SRU A;  3BZC A;  3GTL B;  1Z7T A;  1X65 A;  3HKZ G;  4DR7 Q;  1G2S A;  5CV6 A;  4LF4 Q;  1PZI D;  4LJZ C;  4C1N K;  4ZLT F;  1F2Y A;  4DV5 Q;  1RF2 D;  1IKL A;  4JOI A;  1EYA A;  3WWV A;  1LTS D;  1U4P A;  1NMG A;  1VQD A;  3RLO A;  3UDX A;  1WTR A;  1EU4 A;  1QZG A;  2E2H B;  1X55 A;  2VQF L;  4AYB E;  2CW0 D;  2LSS A;  2KEN A;  4KD3 A;  5GQO A;  4V0B A;  1ASY A;  4B3T L;  1E7Z A;  2EXZ A;  4A93 H;  4ZUJ A;  2K05 A;  1JWM D;  3MTS A;  4NMZ A;  3TSS A;  4CBV A;  4LF7 L;  4ODG A;  4RGM A;  1EZ6 A;  3KBX A;  1VQH A;  3D6C A;  4B3M L;  3CCV A;  5HGQ A;  5JPN C;  2VY3 A;  1FJG Q;  1SYG A;  3ITP A;  4OHJ A;  4XQJ A;  4F88 A;  2RHS B;  1SNO A;  4K0K Q;  2KBN A;  5C5L A;  2NUC A;  4NW2 A;  4DUY Q;  5JJK A;  4HMI A;  1X9N A;  2ZTE A;  4S3S A;  1EZ8 A;  4WOR A;  1JJG A;  1WI5 A;  4DV4 Q;  1VQ9 A;  1VQA A;  2MO1 A;  4JOI C;  1Y69 U;  1LM0 A;  3F1Z A;  5EJW A;  2E2I B;  1GD7 A;  2F0K A;  1VF5 C;  2MQH A;  2Q2U A;  2RDG A;  1STN A;  3ZYY X;  3KF8 B;  3Q6S A;  1RTN A;  4FXD A;  4DV2 Q;  2QA4 A;  3O13 A;  4FDB A;  4YWL A;  1WCM B;  4A3D G;  2XNA C;  4DR3 L;  2R7Z B;  2SDF A;  4DR5 Q;  1PH4 A;  1K83 B;  1M8A A;  1YNJ D;  5BR8 L;  2K5W A;  5C0X J;  1D1K A;  2NTS A;  4L5T A;  1XPR A;  5JJZ A;  3I4M G;  1G91 A;  2K5H A;  4JI4 L;  2MNA A;  1HZC A;  1JIC A;  2Z8L A;  3S1N B;  5C4J H;  2R7D A;  3S1M H;  2JE6 I;  2CWA A;  1Q81 C;  4POF A;  3GTP H;  1EIH A;  1O7Y A;  2VW9 A;  4MN3 A;  4H7B A;  1SJH D;  2JA8 B;  1OXT A;  4IN3 A;  2XTI A;  1XX8 A;  1IW7 D;  3E0J A;  1B3A A;  1A2U A;  1BO0 A;  2YU9 H;  2A19 A;  3I72 A;  4A3E B;  4IAL A;  3S14 B;  2ALY B;  1BBW A;  1SRO A;  5IT9 E;  1TWA B;  1VQ5 A;  4TKO B;  1ET6 A;  4H44 C;  2JA5 B;  1D5X C;  3UE1 A;  1B9M A;  3HOZ G;  3OSO A;  1YHA A;  1C9O A;  2WB1 E;  2LFN A;  1BCP F;  2PQA A;  4KTA A;  4OWX B;  3MXN B;  4GOP C;  3EQL C;  1N33 Q;  4BBR H;  3PUZ A;  1LAC A;  2UUB Q;  1CZG A;  1PH6 A;  4NXN Q;  3MFY A;  3V05 A;  1I6H B;  2FJ2 A;  1EYG A;  4HIM A;  2AHO B;  1PH8 A;  3A55 A;  4DR6 Q;  2VNU D;  2Q2I A;  1T5E A;  2QGQ A;  5C4X H;  4DV6 L;  1A3U A;  1SNM A;  1EFW A;  1B44 D;  5IT9 L;  4A3C H;  3HKZ B;  2KHS A;  1TS2 A;  4JI0 Q;  5CV7 A;  1SE3 A;  2F52 A;  5LMN Q;  4LAA A;  1HUM A;  3CPW A;  1TU2 B;  3KYH C;  3M4O H;  4Y7N B;  3AYH B;  4IFD J;  4EQ5 A;  3HOV H;  2VQE L;  4DV1 L;  2JA6 G;  1K0R A;  3TDQ A;  1VMP A;  3RMH A;  4C56 C;  5EQ0 A;  1V43 A;  3HOW G;  5GAE C;  3SK4 A;  5C44 H;  4LF5 L;  1KTK A;  4OO1 G;  4J1M A;  3HP3 A;  4TQU S;  2TSS A;  1X32 A;  2A73 B;  3CRK C;  5A2Q E;  2PMZ E;  2WAQ G;  4HJ9 A;  1JOQ A;  4XYQ A;  2Y0S B;  1W2B A;  4BY1 B;  1UEB A;  2NVT H;  1K8A C;  3K0Y A;  4HJ8 A;  5J3B A;  5IT9 c;  1TS3 A;  4RG1 A;  4GKJ L;  2WII B;  3MAQ A;  1Y8P B;  4JVZ A;  1O7Z A;  1STH A;  4DAY B;  5EAY A;  2HQL A;  5JJI A;  4UP9 A;  3URY A;  4DUZ L;  2Q8R E;  3KFU A;  1GM5 A;  1U4R A;  2BH8 A;  1ILQ A;  4KJN A;  2CFM A;  5A2Q L;  5C0X H;  5DAU A;  5C0X I;  1PYB A;  3HFZ B;  3NWS A;  1RD9 D;  2RA4 A;  3S2H B;  2YTX A;  4J6H A;  1E2W A;  3NK9 A;  1QCB D;  2MPM A;  4A3B G;  3CCU A;  4A93 G;  4CKB A;  1QOH A;  1WTW A;  2ZXR A;  5HGT A;  1UE1 A;  1X54 A;  2QIL A;  2CCZ A;  1GHJ A;  1HZB A;  2K03 A;  4RGT A;  1KHI A;  2DN8 A;  2L5T A;  2IHF A;  3PO3 H;  1E2Z A;  5I6Y A;  4RKL A;  2A68 C;  4R8I A;  1AE2 A;  3ZJY C;  3FEW X;  1PH2 A;  2D0O A;  5KYL A;  2K5Q A;  1CKM A;  2NYZ D;  1JC7 A;  2RBM A;  2D9U A;  1SND A;  3HZX A;  3GTG B;  1YBY A;  3TN2 A;  4FF4 A;  2MJ8 A;  4JBW A;  3T4A C;  2VS1 A;  3BU2 A;  5E1F A;  2N3S A;  4YCU A;  4Z9C B;  2Q8I B;  1Q7Y C;  3R3O A;  4B9W A;  1JOK A;  5LHY 1;  4XIG S;  5IP9 G;  1EY5 A;  4CJ0 B;  3S2D H;  2JA9 A;  2NVQ B;  3J7Z C;  1JR0 D;  1L0W A;  3KLR A;  2KJX A;  4X3S A;  1CT1 D;  2KCN A;  3CU7 A;  2L4N A;  2RVL A;  2VB2 X;  4CHT B;  1YIJ A;  1Q12 A;  2R93 H;  1DD2 A;  3DM3 A;  1OXX K;  2OTL A;  2F1M A;  5EKK A;  1O78 A;  3ERS X;  4YWM A;  4IFD H;  2LXJ A;  1KAB A;  1PFB A;  3TS2 A;  2WAC A;  4PMC A;  1E2V A;  1EY9 A;  1BDO A;  5LMN W;  5M5X B;  3J7A 5;  4HSP A;  5COY A;  5DM6 3;  3STB D;  4JI2 L;  4UPA A;  2KCC A;  1N34 L;  4QUC A;  5BN4 A;  3CC4 A;  2DNE A;  2IWH A;  2NBF A;  4F7X A;  3C3L A;  1GUO A;  3L2P A;  3CMA A;  1TWC H;  2K01 A;  3E3X A;  2V1C C;  4JI6 Q;  4GOP B;  3X3M A;  2RDF A;  2F0Q A;  2IX0 A;  1MBY A;  1UE6 A;  3S1R B;  4X3T A;  1Y1W B;  2JA6 B;  5GAD C;  1N8R C;  4L5R C;  1PFS A;  5IOD A;  2MUY A;  1AZP A;  1R9T H;  4CKC A;  4HIK A;  4RHR A;  3CC7 A;  3CXC A;  2VZA A;  4AYB B;  4ZKC B;  5IYD G;  3F2U A;  4RA8 A;  4BBR G;  1JB7 A;  3TBI B;  3RR5 A;  4C3H B;  1EOT A;  3NEN A;  5C3X A;  5LL6 X;  1BBU A;  2UUA Q;  4XXE A;  1OXV A;  1YNJ C;  1WTQ A;  3I70 A;  4DU9 A;  4IPC A;  3Q8D A;  2K6A A;  3D31 A;  3VA7 A;  2F0D A;  4O2D A;  4A3C G;  1M4V A;  4IJL A;  1YHQ A;  5LMU L;  4JI3 Q;  4Q0F A;  2K04 A;  3I55 A;  4A76 A;  2A6E D;  2AUJ D;  1LO5 D;  2FHT A;  4DNT B;  3EBE A;  3I4N B;  4C3J B;  1PMR A;  4XDX A;  2EJG C;  4XT1 B;  3OTO Q;  1WYD A;  3GTJ H;  5E4X A;  4G7H C;  3OIQ A;  2JEB I;  4C3I H;  2F0P A;  3U4V A;  3GTM B;  3HOV G;  2EPB A;  1ENC A;  2IPK D;  4CDE C;  5FJ8 G;  3WOF A;  2IJ0 A;  3PF5 A;  1K8O A;  2M00 A;  3DXJ C;  1G29 1;  4AQY L;  3MZ5 A;  2V4D A;  5C44 G;  5FKA C;  2F4V L;  1XPU A;  2B39 A;  4FF3 A;  2L11 A;  3BG3 A;  2NVY H;  1KLG D;  1F2L A;  5C4Z A;  4A93 B;  4NP5 A;  4NKL A;  3C1F A;  1HPC A;  4ILW A;  3JAM E;  1STB A;  4R9W A;  1EWH A;  2PQE A;  2FMM A;  3S17 H;  1KDB A;  1SYB A;  5DEH A;  4ID6 A;  1WVL A;  3S9W A;  4B3S Q;  1JJC B;  4ZUI A;  3AMU A;  3NTI A;  4LW1 A;  1ZXT A;  3DMU A;  3TEH B;  1X6O A;  4PMB A;  3AFQ A;  1TS5 A;  3HKZ E;  2K28 A;  4PQX A;  1TQO A;  3S1Q B;  5CV8 A;  5C0X G;  1IBL L;  4IUR A;  3M7N A;  1N32 L;  1XPO A;  4TRD A;  1DZ1 A;  3JAM L;  2I5H A;  2ZJR A;  1VQ7 A;  3H6M A;  2UXC L;  1IZ6 A;  4RH6 A;  4GN3 B;  1H9J A;  1H9M A;  1XMO Q;  4L6T B;  2C5C A;  3ERO A;  4X64 L;  3D8G A;  4FF1 A;  3E9I A;  3QOL A;  5DM7 3;  5M3F H;  5C3E H;  2JK8 A;  2F0F A;  1AEX A;  3QR8 A;  2JP1 A;  5L37 A;  2B2T A;  1H9K A;  2EY2 A;  1PH5 A;  1J5E L;  1PTO D;  3U4Z A;  4CDD C;  4X62 Q;  4JG2 A;  3F8T A;  3BJU A;  1B9N A;  3SDZ A;  4LFC L;  2Y0S E;  4X3U A;  1JT8 A;  3PO3 G;  5IYC H;  4HMJ A;  1E3P A;  3S1M B;  2OF1 A;  3RLF A;  3GTP B;  1ONL A;  1R4P B;  2JN4 A;  1LT4 D;  2CQO A;  3I4M H;  1RJT A;  2PCF B;  1XNQ Q;  1EY0 A;  3H0G H;  1ASZ A;  3JAM c;  2EVB A;  2DY7 A;  3SK6 A;  3EJI A;  1EL0 A;  3VR4 A;  1HQR D;  4G7O C;  3Q0A A;  1F9P A;  4ZYS A;  1A3V A;  1L2F A;  1MI2 A;  3T16 A;  2BA1 A;  4BBS H;  1A3T A;  2F0N A;  3Q23 A;  3ULP A;  2CVR A;  3QG1 A;  2XSC A;  1SBB B;  4IPD A;  2ZXO A;  2HHH L;  2R93 G;  1M1K C;  3L0O A;  1UE7 A;  1CSQ A;  2AMC B;  4HTH A;  4U67 3;  2X6L A;  1V1Q A;  1XTD A;  1U4M A;  2B2T C;  3HOZ H;  4IFD G;  3A0J A;  1B50 A;  4OX9 L;  1J8I A;  3ONA B;  5C4X B;  1SNQ A;  1TVX A;  2B2V C;  2NTT A;  4RGN A;  4JYA Q;  5I6W A;  4APV A;  1O7L A;  5DLQ E;  5M3M H;  2YTV A;  4JBK A;  4JC0 A;  1S5B D;  1F77 A;  1QVC A;  1BQQ T;  4XT3 B;  1WTH A;  5JEA J;  4LUV A;  3GTK H;  2H4O A;  1WD0 A;  2B8F A;  2HCC A;  2E75 C;  4DR2 Q;  1H9R A;  2ATW A;  4FP5 D;  1WTV A;  2B63 B;  3RZD B;  3NP8 A;  3UE0 A;  3HOV B;  3BDL A;  1S5D D;  1YNX A;  2H1E A;  3OWF A;  3NWT A;  3LX0 A;  1PTO H;  1CA6 A;  1G8Z D;  3KF6 A;  1MGS A;  1RL2 A;  2EJM A;  4DR7 L;  5DNF A;  2MO0 A;  1CM9 A;  3CQZ H;  3OYY A;  5D14 A;  4X66 L;  2CQA A;  4KY7 A;  3EFX D;  2NZO A;  2Q8T A;  1FD7 D;  5FLX E;  4IO9 A;  1FL0 A;  5H1S E;  2O4X A;  4KI0 A;  1C0A A;  3RUZ A;  1S40 A;  4OWT B;  1AW7 A;  3HOW H;  2KHJ A;  2F0G A;  1Z47 A;  4A3J H;  2R92 H;  1KNA A;  4A3G G;  2HT1 A;  3UI2 A;  2F0U A;  1I3Q H;  2VUM B;  1EFI D;  4K8I A;  5EPJ A;  3STB C;  4CJ2 C;  1U4L A;  4DPG A;  3Q24 A;  2K33 A;  4IUT A;  3K6O A;  3IFT A;  1ZYR C;  3I8Z A;  3D4R A;  5FLX L;  4RCO A;  4C3I G;  1TWH B;  3MWY W;  2YYZ A;  4KKS A;  2AKW B;  3DEP A;  4BXX G;  4H0L C;  3FMC A;  2B29 A;  3F2C A;  4JI7 L;  1FJG L;  2F3V A;  1E1T A;  4JI1 L;  4OIK A;  4DUY L;  3ER0 A;  3M4Y A;  3S24 A;  1KAA A;  3C2P A;  1QE6 A;  2EY5 A;  3P1H A;  4GKK L;  3KLW A;  3MEH A;  2ICI A;  2E5L Q;  4LF6 Q;  1PDQ A;  4XTC S;  1QVF A;  4HAE A;  4IQZ A;  2FMC A;  4P75 A;  2PZU A;  2KCT A;  5JVH 3;  1CHP D;  4DV0 Q;  3PO2 H;  2DGY A;  4A3B H;  2PZT A;  3OWE B;  1SNC A;  2Z4I A;  3NEL A;  4K2K A;  1F2Z A;  4DV2 L;  2QF7 A;  1UE5 A;  3C1E A;  3J7A V;  3VA5 A;  1KRT A;  1FNU A;  5E3F A;  4JI5 L;  4DAM A;  3H94 A;  3DWP A;  2K7V A;  4HR7 B;  3T53 B;  4DR1 L;  5ISR A;  4GLX A;  1LV9 A;  2A6E C;  2GA4 B;  5FLX c;  1UNS A;  2L12 A;  1I6V C;  2NVX H;  1Q90 A;  4MIU A;  2SNM A;  5I9P A;  2A69 D;  1I50 H;  5M5Y H;  3MXP A;  2PNR C;  3H15 A;  1U5K A;  3U50 C;  1N36 L;  1JOR A;  4N8F A;  3M4Q A;  4E6I A;  1KQS A;  1SMX A;  2GVA A;  1YZ6 A;  5EBC A;  5HUR A;  3QJY A;  5M3F G;  1KD1 C;  2E2J B;  5C3E G;  2RSN A;  3MA2 B;  5JEA H;  2ENB A;  2ASB A;  5CMD A;  4KHP L;  5IP9 H;  1GHK A;  5IOC A;  3P7J A;  3TRE A;  3CHB D;  1C8C A;  1Q82 C;  1X3F A;  2JA7 B;  2X6G A;  4B3R Q;  2O5I C;  1ZKO A;  5IYC G;  4N9P A;  5GRO A;  4A3M H;  3VYT A;  3HGB A;  1BCP C;  2VQF Q;  3TZU A;  2ZM6 L;  3HOY H;  4ME5 A;  4HSV A;  3OMG A;  4DV7 L;  4RWS C;  4I7Z C;  2N78 A;  1NUC A;  1TWC B;  4GS3 A;  4RKB A;  1CHQ D;  5EKI A;  4B3T Q;  3I2Z A;  4YIJ A;  4KHV A;  5IGC A;  4IJH A;  2UU9 Q;  3H0G G;  3NBI A;  4A3I H;  2UUB L;  1YI2 A;  2MHV A;  1IYU A;  1GOZ A;  2QDL A;  4NXN L;  3NBH B;  5IWA L;  5JJL A;  1YNN D;  3HKS A;  3H09 A;  4O42 A;  4DF7 A;  4DR6 L;  1A2T A;  1HNX L;  4QL5 A;  4C1N I;  3OPO A;  1V1O A;  4BBS G;  1OXU A;  1VQ8 A;  4B3M Q;  2XIW A;  4JK1 C;  5T1G A;  1R9T B;  4K8J A;  1XXG A;  4JI0 L;  4QIW B;  4GN5 A;  4LFA L;  2SEB D;  5EKL A;  1JMC A;  3D4D A;  1S5F D;  1D7Q A;  2QEX A;  1HR0 L;  1Y1V B;  3G48 A;  2HDM A;  2L1B A;  4K14 A;  3M7G A;  1LT3 D;  4FO2 A;  1C4Q A;  1GUW A;  1PTO C;  2EJF C;  1J6Q A;  1XJV A;  4A3F H;  5M5W H;  1FVI A;  5IP7 G;  5IYD H;  3HOX B;  5M3M G;  3PGZ A;  2E76 C;  2C9O A;  3ND9 A;  1MSH A;  3AEV A;  1EU3 A;  3RZO H;  3FKI H;  1P16 A;  2HIX A;  4DR3 Q;  1HH2 P;  3GTJ B;  3DWA A;  1PHJ A;  5BR8 Q;  3KOJ A;  5KNB A;  3QWN A;  3A8K E;  1B8A A;  4KN7 C;  1Y14 B;  3S16 H;  4NB3 A;  4JI4 Q;  3PV0 A;  3J81 j;  3W2D A;  2YTY A;  4UHV A;  3MC0 B;  4LUO A;  2EE1 A;  2R3Z A;  2L15 A;  4R4I A;  3TP6 A;  1JE4 A;  1T9H A;  5FJ8 H;  3NE5 B;  1QNU A;  4HJA A;  2VXW A;  3AB9 A;  2EZV A;  4DV3 L;  1PTO F;  3U9S A;  1EY8 A;  2SOB A;  2CKZ B;  4A3J G;  2R92 G;  1TWF H;  3UDI A;  3RN5 A;  1VF7 A;  4X6A H;  1QB5 D;  4UY8 C;  4EVO A;  1HNW L;  3GTQ H;  3LNN A;  4PZ7 A;  4JV5 Q;  3BYT B;  4OXP A;  1DM0 B;  3NQI A;  2D0P A;  2ZT9 C;  5E4W C;  5FOB B;  1ML0 D;  1VMC A;  2M2L A;  3A5Z B;  2AQ2 B;  3OW7 A;  1VQB A;  1VQO A;  1VCI A;  1SYC A;  4X3K A;  3CCR A;  4DV6 Q;  5IY0 A;  3H91 A;  2K52 A;  3CRL C;  4LNQ A;  4WJ3 M;  1PH7 A;  1SFO H;  1Q3L A;  5CBA E;  5C3E B;  3GTO B;  3E9H A;  3KDF A;  4P73 A;  1HCZ A;  2FIN B;  1BXT A;  4JBJ A;  3RN2 A;  1I5F A;  3VR3 A;  2F0I A;  1DON A;  3MEF A;  3PO2 G;  2XGT A;  4A3D B;  4PZ8 A;  1PYS B;  1H95 A;  2VQE Q;  1LT5 D;  5C5M A;  4O1N A;  3MHB A;  4U68 A;  3W3A A;  2PI2 E;  3GTL H;  1NR4 A;  4ULL A;  1RIP A;  4LF5 Q;  2AWN A;  4RGO S;  3I91 A;  1WTP A;  4Y52 H;  3I4M B;  3GD7 A;  4A75 A;  3I90 A;  2SNS A;  3G6J B;  2F03 A;  2G9H D;  1XNR L;  2IW3 A;  4BY7 G;  2HDL A;  4EQO A;  4BA2 I;  5IGF A;  4GKJ Q;  4G4K A;  1BCP B;  1GUG A;  1QNK A;  2F3W A;  3P75 A;  3BDO A;  1EYD A;  2KCM A;  3BYY B;  1QUQ A;  1EUJ A;  2VL6 A;  5JEA G;  3M3Y B;  4R8N A;  4DXG A;  1BF4 A;  3GV3 A;  1I94 Q;  1HZA A;  1P8L A;  2MGS A;  4CKE A;  2KUM A;  1Q86 C;  1J9O A;  4LWC A;  3HOZ B;  2MP1 A;  2EYO A;  1KC8 C;  3NQT A;  2UUC L;  2OQK A;  1WFQ A;  4A3M G;  5EPL A;  2CW0 C;  1VQ6 A;  2EQS A;  3T1H Q;  3HOY G;  1NNX A;  1A63 A;  3W1B A;  1D1I A;  4N8X 1;  2I5L X;  1U9R A;  4IFD I;  2JSO A;  3HOU H;  1EQT A;  4CDF C;  3OHX C;  1I4X A;  3M9B A;  2FFK B;  4A3I G;  3J80 L;  3T1Y L;  4YCW A;  1CQF A;  1CKN A;  2O5J C;  1OTC A;  2LXK A;  5IGE A;  3C46 A;  2E2I H;  1EY7 A;  4J15 A;  3BVM A;  1PVO A;  2H5X A;  1NMF A;  1PTO B;  1SE4 A;  4NPS A;  2WB1 G;  3VYR A;  2D5D A;  4CDC C;  3G7L A;  1QWY A;  2O2L D;  1D2B A;  2A69 C;  4AIM A;  4YY3 L;  2A1A A;  2G5D A;  1WCM H;  3CQZ B;  3I3C A;  2A74 C;  4OEL B;  3NTH A;  4DFA A;  5HY6 A;  5CV5 A;  1WD1 A;  3CAM A;  1LTI D;  4YHH Q;  3HOW B;  3VR2 A;  1S5C D;  4B08 A;  5IGG A;  2A8V A;  1KIX A;  1B53 A;  2R92 B;  1EY4 A;  1EQV A;  4A3F G;  1W3S A;  2WAQ B;  3JAM i;  2LKV A;  1ICW A;  2L9H A;  1I3Q B;  4QQB X;  1Q1B A;  2JYO A;  4EX5 A;  1EIY B;  4OWW B;  1EEF D;  1IBM Q;  2X69 A;  1H9S A;  3FKI G;  3T56 B;  1LTT D;  4IPH A;  2JA8 H;  4RFB A;  4A3G H;  1X56 A;  4KY5 A;  1D5M C;  1ET9 A;  2Z6B A; 
#chains in the Genus database with same CATH homology
 1V1Q A;  1XTD A;  4PZ6 A;  1JJG A;  4IFD G;  2JJQ A;  3HOZ H;  1WI5 A;  3A0J A;  4DV4 Q;  1VQA A;  1TWA H;  1VQ9 A;  2MO1 A;  4OX9 L;  4JOI C;  1LM0 A;  3K80 C;  3F1Z A;  4NXM Q;  3I4O A;  2VUM H;  3U58 A;  1PH9 A;  1IBK L;  2JA5 H;  1CKO A;  2PQA B;  1GD7 A;  1N34 Q;  4HJ7 A;  2MQH A;  2N49 A;  1PH1 A;  2Q2U A;  4JYA Q;  1I94 L;  1HNZ Q;  2F3I A;  4APV A;  4YWK A;  5M3M H;  5DLQ E;  3SGI A;  2YTV A;  4JBK A;  3KF8 B;  4JC0 A;  3I4N G;  3CF5 A;  4QGU A;  4DV1 Q;  3ICE A;  2ZJP A;  4DV2 Q;  1QVC A;  4BXX H;  1JE5 A;  4QIW E;  2I5M X;  2QA4 A;  1C7Y A;  4HJ5 A;  4FDB A;  5JEA J;  4LUV A;  4P74 A;  4YWL A;  3GTK H;  4A3D G;  4DV3 Q;  1VQ4 A;  1AE3 A;  1TWH H;  1X9N A;  4DR3 L;  4DR2 Q;  3GO5 A;  4WJ4 A;  4DR5 Q;  1PH4 A;  1YHB A;  1VQI A;  3CCS A;  1I6H H;  2ATW A;  3T1H L;  2UXD Q;  5BR8 L;  3UE0 A;  5C0X J;  1YJW A;  1E1O A;  1YNX A;  3EIV A;  4IOC A;  4A3L H;  1HNW Q;  4L5T A;  1XPR A;  3I4M G;  4LF9 L;  2K5H A;  4UP7 A;  4JI4 L;  2MNA A;  1HZC A;  3KF6 A;  1RL2 A;  2C35 B;  4DR7 L;  2E2H H;  3G4S A;  5C4J H;  2R7D A;  3CC2 A;  2JE6 I;  2MO0 A;  2CWA A;  1Q81 C;  4POF A;  1K9M C;  1VQK A;  3CQZ H;  3OYY A;  4X66 L;  3GTP H;  2VW9 A;  3CP0 A;  3AFP A;  2NZO A;  4IO9 A;  4Y7N H;  1FL0 A;  1OXT A;  5H1S E;  4KI0 A;  4DUZ Q;  1C0A A;  2R6G A;  1S40 A;  2PNH A;  2XTI A;  3A74 A;  4OWT B;  1L1O A;  2AWO A;  3HOW H;  1KRS A;  4JI6 L;  2KHJ A;  2YU9 H;  2A19 A;  1O7I A;  1Z47 A;  4A3K G;  4QJF A;  4A3J H;  1XMQ Q;  2R92 H;  2ALY B;  1BBW A;  1SRO A;  2HT1 A;  4A3G G;  1VQ5 A;  1I3Q H;  1EOV A;  5AJ3 L;  3UE1 A;  2JEA I;  3STB C;  1NBW A;  1YHA A;  1C9O A;  3HOZ G;  4DPG A;  2WB1 E;  3G71 A;  1XNQ L;  4YHH L;  1SN8 A;  2PQA A;  3AQQ A;  4POG A;  4BY1 H;  4OWX B;  3PIO A;  3MXN B;  4GOP C;  1N33 Q;  4BBR H;  3PUZ A;  2CWP A;  2YYZ A;  2UUB Q;  2AKW B;  2DUD A;  1PH6 A;  4BXX G;  4NXN Q;  2JQO A;  1Q1E A;  4R4C A;  1IBM L;  1EYG A;  4HIM A;  2AHO B;  1PH8 A;  2UUA L;  2B29 A;  4MZ9 A;  3F2C A;  4AQY Q;  2E2J H;  4JI7 L;  1FJG L;  4DR6 Q;  2VNU D;  2Q2I A;  2QGQ A;  5C4X H;  4DV6 L;  1E1T A;  1EFW A;  2F4V Q;  3B6Y A;  4JI1 L;  4A3C H;  4DUY L;  3ER0 A;  3S24 A;  1YVC A;  1JJ2 A;  2ZJQ A;  3K7U C;  4GKK L;  3TQY A;  4JI3 L;  3KLW A;  2R7F A;  4JI0 Q;  4YCV A;  2E5L Q;  3KDF B;  2JA7 H;  4LF6 Q;  1SR3 A;  4AH6 A;  2IT1 A;  4ALP A;  4L5S A;  2F52 A;  5LMN Q;  1MKH A;  4XTC S;  1EQQ A;  4NXM L;  1QVF A;  1XNR Q;  4P75 A;  3CPW A;  2R7Z H;  2KCT A;  3KYH C;  4LF8 L;  1K83 H;  3M4O H;  3OTO L;  1L1O C;  3AYH B;  4DV0 Q;  1HR0 W;  3PO2 H;  4HID A;  1HNZ L;  4IFD J;  2DGY A;  4EQ5 A;  4A3B H;  3K7A H;  3HOV H;  2VQE L;  4DV1 L;  1LYL A;  3NEL A;  2GVB A;  4DV2 L;  2JA6 G;  1UE5 A;  1K0R A;  4KLK A;  1KRT A;  1K8G A;  2UXB L;  1VQE A;  1V43 A;  3HOW G;  5GAE C;  4JI5 L;  5C44 H;  4DAM A;  4DR2 L;  4LF5 L;  4OO1 G;  3TS0 A;  3S1N H;  4DK6 C;  2BH2 A;  4TQU S;  4JI8 L;  4DR1 L;  2PI2 A;  4GLX A;  1IBL Q;  2PMZ E;  3F2B A;  2UXD L;  2WAQ G;  3I7F A;  5FLX c;  1N32 Q;  2UUC Q;  4HJ9 A;  3FP9 A;  1Q8K A;  3J80 c;  2RF4 A;  1KXL A;  4DNI A;  2NVX H;  2Z0S A;  4LFB L;  1WJJ A;  1W2B A;  4PMW A;  1MJE A;  1UEB A;  2NVT H;  1I50 H;  5M5Y H;  1K8A C;  4H02 A;  4HJ8 A;  4A3E H;  5J3B A;  3H15 A;  5IT9 c;  1U5K A;  3S14 H;  3U50 C;  4X64 Q;  1N36 L;  3GDE A;  4RG1 A;  3M4Q A;  4GKJ L;  1KQS A;  3HOU G;  1SMX A;  2GVA A;  1YZ6 A;  4RMF A;  4B3S L;  1KD1 C;  5M3F G;  1QUQ B;  5C3E G;  4DAY B;  3GTG H;  5EAY A;  4JI2 Q;  2ASB A;  2IHE A;  2HQL A;  1GO3 E;  1M90 C;  4UP9 A;  1Y1V H;  3T1Y Q;  5JJI A;  1A0I A;  4DUZ L;  1BKB A;  5IP7 H;  1J5E Q;  4KHP L;  5IP9 H;  3KFU A;  1VQC A;  1GM5 A;  2BH8 A;  3TRE A;  1VQM A;  5C4X G;  1Q82 C;  4DR4 L;  2CFM A;  1XMQ L;  1X3F A;  4B3R Q;  1G6P A;  1KL9 A;  1CUK A;  5C0X I;  3HOX H;  1PYB A;  3HFZ B;  5IYC G;  3IRB A;  4A3M H;  5GRO A;  2OTJ A;  3W5O A;  5FLM G;  2NVQ H;  2VQF Q;  4YY3 Q;  2ZM6 L;  3HOY H;  3PUX A;  4QY7 A;  1WCM G;  1EWI A;  2YTX A;  4P72 A;  4DV7 L;  3CCL A;  1DGS A;  1XMO L;  2N78 A;  4GS3 A;  1EIF A;  4IOA A;  4B3T Q;  2B63 G;  3I2Z A;  2UU9 Q;  4IJH A;  4A3B G;  3H0G G;  3CCU A;  4A3I H;  2UUB L;  4A93 G;  1YI2 A;  3PUW A;  2K50 A;  4LF4 L;  4NXN L;  3NBH B;  1TXY A;  5IWA L;  5JJL A;  3HKS A;  5M5X H;  3CD6 A;  4DV5 L;  1UE1 A;  1X54 A;  1PV4 A;  4GNX A;  1K3R A;  2CCZ A;  4DR6 L;  4X62 L;  1HZB A;  3K0X A;  4QL5 A;  1HNX L;  1KHI A;  1VQJ A;  2RHQ B;  4LUZ A;  1HJP A;  2IHF A;  3S1M H;  4BBS G;  1OXU A;  3PO3 H;  2K14 A;  1VQ8 A;  4B3M Q;  1AE2 A;  3ZJY C;  4PG3 A;  3LGJ A;  4JI0 L;  1PH2 A;  2JA8 G;  3K8A A;  4LF6 L;  2D0O A;  4GN5 A;  4LFA L;  1CKM A;  1JMC A;  1WOC A;  5LMU Q;  2NN6 I;  4JV5 Q;  1YBY A;  1GVP A;  1D7Q A;  2QEX A;  5K36 G;  4JBW A;  1HR0 L;  2VS1 A;  3G48 A;  1S3O A;  5ELO A;  4OX9 Q;  3BU2 A;  2IX1 A;  2N3S A;  4YCU A;  1IBK Q;  2VUM G;  2JA5 G;  2KHI A;  1XJV A;  1J6Q A;  4A3F H;  4KHZ A;  5M5W H;  5GAG C;  1FVI A;  1Q7Y C;  5IP7 G;  5IYD H;  4XIG S;  5IP9 G;  5M3M G;  1G51 A;  4R1J A;  3FHW A;  3PGZ A;  4HIO A;  2Z6K A;  3CCM A;  3S2D H;  3AEV A;  2JA9 A;  3J7Z C;  3RZO H;  1L0W A;  3FKI H;  5ELN A;  1QVG A;  2Q2T A;  3S15 H;  1P16 A;  2HIX A;  4DR3 Q;  1HH2 P;  2GN5 A;  2YV5 A;  1U0L A;  1YIJ A;  4C3H H;  2HIV A;  1Q12 A;  2R93 H;  4K0K L;  4C2M H;  3DM3 A;  1YJN A;  1OXX K;  3KOJ A;  5BR8 Q;  4BA1 I;  1PHJ A;  2I0Q A;  2OTL A;  1AH9 A;  4X65 Q;  3ERS X;  1NTG A;  4YWM A;  3I56 A;  4A3L G;  2LXJ A;  1B8A A;  3TS2 A;  4DV4 L;  1Y14 B;  2K75 A;  5GAH C;  4O0A A;  4GNX C;  4LF9 Q;  3S16 H;  4NB3 A;  5LMN W;  4JI4 Q;  2WAQ E;  2Q2H A;  3PV0 A;  3J81 j;  1IL2 A;  3J7A 5;  3GTO H;  3STB D;  2YTY A;  4JI2 L;  1X3E A;  4UP8 A;  4LUO A;  4UPA A;  1N34 L;  3CC4 A;  3S2H H;  4X66 Q;  4JYA L;  1VQP A;  2L15 A;  1K73 C;  3I4N H;  4R4I A;  4C3J H;  3L2P A;  3CMA A;  1VQN A;  5E7N A;  1T9H A;  4P71 A;  5FJ8 H;  1TWC H;  4HJA A;  4B3R L;  1PH3 A;  2OCE A;  2V1C C;  4A3D H;  2K5V A;  4DV3 L;  3E0E A;  4JI6 Q;  3GTM H;  1N9W A;  4GOP B;  4DR5 L;  1NJI C;  2MFI A;  2CKZ B;  4A3J G;  2R92 G;  1TWF H;  2IX0 A;  3UDI A;  3RN5 A;  3VDY A;  3CW2 C;  1UE6 A;  4GLV B;  4X6A H;  5IE8 A;  1TWG H;  4MTN A;  5AJ3 Q;  4UY8 C;  4OON A;  3PUY A;  1HNW L;  4GLA C;  4JCV E;  4L5Q A;  3GTQ H;  3H3V H;  2ID0 A;  4PZ7 A;  5GAD C;  1N8R C;  1PFS A;  2UU9 L;  2K4K A;  4L5R C;  3H3V I;  3D0F A;  2Z6K C;  3ULL A;  2UXC Q;  3RNU A;  4OXP A;  2D0P A;  1R9T H;  4HIK A;  4GN4 B;  3BZK A;  3CXC A;  3CC7 A;  1IYJ B;  1PA6 A;  2VZA A;  4BY7 H;  3UDF A;  3KJO A;  3PF4 A;  3CPF A;  2Y0S G;  3A5Z B;  5IYD G;  4BY1 G;  3J81 c;  5IYB H;  2WFW A;  4BBR G;  2K5N A;  1JB7 A;  1VQB A;  3RR5 A;  3K81 C;  3NEN A;  3J81 i;  1BBU A;  1VQO A;  1VCI A;  2UUA Q;  1L1O B;  1E22 A;  1OXV A;  1V9P A;  4JI7 Q;  2EIF A;  2RCN A;  3CCR A;  4DV6 Q;  2ZTD A;  5IY0 A;  3M3Y H;  2K52 A;  4IPC A;  4JI1 Q;  3Q8D A;  4LNQ A;  4WJ3 M;  2D62 A;  3D31 A;  1PH7 A;  4LFC Q;  4O2D A;  1SFO H;  4A3C G;  1MIU A;  1YHQ A;  1E24 A;  4IJL A;  4GKK Q;  5LMU L;  1D8L A;  4ME3 A;  4JI3 Q;  3E9H A;  3I55 A;  4A76 A;  1S72 A;  3S1Q H;  2IY5 B;  3KDF A;  2JA7 G;  4P73 A;  4JBJ A;  3RN2 A;  3EBE A;  1I5F A;  4LF8 Q;  2R7Z G;  2B3G A;  3OTO Q;  1WYD A;  3MEF A;  1YEZ A;  3GTJ H;  1HZ9 A;  3PO2 G;  1SE8 A;  2XGT A;  4PZ8 A;  2JEB I;  4C3I H;  1PYS B;  1N33 L;  3U4V A;  1H95 A;  2VQE Q;  3HOV G;  3ULJ A;  2NZH A;  5FJ8 G;  3PF5 A;  4DK3 C;  3RLN A;  1BVS A;  4LF7 Q;  1B7Y B;  2PI2 E;  1CKN B;  3G6E A;  2OQ0 A;  2OWO A;  3GTL H;  3CME A;  2UXB Q;  1RIP A;  1G29 1;  1X3G A;  4AQY L;  4JI5 Q;  4LF5 Q;  2AWN A;  5C44 G;  4GOP A;  3OW2 A;  3TRZ A;  2F4V L;  4JI8 Q;  3A5U A;  3CCE A;  4DR1 Q;  1XPU A;  4Y52 H;  1VQG A;  3GD7 A;  2NVY H;  1KAW A;  4A75 A;  1B70 B;  4MNO A;  4X65 L;  2E5L L;  3PUV A;  4LFB Q;  2HHH Q;  5LMN L;  1XNR L;  4JBM A;  3S17 H;  1LUZ A;  3W1G A;  4A3E G;  4BY7 G;  1N36 Q;  1VS0 A;  4DV0 L;  4BA2 I;  4GKJ Q;  2WP8 J;  1EQR A;  3M85 A;  1OXS C;  4B3S Q;  2KCM A;  3CCQ A;  1JJC B;  3S1R H;  5IYB G;  1QUQ A;  3NEM A;  1EUJ A;  2VL6 A;  1Y1W H;  4LW1 A;  5JEA G;  2JA6 H;  1LTL A;  3PSI A;  3TEH B;  1Y1V G;  2N8N A;  3EN2 A;  3UDG A;  1VQF A;  1X6O A;  1I94 Q;  1CSP A;  4KHP Q;  1HZA A;  1P8L A;  3AFQ A;  3HKZ E;  1Q86 C;  2ES2 A;  4IPG A;  4LWC A;  4DR4 Q;  3DLL A;  3F2D A;  4OO1 I;  1NE3 A;  5C0X G;  1IBL L;  4R4Q A;  3M7N A;  3HOX G;  1N32 L;  1KC8 C;  2UUC L;  2OQK A;  3JC6 6;  1WFQ A;  1XPO A;  4A3M G;  1Q46 A;  2FXQ A;  2I5H A;  2ZJR A;  4JV5 L;  2ZM6 Q;  3M4P A;  4DKA C;  1VQ7 A;  1VQ6 A;  2EQS A;  3T1H Q;  2UXC L;  3HOY G;  1IZ6 A;  4DV7 Q;  2ZTC A;  4GN3 B;  1A63 A;  3W1B A;  1XMO Q;  1MJC A;  2I5L X;  1SLJ A;  4X64 L;  4IFD I;  3E9I A;  4R4T A;  1SRU A;  3BZC A;  3L7Z C;  4R4O A;  3M9B A;  3HOU H;  1X65 A;  5M3F H;  5C3E H;  3HKZ G;  4DR7 Q;  4LF4 Q;  2JK8 A;  4A3I G;  1QZH A;  5IWA Q;  3T1Y L;  4YCW A;  1CKN A;  1J5E L;  1IXR A;  1UWV A;  4DV5 Q;  1PH5 A;  3U4Z A;  2LXK A;  1OTC A;  1Z9F A;  4X62 Q;  4JG2 A;  3F8T A;  4JOI A;  3BJU A;  1YJ9 A;  1HNX Q;  2E2I H;  4J15 A;  2E8G A;  1PVO A;  1YIT A;  3WWV A;  2H5X A;  1NMF A;  4NPS A;  4LFC L;  1A8V A;  1NMG A;  1VQD A;  2WB1 G;  2Y0S E;  5IYC H;  3RLO A;  3UDX A;  3PO3 G;  1JT8 A;  1QZG A;  1A62 A;  1E3P A;  5FLM H;  1X55 A;  2VQF L;  3RLF A;  4AIM A;  4LFA Q;  4AYB E;  2A1A A;  4YY3 L;  1WCM H;  2NN6 G;  2LSS A;  2KEN A;  3PIP A;  5GQO A;  4TVA B;  1GKH A;  1HR0 Q;  2CQO A;  3KJP A;  5HY6 A;  2B63 H;  3I4M H;  1ASY A;  4B3T L;  1E7Z A;  3CAM A;  3RZD H;  1NY4 A;  1XNQ Q;  4YHH Q;  3H0G H;  3KF6 B;  1ASZ A;  4A93 H;  2A8V A;  3JAM c;  1KIX A;  1Y1W G;  1FGU A;  2EXD A;  1VQL A;  4A3F G;  3CCJ A;  4LF7 L;  1W3S A;  4GNX B;  3JAM i;  4A4I A;  4QQB X;  1L2F A;  1Q1B A;  2BA1 A;  4EX5 A;  1EIY B;  4OWW B;  4BBS H;  1VQH A;  3ULP A;  4AYB G;  1IBM Q;  2BA0 A;  3FKI G;  3CCV A;  4B3M L;  5HGQ A;  2VY3 A;  4A3K H;  1FJG Q;  4IPD A;  4IPH A;  2JA8 H;  2RHS B;  4A3G H;  1X56 A;  2KBN A;  2HHH L;  4K0K Q;  4DUY Q;  1M1K C;  2R93 G;  3L0O A;  1UE7 A;  3J80 i;  1CSQ A;  5JJK A;  2AMC B;  3PCO B;  2ZTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...