1QVGN

Structure of cca oligonucleotide bound to the trna binding sites of the large ribosomal subunit of haloarcula marismortui
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
115
structure length
115
Chain Sequence
SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of deacylated tRNA mimics bound to the E site of the large ribosomal subunit
pubmed doi rcsb
molecule keywords 23S ribosomal rna
molecule tags Ribosome
total genus 36
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2003-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1qvgN00
3G71O 1W2BN 1VQPL 2OTLO 3CCSO 1Q7YP 3CMAO 1K9MP 1KD1P 3I55O 3G4SO 2OTJO 3CCRL 1M90P 3CCEL 1YJNL 1N8RM 1YHQO 1VQ7L 1VQ5L 1QVFN 3CC2O 1W2BK 1VQ4L 3CCUO 3G6EO 1VQOO 1NJIP 1QVGN 1QVFK 1VQPO 1Q81P 1VQ9L 1YIJL 3CCJL 1Q82P 1VQ6L 3CCQL 3CCRO 3CCEO 1YJNO 3CMEL 1JJ2N 1VQ7O 1VQ5O 3CPWN 3CCLL 2QEXO 1K73P 1VQ4O 1KC8P 1K8AM 1KQSN 3CCML 3CC7L 1YITL 1JJ2K 1VQKL 2QA4O 3CPWK 1VQ9O 3CCJO 1Q7YM 1Q86P 1K9MM 1KD1M 1VQ6O 3CCQO 3CMEO 1M90M 1VQML 3G71L 1M1KP 3CCLO 3CCVL 3I56L 1QVGK 1VQLL 1YI2L 3CCMO 3CC7O 1YITO 3OW2N 3CC4L 1YJ9L 1VQKO 1NJIM 1YJWL 1N8RP 1S72L 1Q81M 1VQ8L 1VQNL 1Q82M 1YIJO 3OW2K 3CD6L 1VQMO 3CXCN 3CCVO 1KQSK 1K73M 3I56O 1VQLO 1YI2O 1KC8M 2OTLL 3CCSL 3CMAL 3I55L 3CC4O 1YJ9O 3G4SL 2OTJL 1YJWO 3CXCK 2QEXL 1S72O 1VQ8O 1YHQL 3CC2L 1Q86M 1VQNO 3CCUL 1K8AP 3G6EL 3CD6O 2QA4L 1VQOL 1M1KM
chains in the Genus database with same CATH superfamily
3G71O 4P6IC 1W2BN 1VQPL 2OTLO 3CCSO 1Q7YP 3CMAO 1K9MP 1KD1P 3I55O 3G4SO 2OTJO 3CCRL 1M90P 3CCEL 1YJNL 1N8RM 1YHQO 1VQ7L 1VQ5L 1QVFN 5FCLA 3CC2O 1W2BK 3NKDA 1VQ4L 4WJ0A 3CCUO 3G6EO 1VQOO 1NJIP 1QVGN 1QVFK 1VQPO 1Q81P 4QDLA 1VQ9L 1YIJL 3CCJL 1Q82P 1VQ6L 3CCQL 3CCRO 2YZSA 3CCEO 1YJNO 3CMEL 1JJ2N 5DQZA 1VQ7O 1VQ5O 3CPWN 3CCLL 2QEXO 1K73P 1VQ4O 4W8KA 1KC8P 1K8AM 1KQSN 4XTKA 3CCML 3CC7L 1YITL 1JJ2K 1VQKL 2QA4O 3CPWK 1VQ9O 5DS5A 3CCJO 1Q7YM 1Q86P 1K9MM 1KD1M 1VQ6O 3CCQO 3CMEO 1M90M 1VQML 5DS4A 3G71L 1M1KP 3CCLO 3CCVL 5DQTA 3I56L 1QVGK 1VQLL 1YI2L 3CCMO 3CC7O 1YITO 3OW2N 3CC4L 1YJ9L 1VQKO 1NJIM 1YJWL 1N8RP 1S72L 1Q81M 1VQ8L 1VQNL 1Q82M 1YIJO 3OW2K 3CD6L 1VQMO 3CXCN 3GODA 3CCVO 1KQSK 5DLJA 1K73M 3I56O 1VQLO 1YI2O 1KC8M 2OTLL 3CCSL 3CMAL 3I55L 3CC4O 1YJ9O 3G4SL 2OTJL 1YJWO 3CXCK 2QEXL 1S72O 1VQ8O 1YHQL 3CC2L 1Q86M 1VQNO 3CCUL 1K8AP 3G6EL 3CD6O 5DS6A 4N06A 2QA4L 1VQOL 1M1KM
chains in the Genus database with same CATH topology
3G71O 4P6IC 1W2BN 1VQPL 2OTLO 3CCSO 1Q7YP 3CMAO 1K9MP 1KD1P 3I55O 3G4SO 2OTJO 3CCRL 1M90P 3CCEL 1YJNL 1N8RM 1YHQO 1VQ7L 1VQ5L 1QVFN 5FCLA 3CC2O 1W2BK 3NKDA 1VQ4L 4WJ0A 3CCUO 3G6EO 1VQOO 1NJIP 1QVGN 1QVFK 1VQPO 1Q81P 4QDLA 1VQ9L 1YIJL 3CCJL 1Q82P 1VQ6L 3CCQL 3CCRO 2YZSA 3CCEO 1YJNO 3CMEL 1JJ2N 5DQZA 1VQ7O 1VQ5O 3CPWN 3CCLL 2QEXO 1K73P 1VQ4O 4W8KA 1KC8P 1K8AM 1KQSN 4XTKA 3CCML 3CC7L 1YITL 1JJ2K 1VQKL 2QA4O 3CPWK 1VQ9O 5DS5A 3CCJO 1Q7YM 1Q86P 1K9MM 1KD1M 1VQ6O 3CCQO 3CMEO 1M90M 1VQML 5DS4A 3G71L 1M1KP 3CCLO 3CCVL 5DQTA 3I56L 1QVGK 1VQLL 1YI2L 3CCMO 3CC7O 1YITO 3OW2N 3CC4L 1YJ9L 1VQKO 1NJIM 1YJWL 1N8RP 1S72L 1Q81M 1VQ8L 1VQNL 1Q82M 1YIJO 3OW2K 3CD6L 1VQMO 3CXCN 3GODA 3CCVO 1KQSK 5DLJA 1K73M 3I56O 1VQLO 1YI2O 1KC8M 2OTLL 3CCSL 3CMAL 3I55L 3CC4O 1YJ9O 3G4SL 2OTJL 1YJWO 3CXCK 2QEXL 1S72O 1VQ8O 1YHQL 3CC2L 1Q86M 1VQNO 3CCUL 1K8AP 3G6EL 3CD6O 5DS6A 4N06A 2QA4L 1VQOL 1M1KM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 O;  1W2B N;  1VQP L;  2OTL O;  3CCS O;  1Q7Y P;  3CMA O;  1K9M P;  1KD1 P;  3I55 O;  3G4S O;  2OTJ O;  3CCR L;  1M90 P;  3CCE L;  1YJN L;  1N8R M;  1YHQ O;  1VQ7 L;  1VQ5 L;  1QVF N;  3CC2 O;  1W2B K;  1VQ4 L;  3CCU O;  3G6E O;  1VQO O;  1NJI P;  1QVG N;  1QVF K;  1VQP O;  1Q81 P;  1VQ9 L;  1YIJ L;  3CCJ L;  1Q82 P;  1VQ6 L;  3CCQ L;  3CCR O;  3CCE O;  1YJN O;  3CME L;  1JJ2 N;  1VQ7 O;  1VQ5 O;  3CPW N;  3CCL L;  2QEX O;  1K73 P;  1VQ4 O;  1KC8 P;  1K8A M;  1KQS N;  3CCM L;  3CC7 L;  1YIT L;  1JJ2 K;  1VQK L;  2QA4 O;  3CPW K;  1VQ9 O;  3CCJ O;  1Q7Y M;  1Q86 P;  1K9M M;  1KD1 M;  1VQ6 O;  3CCQ O;  3CME O;  1M90 M;  1VQM L;  3G71 L;  1M1K P;  3CCL O;  3CCV L;  3I56 L;  1QVG K;  1VQL L;  1YI2 L;  3CCM O;  3CC7 O;  1YIT O;  3OW2 N;  3CC4 L;  1YJ9 L;  1VQK O;  1NJI M;  1YJW L;  1N8R P;  1S72 L;  1Q81 M;  1VQ8 L;  1VQN L;  1Q82 M;  1YIJ O;  3OW2 K;  3CD6 L;  1VQM O;  3CXC N;  3CCV O;  1KQS K;  1K73 M;  3I56 O;  1VQL O;  1YI2 O;  1KC8 M;  2OTL L;  3CCS L;  3CMA L;  3I55 L;  3CC4 O;  1YJ9 O;  3G4S L;  2OTJ L;  1YJW O;  3CXC K;  2QEX L;  1S72 O;  1VQ8 O;  1YHQ L;  3CC2 L;  1Q86 M;  1VQN O;  3CCU L;  1K8A P;  3G6E L;  3CD6 O;  2QA4 L;  1VQO L;  1M1K M; 
#chains in the Genus database with same CATH topology
 3G71 O;  4P6I C;  1W2B N;  1VQP L;  2OTL O;  3CCS O;  1Q7Y P;  3CMA O;  1K9M P;  1KD1 P;  3I55 O;  3G4S O;  2OTJ O;  3CCR L;  1M90 P;  3CCE L;  1YJN L;  1N8R M;  1YHQ O;  1VQ7 L;  1VQ5 L;  1QVF N;  5FCL A;  3CC2 O;  1W2B K;  3NKD A;  1VQ4 L;  4WJ0 A;  3CCU O;  3G6E O;  1VQO O;  1NJI P;  1QVG N;  1QVF K;  1VQP O;  1Q81 P;  4QDL A;  1VQ9 L;  1YIJ L;  3CCJ L;  1Q82 P;  1VQ6 L;  3CCQ L;  3CCR O;  2YZS A;  3CCE O;  1YJN O;  3CME L;  1JJ2 N;  5DQZ A;  1VQ7 O;  1VQ5 O;  3CPW N;  3CCL L;  2QEX O;  1K73 P;  1VQ4 O;  4W8K A;  1KC8 P;  1K8A M;  1KQS N;  4XTK A;  3CCM L;  3CC7 L;  1YIT L;  1JJ2 K;  1VQK L;  2QA4 O;  3CPW K;  1VQ9 O;  5DS5 A;  3CCJ O;  1Q7Y M;  1Q86 P;  1K9M M;  1KD1 M;  1VQ6 O;  3CCQ O;  3CME O;  1M90 M;  1VQM L;  5DS4 A;  3G71 L;  1M1K P;  3CCL O;  3CCV L;  5DQT A;  3I56 L;  1QVG K;  1VQL L;  1YI2 L;  3CCM O;  3CC7 O;  1YIT O;  3OW2 N;  3CC4 L;  1YJ9 L;  1VQK O;  1NJI M;  1YJW L;  1N8R P;  1S72 L;  1Q81 M;  1VQ8 L;  1VQN L;  1Q82 M;  1YIJ O;  3OW2 K;  3CD6 L;  1VQM O;  3CXC N;  3GOD A;  3CCV O;  1KQS K;  5DLJ A;  1K73 M;  3I56 O;  1VQL O;  1YI2 O;  1KC8 M;  2OTL L;  3CCS L;  3CMA L;  3I55 L;  3CC4 O;  1YJ9 O;  3G4S L;  2OTJ L;  1YJW O;  3CXC K;  2QEX L;  1S72 O;  1VQ8 O;  1YHQ L;  3CC2 L;  1Q86 M;  1VQN O;  3CCU L;  1K8A P;  3G6E L;  3CD6 O;  5DS6 A;  4N06 A;  2QA4 L;  1VQO L;  1M1K M; 
#chains in the Genus database with same CATH homology
 3G71 O;  4P6I C;  1W2B N;  1VQP L;  2OTL O;  3CCS O;  1Q7Y P;  3CMA O;  1K9M P;  1KD1 P;  3I55 O;  3G4S O;  2OTJ O;  3CCR L;  1M90 P;  3CCE L;  1YJN L;  1N8R M;  1YHQ O;  1VQ7 L;  1VQ5 L;  1QVF N;  5FCL A;  3CC2 O;  1W2B K;  3NKD A;  1VQ4 L;  4WJ0 A;  3CCU O;  3G6E O;  1VQO O;  1NJI P;  1QVG N;  1QVF K;  1VQP O;  1Q81 P;  4QDL A;  1VQ9 L;  1YIJ L;  3CCJ L;  1Q82 P;  1VQ6 L;  3CCQ L;  3CCR O;  2YZS A;  3CCE O;  1YJN O;  3CME L;  1JJ2 N;  5DQZ A;  1VQ7 O;  1VQ5 O;  3CPW N;  3CCL L;  2QEX O;  1K73 P;  1VQ4 O;  4W8K A;  1KC8 P;  1K8A M;  1KQS N;  4XTK A;  3CCM L;  3CC7 L;  1YIT L;  1JJ2 K;  1VQK L;  2QA4 O;  3CPW K;  1VQ9 O;  5DS5 A;  3CCJ O;  1Q7Y M;  1Q86 P;  1K9M M;  1KD1 M;  1VQ6 O;  3CCQ O;  3CME O;  1M90 M;  1VQM L;  5DS4 A;  3G71 L;  1M1K P;  3CCL O;  3CCV L;  5DQT A;  3I56 L;  1QVG K;  1VQL L;  1YI2 L;  3CCM O;  3CC7 O;  1YIT O;  3OW2 N;  3CC4 L;  1YJ9 L;  1VQK O;  1NJI M;  1YJW L;  1N8R P;  1S72 L;  1Q81 M;  1VQ8 L;  1VQN L;  1Q82 M;  1YIJ O;  3OW2 K;  3CD6 L;  1VQM O;  3CXC N;  3GOD A;  3CCV O;  1KQS K;  5DLJ A;  1K73 M;  3I56 O;  1VQL O;  1YI2 O;  1KC8 M;  2OTL L;  3CCS L;  3CMA L;  3I55 L;  3CC4 O;  1YJ9 O;  3G4S L;  2OTJ L;  1YJW O;  3CXC K;  2QEX L;  1S72 O;  1VQ8 O;  1YHQ L;  3CC2 L;  1Q86 M;  1VQN O;  3CCU L;  1K8A P;  3G6E L;  3CD6 O;  5DS6 A;  4N06 A;  2QA4 L;  1VQO L;  1M1K M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...