1QVFE

Structure of a deacylated trna minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 39
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1qvfE01
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1qvfE02
3CMAE 4IO9E 1NJIG 3PIPE 1QVFE 4WFBE 3CXCE 5MLCH 1VQ4E 3PIOE 1Q82G 1VQ8E 2QEXE 3CCQE 1VQME 1YHQE 1VQ9E 1YJWE 3G71E 1KD1G 3CCSE 3CCVE 1RL6A 2ZJRE 3I55E 5GAGG 1M1KG 3CCLE 3G4SE 1K73G 3OW2E 5HL7E 2ZJQE 4UY8G 1VQOE 1VQ5E 3CC2E 1Q81G 1JJ2E 3CD6E 3I56E 5GADG 3DLLE 3CCJE 4IOCE 2CQLA 3CCME 5AN9B 3CCEE 1N8RG 5JVHE 4WFNE 4WCEE 1YIJE 3CF5E 1M90G 5H1SI 1KQSE 1VQKE 3CC4E 1S72E 3CC7E 5GAEG 1YITE 1VQPE 2QA4E 1VQNE 3G6EE 1VQLE 4U67E 1KC8G 5JVGE 1VQ7E 1YJNE 4WF9E 5GAHG 3CCRE 3J7ZG 1K9MG 3CCUE 1YI2E 2OTLE 4IOAE 1W2BE 1YJ9E 2ZJPE 1Q86G 3CPWE 1K8AG 1Q7YG 1QVGE 3CMEE 4WFAE 1VQ6E 2OTJE 5DM6E 5DM7E
chains in the Genus database with same CATH superfamily
3CMAE 4IO9E 1NJIG 3PIPE 3IG9A 1QVFE 4WFBE 1RJLC 3CXCE 5B11O 5MLCH 2PI3O 1VQ4E 1FJ1E 3PIOE 1Q82G 1VQ8E 2OL6O 1OSPO 3CKGA 2QEXE 3CCQE 1VQME 1YHQE 1VQ9E 1YJWE 3EC5A 3G71E 2OYBO 1KD1G 3CCSE 3CCVE 1RL6A 2FKGA 2ZJRE 5GAGG 3I55E 1M1KG 3CCLE 3G4SE 1K73G 3OW2E 5HL7E 2ZJQE 4UY8G 1VQOE 1VQ5E 3CC2E 1Q81G 1JJ2E 3CD6E 3I56E 5GADG 3DLLE 3CCJE 4IOCE 2OL8O 2CQLA 3CCME 5AN9B 3CCEE 1N8RG 5JVHE 4WFNE 4WCEE 1YIJE 3CKFA 3CF5E 1M90G 5H1SI 1KQSE 1VQKE 3CC4E 2G8CO 1S72E 3CC7E 5GAEG 2OY8A 1YITE 1VQPE 2OY5O 5B3MO 2OY7A 2QA4E 1VQNE 3G6EE 1P4PA 2HKDA 1VQLE 5DM7E 4U67E 2FKJA 1KC8G 5JVGE 1VQ7E 1YJNE 2OY1O 5GAHG 4WF9E 3CCRE 3AUMO 3J7ZG 1K9MG 3CCUE 1YI2E 2OTLE 4IOAE 1W2BE 1YJ9E 2ZJPE 1Q86G 3CPWE 1K8AG 5B2AO 1Q7YG 2I5ZO 1QVGE 5B10O 3CMEE 3IGEA 4WFAE 1VQ6E 2OTJE 2AF5A 5DM6E 2OL7A 2I5VO
chains in the Genus database with same CATH topology
3CMAE 4IO9E 1NJIG 3PIPE 1QVFE 4WFBE 3CXCE 5MLCH 1VQ4E 3PIOE 1Q82G 1VQ8E 2QEXE 3CCQE 1VQME 1YHQE 1VQ9E 1YJWE 3G71E 1KD1G 3CCSE 3CCVE 1RL6A 2ZJRE 3I55E 5GAGG 1M1KG 3CCLE 3G4SE 1K73G 3OW2E 5HL7E 2ZJQE 4UY8G 1VQOE 1VQ5E 3CC2E 1Q81G 1JJ2E 3CD6E 3I56E 5GADG 3DLLE 3CCJE 4IOCE 2CQLA 3CCME 5AN9B 3CCEE 1N8RG 5JVHE 4WFNE 4WCEE 1YIJE 3CF5E 1M90G 5H1SI 1KQSE 1VQKE 3CC4E 1S72E 3CC7E 5GAEG 1YITE 1VQPE 2QA4E 1VQNE 3G6EE 1VQLE 4U67E 1KC8G 5JVGE 1VQ7E 1YJNE 4WF9E 5GAHG 3CCRE 3J7ZG 1K9MG 3CCUE 1YI2E 2OTLE 4IOAE 1W2BE 1YJ9E 2ZJPE 1Q86G 3CPWE 1K8AG 1Q7YG 1QVGE 3CMEE 4WFAE 1VQ6E 2OTJE 5DM6E 5DM7E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA E;  4IO9 E;  1NJI G;  3PIP E;  1QVF E;  4WFB E;  3CXC E;  5MLC H;  1VQ4 E;  3PIO E;  1Q82 G;  1VQ8 E;  2QEX E;  3CCQ E;  1VQM E;  1YHQ E;  1VQ9 E;  1YJW E;  3G71 E;  1KD1 G;  3CCS E;  3CCV E;  1RL6 A;  2ZJR E;  3I55 E;  5GAG G;  1M1K G;  3CCL E;  3G4S E;  1K73 G;  3OW2 E;  5HL7 E;  2ZJQ E;  4UY8 G;  1VQO E;  1VQ5 E;  3CC2 E;  1Q81 G;  1JJ2 E;  3CD6 E;  3I56 E;  5GAD G;  3DLL E;  3CCJ E;  4IOC E;  2CQL A;  3CCM E;  5AN9 B;  3CCE E;  1N8R G;  5JVH E;  4WFN E;  4WCE E;  1YIJ E;  3CF5 E;  1M90 G;  5H1S I;  1KQS E;  1VQK E;  3CC4 E;  1S72 E;  3CC7 E;  5GAE G;  1YIT E;  1VQP E;  2QA4 E;  1VQN E;  3G6E E;  1VQL E;  4U67 E;  1KC8 G;  5JVG E;  1VQ7 E;  1YJN E;  4WF9 E;  5GAH G;  3CCR E;  3J7Z G;  1K9M G;  3CCU E;  1YI2 E;  2OTL E;  4IOA E;  1W2B E;  1YJ9 E;  2ZJP E;  1Q86 G;  3CPW E;  1K8A G;  1Q7Y G;  1QVG E;  3CME E;  4WFA E;  1VQ6 E;  2OTJ E;  5DM6 E;  5DM7 E; 
#chains in the Genus database with same CATH topology
 3CMA E;  4IO9 E;  1NJI G;  3PIP E;  3IG9 A;  1QVF E;  4WFB E;  1RJL C;  3CXC E;  5B11 O;  5MLC H;  2PI3 O;  1VQ4 E;  1FJ1 E;  3PIO E;  1Q82 G;  1VQ8 E;  2OL6 O;  1OSP O;  3CKG A;  2QEX E;  3CCQ E;  1VQM E;  1YHQ E;  1VQ9 E;  1YJW E;  3EC5 A;  3G71 E;  2OYB O;  1KD1 G;  3CCS E;  3CCV E;  1RL6 A;  2FKG A;  2ZJR E;  5GAG G;  3I55 E;  1M1K G;  3CCL E;  3G4S E;  1K73 G;  3OW2 E;  5HL7 E;  2ZJQ E;  4UY8 G;  1VQO E;  1VQ5 E;  3CC2 E;  1Q81 G;  1JJ2 E;  3CD6 E;  3I56 E;  5GAD G;  3DLL E;  3CCJ E;  4IOC E;  2OL8 O;  2CQL A;  3CCM E;  5AN9 B;  3CCE E;  1N8R G;  5JVH E;  4WFN E;  4WCE E;  1YIJ E;  3CKF A;  3CF5 E;  1M90 G;  5H1S I;  1KQS E;  1VQK E;  3CC4 E;  2G8C O;  1S72 E;  3CC7 E;  5GAE G;  2OY8 A;  1YIT E;  1VQP E;  2OY5 O;  5B3M O;  2OY7 A;  2QA4 E;  1VQN E;  3G6E E;  1P4P A;  2HKD A;  1VQL E;  5DM7 E;  4U67 E;  2FKJ A;  1KC8 G;  5JVG E;  1VQ7 E;  1YJN E;  2OY1 O;  5GAH G;  4WF9 E;  3CCR E;  3AUM O;  3J7Z G;  1K9M G;  3CCU E;  1YI2 E;  2OTL E;  4IOA E;  1W2B E;  1YJ9 E;  2ZJP E;  1Q86 G;  3CPW E;  1K8A G;  5B2A O;  1Q7Y G;  2I5Z O;  1QVG E;  5B10 O;  3CME E;  3IGE A;  4WFA E;  1VQ6 E;  2OTJ E;  2AF5 A;  5DM6 E;  2OL7 A;  2I5V O; 
#chains in the Genus database with same CATH homology
 3CMA E;  4IO9 E;  1NJI G;  3PIP E;  1QVF E;  4WFB E;  3CXC E;  5MLC H;  1VQ4 E;  3PIO E;  1Q82 G;  1VQ8 E;  2QEX E;  3CCQ E;  1VQM E;  1YHQ E;  1VQ9 E;  1YJW E;  3G71 E;  1KD1 G;  3CCS E;  3CCV E;  1RL6 A;  2ZJR E;  3I55 E;  5GAG G;  1M1K G;  3CCL E;  3G4S E;  1K73 G;  3OW2 E;  5HL7 E;  2ZJQ E;  4UY8 G;  1VQO E;  1VQ5 E;  3CC2 E;  1Q81 G;  1JJ2 E;  3CD6 E;  3I56 E;  5GAD G;  3DLL E;  3CCJ E;  4IOC E;  2CQL A;  3CCM E;  5AN9 B;  3CCE E;  1N8R G;  5JVH E;  4WFN E;  4WCE E;  1YIJ E;  3CF5 E;  1M90 G;  5H1S I;  1KQS E;  1VQK E;  3CC4 E;  1S72 E;  3CC7 E;  5GAE G;  1YIT E;  1VQP E;  2QA4 E;  1VQN E;  3G6E E;  1VQL E;  4U67 E;  1KC8 G;  5JVG E;  1VQ7 E;  1YJN E;  4WF9 E;  5GAH G;  3CCR E;  3J7Z G;  1K9M G;  3CCU E;  1YI2 E;  2OTL E;  4IOA E;  1W2B E;  1YJ9 E;  2ZJP E;  1Q86 G;  3CPW E;  1K8A G;  1Q7Y G;  1QVG E;  3CME E;  4WFA E;  1VQ6 E;  2OTJ E;  5DM6 E;  5DM7 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...